F491604
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1202 | 425 | 1202 | 252 |
Family's Representative Sequence
| Representative Sequence | 3300005578|Ga0068854_100541609|Ga0068854_1005416092 |
| Length | 234 |
| Sequence | MTGRLSGKRAFITAAGQGIGAAIAATFIAEGADVIATDLDASKLKALKTDKVIDSYGAPHILVNCAGYVHQGSILDCSEKDWDFSFDLNVKSMHRTLTAFLPAMLKNGGGSIVNISSIVSSLRGVPKRYAYGATKAAVIGLTKAVAADFIREGIRCNCICPGTIQSPSLDERVDANAKATGQTRDKAYADFVARQPIGRLGTAQEVANLALFLASDESSYITGQPHLVDGGMGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 5 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 6 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 7 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 8 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 9 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 12 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 13 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 14 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 15 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 16 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 17 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 18 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 19 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 20 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 21 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 22 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 23 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 84 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 86 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 98 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 99 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 101 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 102 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 104 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 105 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 106 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 107 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 111 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 116 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 117 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 118 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 119 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 120 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 121 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 122 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 124 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 141 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 142 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 233 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 237 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 239 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 240 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 242 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 245 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 246 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 247 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 248 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 249 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 250 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 251 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 252 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 255 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 256 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 258 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 261 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 262 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 265 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 266 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 268 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 269 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 270 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 271 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 272 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 274 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 275 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 276 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 277 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 278 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 279 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 280 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 282 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 283 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 284 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 285 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 286 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 287 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 288 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 289 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 290 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 291 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 292 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 293 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 294 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 295 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 296 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 297 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 298 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 372 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 373 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 374 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 375 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 376 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 377 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 380 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 381 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 382 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 383 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 384 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 385 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 386 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 400 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 401 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 402 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 403 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 404 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 405 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 420 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 421 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 422 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 423 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 425 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2 |
| Nodule | 0 |
| Rhizoplane | 7.32 |
| Rhizosphere | 90.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c000939 | 3300000041 | Bacteria | 3180 |
| 2 | ARcpr5oldR_c006380 | 3300000041 | Bacteria | 1007 |
| 3 | ARcpr5yngRDRAFT_c001001 | 3300000043 | Bacteria | 3240 |
| 4 | ARSoilOldRDRAFT_c000297 | 3300000044 | Bacteria | 6916 |
| 5 | ARCol0yngRDRAFT_1000069 | 3300000652 | Bacteria | 18965 |
| 6 | JGI24032J14994_101229 | 3300001430 | Bacteria | 1126 |
| 7 | JGI24752J21851_1004116 | 3300001976 | Bacteria | 1908 |
| 8 | JGI24746J21847_1000078 | 3300001977 | Bacteria | 10426 |
| 9 | JGI24747J21853_1000030 | 3300001978 | Bacteria | 5385 |
| 10 | JGI24739J22299_10002225 | 3300001989 | Bacteria | 7452 |
| 11 | JGI24737J22298_10001972 | 3300001990 | Bacteria | 7332 |
| 12 | JGI24737J22298_10026703 | 3300001990 | Bacteria | 1823 |
| 13 | JGI24743J22301_10003246 | 3300001991 | Bacteria | 2557 |
| 14 | JGI24750J21931_1000188 | 3300002070 | Bacteria | 10321 |
| 15 | JGI24750J21931_1001805 | 3300002070 | Bacteria | 2609 |
| 16 | JGI24745J21846_1000126 | 3300002073 | Bacteria | 5829 |
| 17 | JGI24748J21848_1006879 | 3300002074 | Bacteria | 1328 |
| 18 | JGI24748J21848_1014790 | 3300002074 | Bacteria | 927 |
| 19 | JGI24738J21930_10000068 | 3300002075 | Bacteria | 21789 |
| 20 | JGI24738J21930_10005515 | 3300002075 | Bacteria | 3026 |
| 21 | JGI24749J21850_1000122 | 3300002076 | Bacteria | 13176 |
| 22 | JGI24744J21845_10003010 | 3300002077 | Bacteria | 3455 |
| 23 | JGI24744J21845_10004022 | 3300002077 | Bacteria | 3034 |
| 24 | JGI24035J26624_1000121 | 3300002126 | Bacteria | 6818 |
| 25 | JGI24033J26618_1002438 | 3300002155 | Bacteria | 1905 |
| 26 | JGI24034J26672_10000519 | 3300002239 | Bacteria | 4969 |
| 27 | JGI24034J26672_10004919 | 3300002239 | Bacteria | 1904 |
| 28 | JGI24742J22300_10000082 | 3300002244 | Bacteria | 13679 |
| 29 | JGI24742J22300_10001792 | 3300002244 | Bacteria | 3427 |
| 30 | JGI24751J29686_10008626 | 3300002459 | Bacteria | 2088 |
| 31 | JGI24751J29686_10029822 | 3300002459 | Bacteria | 1132 |
| 32 | JGI24751J29686_10041519 | 3300002459 | Bacteria | 952 |
| 33 | JGI25405J52794_10003641 | 3300003911 | Bacteria | 2715 |
| 34 | Ga0065712_10001352 | 3300005290 | Bacteria | 6650 |
| 35 | Ga0065712_10013324 | 3300005290 | Bacteria | 1902 |
| 36 | Ga0065712_10104339 | 3300005290 | Bacteria | 1963 |
| 37 | Ga0065715_10089172 | 3300005293 | Bacteria | 13154 |
| 38 | Ga0070658_10068112 | 3300005327 | Bacteria | 2909 |
| 39 | Ga0070676_10000363 | 3300005328 | Bacteria | 20801 |
| 40 | Ga0070683_100004718 | 3300005329 | Bacteria | 11267 |
| 41 | Ga0070683_100208384 | 3300005329 | Bacteria | 1856 |
| 42 | Ga0070690_100001828 | 3300005330 | Bacteria | 11279 |
| 43 | Ga0070690_100038771 | 3300005330 | Bacteria | 3008 |
| 44 | Ga0070690_100057719 | 3300005330 | Bacteria | 2491 |
| 45 | Ga0070670_100001134 | 3300005331 | Bacteria | 21148 |
| 46 | Ga0070670_100006490 | 3300005331 | Bacteria | 9902 |
| 47 | Ga0070670_100064312 | 3300005331 | Bacteria | 3148 |
| 48 | Ga0070670_100182814 | 3300005331 | Bacteria | 1820 |
| 49 | Ga0070677_10000301 | 3300005333 | Bacteria | 17280 |
| 50 | Ga0068869_100006712 | 3300005334 | Bacteria | 7314 |
| 51 | Ga0068869_100138987 | 3300005334 | Bacteria | 1874 |
| 52 | Ga0068869_100348428 | 3300005334 | Bacteria | 1207 |
| 53 | Ga0070666_10022647 | 3300005335 | Bacteria | 4082 |
| 54 | Ga0070666_10032235 | 3300005335 | Bacteria | 3460 |
| 55 | Ga0070666_10212724 | 3300005335 | Bacteria | 1362 |
| 56 | Ga0070680_100014945 | 3300005336 | Bacteria | 6076 |
| 57 | Ga0070680_100057625 | 3300005336 | Bacteria | 3176 |
| 58 | Ga0070682_100000719 | 3300005337 | Bacteria | 19838 |
| 59 | Ga0070682_100045580 | 3300005337 | Bacteria | 2718 |
| 60 | Ga0070682_100145483 | 3300005337 | Bacteria | 1621 |
| 61 | Ga0070682_100177332 | 3300005337 | Bacteria | 1486 |
| 62 | Ga0068868_100013587 | 3300005338 | Bacteria | 5978 |
| 63 | Ga0068868_100073781 | 3300005338 | Bacteria | 2725 |
| 64 | Ga0070660_100000730 | 3300005339 | Bacteria | 21778 |
| 65 | Ga0070660_100037257 | 3300005339 | Bacteria | 3687 |
| 66 | Ga0070660_100050497 | 3300005339 | Bacteria | 3200 |
| 67 | Ga0070689_100000601 | 3300005340 | Bacteria | 21783 |
| 68 | Ga0070689_100013621 | 3300005340 | Bacteria | 5889 |
| 69 | Ga0070689_100086701 | 3300005340 | Bacteria | 2462 |
| 70 | Ga0070689_100142282 | 3300005340 | Bacteria | 1929 |
| 71 | Ga0070691_10001015 | 3300005341 | Bacteria | 11523 |
| 72 | Ga0070691_10171305 | 3300005341 | Bacteria | 1125 |
| 73 | Ga0070687_100000253 | 3300005343 | Bacteria | 18199 |
| 74 | Ga0070687_100003704 | 3300005343 | Bacteria | 5982 |
| 75 | Ga0070661_100003564 | 3300005344 | Bacteria | 10720 |
| 76 | Ga0070692_10000060 | 3300005345 | Bacteria | 21392 |
| 77 | Ga0070668_100001851 | 3300005347 | Bacteria | 15430 |
| 78 | Ga0070668_100087704 | 3300005347 | Bacteria | 2448 |
| 79 | Ga0070669_100000888 | 3300005353 | Bacteria | 21753 |
| 80 | Ga0070669_100026939 | 3300005353 | Bacteria | 4136 |
| 81 | Ga0070669_100537628 | 3300005353 | Bacteria | 973 |
| 82 | Ga0070675_100000441 | 3300005354 | Bacteria | 28206 |
| 83 | Ga0070675_100008895 | 3300005354 | Bacteria | 7806 |
| 84 | Ga0070671_100001180 | 3300005355 | Bacteria | 19534 |
| 85 | Ga0070671_100011505 | 3300005355 | Bacteria | 7114 |
| 86 | Ga0070671_100012122 | 3300005355 | Bacteria | 6937 |
| 87 | Ga0070674_100000723 | 3300005356 | Bacteria | 16855 |
| 88 | Ga0070674_100052446 | 3300005356 | Bacteria | 2814 |
| 89 | Ga0070673_100000456 | 3300005364 | Bacteria | 21637 |
| 90 | Ga0070688_100000483 | 3300005365 | Bacteria | 20204 |
| 91 | Ga0070688_100010309 | 3300005365 | Bacteria | 5149 |
| 92 | Ga0070688_100015266 | 3300005365 | Bacteria | 4364 |
| 93 | Ga0070659_100001763 | 3300005366 | Bacteria | 15553 |
| 94 | Ga0070659_100020482 | 3300005366 | Bacteria | 5024 |
| 95 | Ga0070659_100064724 | 3300005366 | Bacteria | 2894 |
| 96 | Ga0070659_100167244 | 3300005366 | Bacteria | 1800 |
| 97 | Ga0070667_100004366 | 3300005367 | Bacteria | 11932 |
| 98 | Ga0070667_100029031 | 3300005367 | Bacteria | 4606 |
| 99 | Ga0070667_100053332 | 3300005367 | Bacteria | 3413 |
| 100 | Ga0070667_100472184 | 3300005367 | Bacteria | 1148 |
| 101 | Ga0070703_10002031 | 3300005406 | Bacteria | 5916 |
| 102 | Ga0070703_10020218 | 3300005406 | Bacteria | 1936 |
| 103 | Ga0070709_10007969 | 3300005434 | Bacteria | 5819 |
| 104 | Ga0070709_10242814 | 3300005434 | Bacteria | 1294 |
| 105 | Ga0070714_100089770 | 3300005435 | Bacteria | 2691 |
| 106 | Ga0070714_100236796 | 3300005435 | Bacteria | 1684 |
| 107 | Ga0070714_100456706 | 3300005435 | Bacteria | 1214 |
| 108 | Ga0070713_100052199 | 3300005436 | Bacteria | 3384 |
| 109 | Ga0070713_100141795 | 3300005436 | Bacteria | 2129 |
| 110 | Ga0070713_100292797 | 3300005436 | Bacteria | 1497 |
| 111 | Ga0070713_100467309 | 3300005436 | Bacteria | 1187 |
| 112 | Ga0070713_100472116 | 3300005436 | Bacteria | 1181 |
| 113 | Ga0070713_100487380 | 3300005436 | Bacteria | 1162 |
| 114 | Ga0070710_10019850 | 3300005437 | Bacteria | 3479 |
| 115 | Ga0070710_10026259 | 3300005437 | Bacteria | 3092 |
| 116 | Ga0070701_10000150 | 3300005438 | Bacteria | 21357 |
| 117 | Ga0070701_10018237 | 3300005438 | Bacteria | 3295 |
| 118 | Ga0070711_100009998 | 3300005439 | Bacteria | 5854 |
| 119 | Ga0070711_100027082 | 3300005439 | Bacteria | 3761 |
| 120 | Ga0070711_100043909 | 3300005439 | Bacteria | 3030 |
| 121 | Ga0070711_100062480 | 3300005439 | Bacteria | 2596 |
| 122 | Ga0070711_100304933 | 3300005439 | Bacteria | 1267 |
| 123 | Ga0070711_100419281 | 3300005439 | Bacteria | 1090 |
| 124 | Ga0070705_100003099 | 3300005440 | Bacteria | 8178 |
| 125 | Ga0070705_100127316 | 3300005440 | Bacteria | 1655 |
| 126 | Ga0070705_100177461 | 3300005440 | Bacteria | 1440 |
| 127 | Ga0070700_100001083 | 3300005441 | Bacteria | 13532 |
| 128 | Ga0070700_100035299 | 3300005441 | Bacteria | 3025 |
| 129 | Ga0070694_100001678 | 3300005444 | Bacteria | 13024 |
| 130 | Ga0070708_100013928 | 3300005445 | Bacteria | 6606 |
| 131 | Ga0070663_100001801 | 3300005455 | Bacteria | 11920 |
| 132 | Ga0070663_100108736 | 3300005455 | Bacteria | 2080 |
| 133 | Ga0070678_100000199 | 3300005456 | Bacteria | 26434 |
| 134 | Ga0070678_100031746 | 3300005456 | Bacteria | 3648 |
| 135 | Ga0070678_100048354 | 3300005456 | Bacteria | 3062 |
| 136 | Ga0070678_100075457 | 3300005456 | Bacteria | 2536 |
| 137 | Ga0070662_100016138 | 3300005457 | Bacteria | 5011 |
| 138 | Ga0070662_100030935 | 3300005457 | Bacteria | 3751 |
| 139 | Ga0070662_100102736 | 3300005457 | Bacteria | 2166 |
| 140 | Ga0070681_10001398 | 3300005458 | Bacteria | 21148 |
| 141 | Ga0070681_10061363 | 3300005458 | Bacteria | 3734 |
| 142 | Ga0068867_100001623 | 3300005459 | Bacteria | 15640 |
| 143 | Ga0068867_100021030 | 3300005459 | Bacteria | 4654 |
| 144 | Ga0068867_100160027 | 3300005459 | Bacteria | 1775 |
| 145 | Ga0070685_10000782 | 3300005466 | Bacteria | 17256 |
| 146 | Ga0070685_10001511 | 3300005466 | Bacteria | 12252 |
| 147 | Ga0070685_10045926 | 3300005466 | Bacteria | 2506 |
| 148 | Ga0070706_100458705 | 3300005467 | Bacteria | 1186 |
| 149 | Ga0070707_100200688 | 3300005468 | Bacteria | 1944 |
| 150 | Ga0070698_100720832 | 3300005471 | Bacteria | 940 |
| 151 | Ga0070699_100216835 | 3300005518 | Bacteria | 1705 |
| 152 | Ga0070679_100213260 | 3300005530 | Bacteria | 1894 |
| 153 | Ga0070684_100001802 | 3300005535 | Bacteria | 15671 |
| 154 | Ga0070684_100060250 | 3300005535 | Bacteria | 3319 |
| 155 | Ga0070684_100137558 | 3300005535 | Bacteria | 2207 |
| 156 | Ga0070684_100212866 | 3300005535 | Bacteria | 1762 |
| 157 | Ga0068853_100002281 | 3300005539 | Bacteria | 14329 |
| 158 | Ga0070672_100001622 | 3300005543 | Bacteria | 13990 |
| 159 | Ga0070672_100060325 | 3300005543 | Bacteria | 2986 |
| 160 | Ga0070686_100000746 | 3300005544 | Bacteria | 18847 |
| 161 | Ga0070686_100004148 | 3300005544 | Bacteria | 7974 |
| 162 | Ga0070686_100061519 | 3300005544 | Bacteria | 2426 |
| 163 | Ga0070686_100378590 | 3300005544 | Bacteria | 1071 |
| 164 | Ga0070695_100000553 | 3300005545 | Bacteria | 19808 |
| 165 | Ga0070696_100001299 | 3300005546 | Bacteria | 16280 |
| 166 | Ga0070696_100030835 | 3300005546 | Bacteria | 3672 |
| 167 | Ga0070693_100000613 | 3300005547 | Bacteria | 15823 |
| 168 | Ga0070693_100038637 | 3300005547 | Bacteria | 2669 |
| 169 | Ga0070693_100041191 | 3300005547 | Bacteria | 2597 |
| 170 | Ga0070693_100096173 | 3300005547 | Bacteria | 1795 |
| 171 | Ga0070665_100373235 | 3300005548 | Bacteria | 1433 |
| 172 | Ga0070704_100000423 | 3300005549 | Bacteria | 19666 |
| 173 | Ga0070704_100095947 | 3300005549 | Bacteria | 2222 |
| 174 | Ga0070704_100136880 | 3300005549 | Bacteria | 1906 |
| 175 | Ga0070704_100199897 | 3300005549 | Bacteria | 1613 |
| 176 | Ga0070704_100335192 | 3300005549 | Bacteria | 1272 |
| 177 | Ga0068855_100004415 | 3300005563 | Bacteria | 17183 |
| 178 | Ga0068855_100245922 | 3300005563 | Bacteria | 1997 |
| 179 | Ga0068855_100412421 | 3300005563 | Bacteria | 1479 |
| 180 | Ga0068855_100605940 | 3300005563 | Bacteria | 1180 |
| 181 | Ga0070664_100001312 | 3300005564 | Bacteria | 19866 |
| 182 | Ga0070664_100024128 | 3300005564 | Bacteria | 5028 |
| 183 | Ga0068857_100007906 | 3300005577 | Bacteria | 9173 |
| 184 | Ga0068857_100144242 | 3300005577 | Bacteria | 2154 |
| 185 | Ga0068857_100244687 | 3300005577 | Bacteria | 1643 |
| 186 | Ga0068854_100000827 | 3300005578 | Bacteria | 18476 |
| 187 | Ga0068854_100044204 | 3300005578 | Bacteria | 3160 |
| 188 | Ga0068854_100541609 | 3300005578 | Bacteria | 986 |
| 189 | Ga0068856_100001340 | 3300005614 | Bacteria | 25903 |
| 190 | Ga0068856_100024759 | 3300005614 | Bacteria | 5846 |
| 191 | Ga0068856_100085111 | 3300005614 | Bacteria | 3141 |
| 192 | Ga0068856_100523899 | 3300005614 | Bacteria | 1206 |
| 193 | Ga0070702_100001213 | 3300005615 | Bacteria | 10437 |
| 194 | Ga0070702_100021853 | 3300005615 | Bacteria | 3374 |
| 195 | Ga0070702_100029869 | 3300005615 | Bacteria | 2968 |
| 196 | Ga0070702_100255369 | 3300005615 | Bacteria | 1190 |
| 197 | Ga0068852_100007064 | 3300005616 | Bacteria | 8177 |
| 198 | Ga0068852_100039827 | 3300005616 | Bacteria | 3959 |
| 199 | Ga0068852_100288873 | 3300005616 | Bacteria | 1583 |
| 200 | Ga0068859_100001767 | 3300005617 | Bacteria | 21986 |
| 201 | Ga0068859_100009332 | 3300005617 | Bacteria | 9902 |
| 202 | Ga0068859_100284133 | 3300005617 | Bacteria | 1747 |
| 203 | Ga0068864_100003544 | 3300005618 | Bacteria | 12907 |
| 204 | Ga0068864_100052324 | 3300005618 | Bacteria | 3519 |
| 205 | Ga0068866_10000372 | 3300005718 | Bacteria | 21128 |
| 206 | Ga0068866_10045509 | 3300005718 | Bacteria | 2201 |
| 207 | Ga0068866_10055926 | 3300005718 | Bacteria | 2028 |
| 208 | Ga0068861_100001202 | 3300005719 | Bacteria | 16126 |
| 209 | Ga0068870_10000207 | 3300005840 | Bacteria | 21125 |
| 210 | Ga0068870_10093149 | 3300005840 | Bacteria | 1689 |
| 211 | Ga0068863_100003062 | 3300005841 | Bacteria | 16530 |
| 212 | Ga0068863_100103435 | 3300005841 | Bacteria | 2709 |
| 213 | Ga0068858_100009856 | 3300005842 | Bacteria | 9079 |
| 214 | Ga0068860_100007079 | 3300005843 | Bacteria | 11224 |
| 215 | Ga0068860_100027232 | 3300005843 | Bacteria | 5506 |
| 216 | Ga0068862_100002236 | 3300005844 | Bacteria | 17352 |
| 217 | Ga0068862_100015217 | 3300005844 | Bacteria | 6388 |
| 218 | Ga0081455_10005862 | 3300005937 | Bacteria | 13359 |
| 219 | Ga0081455_10006016 | 3300005937 | Bacteria | 13146 |
| 220 | Ga0081455_10006534 | 3300005937 | Bacteria | 12482 |
| 221 | Ga0081455_10010698 | 3300005937 | Bacteria | 9280 |
| 222 | Ga0081455_10012847 | 3300005937 | Bacteria | 8316 |
| 223 | Ga0081455_10061621 | 3300005937 | Bacteria | 3156 |
| 224 | Ga0081455_10167172 | 3300005937 | Bacteria | 1679 |
| 225 | Ga0081538_10013962 | 3300005981 | Bacteria | 6324 |
| 226 | Ga0081538_10024573 | 3300005981 | Bacteria | 4288 |
| 227 | Ga0081538_10030004 | 3300005981 | Bacteria | 3701 |
| 228 | Ga0081538_10077823 | 3300005981 | Bacteria | 1784 |
| 229 | Ga0081540_1027376 | 3300005983 | Bacteria | 3231 |
| 230 | Ga0081540_1133036 | 3300005983 | Bacteria | 1012 |
| 231 | Ga0070717_10047085 | 3300006028 | Bacteria | 3531 |
| 232 | Ga0070717_10184932 | 3300006028 | Bacteria | 1818 |
| 233 | Ga0070717_10358002 | 3300006028 | Bacteria | 1306 |
| 234 | Ga0075365_10001784 | 3300006038 | Bacteria | 10036 |
| 235 | Ga0075365_10017017 | 3300006038 | Bacteria | 4439 |
| 236 | Ga0075365_10037350 | 3300006038 | Bacteria | 3153 |
| 237 | Ga0075365_10259840 | 3300006038 | Bacteria | 1221 |
| 238 | Ga0075363_100192963 | 3300006048 | Bacteria | 1162 |
| 239 | Ga0075364_10058565 | 3300006051 | Bacteria | 2525 |
| 240 | Ga0075432_10013777 | 3300006058 | Bacteria | 2751 |
| 241 | Ga0070715_10099465 | 3300006163 | Bacteria | 1354 |
| 242 | Ga0070715_10199282 | 3300006163 | Bacteria | 1016 |
| 243 | Ga0070715_10320153 | 3300006163 | Bacteria | 837 |
| 244 | Ga0070716_100043247 | 3300006173 | Bacteria | 2517 |
| 245 | Ga0070716_100121396 | 3300006173 | Bacteria | 1636 |
| 246 | Ga0070712_100007234 | 3300006175 | Bacteria | 6926 |
| 247 | Ga0070712_100113727 | 3300006175 | Bacteria | 2025 |
| 248 | Ga0075367_10021834 | 3300006178 | Bacteria | 3584 |
| 249 | Ga0075367_10105375 | 3300006178 | Bacteria | 1727 |
| 250 | Ga0075367_10243277 | 3300006178 | Bacteria | 1128 |
| 251 | Ga0097621_100002408 | 3300006237 | Bacteria | 12812 |
| 252 | Ga0075370_10144277 | 3300006353 | Bacteria | 1393 |
| 253 | Ga0068871_100002267 | 3300006358 | Bacteria | 13082 |
| 254 | Ga0068871_100034059 | 3300006358 | Bacteria | 4038 |
| 255 | Ga0075428_100234280 | 3300006844 | Bacteria | 1981 |
| 256 | Ga0075428_100340154 | 3300006844 | Bacteria | 1611 |
| 257 | Ga0075428_100789534 | 3300006844 | Bacteria | 1009 |
| 258 | Ga0075430_100013448 | 3300006846 | Bacteria | 6977 |
| 259 | Ga0075430_100078649 | 3300006846 | Bacteria | 2764 |
| 260 | Ga0075430_100342962 | 3300006846 | Bacteria | 1234 |
| 261 | Ga0075431_100005769 | 3300006847 | Bacteria | 12247 |
| 262 | Ga0075431_100023620 | 3300006847 | Bacteria | 6293 |
| 263 | Ga0075431_100113391 | 3300006847 | Bacteria | 2798 |
| 264 | Ga0075431_100131562 | 3300006847 | Bacteria | 2580 |
| 265 | Ga0075433_10039549 | 3300006852 | Bacteria | 4079 |
| 266 | Ga0075433_10082850 | 3300006852 | Bacteria | 2830 |
| 267 | Ga0075433_10146797 | 3300006852 | Bacteria | 2097 |
| 268 | Ga0075433_10232618 | 3300006852 | Bacteria | 1636 |
| 269 | Ga0075433_10411442 | 3300006852 | Bacteria | 1193 |
| 270 | Ga0075434_100007264 | 3300006871 | Bacteria | 10249 |
| 271 | Ga0075434_100016025 | 3300006871 | Bacteria | 7201 |
| 272 | Ga0075434_100029369 | 3300006871 | Bacteria | 5408 |
| 273 | Ga0075434_100044598 | 3300006871 | Bacteria | 4398 |
| 274 | Ga0075434_100104976 | 3300006871 | Bacteria | 2835 |
| 275 | Ga0075429_100011165 | 3300006880 | Bacteria | 7776 |
| 276 | Ga0075429_100069547 | 3300006880 | Bacteria | 3065 |
| 277 | Ga0075429_100069699 | 3300006880 | Bacteria | 3061 |
| 278 | Ga0075429_100370584 | 3300006880 | Bacteria | 1254 |
| 279 | Ga0068865_100000537 | 3300006881 | Bacteria | 21125 |
| 280 | Ga0068865_100010539 | 3300006881 | Bacteria | 5757 |
| 281 | Ga0075436_100023694 | 3300006914 | Bacteria | 4217 |
| 282 | Ga0075436_100123650 | 3300006914 | Bacteria | 1812 |
| 283 | Ga0097620_100001767 | 3300006931 | Bacteria | 21986 |
| 284 | Ga0097620_100009332 | 3300006931 | Bacteria | 9902 |
| 285 | Ga0097620_100284125 | 3300006931 | Bacteria | 1747 |
| 286 | Ga0075435_100014461 | 3300007076 | Bacteria | 5899 |
| 287 | Ga0075435_100165067 | 3300007076 | Bacteria | 1867 |
| 288 | Ga0105251_10037885 | 3300009011 | Bacteria | 2364 |
| 289 | Ga0105244_10052114 | 3300009036 | Bacteria | 2084 |
| 290 | Ga0105240_10089436 | 3300009093 | Bacteria | 3766 |
| 291 | Ga0105240_10605519 | 3300009093 | Bacteria | 1206 |
| 292 | Ga0111539_10004508 | 3300009094 | Bacteria | 18213 |
| 293 | Ga0111539_10008569 | 3300009094 | Bacteria | 12982 |
| 294 | Ga0111539_10048979 | 3300009094 | Bacteria | 5043 |
| 295 | Ga0111539_10061855 | 3300009094 | Bacteria | 4434 |
| 296 | Ga0111539_10244902 | 3300009094 | Bacteria | 2087 |
| 297 | Ga0111539_10256588 | 3300009094 | Bacteria | 2036 |
| 298 | Ga0111539_10543210 | 3300009094 | Bacteria | 1354 |
| 299 | Ga0105245_10000888 | 3300009098 | Bacteria | 27206 |
| 300 | Ga0105245_10021572 | 3300009098 | Bacteria | 5652 |
| 301 | Ga0105247_10001292 | 3300009101 | Bacteria | 18486 |
| 302 | Ga0105247_10086321 | 3300009101 | Bacteria | 1986 |
| 303 | Ga0105247_10339098 | 3300009101 | Bacteria | 1054 |
| 304 | Ga0105247_10406313 | 3300009101 | Bacteria | 972 |
| 305 | Ga0114129_10003043 | 3300009147 | Bacteria | 23503 |
| 306 | Ga0114129_10006042 | 3300009147 | Bacteria | 17168 |
| 307 | Ga0114129_10011980 | 3300009147 | Bacteria | 12334 |
| 308 | Ga0114129_10037803 | 3300009147 | Bacteria | 6813 |
| 309 | Ga0114129_10064901 | 3300009147 | Bacteria | 5096 |
| 310 | Ga0114129_10080507 | 3300009147 | Bacteria | 4527 |
| 311 | Ga0105243_10004521 | 3300009148 | Bacteria | 10993 |
| 312 | Ga0105243_10072224 | 3300009148 | Bacteria | 2793 |
| 313 | Ga0105243_10110850 | 3300009148 | Bacteria | 2296 |
| 314 | Ga0105243_10302157 | 3300009148 | Bacteria | 1451 |
| 315 | Ga0105243_10364696 | 3300009148 | Bacteria | 1331 |
| 316 | Ga0105241_10000662 | 3300009174 | Bacteria | 25854 |
| 317 | Ga0105241_10062168 | 3300009174 | Bacteria | 2878 |
| 318 | Ga0105242_10001202 | 3300009176 | Bacteria | 20446 |
| 319 | Ga0105242_10033477 | 3300009176 | Bacteria | 4114 |
| 320 | Ga0105248_10002336 | 3300009177 | Bacteria | 21042 |
| 321 | Ga0105248_10040793 | 3300009177 | Bacteria | 5204 |
| 322 | Ga0105248_10061774 | 3300009177 | Bacteria | 4207 |
| 323 | Ga0105248_10420636 | 3300009177 | Bacteria | 1505 |
| 324 | Ga0105237_10020331 | 3300009545 | Bacteria | 6847 |
| 325 | Ga0105237_10086525 | 3300009545 | Bacteria | 3124 |
| 326 | Ga0105237_10230003 | 3300009545 | Bacteria | 1855 |
| 327 | Ga0105238_10131783 | 3300009551 | Bacteria | 2478 |
| 328 | Ga0105238_10143856 | 3300009551 | Bacteria | 2361 |
| 329 | Ga0105249_10001808 | 3300009553 | Bacteria | 18605 |
| 330 | Ga0105249_10195476 | 3300009553 | Bacteria | 1977 |
| 331 | Ga0105249_10243964 | 3300009553 | Bacteria | 1777 |
| 332 | Ga0105239_10018370 | 3300010375 | Bacteria | 7730 |
| 333 | Ga0105239_10060609 | 3300010375 | Bacteria | 4153 |
| 334 | Ga0105239_10103533 | 3300010375 | Bacteria | 3151 |
| 335 | Ga0105239_10260680 | 3300010375 | Bacteria | 1948 |
| 336 | Ga0105239_10541513 | 3300010375 | Bacteria | 1325 |
| 337 | Ga0105239_10801476 | 3300010375 | Bacteria | 1079 |
| 338 | Ga0105246_10689388 | 3300011119 | Bacteria | 894 |
| 339 | Ga0157335_1006657 | 3300012492 | Bacteria | 844 |
| 340 | Ga0157342_1000478 | 3300012507 | Bacteria | 2451 |
| 341 | Ga0157373_10006024 | 3300013100 | Bacteria | 9067 |
| 342 | Ga0157373_10198989 | 3300013100 | Bacteria | 1412 |
| 343 | Ga0157371_10027329 | 3300013102 | Bacteria | 4139 |
| 344 | Ga0157371_10165951 | 3300013102 | Bacteria | 1577 |
| 345 | Ga0157370_10470781 | 3300013104 | Bacteria | 1155 |
| 346 | Ga0157369_10535210 | 3300013105 | Bacteria | 1211 |
| 347 | Ga0157374_10002267 | 3300013296 | Bacteria | 16192 |
| 348 | Ga0157374_10053178 | 3300013296 | Bacteria | 3774 |
| 349 | Ga0157374_10140876 | 3300013296 | Bacteria | 2341 |
| 350 | Ga0157378_10003851 | 3300013297 | Bacteria | 13270 |
| 351 | Ga0157378_10023127 | 3300013297 | Bacteria | 5469 |
| 352 | Ga0157378_10243787 | 3300013297 | Bacteria | 1718 |
| 353 | Ga0163162_10009182 | 3300013306 | Bacteria | 9623 |
| 354 | Ga0163162_10015064 | 3300013306 | Bacteria | 7553 |
| 355 | Ga0157372_10011471 | 3300013307 | Bacteria | 9424 |
| 356 | Ga0157372_10088626 | 3300013307 | Bacteria | 3514 |
| 357 | Ga0157372_10172507 | 3300013307 | Bacteria | 2502 |
| 358 | Ga0157372_10487716 | 3300013307 | Bacteria | 1437 |
| 359 | Ga0157372_11105963 | 3300013307 | Bacteria | 917 |
| 360 | Ga0157375_10001031 | 3300013308 | Bacteria | 24026 |
| 361 | Ga0157375_10012658 | 3300013308 | Bacteria | 7488 |
| 362 | Ga0157375_10473737 | 3300013308 | Bacteria | 1417 |
| 363 | Ga0163163_10003323 | 3300014325 | Bacteria | 13641 |
| 364 | Ga0163163_10026839 | 3300014325 | Bacteria | 5509 |
| 365 | Ga0163163_10038122 | 3300014325 | Bacteria | 4680 |
| 366 | Ga0163163_10139060 | 3300014325 | Bacteria | 2470 |
| 367 | Ga0163163_10779657 | 3300014325 | Bacteria | 1019 |
| 368 | Ga0163163_11079087 | 3300014325 | Bacteria | 866 |
| 369 | Ga0157380_10000726 | 3300014326 | Bacteria | 20528 |
| 370 | Ga0157380_10012046 | 3300014326 | Bacteria | 6259 |
| 371 | Ga0157377_10000324 | 3300014745 | Bacteria | 21481 |
| 372 | Ga0157377_10009317 | 3300014745 | Bacteria | 4810 |
| 373 | Ga0157379_10001193 | 3300014968 | Bacteria | 21154 |
| 374 | Ga0157379_10013061 | 3300014968 | Bacteria | 7273 |
| 375 | Ga0157379_10027074 | 3300014968 | Bacteria | 5103 |
| 376 | Ga0157379_10375791 | 3300014968 | Bacteria | 1303 |
| 377 | Ga0157379_10446829 | 3300014968 | Bacteria | 1193 |
| 378 | Ga0157376_10003383 | 3300014969 | Bacteria | 10978 |
| 379 | Ga0157376_10036675 | 3300014969 | Bacteria | 3974 |
| 380 | Ga0157376_10066060 | 3300014969 | Bacteria | 3056 |
| 381 | Ga0163161_10001040 | 3300017792 | Bacteria | 21136 |
| 382 | Ga0163161_10077137 | 3300017792 | Bacteria | 2447 |
| 383 | Ga0163161_10194105 | 3300017792 | Bacteria | 1562 |
| 384 | Ga0207666_1000034 | 3300025271 | Bacteria | 28645 |
| 385 | Ga0207673_1000073 | 3300025290 | Bacteria | 8700 |
| 386 | Ga0207697_10000280 | 3300025315 | Bacteria | 28276 |
| 387 | Ga0207656_10122431 | 3300025321 | Bacteria | 1212 |
| 388 | Ga0207655_1054113 | 3300025728 | Bacteria | 1598 |
| 389 | Ga0207653_10001427 | 3300025885 | Bacteria | 7746 |
| 390 | Ga0207653_10031182 | 3300025885 | Bacteria | 1722 |
| 391 | Ga0207682_10000134 | 3300025893 | Bacteria | 33520 |
| 392 | Ga0207692_10113652 | 3300025898 | Bacteria | 1505 |
| 393 | Ga0207692_10129449 | 3300025898 | Bacteria | 1423 |
| 394 | Ga0207642_10110202 | 3300025899 | Bacteria | 1400 |
| 395 | Ga0207710_10001541 | 3300025900 | Bacteria | 11350 |
| 396 | Ga0207710_10080676 | 3300025900 | Bacteria | 1509 |
| 397 | Ga0207688_10000033 | 3300025901 | Bacteria | 46898 |
| 398 | Ga0207688_10000526 | 3300025901 | Bacteria | 18554 |
| 399 | Ga0207680_10003687 | 3300025903 | Bacteria | 7196 |
| 400 | Ga0207680_10011913 | 3300025903 | Bacteria | 4414 |
| 401 | Ga0207680_10037146 | 3300025903 | Bacteria | 2810 |
| 402 | Ga0207680_10095201 | 3300025903 | Bacteria | 1902 |
| 403 | Ga0207647_10003350 | 3300025904 | Bacteria | 12019 |
| 404 | Ga0207647_10011872 | 3300025904 | Bacteria | 6086 |
| 405 | Ga0207647_10023449 | 3300025904 | Bacteria | 4080 |
| 406 | Ga0207699_10024497 | 3300025906 | Bacteria | 3301 |
| 407 | Ga0207699_10025852 | 3300025906 | Bacteria | 3229 |
| 408 | Ga0207699_10080753 | 3300025906 | Bacteria | 2015 |
| 409 | Ga0207699_10238507 | 3300025906 | Bacteria | 1248 |
| 410 | Ga0207699_10387889 | 3300025906 | Bacteria | 993 |
| 411 | Ga0207645_10001617 | 3300025907 | Bacteria | 18370 |
| 412 | Ga0207645_10114448 | 3300025907 | Bacteria | 1748 |
| 413 | Ga0207643_10000756 | 3300025908 | Bacteria | 19870 |
| 414 | Ga0207643_10004718 | 3300025908 | Bacteria | 7314 |
| 415 | Ga0207705_10270689 | 3300025909 | Bacteria | 1299 |
| 416 | Ga0207684_10193478 | 3300025910 | Bacteria | 1754 |
| 417 | Ga0207684_10408408 | 3300025910 | Bacteria | 1167 |
| 418 | Ga0207654_10004513 | 3300025911 | Bacteria | 7031 |
| 419 | Ga0207707_10002112 | 3300025912 | Bacteria | 17984 |
| 420 | Ga0207707_10390291 | 3300025912 | Bacteria | 1196 |
| 421 | Ga0207695_10063206 | 3300025913 | Bacteria | 3817 |
| 422 | Ga0207671_10088716 | 3300025914 | Bacteria | 2327 |
| 423 | Ga0207671_10218462 | 3300025914 | Bacteria | 1493 |
| 424 | Ga0207693_10009432 | 3300025915 | Bacteria | 7955 |
| 425 | Ga0207693_10027020 | 3300025915 | Bacteria | 4539 |
| 426 | Ga0207693_10039890 | 3300025915 | Bacteria | 3698 |
| 427 | Ga0207693_10100762 | 3300025915 | Bacteria | 2265 |
| 428 | Ga0207693_10111817 | 3300025915 | Bacteria | 2142 |
| 429 | Ga0207693_10126504 | 3300025915 | Bacteria | 2009 |
| 430 | Ga0207693_10458870 | 3300025915 | Bacteria | 995 |
| 431 | Ga0207663_10034861 | 3300025916 | Bacteria | 3014 |
| 432 | Ga0207663_10175795 | 3300025916 | Bacteria | 1525 |
| 433 | Ga0207663_10183236 | 3300025916 | Bacteria | 1497 |
| 434 | Ga0207660_10001335 | 3300025917 | Bacteria | 16500 |
| 435 | Ga0207660_10129815 | 3300025917 | Bacteria | 1917 |
| 436 | Ga0207660_10294683 | 3300025917 | Bacteria | 1291 |
| 437 | Ga0207660_10311272 | 3300025917 | Bacteria | 1256 |
| 438 | Ga0207662_10000341 | 3300025918 | Bacteria | 21083 |
| 439 | Ga0207662_10003898 | 3300025918 | Bacteria | 7771 |
| 440 | Ga0207662_10007966 | 3300025918 | Bacteria | 5773 |
| 441 | Ga0207657_10002888 | 3300025919 | Bacteria | 18459 |
| 442 | Ga0207657_10022947 | 3300025919 | Bacteria | 5823 |
| 443 | Ga0207657_10054672 | 3300025919 | Bacteria | 3451 |
| 444 | Ga0207657_10055265 | 3300025919 | Bacteria | 3430 |
| 445 | Ga0207657_10147877 | 3300025919 | Bacteria | 1915 |
| 446 | Ga0207657_10397641 | 3300025919 | Bacteria | 1084 |
| 447 | Ga0207649_10000271 | 3300025920 | Bacteria | 40924 |
| 448 | Ga0207652_10001830 | 3300025921 | Bacteria | 18431 |
| 449 | Ga0207652_10210529 | 3300025921 | Bacteria | 1750 |
| 450 | Ga0207681_10000658 | 3300025923 | Bacteria | 22886 |
| 451 | Ga0207681_10052178 | 3300025923 | Bacteria | 2773 |
| 452 | Ga0207681_10114924 | 3300025923 | Bacteria | 1964 |
| 453 | Ga0207694_10077300 | 3300025924 | Bacteria | 2608 |
| 454 | Ga0207694_10112188 | 3300025924 | Bacteria | 2170 |
| 455 | Ga0207694_10137781 | 3300025924 | Bacteria | 1961 |
| 456 | Ga0207650_10002267 | 3300025925 | Bacteria | 13424 |
| 457 | Ga0207650_10006007 | 3300025925 | Bacteria | 8283 |
| 458 | Ga0207650_10041801 | 3300025925 | Bacteria | 3361 |
| 459 | Ga0207650_10146997 | 3300025925 | Bacteria | 1857 |
| 460 | Ga0207659_10000177 | 3300025926 | Bacteria | 38217 |
| 461 | Ga0207659_10349933 | 3300025926 | Bacteria | 1226 |
| 462 | Ga0207687_10000495 | 3300025927 | Bacteria | 26551 |
| 463 | Ga0207687_10006623 | 3300025927 | Bacteria | 7642 |
| 464 | Ga0207687_10029641 | 3300025927 | Bacteria | 3683 |
| 465 | Ga0207700_10114017 | 3300025928 | Bacteria | 2180 |
| 466 | Ga0207700_10141346 | 3300025928 | Bacteria | 1978 |
| 467 | Ga0207700_10188564 | 3300025928 | Bacteria | 1731 |
| 468 | Ga0207700_10253591 | 3300025928 | Bacteria | 1504 |
| 469 | Ga0207664_10271689 | 3300025929 | Bacteria | 1485 |
| 470 | Ga0207644_10000279 | 3300025931 | Bacteria | 33969 |
| 471 | Ga0207644_10062434 | 3300025931 | Bacteria | 2702 |
| 472 | Ga0207644_10074660 | 3300025931 | Bacteria | 2489 |
| 473 | Ga0207644_10523311 | 3300025931 | Unclassified | 980 |
| 474 | Ga0207690_10001557 | 3300025932 | Bacteria | 14369 |
| 475 | Ga0207690_10144034 | 3300025932 | Bacteria | 1759 |
| 476 | Ga0207706_10003167 | 3300025933 | Bacteria | 15802 |
| 477 | Ga0207706_10005939 | 3300025933 | Bacteria | 11357 |
| 478 | Ga0207706_10065929 | 3300025933 | Bacteria | 3187 |
| 479 | Ga0207686_10001383 | 3300025934 | Bacteria | 13773 |
| 480 | Ga0207686_10052401 | 3300025934 | Bacteria | 2546 |
| 481 | Ga0207686_10300817 | 3300025934 | Bacteria | 1191 |
| 482 | Ga0207709_10000952 | 3300025935 | Bacteria | 21659 |
| 483 | Ga0207709_10130124 | 3300025935 | Bacteria | 1714 |
| 484 | Ga0207709_10189751 | 3300025935 | Bacteria | 1459 |
| 485 | Ga0207670_10000491 | 3300025936 | Bacteria | 21793 |
| 486 | Ga0207670_10130196 | 3300025936 | Bacteria | 1842 |
| 487 | Ga0207670_10325591 | 3300025936 | Bacteria | 1210 |
| 488 | Ga0207669_10000649 | 3300025937 | Bacteria | 15064 |
| 489 | Ga0207669_10057728 | 3300025937 | Bacteria | 2364 |
| 490 | Ga0207704_10001342 | 3300025938 | Bacteria | 10974 |
| 491 | Ga0207704_10016141 | 3300025938 | Bacteria | 3829 |
| 492 | Ga0207704_10164606 | 3300025938 | Bacteria | 1582 |
| 493 | Ga0207704_10221957 | 3300025938 | Bacteria | 1399 |
| 494 | Ga0207665_10004210 | 3300025939 | Bacteria | 9576 |
| 495 | Ga0207665_10182378 | 3300025939 | Bacteria | 1521 |
| 496 | Ga0207665_10204402 | 3300025939 | Bacteria | 1440 |
| 497 | Ga0207691_10002815 | 3300025940 | Bacteria | 16961 |
| 498 | Ga0207691_10012526 | 3300025940 | Bacteria | 8129 |
| 499 | Ga0207691_10155691 | 3300025940 | Bacteria | 2007 |
| 500 | Ga0207691_10207640 | 3300025940 | Bacteria | 1702 |
| 501 | Ga0207711_10001570 | 3300025941 | Bacteria | 21117 |
| 502 | Ga0207711_10011263 | 3300025941 | Bacteria | 7432 |
| 503 | Ga0207711_10016743 | 3300025941 | Bacteria | 6088 |
| 504 | Ga0207711_10068152 | 3300025941 | Bacteria | 3081 |
| 505 | Ga0207689_10002449 | 3300025942 | Bacteria | 17292 |
| 506 | Ga0207689_10003816 | 3300025942 | Bacteria | 13733 |
| 507 | Ga0207689_10131020 | 3300025942 | Bacteria | 2064 |
| 508 | Ga0207661_10000642 | 3300025944 | Bacteria | 22523 |
| 509 | Ga0207661_10218373 | 3300025944 | Bacteria | 1684 |
| 510 | Ga0207661_10677803 | 3300025944 | Bacteria | 948 |
| 511 | Ga0207679_10000046 | 3300025945 | Bacteria | 119975 |
| 512 | Ga0207679_10044409 | 3300025945 | Bacteria | 3206 |
| 513 | Ga0207667_10007962 | 3300025949 | Bacteria | 12641 |
| 514 | Ga0207667_10047435 | 3300025949 | Bacteria | 4547 |
| 515 | Ga0207667_10226942 | 3300025949 | Bacteria | 1913 |
| 516 | Ga0207651_10000214 | 3300025960 | Bacteria | 24891 |
| 517 | Ga0207651_10054490 | 3300025960 | Bacteria | 2741 |
| 518 | Ga0207651_10085066 | 3300025960 | Bacteria | 2293 |
| 519 | Ga0207712_10003297 | 3300025961 | Bacteria | 10236 |
| 520 | Ga0207712_10113898 | 3300025961 | Bacteria | 2033 |
| 521 | Ga0207712_10165498 | 3300025961 | Bacteria | 1723 |
| 522 | Ga0207712_10378142 | 3300025961 | Bacteria | 1184 |
| 523 | Ga0207668_10000537 | 3300025972 | Bacteria | 23803 |
| 524 | Ga0207668_10045783 | 3300025972 | Bacteria | 2985 |
| 525 | Ga0207668_10458514 | 3300025972 | Bacteria | 1089 |
| 526 | Ga0207668_10665727 | 3300025972 | Bacteria | 912 |
| 527 | Ga0207640_10000765 | 3300025981 | Bacteria | 18401 |
| 528 | Ga0207640_10072606 | 3300025981 | Bacteria | 2322 |
| 529 | Ga0207658_10001147 | 3300025986 | Bacteria | 21223 |
| 530 | Ga0207658_10014386 | 3300025986 | Bacteria | 5419 |
| 531 | Ga0207677_10003377 | 3300026023 | Bacteria | 8450 |
| 532 | Ga0207677_10020914 | 3300026023 | Bacteria | 3987 |
| 533 | Ga0207677_10245657 | 3300026023 | Bacteria | 1450 |
| 534 | Ga0207703_10000940 | 3300026035 | Bacteria | 28248 |
| 535 | Ga0207703_10021815 | 3300026035 | Bacteria | 5014 |
| 536 | Ga0207639_10000852 | 3300026041 | Bacteria | 20713 |
| 537 | Ga0207639_10084643 | 3300026041 | Bacteria | 2519 |
| 538 | Ga0207639_10300042 | 3300026041 | Bacteria | 1420 |
| 539 | Ga0207678_10002525 | 3300026067 | Bacteria | 16674 |
| 540 | Ga0207678_10011036 | 3300026067 | Bacteria | 7935 |
| 541 | Ga0207678_10014774 | 3300026067 | Bacteria | 6871 |
| 542 | Ga0207678_10073591 | 3300026067 | Bacteria | 2928 |
| 543 | Ga0207678_10089495 | 3300026067 | Bacteria | 2631 |
| 544 | Ga0207678_10246758 | 3300026067 | Bacteria | 1529 |
| 545 | Ga0207708_10000124 | 3300026075 | Bacteria | 59953 |
| 546 | Ga0207708_10001006 | 3300026075 | Bacteria | 21086 |
| 547 | Ga0207708_10005549 | 3300026075 | Bacteria | 9308 |
| 548 | Ga0207702_10002642 | 3300026078 | Bacteria | 16821 |
| 549 | Ga0207702_10161024 | 3300026078 | Bacteria | 2049 |
| 550 | Ga0207702_10219674 | 3300026078 | Bacteria | 1770 |
| 551 | Ga0207702_10304987 | 3300026078 | Bacteria | 1512 |
| 552 | Ga0207702_10370211 | 3300026078 | Bacteria | 1375 |
| 553 | Ga0207641_10001370 | 3300026088 | Bacteria | 24094 |
| 554 | Ga0207641_10294594 | 3300026088 | Bacteria | 1530 |
| 555 | Ga0207648_10001663 | 3300026089 | Bacteria | 24358 |
| 556 | Ga0207648_10002036 | 3300026089 | Bacteria | 22064 |
| 557 | Ga0207676_10004314 | 3300026095 | Bacteria | 10058 |
| 558 | Ga0207676_10018460 | 3300026095 | Bacteria | 5070 |
| 559 | Ga0207674_10002956 | 3300026116 | Bacteria | 21106 |
| 560 | Ga0207674_10184058 | 3300026116 | Bacteria | 2039 |
| 561 | Ga0207674_10196229 | 3300026116 | Bacteria | 1968 |
| 562 | Ga0207675_100006209 | 3300026118 | Bacteria | 11346 |
| 563 | Ga0207675_100007875 | 3300026118 | Bacteria | 10055 |
| 564 | Ga0207675_100075048 | 3300026118 | Bacteria | 3165 |
| 565 | Ga0207675_100528153 | 3300026118 | Bacteria | 1177 |
| 566 | Ga0207683_10001904 | 3300026121 | Bacteria | 18455 |
| 567 | Ga0207683_10009531 | 3300026121 | Bacteria | 8276 |
| 568 | Ga0207683_10067251 | 3300026121 | Bacteria | 3161 |
| 569 | Ga0207698_10001980 | 3300026142 | Bacteria | 12051 |
| 570 | Ga0207698_10003723 | 3300026142 | Bacteria | 9223 |
| 571 | Ga0207698_10026412 | 3300026142 | Bacteria | 4107 |
| 572 | Ga0209973_1011826 | 3300027252 | Bacteria | 1053 |
| 573 | Ga0210002_1000354 | 3300027617 | Bacteria | 6258 |
| 574 | Ga0210002_1014531 | 3300027617 | Bacteria | 1235 |
| 575 | Ga0209971_1005583 | 3300027682 | Bacteria | 2986 |
| 576 | Ga0209966_1001997 | 3300027695 | Bacteria | 3413 |
| 577 | Ga0209998_10001696 | 3300027717 | Bacteria | 5264 |
| 578 | Ga0209998_10002995 | 3300027717 | Bacteria | 3758 |
| 579 | Ga0209974_10000502 | 3300027876 | Bacteria | 13050 |
| 580 | Ga0207428_10002104 | 3300027907 | Bacteria | 20069 |
| 581 | Ga0207428_10002830 | 3300027907 | Bacteria | 17218 |
| 582 | Ga0207428_10002977 | 3300027907 | Bacteria | 16750 |
| 583 | Ga0207428_10005357 | 3300027907 | Bacteria | 11969 |
| 584 | Ga0207428_10070447 | 3300027907 | Bacteria | 2748 |
| 585 | Ga0207428_10389055 | 3300027907 | Bacteria | 1022 |
| 586 | Ga0268266_10019214 | 3300028379 | Bacteria | 5819 |
| 587 | Ga0268266_10042402 | 3300028379 | Bacteria | 3886 |
| 588 | Ga0268265_10000817 | 3300028380 | Bacteria | 29538 |
| 589 | Ga0268265_10079471 | 3300028380 | Bacteria | 2583 |
| 590 | Ga0268265_10366513 | 3300028380 | Bacteria | 1321 |
| 591 | Ga0268264_10001227 | 3300028381 | Bacteria | 24655 |
| 592 | Ga0268264_10062211 | 3300028381 | Bacteria | 3134 |
| 593 | Ga0268264_10219849 | 3300028381 | Bacteria | 1748 |
| 594 | Ga0268264_10262104 | 3300028381 | Bacteria | 1611 |
| 595 | Ga0265337_1001372 | 3300028556 | Bacteria | 11994 |
| 596 | Ga0265338_10018779 | 3300028800 | Bacteria | 7379 |
| 597 | Ga0265338_10020724 | 3300028800 | Bacteria | 6897 |
| 598 | Ga0265338_10038967 | 3300028800 | Bacteria | 4492 |
| 599 | Ga0265338_10391317 | 3300028800 | Bacteria | 992 |
| 600 | Ga0265338_10406651 | 3300028800 | Bacteria | 969 |
| 601 | Ga0265325_10000043 | 3300031241 | Bacteria | 89158 |
| 602 | Ga0265325_10002820 | 3300031241 | Bacteria | 11596 |
| 603 | Ga0265325_10026685 | 3300031241 | Bacteria | 3126 |
| 604 | Ga0265325_10027239 | 3300031241 | Bacteria | 3090 |
| 605 | Ga0265325_10038759 | 3300031241 | Bacteria | 2513 |
| 606 | Ga0265340_10006632 | 3300031247 | Bacteria | 6350 |
| 607 | Ga0265340_10123403 | 3300031247 | Bacteria | 1191 |
| 608 | Ga0265339_10000091 | 3300031249 | Bacteria | 75937 |
| 609 | Ga0265339_10031675 | 3300031249 | Bacteria | 2986 |
| 610 | Ga0265316_10032664 | 3300031344 | Bacteria | 4246 |
| 611 | Ga0265313_10000260 | 3300031595 | Bacteria | 57581 |
| 612 | Ga0265313_10024154 | 3300031595 | Bacteria | 3254 |
| 613 | Ga0265314_10006712 | 3300031711 | Bacteria | 10106 |
| 614 | Ga0265314_10191643 | 3300031711 | Bacteria | 1216 |
| 615 | Ga0265342_10000290 | 3300031712 | Bacteria | 56854 |
| 616 | Ga0265342_10014743 | 3300031712 | Bacteria | 5176 |
| 617 | Ga0373930_0000266 | 3300034816 | Bacteria | 6666 |
| 618 | Ga0373930_0010805 | 3300034816 | Bacteria | 1638 |
| 619 | Ga0373948_0000471 | 3300034817 | Bacteria | 5018 |
| 620 | Ga0373948_0006126 | 3300034817 | Bacteria | 1977 |
| 621 | Ga0373950_0000324 | 3300034818 | Bacteria | 5986 |
| 622 | Ga0373950_0014500 | 3300034818 | Bacteria | 1326 |
| 623 | Ga0373958_0000451 | 3300034819 | Bacteria | 5021 |
| 624 | Ga0373938_0000308 | 3300034957 | Bacteria | 7806 |
| 625 | Ga0373938_0000348 | 3300034957 | Bacteria | 7337 |
| 626 | Ga0373926_0002868 | 3300035083 | Bacteria | 5523 |
| 627 | Ga0373926_0008286 | 3300035083 | Bacteria | 3458 |
| 628 | Ga0373926_0085199 | 3300035083 | Bacteria | 1172 |
| 629 | Ga0373928_0001853 | 3300035084 | Bacteria | 4124 |
| 630 | Ga0373928_0002060 | 3300035084 | Bacteria | 3915 |
| 631 | Ga0373934_0015266 | 3300035086 | Bacteria | 2913 |
| 632 | Ga0373934_0027772 | 3300035086 | Bacteria | 2201 |
| 633 | Ga0373934_0068018 | 3300035086 | Bacteria | 1423 |
| 634 | Ga0373940_0001082 | 3300035088 | Bacteria | 4724 |
| 635 | Ga0373940_0003271 | 3300035088 | Bacteria | 3283 |
| 636 | Ga0373940_0008910 | 3300035088 | Bacteria | 2317 |
| 637 | Ga0373944_0003210 | 3300035089 | Bacteria | 4200 |
| 638 | Ga0373944_0005831 | 3300035089 | Bacteria | 3258 |
| 639 | Ga0373944_0031938 | 3300035089 | Bacteria | 1587 |
| 640 | Ga0373944_0038845 | 3300035089 | Bacteria | 1463 |
| 641 | Ga0373944_0052200 | 3300035089 | Bacteria | 1291 |
| 642 | Ga0373944_0079206 | 3300035089 | Bacteria | 1082 |
| 643 | Ga0373949_0004203 | 3300035090 | Bacteria | 3325 |
| 644 | Ga0373949_0034321 | 3300035090 | Bacteria | 1222 |
| 645 | Ga0373951_0001125 | 3300035091 | Bacteria | 7115 |
| 646 | Ga0373952_0000133 | 3300035092 | Bacteria | 10703 |
| 647 | Ga0373952_0008267 | 3300035092 | Bacteria | 1971 |
| 648 | Ga0373952_0010301 | 3300035092 | Bacteria | 1804 |
| 649 | Ga0373923_0012826 | 3300035111 | Bacteria | 3110 |
| 650 | Ga0373923_0027798 | 3300035111 | Bacteria | 2259 |
| 651 | Ga0373923_0031402 | 3300035111 | Bacteria | 2141 |
| 652 | Ga0373932_0001964 | 3300035112 | Bacteria | 5434 |
| 653 | Ga0373936_0031194 | 3300035113 | Bacteria | 2104 |
| 654 | Ga0373936_0052387 | 3300035113 | Bacteria | 1653 |
| 655 | Ga0373939_0000343 | 3300035114 | Bacteria | 11867 |
| 656 | Ga0373939_0005408 | 3300035114 | Bacteria | 3041 |
| 657 | Ga0373939_0033924 | 3300035114 | Bacteria | 1494 |
| 658 | Ga0373941_0001154 | 3300035115 | Bacteria | 5508 |
| 659 | Ga0373945_0004512 | 3300035116 | Bacteria | 4424 |
| 660 | Ga0373945_0042669 | 3300035116 | Bacteria | 1644 |
| 661 | Ga0373953_0003117 | 3300035117 | Bacteria | 5110 |
| 662 | Ga0373953_0054496 | 3300035117 | Bacteria | 1622 |
| 663 | Ga0373953_0119651 | 3300035117 | Bacteria | 1118 |
| 664 | Ga0373954_0006503 | 3300035118 | Bacteria | 5095 |
| 665 | Ga0373954_0086937 | 3300035118 | Bacteria | 1498 |
| 666 | Ga0373956_0001924 | 3300035119 | Bacteria | 8571 |
| 667 | Ga0373956_0009376 | 3300035119 | Bacteria | 3982 |
| 668 | Ga0373956_0021669 | 3300035119 | Bacteria | 2742 |
| 669 | Ga0373956_0120090 | 3300035119 | Bacteria | 1227 |
| 670 | Ga0373957_0001572 | 3300035120 | Bacteria | 6231 |
| 671 | Ga0373960_0002646 | 3300035121 | Bacteria | 4050 |
| 672 | Ga0373960_0007249 | 3300035121 | Bacteria | 2623 |
| 673 | Ga0373943_0005039 | 3300035170 | Bacteria | 5958 |
| 674 | Ga0373943_0007317 | 3300035170 | Bacteria | 4956 |
| 675 | Ga0373943_0008492 | 3300035170 | Bacteria | 4606 |
| 676 | Ga0373943_0034153 | 3300035170 | Bacteria | 2425 |
| 677 | Ga0373946_0010820 | 3300035171 | Bacteria | 3388 |
| 678 | Ga0373946_0072114 | 3300035171 | Bacteria | 1494 |
| 679 | Ga0373946_0117386 | 3300035171 | Bacteria | 1211 |
| 680 | Ga0373955_0002275 | 3300035172 | Bacteria | 8339 |
| 681 | Ga0373955_0007053 | 3300035172 | Bacteria | 5147 |
| 682 | Ga0373955_0022739 | 3300035172 | Bacteria | 3184 |
| 683 | Ga0373955_0027293 | 3300035172 | Bacteria | 2949 |
| 684 | Ga0373955_0052897 | 3300035172 | Bacteria | 2216 |
| 685 | Ga0373942_0001912 | 3300035207 | Bacteria | 5225 |
| 686 | Ga0373942_0005068 | 3300035207 | Bacteria | 3056 |
| 687 | Ga0373942_0012073 | 3300035207 | Bacteria | 2057 |
| 688 | Ga0373962_0000253 | 3300035242 | Bacteria | 11386 |
| 689 | Ga0373962_0013895 | 3300035242 | Bacteria | 2045 |
| 690 | Ga0373924_0005148 | 3300035410 | Bacteria | 4615 |
| 691 | Ga0373924_0020722 | 3300035410 | Bacteria | 2558 |
| 692 | Ga0373931_0000714 | 3300035691 | Bacteria | 13748 |
| 693 | Ga0373931_0001610 | 3300035691 | Bacteria | 9775 |
| 694 | Ga0373931_0025062 | 3300035691 | Bacteria | 3028 |
| 695 | Ga0373931_0054884 | 3300035691 | Bacteria | 2131 |
| 696 | Ga0373935_0004317 | 3300035692 | Bacteria | 8341 |
| 697 | Ga0373935_0023439 | 3300035692 | Bacteria | 3793 |
| 698 | Ga0373935_0190134 | 3300035692 | Bacteria | 1414 |
| 699 | Ga0373935_0302081 | 3300035692 | Bacteria | 1131 |
| 700 | Ga0373927_0007289 | 3300035695 | Bacteria | 7502 |
| 701 | Ga0373927_0009357 | 3300035695 | Bacteria | 6572 |
| 702 | Ga0373927_0018783 | 3300035695 | Bacteria | 4536 |
| 703 | Ga0373927_0027987 | 3300035695 | Bacteria | 3678 |
| 704 | Ga0373927_0047576 | 3300035695 | Bacteria | 2774 |
| 705 | Ga0373927_0060880 | 3300035695 | Bacteria | 2442 |
| 706 | Ga0373927_0137079 | 3300035695 | Bacteria | 1600 |
| 707 | Ga0373927_0263026 | 3300035695 | Bacteria | 1135 |
| 708 | Ga0373933_0001224 | 3300035724 | Bacteria | 15196 |
| 709 | Ga0373933_0002515 | 3300035724 | Bacteria | 10296 |
| 710 | Ga0373933_0005081 | 3300035724 | Bacteria | 7174 |
| 711 | Ga0373933_0100261 | 3300035724 | Bacteria | 1796 |
| 712 | Ga0373933_0189294 | 3300035724 | Bacteria | 1314 |
| 713 | Ga0373933_0196441 | 3300035724 | Bacteria | 1290 |
| 714 | Ga0373947_0002242 | 3300035725 | Bacteria | 11693 |
| 715 | Ga0373947_0005699 | 3300035725 | Bacteria | 7261 |
| 716 | Ga0373947_0029617 | 3300035725 | Bacteria | 3213 |
| 717 | Ga0373947_0039388 | 3300035725 | Bacteria | 2811 |
| 718 | Ga0373947_0043254 | 3300035725 | Bacteria | 2690 |
| 719 | Ga0373947_0059857 | 3300035725 | Bacteria | 2310 |
| 720 | Ga0373937_0000975 | 3300036401 | Bacteria | 24290 |
| 721 | Ga0373937_0001146 | 3300036401 | Bacteria | 22227 |
| 722 | Ga0373937_0005174 | 3300036401 | Bacteria | 11127 |
| 723 | Ga0373937_0008485 | 3300036401 | Bacteria | 8929 |
| 724 | Ga0373937_0052710 | 3300036401 | Bacteria | 3731 |
| 725 | Ga0373937_0155073 | 3300036401 | Bacteria | 2146 |
| 726 | Ga0373937_0313823 | 3300036401 | Bacteria | 1483 |
| 727 | Ga0373937_0649147 | 3300036401 | Bacteria | 1001 |
| 728 | Ga0373925_0000957 | 3300037068 | Bacteria | 26248 |
| 729 | Ga0373925_0009418 | 3300037068 | Bacteria | 7112 |
| 730 | Ga0373925_0055962 | 3300037068 | Bacteria | 2954 |
| 731 | Ga0373925_0099421 | 3300037068 | Bacteria | 2234 |
| 732 | Ga0373925_0168422 | 3300037068 | Bacteria | 1728 |
| 733 | Ga0373925_0402600 | 3300037068 | Bacteria | 1116 |
| 734 | Ga0395899_0008367 | 3300037312 | Bacteria | 7963 |
| 735 | Ga0395900_0005495 | 3300037418 | Bacteria | 13263 |
| 736 | Ga0395900_0024104 | 3300037418 | Bacteria | 6229 |
| 737 | Ga0395898_0007621 | 3300037466 | Bacteria | 11490 |
| 738 | Ga0395898_0017809 | 3300037466 | Bacteria | 7248 |
| 739 | Ga0395898_0129220 | 3300037466 | Bacteria | 2420 |
| 740 | Ga0395898_0132944 | 3300037466 | Bacteria | 2382 |
| 741 | Ga0395901_0008887 | 3300038443 | Bacteria | 10173 |
| 742 | Ga0395901_0027102 | 3300038443 | Bacteria | 5885 |
| 743 | Ga0395901_0119180 | 3300038443 | Bacteria | 2773 |
| 744 | Ga0395901_0174151 | 3300038443 | Bacteria | 2257 |
| 745 | Ga0395901_0367506 | 3300038443 | Bacteria | 1482 |
| 746 | Ga0436360_1080146 | 3300039438 | Bacteria | 1921 |
| 747 | Ga0436361_0057894 | 3300039447 | Bacteria | 1086 |
| 748 | Ga0436361_0112922 | 3300039447 | Bacteria | 897 |
| 749 | Ga0436361_1189806 | 3300039447 | Bacteria | 31675 |
| 750 | Ga0451841_1103901 | 3300041498 | Bacteria | 1129 |
| 751 | Ga0466966_0138105 | 3300044684 | Bacteria | 1490 |
| 752 | Ga0466963_0096029 | 3300044694 | Bacteria | 2024 |
| 753 | Ga0466963_0112620 | 3300044694 | Bacteria | 1868 |
| 754 | Ga0466964_0197903 | 3300044706 | Bacteria | 963 |
| 755 | Ga0466971_0063342 | 3300044719 | Bacteria | 1674 |
| 756 | Ga0466957_0012433 | 3300044842 | Bacteria | 4927 |
| 757 | Ga0466959_0021191 | 3300045049 | Bacteria | 4792 |
| 758 | Ga0451576_0091489 | 3300045051 | Bacteria | 3164 |
| 759 | Ga0466958_0034909 | 3300045836 | Bacteria | 3002 |
| 760 | Ga0466967_0010562 | 3300045976 | Bacteria | 6934 |
| 761 | Ga0466967_0294718 | 3300045976 | Bacteria | 1559 |
| 762 | Ga0466967_0448740 | 3300045976 | Bacteria | 1260 |
| 763 | Ga0495617_029664 | 3300046452 | Bacteria | 1839 |
| 764 | Ga0495592_0008218 | 3300046454 | Bacteria | 7837 |
| 765 | Ga0495592_0026610 | 3300046454 | Bacteria | 4384 |
| 766 | Ga0495592_0047700 | 3300046454 | Bacteria | 3189 |
| 767 | Ga0495592_0072135 | 3300046454 | Bacteria | 2513 |
| 768 | Ga0495592_0127285 | 3300046454 | Bacteria | 1785 |
| 769 | Ga0495603_0007025 | 3300046455 | Bacteria | 6757 |
| 770 | Ga0495603_0069549 | 3300046455 | Bacteria | 2070 |
| 771 | Ga0495603_0099243 | 3300046455 | Bacteria | 1700 |
| 772 | Ga0495603_0273942 | 3300046455 | Bacteria | 970 |
| 773 | Ga0495629_0002009 | 3300046459 | Bacteria | 15810 |
| 774 | Ga0495629_0010732 | 3300046459 | Bacteria | 6663 |
| 775 | Ga0495629_0027195 | 3300046459 | Bacteria | 4063 |
| 776 | Ga0495629_0043069 | 3300046459 | Bacteria | 3170 |
| 777 | Ga0495629_0350973 | 3300046459 | Bacteria | 1006 |
| 778 | Ga0495638_0034210 | 3300046460 | Bacteria | 3245 |
| 779 | Ga0495641_0027895 | 3300046461 | Bacteria | 2738 |
| 780 | Ga0495641_0029573 | 3300046461 | Bacteria | 2638 |
| 781 | Ga0495641_0056413 | 3300046461 | Bacteria | 1780 |
| 782 | Ga0495641_0091423 | 3300046461 | Bacteria | 1360 |
| 783 | Ga0495651_0003394 | 3300046462 | Bacteria | 12218 |
| 784 | Ga0495651_0036961 | 3300046462 | Bacteria | 3802 |
| 785 | Ga0495651_0048365 | 3300046462 | Bacteria | 3285 |
| 786 | Ga0495651_0054410 | 3300046462 | Bacteria | 3078 |
| 787 | Ga0495651_0063674 | 3300046462 | Bacteria | 2818 |
| 788 | Ga0495651_0189383 | 3300046462 | Bacteria | 1449 |
| 789 | Ga0495653_0004970 | 3300046463 | Bacteria | 10793 |
| 790 | Ga0495653_0010292 | 3300046463 | Bacteria | 7654 |
| 791 | Ga0495653_0012696 | 3300046463 | Bacteria | 6881 |
| 792 | Ga0495653_0079954 | 3300046463 | Bacteria | 2420 |
| 793 | Ga0495653_0233014 | 3300046463 | Bacteria | 1231 |
| 794 | Ga0495580_0009608 | 3300046472 | Bacteria | 7596 |
| 795 | Ga0495580_0053605 | 3300046472 | Bacteria | 2845 |
| 796 | Ga0495580_0057294 | 3300046472 | Bacteria | 2743 |
| 797 | Ga0495582_0009496 | 3300046473 | Bacteria | 5359 |
| 798 | Ga0495582_0012182 | 3300046473 | Bacteria | 4737 |
| 799 | Ga0495582_0078514 | 3300046473 | Bacteria | 1831 |
| 800 | Ga0495605_0082857 | 3300046474 | Bacteria | 1498 |
| 801 | Ga0495639_0066440 | 3300046475 | Bacteria | 1660 |
| 802 | Ga0495639_0073431 | 3300046475 | Bacteria | 1583 |
| 803 | Ga0495662_0014265 | 3300046476 | Bacteria | 3864 |
| 804 | Ga0495662_0114650 | 3300046476 | Bacteria | 1321 |
| 805 | Ga0495664_0005349 | 3300046477 | Bacteria | 7045 |
| 806 | Ga0495664_0009436 | 3300046477 | Bacteria | 5459 |
| 807 | Ga0495664_0024516 | 3300046477 | Bacteria | 3507 |
| 808 | Ga0495664_0042324 | 3300046477 | Bacteria | 2697 |
| 809 | Ga0495584_0017374 | 3300046491 | Bacteria | 3663 |
| 810 | Ga0495584_0023045 | 3300046491 | Bacteria | 3158 |
| 811 | Ga0495584_0045524 | 3300046491 | Bacteria | 2213 |
| 812 | Ga0495585_0057566 | 3300046492 | Bacteria | 2145 |
| 813 | Ga0495594_0024127 | 3300046499 | Bacteria | 3264 |
| 814 | Ga0495594_0024998 | 3300046499 | Bacteria | 3209 |
| 815 | Ga0495594_0026850 | 3300046499 | Bacteria | 3100 |
| 816 | Ga0495594_0139585 | 3300046499 | Bacteria | 1374 |
| 817 | Ga0495607_0043208 | 3300046501 | Bacteria | 2667 |
| 818 | Ga0495607_0051344 | 3300046501 | Bacteria | 2395 |
| 819 | Ga0495583_0106016 | 3300046506 | Bacteria | 1195 |
| 820 | Ga0495608_0002249 | 3300046511 | Bacteria | 13939 |
| 821 | Ga0495608_0004206 | 3300046511 | Bacteria | 10314 |
| 822 | Ga0495608_0091167 | 3300046511 | Bacteria | 1971 |
| 823 | Ga0495618_0001172 | 3300046514 | Bacteria | 17756 |
| 824 | Ga0495618_0001619 | 3300046514 | Bacteria | 15047 |
| 825 | Ga0495618_0004363 | 3300046514 | Bacteria | 8701 |
| 826 | Ga0495618_0374084 | 3300046514 | Bacteria | 875 |
| 827 | Ga0495618_0426580 | 3300046514 | Bacteria | 808 |
| 828 | Ga0495628_0012115 | 3300046516 | Bacteria | 7269 |
| 829 | Ga0495628_0015917 | 3300046516 | Bacteria | 6275 |
| 830 | Ga0495628_0036636 | 3300046516 | Bacteria | 3935 |
| 831 | Ga0495628_0115301 | 3300046516 | Bacteria | 2063 |
| 832 | Ga0495630_0008146 | 3300046517 | Bacteria | 7528 |
| 833 | Ga0495630_0008748 | 3300046517 | Bacteria | 7273 |
| 834 | Ga0495630_0062990 | 3300046517 | Bacteria | 2786 |
| 835 | Ga0495630_0124544 | 3300046517 | Bacteria | 1955 |
| 836 | Ga0495630_0171519 | 3300046517 | Bacteria | 1653 |
| 837 | Ga0495630_0189414 | 3300046517 | Bacteria | 1569 |
| 838 | Ga0495630_0413098 | 3300046517 | Bacteria | 1034 |
| 839 | Ga0495631_0060265 | 3300046518 | Bacteria | 1647 |
| 840 | Ga0495637_0023416 | 3300046520 | Bacteria | 2807 |
| 841 | Ga0495644_0006450 | 3300046523 | Bacteria | 4546 |
| 842 | Ga0495644_0018349 | 3300046523 | Bacteria | 2672 |
| 843 | Ga0495666_0008087 | 3300046526 | Bacteria | 5272 |
| 844 | Ga0495666_0114582 | 3300046526 | Bacteria | 1265 |
| 845 | Ga0495652_0005206 | 3300046529 | Bacteria | 12292 |
| 846 | Ga0495652_0009266 | 3300046529 | Bacteria | 8947 |
| 847 | Ga0495652_0024740 | 3300046529 | Bacteria | 5314 |
| 848 | Ga0495652_0028155 | 3300046529 | Bacteria | 4948 |
| 849 | Ga0495652_0051485 | 3300046529 | Bacteria | 3516 |
| 850 | Ga0495665_0030853 | 3300046531 | Bacteria | 2867 |
| 851 | Ga0495665_0036404 | 3300046531 | Bacteria | 2627 |
| 852 | Ga0495665_0061885 | 3300046531 | Bacteria | 1977 |
| 853 | Ga0495640_0005042 | 3300046533 | Bacteria | 10490 |
| 854 | Ga0495640_0010221 | 3300046533 | Bacteria | 7262 |
| 855 | Ga0495640_0058007 | 3300046533 | Bacteria | 2641 |
| 856 | Ga0495586_0002128 | 3300046535 | Bacteria | 10768 |
| 857 | Ga0495587_0003095 | 3300046536 | Bacteria | 11115 |
| 858 | Ga0495587_0009385 | 3300046536 | Bacteria | 6272 |
| 859 | Ga0495587_0058871 | 3300046536 | Bacteria | 2256 |
| 860 | Ga0495587_0085920 | 3300046536 | Bacteria | 1821 |
| 861 | Ga0495645_0003434 | 3300046543 | Bacteria | 10742 |
| 862 | Ga0495645_0010106 | 3300046543 | Bacteria | 6612 |
| 863 | Ga0495645_0020403 | 3300046543 | Bacteria | 4779 |
| 864 | Ga0495645_0223701 | 3300046543 | Bacteria | 1264 |
| 865 | Ga0495622_0012355 | 3300046557 | Bacteria | 3952 |
| 866 | Ga0495622_0089885 | 3300046557 | Bacteria | 1411 |
| 867 | Ga0495622_0157356 | 3300046557 | Bacteria | 1026 |
| 868 | Ga0495633_0010291 | 3300046558 | Bacteria | 5114 |
| 869 | Ga0495667_0001067 | 3300046559 | Bacteria | 17817 |
| 870 | Ga0495667_0014053 | 3300046559 | Bacteria | 5404 |
| 871 | Ga0495667_0026810 | 3300046559 | Bacteria | 3882 |
| 872 | Ga0495667_0057759 | 3300046559 | Bacteria | 2550 |
| 873 | Ga0495667_0159583 | 3300046559 | Bacteria | 1450 |
| 874 | Ga0495667_0288433 | 3300046559 | Bacteria | 1041 |
| 875 | Ga0495656_0008765 | 3300046615 | Bacteria | 3622 |
| 876 | Ga0495656_0009015 | 3300046615 | Bacteria | 3580 |
| 877 | Ga0495656_0009923 | 3300046615 | Bacteria | 3443 |
| 878 | Ga0495668_0188077 | 3300046616 | Bacteria | 1131 |
| 879 | Ga0495634_0006047 | 3300046642 | Bacteria | 9235 |
| 880 | Ga0495634_0010688 | 3300046642 | Bacteria | 6719 |
| 881 | Ga0495634_0051910 | 3300046642 | Bacteria | 2750 |
| 882 | Ga0495611_0167764 | 3300046648 | Bacteria | 1026 |
| 883 | Ga0495635_0000394 | 3300046663 | Bacteria | 27871 |
| 884 | Ga0495635_0005384 | 3300046663 | Bacteria | 8903 |
| 885 | Ga0495635_0019246 | 3300046663 | Bacteria | 4761 |
| 886 | Ga0495635_0021691 | 3300046663 | Bacteria | 4476 |
| 887 | Ga0495635_0145178 | 3300046663 | Bacteria | 1615 |
| 888 | Ga0495635_0186123 | 3300046663 | Bacteria | 1410 |
| 889 | Ga0495635_0373986 | 3300046663 | Bacteria | 949 |
| 890 | Ga0495659_0002989 | 3300046664 | Bacteria | 5423 |
| 891 | Ga0495659_0023278 | 3300046664 | Bacteria | 2104 |
| 892 | Ga0495661_0185327 | 3300046665 | Bacteria | 1100 |
| 893 | Ga0495588_0028556 | 3300046674 | Bacteria | 2792 |
| 894 | Ga0495588_0036562 | 3300046674 | Bacteria | 2492 |
| 895 | Ga0495588_0061784 | 3300046674 | Bacteria | 1941 |
| 896 | Ga0495657_0007463 | 3300046675 | Bacteria | 8451 |
| 897 | Ga0495657_0028576 | 3300046675 | Bacteria | 3920 |
| 898 | Ga0495599_0005526 | 3300046678 | Bacteria | 7574 |
| 899 | Ga0495599_0006759 | 3300046678 | Bacteria | 6927 |
| 900 | Ga0495599_0028649 | 3300046678 | Bacteria | 3489 |
| 901 | Ga0495599_0063227 | 3300046678 | Bacteria | 2312 |
| 902 | Ga0495599_0090628 | 3300046678 | Bacteria | 1908 |
| 903 | Ga0495623_0003882 | 3300046679 | Bacteria | 9855 |
| 904 | Ga0495623_0004291 | 3300046679 | Bacteria | 9385 |
| 905 | Ga0495623_0070510 | 3300046679 | Bacteria | 2177 |
| 906 | Ga0495623_0145164 | 3300046679 | Bacteria | 1408 |
| 907 | Ga0495646_0002070 | 3300046680 | Bacteria | 12167 |
| 908 | Ga0495646_0006456 | 3300046680 | Bacteria | 7438 |
| 909 | Ga0495646_0019315 | 3300046680 | Bacteria | 4315 |
| 910 | Ga0495647_0004254 | 3300046681 | Bacteria | 4637 |
| 911 | Ga0495647_0024504 | 3300046681 | Bacteria | 2196 |
| 912 | Ga0495647_0045315 | 3300046681 | Bacteria | 1689 |
| 913 | Ga0495658_0001175 | 3300046683 | Bacteria | 13809 |
| 914 | Ga0495658_0009413 | 3300046683 | Bacteria | 4869 |
| 915 | Ga0495658_0013122 | 3300046683 | Bacteria | 4215 |
| 916 | Ga0495658_0016699 | 3300046683 | Bacteria | 3780 |
| 917 | Ga0495658_0172940 | 3300046683 | Bacteria | 1337 |
| 918 | Ga0495669_0032935 | 3300046684 | Bacteria | 2280 |
| 919 | Ga0495669_0123140 | 3300046684 | Bacteria | 1217 |
| 920 | Ga0495613_0011644 | 3300046689 | Bacteria | 6538 |
| 921 | Ga0495613_0012697 | 3300046689 | Bacteria | 6263 |
| 922 | Ga0495613_0063318 | 3300046689 | Bacteria | 2706 |
| 923 | Ga0495613_0066265 | 3300046689 | Bacteria | 2638 |
| 924 | Ga0495613_0078961 | 3300046689 | Bacteria | 2393 |
| 925 | Ga0495613_0180415 | 3300046689 | Bacteria | 1495 |
| 926 | Ga0495613_0258265 | 3300046689 | Bacteria | 1214 |
| 927 | Ga0495624_0007769 | 3300046690 | Bacteria | 7525 |
| 928 | Ga0495624_0041258 | 3300046690 | Bacteria | 2952 |
| 929 | Ga0495624_0051645 | 3300046690 | Bacteria | 2600 |
| 930 | Ga0495624_0061672 | 3300046690 | Bacteria | 2348 |
| 931 | Ga0495624_0124212 | 3300046690 | Bacteria | 1584 |
| 932 | Ga0495624_0190636 | 3300046690 | Bacteria | 1247 |
| 933 | Ga0495624_0248670 | 3300046690 | Bacteria | 1075 |
| 934 | Ga0495670_0019898 | 3300046691 | Bacteria | 3307 |
| 935 | Ga0495670_0073632 | 3300046691 | Bacteria | 1731 |
| 936 | Ga0495671_0025916 | 3300046692 | Bacteria | 3044 |
| 937 | Ga0495589_0018433 | 3300046794 | Bacteria | 3578 |
| 938 | Ga0495589_0047695 | 3300046794 | Bacteria | 2122 |
| 939 | Ga0495600_0001574 | 3300046809 | Bacteria | 12692 |
| 940 | Ga0495600_0004625 | 3300046809 | Bacteria | 8248 |
| 941 | Ga0495600_0016416 | 3300046809 | Bacteria | 4698 |
| 942 | Ga0495600_0037714 | 3300046809 | Bacteria | 3143 |
| 943 | Ga0495600_0177978 | 3300046809 | Bacteria | 1371 |
| 944 | Ga0495660_0171133 | 3300046810 | Bacteria | 1058 |
| 945 | Ga0495581_0108430 | 3300047315 | Bacteria | 1614 |
| 946 | Ga0495581_0119535 | 3300047315 | Bacteria | 1533 |
| 947 | Ga0495581_0144521 | 3300047315 | Bacteria | 1388 |
| 948 | Ga0495581_0178038 | 3300047315 | Bacteria | 1243 |
| 949 | Ga0495604_0000150 | 3300047317 | Bacteria | 60582 |
| 950 | Ga0495604_0003694 | 3300047317 | Bacteria | 12194 |
| 951 | Ga0495604_0023789 | 3300047317 | Bacteria | 4889 |
| 952 | Ga0495604_0027799 | 3300047317 | Bacteria | 4498 |
| 953 | Ga0495604_0170528 | 3300047317 | Bacteria | 1531 |
| 954 | Ga0495674_0032084 | 3300047319 | Bacteria | 4767 |
| 955 | Ga0495674_0040455 | 3300047319 | Bacteria | 4169 |
| 956 | Ga0495674_0040811 | 3300047319 | Bacteria | 4148 |
| 957 | Ga0495674_0044803 | 3300047319 | Bacteria | 3931 |
| 958 | Ga0495674_0052198 | 3300047319 | Bacteria | 3599 |
| 959 | Ga0495674_0306325 | 3300047319 | Bacteria | 1297 |
| 960 | Ga0495676_0039309 | 3300047321 | Bacteria | 3919 |
| 961 | Ga0495676_0121478 | 3300047321 | Bacteria | 1899 |
| 962 | Ga0495676_0123925 | 3300047321 | Bacteria | 1875 |
| 963 | Ga0495676_0130925 | 3300047321 | Bacteria | 1811 |
| 964 | Ga0495680_0000699 | 3300047322 | Bacteria | 37651 |
| 965 | Ga0495680_0012767 | 3300047322 | Bacteria | 7367 |
| 966 | Ga0495680_0036916 | 3300047322 | Bacteria | 3918 |
| 967 | Ga0495680_0041150 | 3300047322 | Bacteria | 3675 |
| 968 | Ga0495680_0042507 | 3300047322 | Bacteria | 3605 |
| 969 | Ga0495680_0093890 | 3300047322 | Bacteria | 2245 |
| 970 | Ga0495680_0154834 | 3300047322 | Bacteria | 1668 |
| 971 | Ga0495680_0338998 | 3300047322 | Bacteria | 1049 |
| 972 | Ga0495675_0001338 | 3300047444 | Bacteria | 14916 |
| 973 | Ga0495675_0004135 | 3300047444 | Bacteria | 8786 |
| 974 | Ga0495675_0007130 | 3300047444 | Bacteria | 6878 |
| 975 | Ga0495675_0038177 | 3300047444 | Bacteria | 3058 |
| 976 | Ga0495677_0038474 | 3300047445 | Bacteria | 1748 |
| 977 | Ga0495679_019083 | 3300047446 | Bacteria | 2418 |
| 978 | Ga0495684_0006000 | 3300047471 | Bacteria | 9439 |
| 979 | Ga0495684_0011394 | 3300047471 | Bacteria | 6866 |
| 980 | Ga0495684_0064230 | 3300047471 | Bacteria | 2789 |
| 981 | Ga0495684_0079614 | 3300047471 | Bacteria | 2487 |
| 982 | Ga0495684_0098651 | 3300047471 | Bacteria | 2209 |
| 983 | Ga0495684_0237746 | 3300047471 | Bacteria | 1330 |
| 984 | Ga0495684_0347368 | 3300047471 | Bacteria | 1054 |
| 985 | Ga0495684_0405297 | 3300047471 | Bacteria | 956 |
| 986 | Ga0495593_0007939 | 3300047673 | Bacteria | 6183 |
| 987 | Ga0495593_0009818 | 3300047673 | Bacteria | 5555 |
| 988 | Ga0495593_0018341 | 3300047673 | Bacteria | 3932 |
| 989 | Ga0495593_0019894 | 3300047673 | Bacteria | 3761 |
| 990 | Ga0495593_0024774 | 3300047673 | Bacteria | 3322 |
| 991 | Ga0495593_0164041 | 3300047673 | Bacteria | 1121 |
| 992 | Ga0495602_0002392 | 3300048088 | Bacteria | 19051 |
| 993 | Ga0495602_0007064 | 3300048088 | Bacteria | 11787 |
| 994 | Ga0495602_0014347 | 3300048088 | Bacteria | 8047 |
| 995 | Ga0495602_0018808 | 3300048088 | Bacteria | 6881 |
| 996 | Ga0495602_0128720 | 3300048088 | Bacteria | 2023 |
| 997 | Ga0495614_0016606 | 3300048089 | Bacteria | 3202 |
| 998 | Ga0495626_0048998 | 3300048091 | Bacteria | 1958 |
| 999 | Ga0495626_0173809 | 3300048091 | Bacteria | 897 |
| 1000 | Ga0496100_0004244 | 3300048903 | Bacteria | 7575 |
| 1001 | Ga0496100_0023159 | 3300048903 | Bacteria | 3768 |
| 1002 | Ga0496100_0059421 | 3300048903 | Bacteria | 2512 |
| 1003 | Ga0496100_0396793 | 3300048903 | Bacteria | 1050 |
| 1004 | Ga0496101_0001185 | 3300048904 | Bacteria | 15593 |
| 1005 | Ga0496101_0024670 | 3300048904 | Bacteria | 4164 |
| 1006 | Ga0496101_0040403 | 3300048904 | Bacteria | 3322 |
| 1007 | Ga0496101_0060997 | 3300048904 | Bacteria | 2737 |
| 1008 | Ga0496102_0001427 | 3300048905 | Bacteria | 21201 |
| 1009 | Ga0496102_0018136 | 3300048905 | Bacteria | 6176 |
| 1010 | Ga0496102_0018426 | 3300048905 | Bacteria | 6136 |
| 1011 | Ga0496102_0053452 | 3300048905 | Bacteria | 3681 |
| 1012 | Ga0496102_0087263 | 3300048905 | Bacteria | 2882 |
| 1013 | Ga0496102_0371997 | 3300048905 | Bacteria | 1345 |
| 1014 | Ga0496103_0001145 | 3300048906 | Bacteria | 18320 |
| 1015 | Ga0496103_0001524 | 3300048906 | Bacteria | 15476 |
| 1016 | Ga0496103_0031477 | 3300048906 | Bacteria | 3232 |
| 1017 | Ga0496103_0114348 | 3300048906 | Bacteria | 1716 |
| 1018 | Ga0496103_0153280 | 3300048906 | Bacteria | 1476 |
| 1019 | Ga0496103_0285618 | 3300048906 | Bacteria | 1061 |
| 1020 | Ga0496104_0000800 | 3300048907 | Bacteria | 27054 |
| 1021 | Ga0496104_0004650 | 3300048907 | Bacteria | 11943 |
| 1022 | Ga0496104_0008602 | 3300048907 | Bacteria | 9077 |
| 1023 | Ga0496104_0080146 | 3300048907 | Bacteria | 3113 |
| 1024 | Ga0496104_0267042 | 3300048907 | Bacteria | 1623 |
| 1025 | Ga0496105_0001601 | 3300048908 | Bacteria | 16034 |
| 1026 | Ga0496105_0007169 | 3300048908 | Bacteria | 8604 |
| 1027 | Ga0496105_0043840 | 3300048908 | Bacteria | 3689 |
| 1028 | Ga0496105_0055640 | 3300048908 | Bacteria | 3266 |
| 1029 | Ga0496105_0127762 | 3300048908 | Bacteria | 2095 |
| 1030 | Ga0496105_0131368 | 3300048908 | Bacteria | 2064 |
| 1031 | Ga0496105_0133812 | 3300048908 | Bacteria | 2043 |
| 1032 | Ga0496105_0464510 | 3300048908 | Bacteria | 998 |
| 1033 | Ga0496105_0596551 | 3300048908 | Bacteria | 857 |
| 1034 | Ga0496106_0000644 | 3300048909 | Bacteria | 24997 |
| 1035 | Ga0496106_0001471 | 3300048909 | Bacteria | 17692 |
| 1036 | Ga0496106_0004769 | 3300048909 | Bacteria | 10023 |
| 1037 | Ga0496106_0038434 | 3300048909 | Bacteria | 3581 |
| 1038 | Ga0496106_0074471 | 3300048909 | Bacteria | 2599 |
| 1039 | Ga0496106_0107912 | 3300048909 | Bacteria | 2165 |
| 1040 | Ga0496107_0000844 | 3300048910 | Bacteria | 17921 |
| 1041 | Ga0496107_0003765 | 3300048910 | Bacteria | 10189 |
| 1042 | Ga0496107_0009226 | 3300048910 | Bacteria | 6836 |
| 1043 | Ga0496107_0009798 | 3300048910 | Bacteria | 6645 |
| 1044 | Ga0496107_0057610 | 3300048910 | Bacteria | 2809 |
| 1045 | Ga0496107_0087269 | 3300048910 | Bacteria | 2278 |
| 1046 | Ga0496107_0328215 | 3300048910 | Bacteria | 1138 |
| 1047 | Ga0496108_0002624 | 3300048911 | Bacteria | 14402 |
| 1048 | Ga0496108_0008578 | 3300048911 | Bacteria | 8288 |
| 1049 | Ga0496108_0103900 | 3300048911 | Bacteria | 2424 |
| 1050 | Ga0496108_0255868 | 3300048911 | Bacteria | 1523 |
| 1051 | Ga0496108_0317487 | 3300048911 | Bacteria | 1358 |
| 1052 | Ga0496108_0606640 | 3300048911 | Bacteria | 953 |
| 1053 | Ga0496109_0003011 | 3300048912 | Bacteria | 14061 |
| 1054 | Ga0496109_0003467 | 3300048912 | Bacteria | 13168 |
| 1055 | Ga0496109_0007324 | 3300048912 | Bacteria | 9331 |
| 1056 | Ga0496109_0017542 | 3300048912 | Bacteria | 6275 |
| 1057 | Ga0496109_0040794 | 3300048912 | Bacteria | 4204 |
| 1058 | Ga0496109_0169524 | 3300048912 | Bacteria | 2047 |
| 1059 | Ga0496109_0274510 | 3300048912 | Bacteria | 1588 |
| 1060 | Ga0496110_0002024 | 3300048913 | Bacteria | 15093 |
| 1061 | Ga0496110_0007086 | 3300048913 | Bacteria | 8924 |
| 1062 | Ga0496110_0020732 | 3300048913 | Bacteria | 5550 |
| 1063 | Ga0496110_0148698 | 3300048913 | Bacteria | 2120 |
| 1064 | Ga0496111_0001913 | 3300048914 | Bacteria | 12326 |
| 1065 | Ga0496111_0010288 | 3300048914 | Bacteria | 6267 |
| 1066 | Ga0496111_0028229 | 3300048914 | Bacteria | 3976 |
| 1067 | Ga0496111_0029166 | 3300048914 | Bacteria | 3917 |
| 1068 | Ga0496111_0559644 | 3300048914 | Bacteria | 839 |
| 1069 | Ga0496112_0019149 | 3300048915 | Bacteria | 6454 |
| 1070 | Ga0496112_0230062 | 3300048915 | Bacteria | 1808 |
| 1071 | Ga0496112_0623309 | 3300048915 | Bacteria | 1009 |
| 1072 | Ga0496113_0004226 | 3300048916 | Bacteria | 8786 |
| 1073 | Ga0496113_0007869 | 3300048916 | Bacteria | 6893 |
| 1074 | Ga0496113_0086459 | 3300048916 | Bacteria | 2409 |
| 1075 | Ga0496113_0172048 | 3300048916 | Bacteria | 1715 |
| 1076 | Ga0496113_0446123 | 3300048916 | Bacteria | 1039 |
| 1077 | Ga0496114_0014349 | 3300048917 | Bacteria | 6355 |
| 1078 | Ga0496114_0068992 | 3300048917 | Bacteria | 2968 |
| 1079 | Ga0496114_0089006 | 3300048917 | Bacteria | 2619 |
| 1080 | Ga0496114_0275581 | 3300048917 | Bacteria | 1482 |
| 1081 | Ga0496115_0018826 | 3300048918 | Bacteria | 5309 |
| 1082 | Ga0496115_0061514 | 3300048918 | Bacteria | 3027 |
| 1083 | Ga0496115_0095801 | 3300048918 | Bacteria | 2429 |
| 1084 | Ga0496115_0114500 | 3300048918 | Bacteria | 2216 |
| 1085 | Ga0496115_0196993 | 3300048918 | Bacteria | 1664 |
| 1086 | Ga0496115_0215546 | 3300048918 | Bacteria | 1585 |
| 1087 | Ga0496115_0368967 | 3300048918 | Bacteria | 1169 |
| 1088 | Ga0496125_0196111 | 3300048928 | Bacteria | 1328 |
| 1089 | Ga0501034_0032933 | 3300049571 | Bacteria | 5262 |
| 1090 | Ga0501034_0144463 | 3300049571 | Bacteria | 2357 |
| 1091 | Ga0501036_0591718 | 3300049572 | Bacteria | 921 |
| 1092 | Ga0501039_0196099 | 3300049575 | Bacteria | 1588 |
| 1093 | Ga0501046_0212367 | 3300049580 | Bacteria | 1436 |
| 1094 | Ga0501047_0323981 | 3300049581 | Bacteria | 1380 |
| 1095 | Ga0501047_0453050 | 3300049581 | Bacteria | 1112 |
| 1096 | Ga0501067_0160652 | 3300049583 | Bacteria | 1251 |
| 1097 | Ga0501074_0254866 | 3300049590 | Bacteria | 1248 |
| 1098 | Ga0501075_0046021 | 3300049591 | Bacteria | 3277 |
| 1099 | Ga0501076_0392448 | 3300049592 | Bacteria | 1141 |
| 1100 | Ga0501077_0100807 | 3300049593 | Bacteria | 1830 |
| 1101 | Ga0501079_0023386 | 3300049741 | Bacteria | 4742 |
| 1102 | Ga0501080_0087239 | 3300049742 | Bacteria | 2899 |
| 1103 | Ga0501044_0116295 | 3300049823 | Bacteria | 2680 |
| 1104 | nmdc:mga03683_13694_c1 | 3300050489 | Bacteria | 2989 |
| 1105 | nmdc:mga03n38_195905_c1 | 3300050490 | Bacteria | 1043 |
| 1106 | nmdc:mga0yw44_144524_c1 | 3300050492 | Bacteria | 1548 |
| 1107 | nmdc:mga0yw44_15059_c1 | 3300050492 | Bacteria | 4129 |
| 1108 | nmdc:mga0yw44_1739_c1 | 3300050492 | Bacteria | 8850 |
| 1109 | nmdc:mga0yw44_2945_c1 | 3300050492 | Bacteria | 7413 |
| 1110 | nmdc:mga06z11_109499_c1 | 3300050494 | Bacteria | 1528 |
| 1111 | nmdc:mga06z11_40651_c1 | 3300050494 | Bacteria | 2322 |
| 1112 | nmdc:mga04h51_168816_c1 | 3300050495 | Bacteria | 846 |
| 1113 | nmdc:mga07m45_89651_c1 | 3300050496 | Bacteria | 1398 |
| 1114 | nmdc:mga05p37_215917_c1 | 3300050507 | Bacteria | 2317 |
| 1115 | nmdc:mga05p37_40357_c1 | 3300050507 | Bacteria | 5731 |
| 1116 | nmdc:mga05p37_4809_c1 | 3300050507 | Bacteria | 15796 |
| 1117 | nmdc:mga05p37_5180_c1 | 3300050507 | Bacteria | 15295 |
| 1118 | nmdc:mga05p37_6528_c1 | 3300050507 | Bacteria | 10109 |
| 1119 | nmdc:mga09592_18911_c1 | 3300050508 | Bacteria | 5652 |
| 1120 | nmdc:mga09592_2996_c1 | 3300050508 | Bacteria | 13695 |
| 1121 | nmdc:mga09592_3717_c1 | 3300050508 | Bacteria | 12298 |
| 1122 | nmdc:mga09592_452935_c1 | 3300050508 | Unclassified | 1107 |
| 1123 | nmdc:mga0qj67_3244_c1 | 3300050509 | Bacteria | 11709 |
| 1124 | nmdc:mga0qj67_64256_c1 | 3300050509 | Bacteria | 2919 |
| 1125 | nmdc:mga06r32_4964_c1 | 3300050510 | Bacteria | 11991 |
| 1126 | nmdc:mga06r32_5210_c1 | 3300050510 | Bacteria | 11684 |
| 1127 | nmdc:mga06r32_97073_c1 | 3300050510 | Bacteria | 2887 |
| 1128 | nmdc:mga08y16_111162_c1 | 3300050511 | Bacteria | 2853 |
| 1129 | nmdc:mga08y16_248692_c1 | 3300050511 | Bacteria | 1837 |
| 1130 | nmdc:mga08y16_285699_c1 | 3300050511 | Bacteria | 1701 |
| 1131 | nmdc:mga08y16_346068_c1 | 3300050511 | Bacteria | 1528 |
| 1132 | nmdc:mga08y16_4659_c1 | 3300050511 | Bacteria | 14281 |
| 1133 | nmdc:mga08y16_5147_c1 | 3300050511 | Bacteria | 13664 |
| 1134 | nmdc:mga08y16_74716_c1 | 3300050511 | Bacteria | 3532 |
| 1135 | nmdc:mga08y16_95441_c1 | 3300050511 | Bacteria | 3097 |
| 1136 | nmdc:mga0n895_1698_c1 | 3300050512 | Bacteria | 16639 |
| 1137 | nmdc:mga0n895_26906_c1 | 3300050512 | Bacteria | 5457 |
| 1138 | nmdc:mga0n895_296510_c1 | 3300050512 | Bacteria | 1639 |
| 1139 | nmdc:mga0n895_35962_c1 | 3300050512 | Bacteria | 4779 |
| 1140 | nmdc:mga0n895_397986_c1 | 3300050512 | Bacteria | 1393 |
| 1141 | nmdc:mga0n895_75261_c1 | 3300050512 | Bacteria | 3356 |
| 1142 | nmdc:mga0rr50_140884_c1 | 3300050513 | Bacteria | 1940 |
| 1143 | nmdc:mga0rr50_221166_c1 | 3300050513 | Bacteria | 1564 |
| 1144 | nmdc:mga0rr50_241291_c1 | 3300050513 | Bacteria | 1498 |
| 1145 | nmdc:mga08x19_158662_c1 | 3300050514 | Bacteria | 1535 |
| 1146 | nmdc:mga08x19_32342_c1 | 3300050514 | Bacteria | 3295 |
| 1147 | nmdc:mga0a205_151450_c1 | 3300050515 | Bacteria | 2219 |
| 1148 | nmdc:mga0a205_228243_c1 | 3300050515 | Bacteria | 1746 |
| 1149 | nmdc:mga0a205_377641_c1 | 3300050515 | Bacteria | 1283 |
| 1150 | nmdc:mga0a205_39881_c2 | 3300050515 | Bacteria | 3323 |
| 1151 | nmdc:mga0a205_5270_c1 | 3300050515 | Bacteria | 11646 |
| 1152 | nmdc:mga0a205_81900_c1 | 3300050515 | Bacteria | 3118 |
| 1153 | Ga0495601_0000069 | 3300053077 | Bacteria | 56291 |
| 1154 | Ga0495601_0010394 | 3300053077 | Bacteria | 5537 |
| 1155 | Ga0495601_0012835 | 3300053077 | Bacteria | 5028 |
| 1156 | Ga0495601_0028733 | 3300053077 | Bacteria | 3445 |
| 1157 | Ga0495601_0030043 | 3300053077 | Bacteria | 3373 |
| 1158 | Ga0495601_0031923 | 3300053077 | Bacteria | 3276 |
| 1159 | Ga0495601_0061488 | 3300053077 | Bacteria | 2384 |
| 1160 | Ga0495601_0161288 | 3300053077 | Bacteria | 1465 |
| 1161 | Ga0495601_0277156 | 3300053077 | Bacteria | 1093 |
| 1162 | Ga0495612_0000175 | 3300053078 | Bacteria | 26975 |
| 1163 | Ga0495612_0001538 | 3300053078 | Bacteria | 9512 |
| 1164 | Ga0495612_0003729 | 3300053078 | Bacteria | 6330 |
| 1165 | Ga0495612_0013349 | 3300053078 | Bacteria | 3309 |
| 1166 | Ga0495612_0021353 | 3300053078 | Bacteria | 2597 |
| 1167 | Ga0495612_0048575 | 3300053078 | Bacteria | 1740 |
| 1168 | Ga0495612_0055743 | 3300053078 | Bacteria | 1630 |
| 1169 | Ga0495655_0017879 | 3300053083 | Bacteria | 1550 |
| 1170 | Ga0495595_0000221 | 3300053084 | Bacteria | 22745 |
| 1171 | Ga0495595_0002192 | 3300053084 | Bacteria | 7589 |
| 1172 | Ga0495595_0004944 | 3300053084 | Bacteria | 5373 |
| 1173 | Ga0495595_0010549 | 3300053084 | Bacteria | 3842 |
| 1174 | Ga0495595_0019399 | 3300053084 | Bacteria | 2949 |
| 1175 | Ga0495595_0022642 | 3300053084 | Bacteria | 2760 |
| 1176 | Ga0495595_0049289 | 3300053084 | Bacteria | 1947 |
| 1177 | Ga0495595_0063523 | 3300053084 | Bacteria | 1733 |
| 1178 | Ga0495619_0000510 | 3300053085 | Bacteria | 25902 |
| 1179 | Ga0495619_0000546 | 3300053085 | Bacteria | 24865 |
| 1180 | Ga0495619_0001997 | 3300053085 | Bacteria | 13578 |
| 1181 | Ga0495619_0005933 | 3300053085 | Bacteria | 7737 |
| 1182 | Ga0495619_0018617 | 3300053085 | Bacteria | 4407 |
| 1183 | Ga0495619_0023782 | 3300053085 | Bacteria | 3927 |
| 1184 | Ga0495619_0030190 | 3300053085 | Bacteria | 3508 |
| 1185 | Ga0495619_0031858 | 3300053085 | Bacteria | 3417 |
| 1186 | Ga0495619_0033469 | 3300053085 | Bacteria | 3338 |
| 1187 | Ga0495619_0054034 | 3300053085 | Bacteria | 2657 |
| 1188 | Ga0495619_0059368 | 3300053085 | Bacteria | 2541 |
| 1189 | Ga0495619_0157535 | 3300053085 | Bacteria | 1567 |
| 1190 | Ga0495619_0177313 | 3300053085 | Bacteria | 1474 |
| 1191 | Ga0495619_0346024 | 3300053085 | Bacteria | 1028 |
| 1192 | Ga0500566_0136844 | 3300053094 | Bacteria | 1304 |
| 1193 | Ga0500593_035004 | 3300053117 | Bacteria | 2248 |
| 1194 | Ga0500616_0012330 | 3300053153 | Bacteria | 5004 |
| 1195 | Ga0500657_101060 | 3300053728 | Bacteria | 1190 |
| 1196 | Ga0501082_0068379 | 3300060353 | Bacteria | 3058 |
| 1197 | Ga0501082_0153093 | 3300060353 | Bacteria | 2003 |
| 1198 | Ga0501082_0665614 | 3300060353 | Bacteria | 911 |
| 1199 | Ga0466962_0024798 | 3300061719 | Bacteria | 2880 |
| 1200 | Ga0530510_0044639 | 3300061734 | Bacteria | 3203 |
| 1201 | Ga0530510_0083639 | 3300061734 | Bacteria | 2324 |
| 1202 | Ga0530510_0336849 | 3300061734 | Bacteria | 1132 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005578 | Ga0068854_100541609 | Ga0068854_1005416092 | 234 |
| 2 | 3300025916 | Ga0207663_10175795 | Ga0207663_101757952 | 236 |
| 3 | 3300046533 | Ga0495640_0010221 | Ga0495640_0010221_5655_6413 | 238 |
| 4 | 3300046642 | Ga0495634_0010688 | Ga0495634_0010688_5508_6266 | 238 |
| 5 | 3300028800 | Ga0265338_10391317 | Ga0265338_103913171 | 239 |
| 6 | 3300031241 | Ga0265325_10000043 | Ga0265325_1000004380 | 241 |
| 7 | 3300046514 | Ga0495618_0426580 | Ga0495618_0426580_60_785 | 241 |
| 8 | 3300000044 | ARSoilOldRDRAFT_c000297 | ARSoilOldRDRAFT_0002973 | 242 |
| 9 | 3300005439 | Ga0070711_100062480 | Ga0070711_1000624801 | 242 |
| 10 | 3300005616 | Ga0068852_100288873 | Ga0068852_1002888732 | 242 |
| 11 | 3300009094 | Ga0111539_10004508 | Ga0111539_100045085 | 242 |
| 12 | 3300025910 | Ga0207684_10408408 | Ga0207684_104084081 | 242 |
| 13 | 3300025940 | Ga0207691_10155691 | Ga0207691_101556912 | 242 |
| 14 | 3300027252 | Ga0209973_1011826 | Ga0209973_10118262 | 242 |
| 15 | 3300009101 | Ga0105247_10339098 | Ga0105247_103390982 | 244 |
| 16 | 3300010375 | Ga0105239_10801476 | Ga0105239_108014761 | 244 |
| 17 | 3300013296 | Ga0157374_10140876 | Ga0157374_101408762 | 244 |
| 18 | 3300048928 | Ga0496125_0196111 | Ga0496125_0196111_23_757 | 244 |
| 19 | 3300009147 | Ga0114129_10011980 | Ga0114129_100119802 | 248 |
| 20 | 3300009147 | Ga0114129_10080507 | Ga0114129_100805074 | 248 |
| 21 | 3300035084 | Ga0373928_0002060 | Ga0373928_0002060_2460_3206 | 248 |
| 22 | 3300035089 | Ga0373944_0005831 | Ga0373944_0005831_1985_2731 | 248 |
| 23 | 3300035695 | Ga0373927_0018783 | Ga0373927_0018783_3011_3757 | 248 |
| 24 | 3300035725 | Ga0373947_0005699 | Ga0373947_0005699_3759_4505 | 248 |
| 25 | 3300046455 | Ga0495603_0007025 | Ga0495603_0007025_2304_3050 | 248 |
| 26 | 3300046459 | Ga0495629_0002009 | Ga0495629_0002009_11104_11850 | 248 |
| 27 | 3300046461 | Ga0495641_0027895 | Ga0495641_0027895_440_1186 | 248 |
| 28 | 3300046499 | Ga0495594_0139585 | Ga0495594_0139585_221_967 | 248 |
| 29 | 3300046683 | Ga0495658_0001175 | Ga0495658_0001175_4449_5195 | 248 |
| 30 | 3300046684 | Ga0495669_0032935 | Ga0495669_0032935_771_1559 | 248 |
| 31 | 3300047315 | Ga0495581_0108430 | Ga0495581_0108430_693_1439 | 248 |
| 32 | 3300047321 | Ga0495676_0130925 | Ga0495676_0130925_692_1438 | 248 |
| 33 | 3300047322 | Ga0495680_0042507 | Ga0495680_0042507_1189_1935 | 248 |
| 34 | 3300047471 | Ga0495684_0237746 | Ga0495684_0237746_298_1044 | 248 |
| 35 | 3300049583 | Ga0501067_0160652 | Ga0501067_0160652_12_758 | 248 |
| 36 | 3300050507 | nmdc:mga05p37_4809_c1 | nmdc:mga05p37_4809_c1_14354_15100 | 248 |
| 37 | 3300050507 | nmdc:mga05p37_6528_c1 | nmdc:mga05p37_6528_c1_3998_4744 | 248 |
| 38 | 3300050508 | nmdc:mga09592_2996_c1 | nmdc:mga09592_2996_c1_12600_13346 | 248 |
| 39 | 3300050508 | nmdc:mga09592_3717_c1 | nmdc:mga09592_3717_c1_11206_11952 | 248 |
| 40 | 3300050509 | nmdc:mga0qj67_3244_c1 | nmdc:mga0qj67_3244_c1_10868_11614 | 248 |
| 41 | 3300050509 | nmdc:mga0qj67_64256_c1 | nmdc:mga0qj67_64256_c1_1335_2081 | 248 |
| 42 | 3300050510 | nmdc:mga06r32_4964_c1 | nmdc:mga06r32_4964_c1_350_1096 | 248 |
| 43 | 3300050510 | nmdc:mga06r32_5210_c1 | nmdc:mga06r32_5210_c1_10592_11338 | 248 |
| 44 | 3300050511 | nmdc:mga08y16_4659_c1 | nmdc:mga08y16_4659_c1_12297_13043 | 248 |
| 45 | 3300050511 | nmdc:mga08y16_5147_c1 | nmdc:mga08y16_5147_c1_318_1064 | 248 |
| 46 | 3300050512 | nmdc:mga0n895_35962_c1 | nmdc:mga0n895_35962_c1_3684_4430 | 248 |
| 47 | 3300050512 | nmdc:mga0n895_75261_c1 | nmdc:mga0n895_75261_c1_172_918 | 248 |
| 48 | 3300050515 | nmdc:mga0a205_81900_c1 | nmdc:mga0a205_81900_c1_283_1029 | 248 |
| 49 | 3300053085 | Ga0495619_0000546 | Ga0495619_0000546_7097_7843 | 248 |
| 50 | 3300005434 | Ga0070709_10242814 | Ga0070709_102428142 | 250 |
| 51 | 3300006028 | Ga0070717_10184932 | Ga0070717_101849322 | 250 |
| 52 | 3300026067 | Ga0207678_10246758 | Ga0207678_102467581 | 250 |
| 53 | 3300035089 | Ga0373944_0038845 | Ga0373944_0038845_664_1416 | 250 |
| 54 | 3300035111 | Ga0373923_0012826 | Ga0373923_0012826_811_1563 | 250 |
| 55 | 3300035117 | Ga0373953_0003117 | Ga0373953_0003117_3433_4185 | 250 |
| 56 | 3300035118 | Ga0373954_0006503 | Ga0373954_0006503_1899_2651 | 250 |
| 57 | 3300035119 | Ga0373956_0001924 | Ga0373956_0001924_1230_1982 | 250 |
| 58 | 3300035172 | Ga0373955_0007053 | Ga0373955_0007053_4359_5111 | 250 |
| 59 | 3300035410 | Ga0373924_0020722 | Ga0373924_0020722_384_1136 | 250 |
| 60 | 3300035695 | Ga0373927_0007289 | Ga0373927_0007289_3798_4550 | 250 |
| 61 | 3300035724 | Ga0373933_0002515 | Ga0373933_0002515_7191_7943 | 250 |
| 62 | 3300036401 | Ga0373937_0001146 | Ga0373937_0001146_17740_18492 | 250 |
| 63 | 3300037068 | Ga0373925_0402600 | Ga0373925_0402600_114_866 | 250 |
| 64 | 3300039447 | Ga0436361_0057894 | Ga0436361_0057894_290_1042 | 250 |
| 65 | 3300046454 | Ga0495592_0008218 | Ga0495592_0008218_2446_3198 | 250 |
| 66 | 3300046459 | Ga0495629_0010732 | Ga0495629_0010732_3177_3929 | 250 |
| 67 | 3300046462 | Ga0495651_0003394 | Ga0495651_0003394_7290_8042 | 250 |
| 68 | 3300046463 | Ga0495653_0012696 | Ga0495653_0012696_3198_3950 | 250 |
| 69 | 3300046473 | Ga0495582_0078514 | Ga0495582_0078514_699_1451 | 250 |
| 70 | 3300046477 | Ga0495664_0042324 | Ga0495664_0042324_428_1180 | 250 |
| 71 | 3300046511 | Ga0495608_0002249 | Ga0495608_0002249_5170_5922 | 250 |
| 72 | 3300046514 | Ga0495618_0001172 | Ga0495618_0001172_4777_5529 | 250 |
| 73 | 3300046516 | Ga0495628_0036636 | Ga0495628_0036636_672_1424 | 250 |
| 74 | 3300046517 | Ga0495630_0062990 | Ga0495630_0062990_1729_2481 | 250 |
| 75 | 3300046529 | Ga0495652_0028155 | Ga0495652_0028155_2195_2947 | 250 |
| 76 | 3300046533 | Ga0495640_0005042 | Ga0495640_0005042_4883_5635 | 250 |
| 77 | 3300046536 | Ga0495587_0009385 | Ga0495587_0009385_3099_3851 | 250 |
| 78 | 3300046543 | Ga0495645_0223701 | Ga0495645_0223701_86_838 | 250 |
| 79 | 3300046559 | Ga0495667_0014053 | Ga0495667_0014053_1522_2274 | 250 |
| 80 | 3300046642 | Ga0495634_0006047 | Ga0495634_0006047_5941_6693 | 250 |
| 81 | 3300046663 | Ga0495635_0005384 | Ga0495635_0005384_7202_7954 | 250 |
| 82 | 3300046678 | Ga0495599_0005526 | Ga0495599_0005526_2787_3539 | 250 |
| 83 | 3300046679 | Ga0495623_0003882 | Ga0495623_0003882_5236_5988 | 250 |
| 84 | 3300046680 | Ga0495646_0019315 | Ga0495646_0019315_2872_3624 | 250 |
| 85 | 3300046689 | Ga0495613_0063318 | Ga0495613_0063318_1317_2069 | 250 |
| 86 | 3300046690 | Ga0495624_0190636 | Ga0495624_0190636_88_840 | 250 |
| 87 | 3300046809 | Ga0495600_0001574 | Ga0495600_0001574_6164_6916 | 250 |
| 88 | 3300047317 | Ga0495604_0000150 | Ga0495604_0000150_50041_50793 | 250 |
| 89 | 3300047319 | Ga0495674_0040455 | Ga0495674_0040455_2080_2832 | 250 |
| 90 | 3300047322 | Ga0495680_0000699 | Ga0495680_0000699_27972_28724 | 250 |
| 91 | 3300047444 | Ga0495675_0007130 | Ga0495675_0007130_596_1348 | 250 |
| 92 | 3300047471 | Ga0495684_0011394 | Ga0495684_0011394_3233_3985 | 250 |
| 93 | 3300047673 | Ga0495593_0024774 | Ga0495593_0024774_1088_1840 | 250 |
| 94 | 3300048088 | Ga0495602_0018808 | Ga0495602_0018808_3024_3776 | 250 |
| 95 | 3300053077 | Ga0495601_0010394 | Ga0495601_0010394_459_1211 | 250 |
| 96 | 3300053078 | Ga0495612_0003729 | Ga0495612_0003729_4708_5460 | 250 |
| 97 | 3300053084 | Ga0495595_0000221 | Ga0495595_0000221_17999_18751 | 250 |
| 98 | 3300053085 | Ga0495619_0001997 | Ga0495619_0001997_8595_9347 | 250 |
| 99 | 3300037466 | Ga0395898_0129220 | Ga0395898_0129220_1346_2137 | 251 |
| 100 | 3300038443 | Ga0395901_0119180 | Ga0395901_0119180_135_926 | 251 |
| 101 | 3300046462 | Ga0495651_0054410 | Ga0495651_0054410_2122_2877 | 251 |
| 102 | 3300000041 | ARcpr5oldR_c000939 | ARcpr5oldR_0009392 | 252 |
| 103 | 3300000041 | ARcpr5oldR_c006380 | ARcpr5oldR_0063802 | 252 |
| 104 | 3300000043 | ARcpr5yngRDRAFT_c001001 | ARcpr5yngRDRAFT_0010012 | 252 |
| 105 | 3300000652 | ARCol0yngRDRAFT_1000069 | ARCol0yngRDRAFT_100006929 | 252 |
| 106 | 3300001430 | JGI24032J14994_101229 | JGI24032J14994_1012292 | 252 |
| 107 | 3300001976 | JGI24752J21851_1004116 | JGI24752J21851_10041162 | 252 |
| 108 | 3300001977 | JGI24746J21847_1000078 | JGI24746J21847_10000783 | 252 |
| 109 | 3300001978 | JGI24747J21853_1000030 | JGI24747J21853_10000302 | 252 |
| 110 | 3300001989 | JGI24739J22299_10002225 | JGI24739J22299_100022252 | 252 |
| 111 | 3300001990 | JGI24737J22298_10001972 | JGI24737J22298_100019722 | 252 |
| 112 | 3300001990 | JGI24737J22298_10026703 | JGI24737J22298_100267032 | 252 |
| 113 | 3300001991 | JGI24743J22301_10003246 | JGI24743J22301_100032462 | 252 |
| 114 | 3300002070 | JGI24750J21931_1000188 | JGI24750J21931_100018812 | 252 |
| 115 | 3300002070 | JGI24750J21931_1001805 | JGI24750J21931_10018052 | 252 |
| 116 | 3300002073 | JGI24745J21846_1000126 | JGI24745J21846_10001262 | 252 |
| 117 | 3300002074 | JGI24748J21848_1006879 | JGI24748J21848_10068792 | 252 |
| 118 | 3300002074 | JGI24748J21848_1014790 | JGI24748J21848_10147902 | 252 |
| 119 | 3300002075 | JGI24738J21930_10000068 | JGI24738J21930_100000685 | 252 |
| 120 | 3300002075 | JGI24738J21930_10005515 | JGI24738J21930_100055152 | 252 |
| 121 | 3300002076 | JGI24749J21850_1000122 | JGI24749J21850_10001224 | 252 |
| 122 | 3300002077 | JGI24744J21845_10003010 | JGI24744J21845_100030102 | 252 |
| 123 | 3300002077 | JGI24744J21845_10004022 | JGI24744J21845_100040222 | 252 |
| 124 | 3300002126 | JGI24035J26624_1000121 | JGI24035J26624_10001214 | 252 |
| 125 | 3300002155 | JGI24033J26618_1002438 | JGI24033J26618_10024382 | 252 |
| 126 | 3300002239 | JGI24034J26672_10000519 | JGI24034J26672_100005194 | 252 |
| 127 | 3300002239 | JGI24034J26672_10004919 | JGI24034J26672_100049191 | 252 |
| 128 | 3300002244 | JGI24742J22300_10000082 | JGI24742J22300_100000823 | 252 |
| 129 | 3300002244 | JGI24742J22300_10001792 | JGI24742J22300_100017923 | 252 |
| 130 | 3300002459 | JGI24751J29686_10008626 | JGI24751J29686_100086262 | 252 |
| 131 | 3300002459 | JGI24751J29686_10029822 | JGI24751J29686_100298221 | 252 |
| 132 | 3300002459 | JGI24751J29686_10041519 | JGI24751J29686_100415191 | 252 |
| 133 | 3300003911 | JGI25405J52794_10003641 | JGI25405J52794_100036412 | 252 |
| 134 | 3300005290 | Ga0065712_10001352 | Ga0065712_100013525 | 252 |
| 135 | 3300005290 | Ga0065712_10013324 | Ga0065712_100133241 | 252 |
| 136 | 3300005290 | Ga0065712_10104339 | Ga0065712_101043391 | 252 |
| 137 | 3300005293 | Ga0065715_10089172 | Ga0065715_100891723 | 252 |
| 138 | 3300005327 | Ga0070658_10068112 | Ga0070658_100681123 | 252 |
| 139 | 3300005328 | Ga0070676_10000363 | Ga0070676_100003636 | 252 |
| 140 | 3300005329 | Ga0070683_100004718 | Ga0070683_1000047182 | 252 |
| 141 | 3300005329 | Ga0070683_100208384 | Ga0070683_1002083842 | 252 |
| 142 | 3300005330 | Ga0070690_100001828 | Ga0070690_10000182812 | 252 |
| 143 | 3300005330 | Ga0070690_100038771 | Ga0070690_1000387712 | 252 |
| 144 | 3300005330 | Ga0070690_100057719 | Ga0070690_1000577192 | 252 |
| 145 | 3300005331 | Ga0070670_100001134 | Ga0070670_10000113412 | 252 |
| 146 | 3300005331 | Ga0070670_100006490 | Ga0070670_1000064909 | 252 |
| 147 | 3300005331 | Ga0070670_100064312 | Ga0070670_1000643122 | 252 |
| 148 | 3300005331 | Ga0070670_100182814 | Ga0070670_1001828141 | 252 |
| 149 | 3300005333 | Ga0070677_10000301 | Ga0070677_100003016 | 252 |
| 150 | 3300005334 | Ga0068869_100006712 | Ga0068869_1000067122 | 252 |
| 151 | 3300005334 | Ga0068869_100138987 | Ga0068869_1001389872 | 252 |
| 152 | 3300005334 | Ga0068869_100348428 | Ga0068869_1003484282 | 252 |
| 153 | 3300005335 | Ga0070666_10022647 | Ga0070666_100226472 | 252 |
| 154 | 3300005335 | Ga0070666_10032235 | Ga0070666_100322351 | 252 |
| 155 | 3300005335 | Ga0070666_10212724 | Ga0070666_102127242 | 252 |
| 156 | 3300005336 | Ga0070680_100014945 | Ga0070680_1000149452 | 252 |
| 157 | 3300005336 | Ga0070680_100057625 | Ga0070680_1000576252 | 252 |
| 158 | 3300005337 | Ga0070682_100000719 | Ga0070682_10000071911 | 252 |
| 159 | 3300005337 | Ga0070682_100045580 | Ga0070682_1000455801 | 252 |
| 160 | 3300005337 | Ga0070682_100145483 | Ga0070682_1001454832 | 252 |
| 161 | 3300005337 | Ga0070682_100177332 | Ga0070682_1001773322 | 252 |
| 162 | 3300005338 | Ga0068868_100013587 | Ga0068868_1000135872 | 252 |
| 163 | 3300005338 | Ga0068868_100073781 | Ga0068868_1000737811 | 252 |
| 164 | 3300005339 | Ga0070660_100000730 | Ga0070660_10000073014 | 252 |
| 165 | 3300005339 | Ga0070660_100037257 | Ga0070660_1000372578 | 252 |
| 166 | 3300005339 | Ga0070660_100050497 | Ga0070660_1000504973 | 252 |
| 167 | 3300005340 | Ga0070689_100000601 | Ga0070689_10000060114 | 252 |
| 168 | 3300005340 | Ga0070689_100013621 | Ga0070689_1000136213 | 252 |
| 169 | 3300005340 | Ga0070689_100086701 | Ga0070689_1000867011 | 252 |
| 170 | 3300005340 | Ga0070689_100142282 | Ga0070689_1001422821 | 252 |
| 171 | 3300005341 | Ga0070691_10001015 | Ga0070691_100010153 | 252 |
| 172 | 3300005341 | Ga0070691_10171305 | Ga0070691_101713051 | 252 |
| 173 | 3300005343 | Ga0070687_100000253 | Ga0070687_10000025312 | 252 |
| 174 | 3300005343 | Ga0070687_100003704 | Ga0070687_1000037043 | 252 |
| 175 | 3300005344 | Ga0070661_100003564 | Ga0070661_10000356411 | 252 |
| 176 | 3300005345 | Ga0070692_10000060 | Ga0070692_1000006013 | 252 |
| 177 | 3300005347 | Ga0070668_100001851 | Ga0070668_1000018516 | 252 |
| 178 | 3300005347 | Ga0070668_100087704 | Ga0070668_1000877042 | 252 |
| 179 | 3300005353 | Ga0070669_100000888 | Ga0070669_1000008886 | 252 |
| 180 | 3300005353 | Ga0070669_100026939 | Ga0070669_1000269393 | 252 |
| 181 | 3300005353 | Ga0070669_100537628 | Ga0070669_1005376281 | 252 |
| 182 | 3300005354 | Ga0070675_100000441 | Ga0070675_10000044120 | 252 |
| 183 | 3300005354 | Ga0070675_100008895 | Ga0070675_1000088954 | 252 |
| 184 | 3300005355 | Ga0070671_100001180 | Ga0070671_10000118011 | 252 |
| 185 | 3300005355 | Ga0070671_100011505 | Ga0070671_1000115054 | 252 |
| 186 | 3300005355 | Ga0070671_100012122 | Ga0070671_1000121224 | 252 |
| 187 | 3300005356 | Ga0070674_100000723 | Ga0070674_10000072312 | 252 |
| 188 | 3300005356 | Ga0070674_100052446 | Ga0070674_1000524463 | 252 |
| 189 | 3300005364 | Ga0070673_100000456 | Ga0070673_1000004566 | 252 |
| 190 | 3300005365 | Ga0070688_100000483 | Ga0070688_1000004836 | 252 |
| 191 | 3300005365 | Ga0070688_100010309 | Ga0070688_1000103095 | 252 |
| 192 | 3300005365 | Ga0070688_100015266 | Ga0070688_1000152663 | 252 |
| 193 | 3300005366 | Ga0070659_100001763 | Ga0070659_1000017636 | 252 |
| 194 | 3300005366 | Ga0070659_100020482 | Ga0070659_1000204823 | 252 |
| 195 | 3300005366 | Ga0070659_100064724 | Ga0070659_1000647242 | 252 |
| 196 | 3300005366 | Ga0070659_100167244 | Ga0070659_1001672442 | 252 |
| 197 | 3300005367 | Ga0070667_100004366 | Ga0070667_1000043662 | 252 |
| 198 | 3300005367 | Ga0070667_100029031 | Ga0070667_1000290313 | 252 |
| 199 | 3300005367 | Ga0070667_100053332 | Ga0070667_1000533322 | 252 |
| 200 | 3300005367 | Ga0070667_100472184 | Ga0070667_1004721841 | 252 |
| 201 | 3300005406 | Ga0070703_10002031 | Ga0070703_100020314 | 252 |
| 202 | 3300005406 | Ga0070703_10020218 | Ga0070703_100202182 | 252 |
| 203 | 3300005434 | Ga0070709_10007969 | Ga0070709_100079696 | 252 |
| 204 | 3300005435 | Ga0070714_100089770 | Ga0070714_1000897701 | 252 |
| 205 | 3300005435 | Ga0070714_100236796 | Ga0070714_1002367961 | 252 |
| 206 | 3300005435 | Ga0070714_100456706 | Ga0070714_1004567061 | 252 |
| 207 | 3300005436 | Ga0070713_100052199 | Ga0070713_1000521991 | 252 |
| 208 | 3300005436 | Ga0070713_100141795 | Ga0070713_1001417952 | 252 |
| 209 | 3300005436 | Ga0070713_100292797 | Ga0070713_1002927971 | 252 |
| 210 | 3300005436 | Ga0070713_100467309 | Ga0070713_1004673091 | 252 |
| 211 | 3300005436 | Ga0070713_100472116 | Ga0070713_1004721161 | 252 |
| 212 | 3300005436 | Ga0070713_100487380 | Ga0070713_1004873802 | 252 |
| 213 | 3300005437 | Ga0070710_10019850 | Ga0070710_100198503 | 252 |
| 214 | 3300005437 | Ga0070710_10026259 | Ga0070710_100262593 | 252 |
| 215 | 3300005438 | Ga0070701_10000150 | Ga0070701_100001506 | 252 |
| 216 | 3300005438 | Ga0070701_10018237 | Ga0070701_100182372 | 252 |
| 217 | 3300005439 | Ga0070711_100009998 | Ga0070711_1000099985 | 252 |
| 218 | 3300005439 | Ga0070711_100027082 | Ga0070711_1000270823 | 252 |
| 219 | 3300005439 | Ga0070711_100043909 | Ga0070711_1000439092 | 252 |
| 220 | 3300005439 | Ga0070711_100304933 | Ga0070711_1003049331 | 252 |
| 221 | 3300005439 | Ga0070711_100419281 | Ga0070711_1004192811 | 252 |
| 222 | 3300005440 | Ga0070705_100003099 | Ga0070705_1000030994 | 252 |
| 223 | 3300005440 | Ga0070705_100127316 | Ga0070705_1001273161 | 252 |
| 224 | 3300005440 | Ga0070705_100177461 | Ga0070705_1001774612 | 252 |
| 225 | 3300005441 | Ga0070700_100001083 | Ga0070700_1000010833 | 252 |
| 226 | 3300005441 | Ga0070700_100035299 | Ga0070700_1000352992 | 252 |
| 227 | 3300005444 | Ga0070694_100001678 | Ga0070694_1000016782 | 252 |
| 228 | 3300005445 | Ga0070708_100013928 | Ga0070708_1000139282 | 252 |
| 229 | 3300005455 | Ga0070663_100001801 | Ga0070663_1000018019 | 252 |
| 230 | 3300005455 | Ga0070663_100108736 | Ga0070663_1001087362 | 252 |
| 231 | 3300005456 | Ga0070678_100000199 | Ga0070678_10000019919 | 252 |
| 232 | 3300005456 | Ga0070678_100031746 | Ga0070678_1000317462 | 252 |
| 233 | 3300005456 | Ga0070678_100048354 | Ga0070678_1000483542 | 252 |
| 234 | 3300005456 | Ga0070678_100075457 | Ga0070678_1000754572 | 252 |
| 235 | 3300005457 | Ga0070662_100016138 | Ga0070662_1000161382 | 252 |
| 236 | 3300005457 | Ga0070662_100030935 | Ga0070662_1000309352 | 252 |
| 237 | 3300005457 | Ga0070662_100102736 | Ga0070662_1001027362 | 252 |
| 238 | 3300005458 | Ga0070681_10001398 | Ga0070681_1000139812 | 252 |
| 239 | 3300005458 | Ga0070681_10061363 | Ga0070681_100613632 | 252 |
| 240 | 3300005459 | Ga0068867_100001623 | Ga0068867_10000162310 | 252 |
| 241 | 3300005459 | Ga0068867_100021030 | Ga0068867_1000210303 | 252 |
| 242 | 3300005459 | Ga0068867_100160027 | Ga0068867_1001600272 | 252 |
| 243 | 3300005466 | Ga0070685_10000782 | Ga0070685_100007826 | 252 |
| 244 | 3300005466 | Ga0070685_10001511 | Ga0070685_100015119 | 252 |
| 245 | 3300005466 | Ga0070685_10045926 | Ga0070685_100459263 | 252 |
| 246 | 3300005467 | Ga0070706_100458705 | Ga0070706_1004587051 | 252 |
| 247 | 3300005468 | Ga0070707_100200688 | Ga0070707_1002006882 | 252 |
| 248 | 3300005471 | Ga0070698_100720832 | Ga0070698_1007208321 | 252 |
| 249 | 3300005518 | Ga0070699_100216835 | Ga0070699_1002168352 | 252 |
| 250 | 3300005530 | Ga0070679_100213260 | Ga0070679_1002132602 | 252 |
| 251 | 3300005535 | Ga0070684_100001802 | Ga0070684_1000018026 | 252 |
| 252 | 3300005535 | Ga0070684_100060250 | Ga0070684_1000602502 | 252 |
| 253 | 3300005535 | Ga0070684_100137558 | Ga0070684_1001375581 | 252 |
| 254 | 3300005535 | Ga0070684_100212866 | Ga0070684_1002128662 | 252 |
| 255 | 3300005539 | Ga0068853_100002281 | Ga0068853_1000022814 | 252 |
| 256 | 3300005543 | Ga0070672_100001622 | Ga0070672_1000016225 | 252 |
| 257 | 3300005543 | Ga0070672_100060325 | Ga0070672_1000603253 | 252 |
| 258 | 3300005544 | Ga0070686_100000746 | Ga0070686_1000007466 | 252 |
| 259 | 3300005544 | Ga0070686_100004148 | Ga0070686_1000041486 | 252 |
| 260 | 3300005544 | Ga0070686_100061519 | Ga0070686_1000615192 | 252 |
| 261 | 3300005544 | Ga0070686_100378590 | Ga0070686_1003785901 | 252 |
| 262 | 3300005545 | Ga0070695_100000553 | Ga0070695_10000055311 | 252 |
| 263 | 3300005546 | Ga0070696_100001299 | Ga0070696_1000012995 | 252 |
| 264 | 3300005546 | Ga0070696_100030835 | Ga0070696_1000308353 | 252 |
| 265 | 3300005547 | Ga0070693_100000613 | Ga0070693_1000006135 | 252 |
| 266 | 3300005547 | Ga0070693_100038637 | Ga0070693_1000386373 | 252 |
| 267 | 3300005547 | Ga0070693_100041191 | Ga0070693_1000411912 | 252 |
| 268 | 3300005547 | Ga0070693_100096173 | Ga0070693_1000961732 | 252 |
| 269 | 3300005548 | Ga0070665_100373235 | Ga0070665_1003732352 | 252 |
| 270 | 3300005549 | Ga0070704_100000423 | Ga0070704_1000004236 | 252 |
| 271 | 3300005549 | Ga0070704_100095947 | Ga0070704_1000959471 | 252 |
| 272 | 3300005549 | Ga0070704_100136880 | Ga0070704_1001368802 | 252 |
| 273 | 3300005549 | Ga0070704_100199897 | Ga0070704_1001998972 | 252 |
| 274 | 3300005549 | Ga0070704_100335192 | Ga0070704_1003351922 | 252 |
| 275 | 3300005563 | Ga0068855_100004415 | Ga0068855_1000044155 | 252 |
| 276 | 3300005563 | Ga0068855_100245922 | Ga0068855_1002459222 | 252 |
| 277 | 3300005563 | Ga0068855_100412421 | Ga0068855_1004124212 | 252 |
| 278 | 3300005563 | Ga0068855_100605940 | Ga0068855_1006059401 | 252 |
| 279 | 3300005564 | Ga0070664_100001312 | Ga0070664_10000131210 | 252 |
| 280 | 3300005564 | Ga0070664_100024128 | Ga0070664_1000241284 | 252 |
| 281 | 3300005577 | Ga0068857_100007906 | Ga0068857_1000079065 | 252 |
| 282 | 3300005577 | Ga0068857_100144242 | Ga0068857_1001442421 | 252 |
| 283 | 3300005577 | Ga0068857_100244687 | Ga0068857_1002446872 | 252 |
| 284 | 3300005578 | Ga0068854_100000827 | Ga0068854_1000008278 | 252 |
| 285 | 3300005578 | Ga0068854_100044204 | Ga0068854_1000442043 | 252 |
| 286 | 3300005614 | Ga0068856_100001340 | Ga0068856_10000134017 | 252 |
| 287 | 3300005614 | Ga0068856_100024759 | Ga0068856_1000247592 | 252 |
| 288 | 3300005614 | Ga0068856_100085111 | Ga0068856_1000851112 | 252 |
| 289 | 3300005614 | Ga0068856_100523899 | Ga0068856_1005238992 | 252 |
| 290 | 3300005615 | Ga0070702_100001213 | Ga0070702_1000012133 | 252 |
| 291 | 3300005615 | Ga0070702_100021853 | Ga0070702_1000218532 | 252 |
| 292 | 3300005615 | Ga0070702_100029869 | Ga0070702_1000298692 | 252 |
| 293 | 3300005615 | Ga0070702_100255369 | Ga0070702_1002553692 | 252 |
| 294 | 3300005616 | Ga0068852_100007064 | Ga0068852_1000070644 | 252 |
| 295 | 3300005616 | Ga0068852_100039827 | Ga0068852_1000398273 | 252 |
| 296 | 3300005617 | Ga0068859_100001767 | Ga0068859_10000176713 | 252 |
| 297 | 3300005617 | Ga0068859_100009332 | Ga0068859_1000093325 | 252 |
| 298 | 3300005617 | Ga0068859_100284133 | Ga0068859_1002841332 | 252 |
| 299 | 3300005618 | Ga0068864_100003544 | Ga0068864_1000035443 | 252 |
| 300 | 3300005618 | Ga0068864_100052324 | Ga0068864_1000523242 | 252 |
| 301 | 3300005718 | Ga0068866_10000372 | Ga0068866_1000037211 | 252 |
| 302 | 3300005718 | Ga0068866_10045509 | Ga0068866_100455091 | 252 |
| 303 | 3300005718 | Ga0068866_10055926 | Ga0068866_100559262 | 252 |
| 304 | 3300005719 | Ga0068861_100001202 | Ga0068861_1000012025 | 252 |
| 305 | 3300005840 | Ga0068870_10000207 | Ga0068870_1000020711 | 252 |
| 306 | 3300005840 | Ga0068870_10093149 | Ga0068870_100931492 | 252 |
| 307 | 3300005841 | Ga0068863_100003062 | Ga0068863_1000030625 | 252 |
| 308 | 3300005841 | Ga0068863_100103435 | Ga0068863_1001034353 | 252 |
| 309 | 3300005842 | Ga0068858_100009856 | Ga0068858_1000098563 | 252 |
| 310 | 3300005843 | Ga0068860_100007079 | Ga0068860_1000070794 | 252 |
| 311 | 3300005843 | Ga0068860_100027232 | Ga0068860_1000272323 | 252 |
| 312 | 3300005844 | Ga0068862_100002236 | Ga0068862_10000223611 | 252 |
| 313 | 3300005844 | Ga0068862_100015217 | Ga0068862_1000152173 | 252 |
| 314 | 3300005937 | Ga0081455_10005862 | Ga0081455_100058621 | 252 |
| 315 | 3300005937 | Ga0081455_10006016 | Ga0081455_100060164 | 252 |
| 316 | 3300005937 | Ga0081455_10006534 | Ga0081455_100065347 | 252 |
| 317 | 3300005937 | Ga0081455_10010698 | Ga0081455_100106984 | 252 |
| 318 | 3300005937 | Ga0081455_10012847 | Ga0081455_100128478 | 252 |
| 319 | 3300005937 | Ga0081455_10061621 | Ga0081455_100616212 | 252 |
| 320 | 3300005937 | Ga0081455_10167172 | Ga0081455_101671722 | 252 |
| 321 | 3300005981 | Ga0081538_10013962 | Ga0081538_100139625 | 252 |
| 322 | 3300005981 | Ga0081538_10024573 | Ga0081538_100245734 | 252 |
| 323 | 3300005981 | Ga0081538_10030004 | Ga0081538_100300044 | 252 |
| 324 | 3300005981 | Ga0081538_10077823 | Ga0081538_100778232 | 252 |
| 325 | 3300005983 | Ga0081540_1027376 | Ga0081540_10273763 | 252 |
| 326 | 3300005983 | Ga0081540_1133036 | Ga0081540_11330362 | 252 |
| 327 | 3300006028 | Ga0070717_10047085 | Ga0070717_100470853 | 252 |
| 328 | 3300006028 | Ga0070717_10358002 | Ga0070717_103580022 | 252 |
| 329 | 3300006038 | Ga0075365_10001784 | Ga0075365_100017844 | 252 |
| 330 | 3300006038 | Ga0075365_10017017 | Ga0075365_100170174 | 252 |
| 331 | 3300006038 | Ga0075365_10037350 | Ga0075365_100373503 | 252 |
| 332 | 3300006038 | Ga0075365_10259840 | Ga0075365_102598402 | 252 |
| 333 | 3300006048 | Ga0075363_100192963 | Ga0075363_1001929631 | 252 |
| 334 | 3300006051 | Ga0075364_10058565 | Ga0075364_100585652 | 252 |
| 335 | 3300006058 | Ga0075432_10013777 | Ga0075432_100137772 | 252 |
| 336 | 3300006163 | Ga0070715_10099465 | Ga0070715_100994652 | 252 |
| 337 | 3300006163 | Ga0070715_10199282 | Ga0070715_101992822 | 252 |
| 338 | 3300006163 | Ga0070715_10320153 | Ga0070715_103201531 | 252 |
| 339 | 3300006173 | Ga0070716_100043247 | Ga0070716_1000432472 | 252 |
| 340 | 3300006173 | Ga0070716_100121396 | Ga0070716_1001213962 | 252 |
| 341 | 3300006175 | Ga0070712_100007234 | Ga0070712_1000072346 | 252 |
| 342 | 3300006175 | Ga0070712_100113727 | Ga0070712_1001137273 | 252 |
| 343 | 3300006178 | Ga0075367_10021834 | Ga0075367_100218342 | 252 |
| 344 | 3300006178 | Ga0075367_10105375 | Ga0075367_101053753 | 252 |
| 345 | 3300006178 | Ga0075367_10243277 | Ga0075367_102432772 | 252 |
| 346 | 3300006237 | Ga0097621_100002408 | Ga0097621_1000024085 | 252 |
| 347 | 3300006353 | Ga0075370_10144277 | Ga0075370_101442772 | 252 |
| 348 | 3300006358 | Ga0068871_100002267 | Ga0068871_1000022675 | 252 |
| 349 | 3300006358 | Ga0068871_100034059 | Ga0068871_1000340595 | 252 |
| 350 | 3300006844 | Ga0075428_100234280 | Ga0075428_1002342802 | 252 |
| 351 | 3300006844 | Ga0075428_100340154 | Ga0075428_1003401541 | 252 |
| 352 | 3300006844 | Ga0075428_100789534 | Ga0075428_1007895342 | 252 |
| 353 | 3300006846 | Ga0075430_100013448 | Ga0075430_1000134485 | 252 |
| 354 | 3300006846 | Ga0075430_100078649 | Ga0075430_1000786492 | 252 |
| 355 | 3300006846 | Ga0075430_100342962 | Ga0075430_1003429621 | 252 |
| 356 | 3300006847 | Ga0075431_100005769 | Ga0075431_1000057695 | 252 |
| 357 | 3300006847 | Ga0075431_100023620 | Ga0075431_1000236205 | 252 |
| 358 | 3300006847 | Ga0075431_100113391 | Ga0075431_1001133912 | 252 |
| 359 | 3300006847 | Ga0075431_100131562 | Ga0075431_1001315622 | 252 |
| 360 | 3300006852 | Ga0075433_10039549 | Ga0075433_100395494 | 252 |
| 361 | 3300006852 | Ga0075433_10082850 | Ga0075433_100828502 | 252 |
| 362 | 3300006852 | Ga0075433_10146797 | Ga0075433_101467972 | 252 |
| 363 | 3300006852 | Ga0075433_10232618 | Ga0075433_102326182 | 252 |
| 364 | 3300006852 | Ga0075433_10411442 | Ga0075433_104114422 | 252 |
| 365 | 3300006871 | Ga0075434_100007264 | Ga0075434_1000072642 | 252 |
| 366 | 3300006871 | Ga0075434_100016025 | Ga0075434_1000160252 | 252 |
| 367 | 3300006871 | Ga0075434_100029369 | Ga0075434_1000293693 | 252 |
| 368 | 3300006871 | Ga0075434_100044598 | Ga0075434_1000445982 | 252 |
| 369 | 3300006871 | Ga0075434_100104976 | Ga0075434_1001049762 | 252 |
| 370 | 3300006880 | Ga0075429_100011165 | Ga0075429_1000111652 | 252 |
| 371 | 3300006880 | Ga0075429_100069547 | Ga0075429_1000695472 | 252 |
| 372 | 3300006880 | Ga0075429_100069699 | Ga0075429_1000696992 | 252 |
| 373 | 3300006880 | Ga0075429_100370584 | Ga0075429_1003705842 | 252 |
| 374 | 3300006881 | Ga0068865_100000537 | Ga0068865_1000005376 | 252 |
| 375 | 3300006881 | Ga0068865_100010539 | Ga0068865_1000105393 | 252 |
| 376 | 3300006914 | Ga0075436_100023694 | Ga0075436_1000236942 | 252 |
| 377 | 3300006914 | Ga0075436_100123650 | Ga0075436_1001236501 | 252 |
| 378 | 3300006931 | Ga0097620_100001767 | Ga0097620_10000176713 | 252 |
| 379 | 3300006931 | Ga0097620_100009332 | Ga0097620_1000093325 | 252 |
| 380 | 3300006931 | Ga0097620_100284125 | Ga0097620_1002841252 | 252 |
| 381 | 3300007076 | Ga0075435_100014461 | Ga0075435_1000144613 | 252 |
| 382 | 3300007076 | Ga0075435_100165067 | Ga0075435_1001650672 | 252 |
| 383 | 3300009011 | Ga0105251_10037885 | Ga0105251_100378853 | 252 |
| 384 | 3300009036 | Ga0105244_10052114 | Ga0105244_100521142 | 252 |
| 385 | 3300009093 | Ga0105240_10089436 | Ga0105240_100894362 | 252 |
| 386 | 3300009093 | Ga0105240_10605519 | Ga0105240_106055192 | 252 |
| 387 | 3300009094 | Ga0111539_10008569 | Ga0111539_100085697 | 252 |
| 388 | 3300009094 | Ga0111539_10048979 | Ga0111539_100489792 | 252 |
| 389 | 3300009094 | Ga0111539_10061855 | Ga0111539_100618553 | 252 |
| 390 | 3300009094 | Ga0111539_10244902 | Ga0111539_102449022 | 252 |
| 391 | 3300009094 | Ga0111539_10256588 | Ga0111539_102565882 | 252 |
| 392 | 3300009094 | Ga0111539_10543210 | Ga0111539_105432102 | 252 |
| 393 | 3300009098 | Ga0105245_10000888 | Ga0105245_1000088822 | 252 |
| 394 | 3300009098 | Ga0105245_10021572 | Ga0105245_100215723 | 252 |
| 395 | 3300009101 | Ga0105247_10001292 | Ga0105247_100012929 | 252 |
| 396 | 3300009101 | Ga0105247_10086321 | Ga0105247_100863212 | 252 |
| 397 | 3300009101 | Ga0105247_10406313 | Ga0105247_104063131 | 252 |
| 398 | 3300009147 | Ga0114129_10003043 | Ga0114129_1000304310 | 252 |
| 399 | 3300009147 | Ga0114129_10006042 | Ga0114129_100060426 | 252 |
| 400 | 3300009147 | Ga0114129_10037803 | Ga0114129_100378033 | 252 |
| 401 | 3300009147 | Ga0114129_10064901 | Ga0114129_100649015 | 252 |
| 402 | 3300009148 | Ga0105243_10004521 | Ga0105243_100045215 | 252 |
| 403 | 3300009148 | Ga0105243_10072224 | Ga0105243_100722242 | 252 |
| 404 | 3300009148 | Ga0105243_10110850 | Ga0105243_101108501 | 252 |
| 405 | 3300009148 | Ga0105243_10302157 | Ga0105243_103021572 | 252 |
| 406 | 3300009148 | Ga0105243_10364696 | Ga0105243_103646961 | 252 |
| 407 | 3300009174 | Ga0105241_10000662 | Ga0105241_1000066221 | 252 |
| 408 | 3300009174 | Ga0105241_10062168 | Ga0105241_100621681 | 252 |
| 409 | 3300009176 | Ga0105242_10001202 | Ga0105242_100012026 | 252 |
| 410 | 3300009176 | Ga0105242_10033477 | Ga0105242_100334772 | 252 |
| 411 | 3300009177 | Ga0105248_10002336 | Ga0105248_100023366 | 252 |
| 412 | 3300009177 | Ga0105248_10040793 | Ga0105248_100407933 | 252 |
| 413 | 3300009177 | Ga0105248_10061774 | Ga0105248_100617743 | 252 |
| 414 | 3300009177 | Ga0105248_10420636 | Ga0105248_104206362 | 252 |
| 415 | 3300009545 | Ga0105237_10020331 | Ga0105237_100203317 | 252 |
| 416 | 3300009545 | Ga0105237_10086525 | Ga0105237_100865252 | 252 |
| 417 | 3300009545 | Ga0105237_10230003 | Ga0105237_102300032 | 252 |
| 418 | 3300009551 | Ga0105238_10131783 | Ga0105238_101317832 | 252 |
| 419 | 3300009551 | Ga0105238_10143856 | Ga0105238_101438562 | 252 |
| 420 | 3300009553 | Ga0105249_10001808 | Ga0105249_100018086 | 252 |
| 421 | 3300009553 | Ga0105249_10195476 | Ga0105249_101954762 | 252 |
| 422 | 3300009553 | Ga0105249_10243964 | Ga0105249_102439642 | 252 |
| 423 | 3300010375 | Ga0105239_10018370 | Ga0105239_100183708 | 252 |
| 424 | 3300010375 | Ga0105239_10060609 | Ga0105239_100606093 | 252 |
| 425 | 3300010375 | Ga0105239_10103533 | Ga0105239_101035333 | 252 |
| 426 | 3300010375 | Ga0105239_10260680 | Ga0105239_102606801 | 252 |
| 427 | 3300010375 | Ga0105239_10541513 | Ga0105239_105415132 | 252 |
| 428 | 3300011119 | Ga0105246_10689388 | Ga0105246_106893881 | 252 |
| 429 | 3300012492 | Ga0157335_1006657 | Ga0157335_10066571 | 252 |
| 430 | 3300012507 | Ga0157342_1000478 | Ga0157342_10004782 | 252 |
| 431 | 3300013100 | Ga0157373_10006024 | Ga0157373_100060242 | 252 |
| 432 | 3300013100 | Ga0157373_10198989 | Ga0157373_101989892 | 252 |
| 433 | 3300013102 | Ga0157371_10027329 | Ga0157371_100273293 | 252 |
| 434 | 3300013102 | Ga0157371_10165951 | Ga0157371_101659512 | 252 |
| 435 | 3300013104 | Ga0157370_10470781 | Ga0157370_104707812 | 252 |
| 436 | 3300013105 | Ga0157369_10535210 | Ga0157369_105352102 | 252 |
| 437 | 3300013296 | Ga0157374_10002267 | Ga0157374_100022676 | 252 |
| 438 | 3300013296 | Ga0157374_10053178 | Ga0157374_100531783 | 252 |
| 439 | 3300013297 | Ga0157378_10003851 | Ga0157378_100038512 | 252 |
| 440 | 3300013297 | Ga0157378_10023127 | Ga0157378_100231273 | 252 |
| 441 | 3300013297 | Ga0157378_10243787 | Ga0157378_102437872 | 252 |
| 442 | 3300013306 | Ga0163162_10009182 | Ga0163162_100091823 | 252 |
| 443 | 3300013306 | Ga0163162_10015064 | Ga0163162_100150649 | 252 |
| 444 | 3300013307 | Ga0157372_10011471 | Ga0157372_100114715 | 252 |
| 445 | 3300013307 | Ga0157372_10088626 | Ga0157372_100886262 | 252 |
| 446 | 3300013307 | Ga0157372_10172507 | Ga0157372_101725072 | 252 |
| 447 | 3300013307 | Ga0157372_10487716 | Ga0157372_104877162 | 252 |
| 448 | 3300013307 | Ga0157372_11105963 | Ga0157372_111059632 | 252 |
| 449 | 3300013308 | Ga0157375_10001031 | Ga0157375_100010316 | 252 |
| 450 | 3300013308 | Ga0157375_10012658 | Ga0157375_100126582 | 252 |
| 451 | 3300013308 | Ga0157375_10473737 | Ga0157375_104737371 | 252 |
| 452 | 3300014325 | Ga0163163_10003323 | Ga0163163_1000332311 | 252 |
| 453 | 3300014325 | Ga0163163_10026839 | Ga0163163_100268392 | 252 |
| 454 | 3300014325 | Ga0163163_10038122 | Ga0163163_100381224 | 252 |
| 455 | 3300014325 | Ga0163163_10139060 | Ga0163163_101390602 | 252 |
| 456 | 3300014325 | Ga0163163_10779657 | Ga0163163_107796571 | 252 |
| 457 | 3300014325 | Ga0163163_11079087 | Ga0163163_110790871 | 252 |
| 458 | 3300014326 | Ga0157380_10000726 | Ga0157380_1000072611 | 252 |
| 459 | 3300014326 | Ga0157380_10012046 | Ga0157380_100120463 | 252 |
| 460 | 3300014745 | Ga0157377_10000324 | Ga0157377_1000032412 | 252 |
| 461 | 3300014745 | Ga0157377_10009317 | Ga0157377_100093172 | 252 |
| 462 | 3300014968 | Ga0157379_10001193 | Ga0157379_1000119311 | 252 |
| 463 | 3300014968 | Ga0157379_10013061 | Ga0157379_100130612 | 252 |
| 464 | 3300014968 | Ga0157379_10027074 | Ga0157379_100270743 | 252 |
| 465 | 3300014968 | Ga0157379_10375791 | Ga0157379_103757912 | 252 |
| 466 | 3300014968 | Ga0157379_10446829 | Ga0157379_104468291 | 252 |
| 467 | 3300014969 | Ga0157376_10003383 | Ga0157376_100033835 | 252 |
| 468 | 3300014969 | Ga0157376_10036675 | Ga0157376_100366751 | 252 |
| 469 | 3300014969 | Ga0157376_10066060 | Ga0157376_100660601 | 252 |
| 470 | 3300017792 | Ga0163161_10001040 | Ga0163161_100010406 | 252 |
| 471 | 3300017792 | Ga0163161_10077137 | Ga0163161_100771372 | 252 |
| 472 | 3300017792 | Ga0163161_10194105 | Ga0163161_101941052 | 252 |
| 473 | 3300025271 | Ga0207666_1000034 | Ga0207666_10000346 | 252 |
| 474 | 3300025290 | Ga0207673_1000073 | Ga0207673_10000735 | 252 |
| 475 | 3300025315 | Ga0207697_10000280 | Ga0207697_100002806 | 252 |
| 476 | 3300025321 | Ga0207656_10122431 | Ga0207656_101224312 | 252 |
| 477 | 3300025728 | Ga0207655_1054113 | Ga0207655_10541132 | 252 |
| 478 | 3300025885 | Ga0207653_10001427 | Ga0207653_100014272 | 252 |
| 479 | 3300025885 | Ga0207653_10031182 | Ga0207653_100311822 | 252 |
| 480 | 3300025893 | Ga0207682_10000134 | Ga0207682_1000013425 | 252 |
| 481 | 3300025898 | Ga0207692_10113652 | Ga0207692_101136521 | 252 |
| 482 | 3300025898 | Ga0207692_10129449 | Ga0207692_101294492 | 252 |
| 483 | 3300025899 | Ga0207642_10110202 | Ga0207642_101102022 | 252 |
| 484 | 3300025900 | Ga0207710_10001541 | Ga0207710_100015414 | 252 |
| 485 | 3300025900 | Ga0207710_10080676 | Ga0207710_100806762 | 252 |
| 486 | 3300025901 | Ga0207688_10000033 | Ga0207688_1000003331 | 252 |
| 487 | 3300025901 | Ga0207688_10000526 | Ga0207688_1000052611 | 252 |
| 488 | 3300025903 | Ga0207680_10003687 | Ga0207680_100036875 | 252 |
| 489 | 3300025903 | Ga0207680_10011913 | Ga0207680_100119133 | 252 |
| 490 | 3300025903 | Ga0207680_10037146 | Ga0207680_100371462 | 252 |
| 491 | 3300025903 | Ga0207680_10095201 | Ga0207680_100952012 | 252 |
| 492 | 3300025904 | Ga0207647_10003350 | Ga0207647_100033505 | 252 |
| 493 | 3300025904 | Ga0207647_10011872 | Ga0207647_100118722 | 252 |
| 494 | 3300025904 | Ga0207647_10023449 | Ga0207647_100234493 | 252 |
| 495 | 3300025906 | Ga0207699_10024497 | Ga0207699_100244973 | 252 |
| 496 | 3300025906 | Ga0207699_10025852 | Ga0207699_100258522 | 252 |
| 497 | 3300025906 | Ga0207699_10080753 | Ga0207699_100807531 | 252 |
| 498 | 3300025906 | Ga0207699_10238507 | Ga0207699_102385072 | 252 |
| 499 | 3300025906 | Ga0207699_10387889 | Ga0207699_103878891 | 252 |
| 500 | 3300025907 | Ga0207645_10001617 | Ga0207645_100016176 | 252 |
| 501 | 3300025907 | Ga0207645_10114448 | Ga0207645_101144482 | 252 |
| 502 | 3300025908 | Ga0207643_10000756 | Ga0207643_100007566 | 252 |
| 503 | 3300025908 | Ga0207643_10004718 | Ga0207643_100047185 | 252 |
| 504 | 3300025909 | Ga0207705_10270689 | Ga0207705_102706892 | 252 |
| 505 | 3300025910 | Ga0207684_10193478 | Ga0207684_101934781 | 252 |
| 506 | 3300025911 | Ga0207654_10004513 | Ga0207654_100045134 | 252 |
| 507 | 3300025912 | Ga0207707_10002112 | Ga0207707_100021126 | 252 |
| 508 | 3300025912 | Ga0207707_10390291 | Ga0207707_103902912 | 252 |
| 509 | 3300025913 | Ga0207695_10063206 | Ga0207695_100632062 | 252 |
| 510 | 3300025914 | Ga0207671_10088716 | Ga0207671_100887162 | 252 |
| 511 | 3300025914 | Ga0207671_10218462 | Ga0207671_102184622 | 252 |
| 512 | 3300025915 | Ga0207693_10009432 | Ga0207693_100094324 | 252 |
| 513 | 3300025915 | Ga0207693_10027020 | Ga0207693_100270203 | 252 |
| 514 | 3300025915 | Ga0207693_10039890 | Ga0207693_100398902 | 252 |
| 515 | 3300025915 | Ga0207693_10100762 | Ga0207693_101007622 | 252 |
| 516 | 3300025915 | Ga0207693_10111817 | Ga0207693_101118172 | 252 |
| 517 | 3300025915 | Ga0207693_10126504 | Ga0207693_101265042 | 252 |
| 518 | 3300025915 | Ga0207693_10458870 | Ga0207693_104588702 | 252 |
| 519 | 3300025916 | Ga0207663_10034861 | Ga0207663_100348612 | 252 |
| 520 | 3300025916 | Ga0207663_10183236 | Ga0207663_101832361 | 252 |
| 521 | 3300025917 | Ga0207660_10001335 | Ga0207660_1000133511 | 252 |
| 522 | 3300025917 | Ga0207660_10129815 | Ga0207660_101298152 | 252 |
| 523 | 3300025917 | Ga0207660_10294683 | Ga0207660_102946832 | 252 |
| 524 | 3300025917 | Ga0207660_10311272 | Ga0207660_103112722 | 252 |
| 525 | 3300025918 | Ga0207662_10000341 | Ga0207662_1000034111 | 252 |
| 526 | 3300025918 | Ga0207662_10003898 | Ga0207662_100038985 | 252 |
| 527 | 3300025918 | Ga0207662_10007966 | Ga0207662_100079661 | 252 |
| 528 | 3300025919 | Ga0207657_10002888 | Ga0207657_100028889 | 252 |
| 529 | 3300025919 | Ga0207657_10022947 | Ga0207657_100229475 | 252 |
| 530 | 3300025919 | Ga0207657_10054672 | Ga0207657_100546722 | 252 |
| 531 | 3300025919 | Ga0207657_10055265 | Ga0207657_100552654 | 252 |
| 532 | 3300025919 | Ga0207657_10147877 | Ga0207657_101478772 | 252 |
| 533 | 3300025919 | Ga0207657_10397641 | Ga0207657_103976411 | 252 |
| 534 | 3300025920 | Ga0207649_10000271 | Ga0207649_100002716 | 252 |
| 535 | 3300025921 | Ga0207652_10001830 | Ga0207652_100018306 | 252 |
| 536 | 3300025921 | Ga0207652_10210529 | Ga0207652_102105292 | 252 |
| 537 | 3300025923 | Ga0207681_10000658 | Ga0207681_100006586 | 252 |
| 538 | 3300025923 | Ga0207681_10052178 | Ga0207681_100521782 | 252 |
| 539 | 3300025923 | Ga0207681_10114924 | Ga0207681_101149242 | 252 |
| 540 | 3300025924 | Ga0207694_10077300 | Ga0207694_100773002 | 252 |
| 541 | 3300025924 | Ga0207694_10112188 | Ga0207694_101121881 | 252 |
| 542 | 3300025924 | Ga0207694_10137781 | Ga0207694_101377812 | 252 |
| 543 | 3300025925 | Ga0207650_10002267 | Ga0207650_100022676 | 252 |
| 544 | 3300025925 | Ga0207650_10006007 | Ga0207650_100060076 | 252 |
| 545 | 3300025925 | Ga0207650_10041801 | Ga0207650_100418012 | 252 |
| 546 | 3300025925 | Ga0207650_10146997 | Ga0207650_101469972 | 252 |
| 547 | 3300025926 | Ga0207659_10000177 | Ga0207659_1000017718 | 252 |
| 548 | 3300025926 | Ga0207659_10349933 | Ga0207659_103499331 | 252 |
| 549 | 3300025927 | Ga0207687_10000495 | Ga0207687_100004956 | 252 |
| 550 | 3300025927 | Ga0207687_10006623 | Ga0207687_100066231 | 252 |
| 551 | 3300025927 | Ga0207687_10029641 | Ga0207687_100296413 | 252 |
| 552 | 3300025928 | Ga0207700_10114017 | Ga0207700_101140172 | 252 |
| 553 | 3300025928 | Ga0207700_10141346 | Ga0207700_101413462 | 252 |
| 554 | 3300025928 | Ga0207700_10188564 | Ga0207700_101885642 | 252 |
| 555 | 3300025928 | Ga0207700_10253591 | Ga0207700_102535912 | 252 |
| 556 | 3300025929 | Ga0207664_10271689 | Ga0207664_102716891 | 252 |
| 557 | 3300025931 | Ga0207644_10000279 | Ga0207644_100002795 | 252 |
| 558 | 3300025931 | Ga0207644_10062434 | Ga0207644_100624342 | 252 |
| 559 | 3300025931 | Ga0207644_10074660 | Ga0207644_100746601 | 252 |
| 560 | 3300025931 | Ga0207644_10523311 | Ga0207644_105233111 | 252 |
| 561 | 3300025932 | Ga0207690_10001557 | Ga0207690_100015576 | 252 |
| 562 | 3300025932 | Ga0207690_10144034 | Ga0207690_101440342 | 252 |
| 563 | 3300025933 | Ga0207706_10003167 | Ga0207706_100031676 | 252 |
| 564 | 3300025933 | Ga0207706_10005939 | Ga0207706_1000593911 | 252 |
| 565 | 3300025933 | Ga0207706_10065929 | Ga0207706_100659292 | 252 |
| 566 | 3300025934 | Ga0207686_10001383 | Ga0207686_1000138310 | 252 |
| 567 | 3300025934 | Ga0207686_10052401 | Ga0207686_100524013 | 252 |
| 568 | 3300025934 | Ga0207686_10300817 | Ga0207686_103008172 | 252 |
| 569 | 3300025935 | Ga0207709_10000952 | Ga0207709_100009526 | 252 |
| 570 | 3300025935 | Ga0207709_10130124 | Ga0207709_101301242 | 252 |
| 571 | 3300025935 | Ga0207709_10189751 | Ga0207709_101897512 | 252 |
| 572 | 3300025936 | Ga0207670_10000491 | Ga0207670_100004916 | 252 |
| 573 | 3300025936 | Ga0207670_10130196 | Ga0207670_101301962 | 252 |
| 574 | 3300025936 | Ga0207670_10325591 | Ga0207670_103255912 | 252 |
| 575 | 3300025937 | Ga0207669_10000649 | Ga0207669_100006495 | 252 |
| 576 | 3300025937 | Ga0207669_10057728 | Ga0207669_100577283 | 252 |
| 577 | 3300025938 | Ga0207704_10001342 | Ga0207704_100013425 | 252 |
| 578 | 3300025938 | Ga0207704_10016141 | Ga0207704_100161413 | 252 |
| 579 | 3300025938 | Ga0207704_10164606 | Ga0207704_101646062 | 252 |
| 580 | 3300025938 | Ga0207704_10221957 | Ga0207704_102219572 | 252 |
| 581 | 3300025939 | Ga0207665_10004210 | Ga0207665_100042105 | 252 |
| 582 | 3300025939 | Ga0207665_10182378 | Ga0207665_101823782 | 252 |
| 583 | 3300025939 | Ga0207665_10204402 | Ga0207665_102044022 | 252 |
| 584 | 3300025940 | Ga0207691_10002815 | Ga0207691_100028155 | 252 |
| 585 | 3300025940 | Ga0207691_10012526 | Ga0207691_100125262 | 252 |
| 586 | 3300025940 | Ga0207691_10207640 | Ga0207691_102076402 | 252 |
| 587 | 3300025941 | Ga0207711_10001570 | Ga0207711_100015706 | 252 |
| 588 | 3300025941 | Ga0207711_10011263 | Ga0207711_100112632 | 252 |
| 589 | 3300025941 | Ga0207711_10016743 | Ga0207711_100167432 | 252 |
| 590 | 3300025941 | Ga0207711_10068152 | Ga0207711_100681523 | 252 |
| 591 | 3300025942 | Ga0207689_10002449 | Ga0207689_100024496 | 252 |
| 592 | 3300025942 | Ga0207689_10003816 | Ga0207689_1000381611 | 252 |
| 593 | 3300025942 | Ga0207689_10131020 | Ga0207689_101310202 | 252 |
| 594 | 3300025944 | Ga0207661_10000642 | Ga0207661_1000064211 | 252 |
| 595 | 3300025944 | Ga0207661_10218373 | Ga0207661_102183732 | 252 |
| 596 | 3300025944 | Ga0207661_10677803 | Ga0207661_106778031 | 252 |
| 597 | 3300025945 | Ga0207679_10000046 | Ga0207679_1000004616 | 252 |
| 598 | 3300025945 | Ga0207679_10044409 | Ga0207679_100444092 | 252 |
| 599 | 3300025949 | Ga0207667_10007962 | Ga0207667_100079623 | 252 |
| 600 | 3300025949 | Ga0207667_10047435 | Ga0207667_100474353 | 252 |
| 601 | 3300025949 | Ga0207667_10226942 | Ga0207667_102269421 | 252 |
| 602 | 3300025960 | Ga0207651_10000214 | Ga0207651_100002146 | 252 |
| 603 | 3300025960 | Ga0207651_10054490 | Ga0207651_100544902 | 252 |
| 604 | 3300025960 | Ga0207651_10085066 | Ga0207651_100850661 | 252 |
| 605 | 3300025961 | Ga0207712_10003297 | Ga0207712_100032972 | 252 |
| 606 | 3300025961 | Ga0207712_10113898 | Ga0207712_101138982 | 252 |
| 607 | 3300025961 | Ga0207712_10165498 | Ga0207712_101654982 | 252 |
| 608 | 3300025961 | Ga0207712_10378142 | Ga0207712_103781423 | 252 |
| 609 | 3300025972 | Ga0207668_10000537 | Ga0207668_100005376 | 252 |
| 610 | 3300025972 | Ga0207668_10045783 | Ga0207668_100457831 | 252 |
| 611 | 3300025972 | Ga0207668_10458514 | Ga0207668_104585142 | 252 |
| 612 | 3300025972 | Ga0207668_10665727 | Ga0207668_106657271 | 252 |
| 613 | 3300025981 | Ga0207640_10000765 | Ga0207640_100007656 | 252 |
| 614 | 3300025981 | Ga0207640_10072606 | Ga0207640_100726063 | 252 |
| 615 | 3300025986 | Ga0207658_10001147 | Ga0207658_1000114712 | 252 |
| 616 | 3300025986 | Ga0207658_10014386 | Ga0207658_100143862 | 252 |
| 617 | 3300026023 | Ga0207677_10003377 | Ga0207677_100033779 | 252 |
| 618 | 3300026023 | Ga0207677_10020914 | Ga0207677_100209142 | 252 |
| 619 | 3300026023 | Ga0207677_10245657 | Ga0207677_102456572 | 252 |
| 620 | 3300026035 | Ga0207703_10000940 | Ga0207703_1000094020 | 252 |
| 621 | 3300026035 | Ga0207703_10021815 | Ga0207703_100218153 | 252 |
| 622 | 3300026041 | Ga0207639_10000852 | Ga0207639_100008526 | 252 |
| 623 | 3300026041 | Ga0207639_10084643 | Ga0207639_100846432 | 252 |
| 624 | 3300026041 | Ga0207639_10300042 | Ga0207639_103000422 | 252 |
| 625 | 3300026067 | Ga0207678_10002525 | Ga0207678_100025256 | 252 |
| 626 | 3300026067 | Ga0207678_10011036 | Ga0207678_100110362 | 252 |
| 627 | 3300026067 | Ga0207678_10014774 | Ga0207678_100147742 | 252 |
| 628 | 3300026067 | Ga0207678_10073591 | Ga0207678_100735912 | 252 |
| 629 | 3300026067 | Ga0207678_10089495 | Ga0207678_100894952 | 252 |
| 630 | 3300026075 | Ga0207708_10000124 | Ga0207708_1000012450 | 252 |
| 631 | 3300026075 | Ga0207708_10001006 | Ga0207708_1000100611 | 252 |
| 632 | 3300026075 | Ga0207708_10005549 | Ga0207708_100055492 | 252 |
| 633 | 3300026078 | Ga0207702_10002642 | Ga0207702_1000264218 | 252 |
| 634 | 3300026078 | Ga0207702_10161024 | Ga0207702_101610241 | 252 |
| 635 | 3300026078 | Ga0207702_10219674 | Ga0207702_102196742 | 252 |
| 636 | 3300026078 | Ga0207702_10304987 | Ga0207702_103049872 | 252 |
| 637 | 3300026078 | Ga0207702_10370211 | Ga0207702_103702111 | 252 |
| 638 | 3300026088 | Ga0207641_10001370 | Ga0207641_100013706 | 252 |
| 639 | 3300026088 | Ga0207641_10294594 | Ga0207641_102945942 | 252 |
| 640 | 3300026089 | Ga0207648_10001663 | Ga0207648_100016636 | 252 |
| 641 | 3300026089 | Ga0207648_10002036 | Ga0207648_100020366 | 252 |
| 642 | 3300026095 | Ga0207676_10004314 | Ga0207676_100043143 | 252 |
| 643 | 3300026095 | Ga0207676_10018460 | Ga0207676_100184604 | 252 |
| 644 | 3300026116 | Ga0207674_10002956 | Ga0207674_100029566 | 252 |
| 645 | 3300026116 | Ga0207674_10184058 | Ga0207674_101840581 | 252 |
| 646 | 3300026116 | Ga0207674_10196229 | Ga0207674_101962292 | 252 |
| 647 | 3300026118 | Ga0207675_100006209 | Ga0207675_10000620911 | 252 |
| 648 | 3300026118 | Ga0207675_100007875 | Ga0207675_1000078753 | 252 |
| 649 | 3300026118 | Ga0207675_100075048 | Ga0207675_1000750482 | 252 |
| 650 | 3300026118 | Ga0207675_100528153 | Ga0207675_1005281531 | 252 |
| 651 | 3300026121 | Ga0207683_10001904 | Ga0207683_100019049 | 252 |
| 652 | 3300026121 | Ga0207683_10009531 | Ga0207683_100095313 | 252 |
| 653 | 3300026121 | Ga0207683_10067251 | Ga0207683_100672513 | 252 |
| 654 | 3300026142 | Ga0207698_10001980 | Ga0207698_100019804 | 252 |
| 655 | 3300026142 | Ga0207698_10003723 | Ga0207698_100037235 | 252 |
| 656 | 3300026142 | Ga0207698_10026412 | Ga0207698_100264122 | 252 |
| 657 | 3300027617 | Ga0210002_1000354 | Ga0210002_10003544 | 252 |
| 658 | 3300027617 | Ga0210002_1014531 | Ga0210002_10145312 | 252 |
| 659 | 3300027682 | Ga0209971_1005583 | Ga0209971_10055832 | 252 |
| 660 | 3300027695 | Ga0209966_1001997 | Ga0209966_10019972 | 252 |
| 661 | 3300027717 | Ga0209998_10001696 | Ga0209998_100016963 | 252 |
| 662 | 3300027717 | Ga0209998_10002995 | Ga0209998_100029952 | 252 |
| 663 | 3300027876 | Ga0209974_10000502 | Ga0209974_100005025 | 252 |
| 664 | 3300027907 | Ga0207428_10002104 | Ga0207428_100021046 | 252 |
| 665 | 3300027907 | Ga0207428_10002830 | Ga0207428_1000283016 | 252 |
| 666 | 3300027907 | Ga0207428_10002977 | Ga0207428_100029777 | 252 |
| 667 | 3300027907 | Ga0207428_10005357 | Ga0207428_100053572 | 252 |
| 668 | 3300027907 | Ga0207428_10070447 | Ga0207428_100704471 | 252 |
| 669 | 3300027907 | Ga0207428_10389055 | Ga0207428_103890551 | 252 |
| 670 | 3300028379 | Ga0268266_10019214 | Ga0268266_100192142 | 252 |
| 671 | 3300028379 | Ga0268266_10042402 | Ga0268266_100424024 | 252 |
| 672 | 3300028380 | Ga0268265_10000817 | Ga0268265_1000081720 | 252 |
| 673 | 3300028380 | Ga0268265_10079471 | Ga0268265_100794713 | 252 |
| 674 | 3300028380 | Ga0268265_10366513 | Ga0268265_103665131 | 252 |
| 675 | 3300028381 | Ga0268264_10001227 | Ga0268264_100012276 | 252 |
| 676 | 3300028381 | Ga0268264_10062211 | Ga0268264_100622113 | 252 |
| 677 | 3300028381 | Ga0268264_10219849 | Ga0268264_102198492 | 252 |
| 678 | 3300028381 | Ga0268264_10262104 | Ga0268264_102621042 | 252 |
| 679 | 3300028556 | Ga0265337_1001372 | Ga0265337_10013727 | 252 |
| 680 | 3300028800 | Ga0265338_10018779 | Ga0265338_100187793 | 252 |
| 681 | 3300028800 | Ga0265338_10020724 | Ga0265338_100207243 | 252 |
| 682 | 3300028800 | Ga0265338_10038967 | Ga0265338_100389674 | 252 |
| 683 | 3300028800 | Ga0265338_10406651 | Ga0265338_104066511 | 252 |
| 684 | 3300031241 | Ga0265325_10002820 | Ga0265325_100028208 | 252 |
| 685 | 3300031241 | Ga0265325_10026685 | Ga0265325_100266852 | 252 |
| 686 | 3300031241 | Ga0265325_10027239 | Ga0265325_100272392 | 252 |
| 687 | 3300031241 | Ga0265325_10038759 | Ga0265325_100387593 | 252 |
| 688 | 3300031247 | Ga0265340_10006632 | Ga0265340_100066325 | 252 |
| 689 | 3300031247 | Ga0265340_10123403 | Ga0265340_101234032 | 252 |
| 690 | 3300031249 | Ga0265339_10000091 | Ga0265339_1000009153 | 252 |
| 691 | 3300031249 | Ga0265339_10031675 | Ga0265339_100316752 | 252 |
| 692 | 3300031344 | Ga0265316_10032664 | Ga0265316_100326642 | 252 |
| 693 | 3300031595 | Ga0265313_10000260 | Ga0265313_1000026027 | 252 |
| 694 | 3300031595 | Ga0265313_10024154 | Ga0265313_100241542 | 252 |
| 695 | 3300031711 | Ga0265314_10006712 | Ga0265314_100067124 | 252 |
| 696 | 3300031711 | Ga0265314_10191643 | Ga0265314_101916432 | 252 |
| 697 | 3300031712 | Ga0265342_10000290 | Ga0265342_1000029056 | 252 |
| 698 | 3300031712 | Ga0265342_10014743 | Ga0265342_100147432 | 252 |
| 699 | 3300034816 | Ga0373930_0000266 | Ga0373930_0000266_1594_2352 | 252 |
| 700 | 3300034816 | Ga0373930_0010805 | Ga0373930_0010805_71_829 | 252 |
| 701 | 3300034817 | Ga0373948_0000471 | Ga0373948_0000471_2812_3570 | 252 |
| 702 | 3300034817 | Ga0373948_0006126 | Ga0373948_0006126_869_1627 | 252 |
| 703 | 3300034818 | Ga0373950_0000324 | Ga0373950_0000324_4277_5035 | 252 |
| 704 | 3300034818 | Ga0373950_0014500 | Ga0373950_0014500_289_1047 | 252 |
| 705 | 3300034819 | Ga0373958_0000451 | Ga0373958_0000451_704_1462 | 252 |
| 706 | 3300034957 | Ga0373938_0000308 | Ga0373938_0000308_5984_6742 | 252 |
| 707 | 3300034957 | Ga0373938_0000348 | Ga0373938_0000348_2081_2839 | 252 |
| 708 | 3300035083 | Ga0373926_0002868 | Ga0373926_0002868_4286_5044 | 252 |
| 709 | 3300035083 | Ga0373926_0008286 | Ga0373926_0008286_1947_2705 | 252 |
| 710 | 3300035083 | Ga0373926_0085199 | Ga0373926_0085199_370_1128 | 252 |
| 711 | 3300035084 | Ga0373928_0001853 | Ga0373928_0001853_2891_3649 | 252 |
| 712 | 3300035086 | Ga0373934_0015266 | Ga0373934_0015266_1090_1848 | 252 |
| 713 | 3300035086 | Ga0373934_0027772 | Ga0373934_0027772_1111_1869 | 252 |
| 714 | 3300035086 | Ga0373934_0068018 | Ga0373934_0068018_340_1098 | 252 |
| 715 | 3300035088 | Ga0373940_0001082 | Ga0373940_0001082_1966_2724 | 252 |
| 716 | 3300035088 | Ga0373940_0003271 | Ga0373940_0003271_1858_2616 | 252 |
| 717 | 3300035088 | Ga0373940_0008910 | Ga0373940_0008910_1370_2128 | 252 |
| 718 | 3300035089 | Ga0373944_0003210 | Ga0373944_0003210_1571_2329 | 252 |
| 719 | 3300035089 | Ga0373944_0031938 | Ga0373944_0031938_416_1174 | 252 |
| 720 | 3300035089 | Ga0373944_0052200 | Ga0373944_0052200_180_956 | 252 |
| 721 | 3300035089 | Ga0373944_0079206 | Ga0373944_0079206_255_1013 | 252 |
| 722 | 3300035090 | Ga0373949_0004203 | Ga0373949_0004203_814_1572 | 252 |
| 723 | 3300035090 | Ga0373949_0034321 | Ga0373949_0034321_43_801 | 252 |
| 724 | 3300035091 | Ga0373951_0001125 | Ga0373951_0001125_3558_4316 | 252 |
| 725 | 3300035092 | Ga0373952_0000133 | Ga0373952_0000133_3994_4752 | 252 |
| 726 | 3300035092 | Ga0373952_0008267 | Ga0373952_0008267_326_1084 | 252 |
| 727 | 3300035092 | Ga0373952_0010301 | Ga0373952_0010301_1002_1760 | 252 |
| 728 | 3300035111 | Ga0373923_0027798 | Ga0373923_0027798_166_924 | 252 |
| 729 | 3300035111 | Ga0373923_0031402 | Ga0373923_0031402_1119_1877 | 252 |
| 730 | 3300035112 | Ga0373932_0001964 | Ga0373932_0001964_3083_3841 | 252 |
| 731 | 3300035113 | Ga0373936_0031194 | Ga0373936_0031194_1082_1840 | 252 |
| 732 | 3300035113 | Ga0373936_0052387 | Ga0373936_0052387_864_1622 | 252 |
| 733 | 3300035114 | Ga0373939_0000343 | Ga0373939_0000343_4000_4758 | 252 |
| 734 | 3300035114 | Ga0373939_0005408 | Ga0373939_0005408_2081_2839 | 252 |
| 735 | 3300035114 | Ga0373939_0033924 | Ga0373939_0033924_194_952 | 252 |
| 736 | 3300035115 | Ga0373941_0001154 | Ga0373941_0001154_2325_3083 | 252 |
| 737 | 3300035116 | Ga0373945_0004512 | Ga0373945_0004512_3265_4023 | 252 |
| 738 | 3300035116 | Ga0373945_0042669 | Ga0373945_0042669_324_1082 | 252 |
| 739 | 3300035117 | Ga0373953_0054496 | Ga0373953_0054496_221_979 | 252 |
| 740 | 3300035117 | Ga0373953_0119651 | Ga0373953_0119651_294_1052 | 252 |
| 741 | 3300035118 | Ga0373954_0086937 | Ga0373954_0086937_226_984 | 252 |
| 742 | 3300035119 | Ga0373956_0009376 | Ga0373956_0009376_2314_3072 | 252 |
| 743 | 3300035119 | Ga0373956_0021669 | Ga0373956_0021669_1614_2372 | 252 |
| 744 | 3300035119 | Ga0373956_0120090 | Ga0373956_0120090_228_986 | 252 |
| 745 | 3300035120 | Ga0373957_0001572 | Ga0373957_0001572_1033_1791 | 252 |
| 746 | 3300035121 | Ga0373960_0002646 | Ga0373960_0002646_1719_2477 | 252 |
| 747 | 3300035121 | Ga0373960_0007249 | Ga0373960_0007249_1129_1887 | 252 |
| 748 | 3300035170 | Ga0373943_0005039 | Ga0373943_0005039_3969_4727 | 252 |
| 749 | 3300035170 | Ga0373943_0007317 | Ga0373943_0007317_519_1277 | 252 |
| 750 | 3300035170 | Ga0373943_0008492 | Ga0373943_0008492_2428_3186 | 252 |
| 751 | 3300035170 | Ga0373943_0034153 | Ga0373943_0034153_448_1206 | 252 |
| 752 | 3300035171 | Ga0373946_0010820 | Ga0373946_0010820_2092_2850 | 252 |
| 753 | 3300035171 | Ga0373946_0072114 | Ga0373946_0072114_342_1100 | 252 |
| 754 | 3300035171 | Ga0373946_0117386 | Ga0373946_0117386_245_1021 | 252 |
| 755 | 3300035172 | Ga0373955_0002275 | Ga0373955_0002275_7463_8221 | 252 |
| 756 | 3300035172 | Ga0373955_0022739 | Ga0373955_0022739_655_1413 | 252 |
| 757 | 3300035172 | Ga0373955_0027293 | Ga0373955_0027293_2149_2907 | 252 |
| 758 | 3300035172 | Ga0373955_0052897 | Ga0373955_0052897_16_774 | 252 |
| 759 | 3300035207 | Ga0373942_0001912 | Ga0373942_0001912_1609_2367 | 252 |
| 760 | 3300035207 | Ga0373942_0005068 | Ga0373942_0005068_705_1463 | 252 |
| 761 | 3300035207 | Ga0373942_0012073 | Ga0373942_0012073_215_973 | 252 |
| 762 | 3300035242 | Ga0373962_0000253 | Ga0373962_0000253_4836_5594 | 252 |
| 763 | 3300035242 | Ga0373962_0013895 | Ga0373962_0013895_71_829 | 252 |
| 764 | 3300035410 | Ga0373924_0005148 | Ga0373924_0005148_2323_3081 | 252 |
| 765 | 3300035691 | Ga0373931_0000714 | Ga0373931_0000714_8552_9310 | 252 |
| 766 | 3300035691 | Ga0373931_0001610 | Ga0373931_0001610_3568_4326 | 252 |
| 767 | 3300035691 | Ga0373931_0025062 | Ga0373931_0025062_676_1434 | 252 |
| 768 | 3300035691 | Ga0373931_0054884 | Ga0373931_0054884_1100_1858 | 252 |
| 769 | 3300035692 | Ga0373935_0004317 | Ga0373935_0004317_6689_7447 | 252 |
| 770 | 3300035692 | Ga0373935_0023439 | Ga0373935_0023439_2593_3351 | 252 |
| 771 | 3300035692 | Ga0373935_0190134 | Ga0373935_0190134_643_1401 | 252 |
| 772 | 3300035692 | Ga0373935_0302081 | Ga0373935_0302081_127_885 | 252 |
| 773 | 3300035695 | Ga0373927_0009357 | Ga0373927_0009357_3633_4391 | 252 |
| 774 | 3300035695 | Ga0373927_0027987 | Ga0373927_0027987_454_1212 | 252 |
| 775 | 3300035695 | Ga0373927_0047576 | Ga0373927_0047576_1563_2321 | 252 |
| 776 | 3300035695 | Ga0373927_0060880 | Ga0373927_0060880_799_1557 | 252 |
| 777 | 3300035695 | Ga0373927_0137079 | Ga0373927_0137079_535_1311 | 252 |
| 778 | 3300035695 | Ga0373927_0263026 | Ga0373927_0263026_260_1018 | 252 |
| 779 | 3300035724 | Ga0373933_0001224 | Ga0373933_0001224_12106_12864 | 252 |
| 780 | 3300035724 | Ga0373933_0005081 | Ga0373933_0005081_6226_6984 | 252 |
| 781 | 3300035724 | Ga0373933_0100261 | Ga0373933_0100261_259_1017 | 252 |
| 782 | 3300035724 | Ga0373933_0189294 | Ga0373933_0189294_137_895 | 252 |
| 783 | 3300035724 | Ga0373933_0196441 | Ga0373933_0196441_217_975 | 252 |
| 784 | 3300035725 | Ga0373947_0002242 | Ga0373947_0002242_8979_9737 | 252 |
| 785 | 3300035725 | Ga0373947_0029617 | Ga0373947_0029617_1020_1778 | 252 |
| 786 | 3300035725 | Ga0373947_0039388 | Ga0373947_0039388_416_1174 | 252 |
| 787 | 3300035725 | Ga0373947_0043254 | Ga0373947_0043254_1351_2109 | 252 |
| 788 | 3300035725 | Ga0373947_0059857 | Ga0373947_0059857_442_1200 | 252 |
| 789 | 3300036401 | Ga0373937_0000975 | Ga0373937_0000975_4683_5441 | 252 |
| 790 | 3300036401 | Ga0373937_0005174 | Ga0373937_0005174_2133_2891 | 252 |
| 791 | 3300036401 | Ga0373937_0008485 | Ga0373937_0008485_102_878 | 252 |
| 792 | 3300036401 | Ga0373937_0052710 | Ga0373937_0052710_1018_1776 | 252 |
| 793 | 3300036401 | Ga0373937_0155073 | Ga0373937_0155073_297_1055 | 252 |
| 794 | 3300036401 | Ga0373937_0313823 | Ga0373937_0313823_640_1398 | 252 |
| 795 | 3300036401 | Ga0373937_0649147 | Ga0373937_0649147_229_987 | 252 |
| 796 | 3300037068 | Ga0373925_0000957 | Ga0373925_0000957_3020_3778 | 252 |
| 797 | 3300037068 | Ga0373925_0009418 | Ga0373925_0009418_3713_4489 | 252 |
| 798 | 3300037068 | Ga0373925_0055962 | Ga0373925_0055962_2130_2888 | 252 |
| 799 | 3300037068 | Ga0373925_0099421 | Ga0373925_0099421_1105_1863 | 252 |
| 800 | 3300037068 | Ga0373925_0168422 | Ga0373925_0168422_529_1287 | 252 |
| 801 | 3300037312 | Ga0395899_0008367 | Ga0395899_0008367_5310_6068 | 252 |
| 802 | 3300037418 | Ga0395900_0005495 | Ga0395900_0005495_7441_8199 | 252 |
| 803 | 3300037418 | Ga0395900_0024104 | Ga0395900_0024104_451_1209 | 252 |
| 804 | 3300037466 | Ga0395898_0007621 | Ga0395898_0007621_1447_2205 | 252 |
| 805 | 3300037466 | Ga0395898_0017809 | Ga0395898_0017809_2130_2888 | 252 |
| 806 | 3300037466 | Ga0395898_0132944 | Ga0395898_0132944_646_1404 | 252 |
| 807 | 3300038443 | Ga0395901_0008887 | Ga0395901_0008887_4819_5577 | 252 |
| 808 | 3300038443 | Ga0395901_0027102 | Ga0395901_0027102_4637_5395 | 252 |
| 809 | 3300038443 | Ga0395901_0174151 | Ga0395901_0174151_627_1385 | 252 |
| 810 | 3300038443 | Ga0395901_0367506 | Ga0395901_0367506_18_776 | 252 |
| 811 | 3300039438 | Ga0436360_1080146 | Ga0436360_1080146_797_1555 | 252 |
| 812 | 3300039447 | Ga0436361_0112922 | Ga0436361_0112922_103_861 | 252 |
| 813 | 3300039447 | Ga0436361_1189806 | Ga0436361_1189806_12105_12944 | 252 |
| 814 | 3300041498 | Ga0451841_1103901 | Ga0451841_1103901_354_1112 | 252 |
| 815 | 3300044684 | Ga0466966_0138105 | Ga0466966_0138105_160_918 | 252 |
| 816 | 3300044694 | Ga0466963_0096029 | Ga0466963_0096029_503_1261 | 252 |
| 817 | 3300044694 | Ga0466963_0112620 | Ga0466963_0112620_567_1325 | 252 |
| 818 | 3300044706 | Ga0466964_0197903 | Ga0466964_0197903_139_897 | 252 |
| 819 | 3300044719 | Ga0466971_0063342 | Ga0466971_0063342_131_907 | 252 |
| 820 | 3300044842 | Ga0466957_0012433 | Ga0466957_0012433_3625_4383 | 252 |
| 821 | 3300045049 | Ga0466959_0021191 | Ga0466959_0021191_625_1383 | 252 |
| 822 | 3300045051 | Ga0451576_0091489 | Ga0451576_0091489_564_1322 | 252 |
| 823 | 3300045836 | Ga0466958_0034909 | Ga0466958_0034909_12_770 | 252 |
| 824 | 3300045976 | Ga0466967_0010562 | Ga0466967_0010562_3455_4213 | 252 |
| 825 | 3300045976 | Ga0466967_0294718 | Ga0466967_0294718_637_1395 | 252 |
| 826 | 3300045976 | Ga0466967_0448740 | Ga0466967_0448740_333_1091 | 252 |
| 827 | 3300046452 | Ga0495617_029664 | Ga0495617_029664_242_1000 | 252 |
| 828 | 3300046454 | Ga0495592_0026610 | Ga0495592_0026610_1494_2252 | 252 |
| 829 | 3300046454 | Ga0495592_0047700 | Ga0495592_0047700_633_1391 | 252 |
| 830 | 3300046454 | Ga0495592_0072135 | Ga0495592_0072135_205_963 | 252 |
| 831 | 3300046454 | Ga0495592_0127285 | Ga0495592_0127285_258_1016 | 252 |
| 832 | 3300046455 | Ga0495603_0069549 | Ga0495603_0069549_839_1597 | 252 |
| 833 | 3300046455 | Ga0495603_0099243 | Ga0495603_0099243_457_1215 | 252 |
| 834 | 3300046455 | Ga0495603_0273942 | Ga0495603_0273942_126_884 | 252 |
| 835 | 3300046459 | Ga0495629_0027195 | Ga0495629_0027195_3097_3855 | 252 |
| 836 | 3300046459 | Ga0495629_0043069 | Ga0495629_0043069_2132_2890 | 252 |
| 837 | 3300046459 | Ga0495629_0350973 | Ga0495629_0350973_89_847 | 252 |
| 838 | 3300046460 | Ga0495638_0034210 | Ga0495638_0034210_1425_2183 | 252 |
| 839 | 3300046461 | Ga0495641_0029573 | Ga0495641_0029573_1634_2392 | 252 |
| 840 | 3300046461 | Ga0495641_0056413 | Ga0495641_0056413_532_1290 | 252 |
| 841 | 3300046461 | Ga0495641_0091423 | Ga0495641_0091423_177_935 | 252 |
| 842 | 3300046462 | Ga0495651_0036961 | Ga0495651_0036961_2112_2870 | 252 |
| 843 | 3300046462 | Ga0495651_0048365 | Ga0495651_0048365_1252_2028 | 252 |
| 844 | 3300046462 | Ga0495651_0063674 | Ga0495651_0063674_423_1181 | 252 |
| 845 | 3300046462 | Ga0495651_0189383 | Ga0495651_0189383_135_893 | 252 |
| 846 | 3300046463 | Ga0495653_0004970 | Ga0495653_0004970_8792_9550 | 252 |
| 847 | 3300046463 | Ga0495653_0010292 | Ga0495653_0010292_601_1359 | 252 |
| 848 | 3300046463 | Ga0495653_0079954 | Ga0495653_0079954_1530_2306 | 252 |
| 849 | 3300046463 | Ga0495653_0233014 | Ga0495653_0233014_453_1211 | 252 |
| 850 | 3300046472 | Ga0495580_0009608 | Ga0495580_0009608_5191_5949 | 252 |
| 851 | 3300046472 | Ga0495580_0053605 | Ga0495580_0053605_747_1505 | 252 |
| 852 | 3300046472 | Ga0495580_0057294 | Ga0495580_0057294_377_1135 | 252 |
| 853 | 3300046473 | Ga0495582_0009496 | Ga0495582_0009496_2303_3061 | 252 |
| 854 | 3300046473 | Ga0495582_0012182 | Ga0495582_0012182_1805_2563 | 252 |
| 855 | 3300046474 | Ga0495605_0082857 | Ga0495605_0082857_671_1429 | 252 |
| 856 | 3300046475 | Ga0495639_0066440 | Ga0495639_0066440_864_1622 | 252 |
| 857 | 3300046475 | Ga0495639_0073431 | Ga0495639_0073431_44_802 | 252 |
| 858 | 3300046476 | Ga0495662_0014265 | Ga0495662_0014265_2980_3738 | 252 |
| 859 | 3300046476 | Ga0495662_0114650 | Ga0495662_0114650_551_1309 | 252 |
| 860 | 3300046477 | Ga0495664_0005349 | Ga0495664_0005349_3778_4536 | 252 |
| 861 | 3300046477 | Ga0495664_0009436 | Ga0495664_0009436_2217_2975 | 252 |
| 862 | 3300046477 | Ga0495664_0024516 | Ga0495664_0024516_1565_2323 | 252 |
| 863 | 3300046491 | Ga0495584_0017374 | Ga0495584_0017374_1828_2586 | 252 |
| 864 | 3300046491 | Ga0495584_0023045 | Ga0495584_0023045_476_1234 | 252 |
| 865 | 3300046491 | Ga0495584_0045524 | Ga0495584_0045524_1245_2003 | 252 |
| 866 | 3300046492 | Ga0495585_0057566 | Ga0495585_0057566_1228_1986 | 252 |
| 867 | 3300046499 | Ga0495594_0024127 | Ga0495594_0024127_1666_2424 | 252 |
| 868 | 3300046499 | Ga0495594_0024998 | Ga0495594_0024998_2205_2963 | 252 |
| 869 | 3300046499 | Ga0495594_0026850 | Ga0495594_0026850_133_891 | 252 |
| 870 | 3300046501 | Ga0495607_0043208 | Ga0495607_0043208_257_1015 | 252 |
| 871 | 3300046501 | Ga0495607_0051344 | Ga0495607_0051344_733_1491 | 252 |
| 872 | 3300046506 | Ga0495583_0106016 | Ga0495583_0106016_16_774 | 252 |
| 873 | 3300046511 | Ga0495608_0004206 | Ga0495608_0004206_8392_9150 | 252 |
| 874 | 3300046511 | Ga0495608_0091167 | Ga0495608_0091167_878_1636 | 252 |
| 875 | 3300046514 | Ga0495618_0001619 | Ga0495618_0001619_10944_11702 | 252 |
| 876 | 3300046514 | Ga0495618_0004363 | Ga0495618_0004363_4602_5360 | 252 |
| 877 | 3300046514 | Ga0495618_0374084 | Ga0495618_0374084_40_816 | 252 |
| 878 | 3300046516 | Ga0495628_0012115 | Ga0495628_0012115_2616_3392 | 252 |
| 879 | 3300046516 | Ga0495628_0015917 | Ga0495628_0015917_560_1318 | 252 |
| 880 | 3300046516 | Ga0495628_0115301 | Ga0495628_0115301_601_1359 | 252 |
| 881 | 3300046517 | Ga0495630_0008146 | Ga0495630_0008146_6374_7132 | 252 |
| 882 | 3300046517 | Ga0495630_0008748 | Ga0495630_0008748_1587_2345 | 252 |
| 883 | 3300046517 | Ga0495630_0124544 | Ga0495630_0124544_952_1710 | 252 |
| 884 | 3300046517 | Ga0495630_0171519 | Ga0495630_0171519_311_1069 | 252 |
| 885 | 3300046517 | Ga0495630_0189414 | Ga0495630_0189414_557_1315 | 252 |
| 886 | 3300046517 | Ga0495630_0413098 | Ga0495630_0413098_239_1015 | 252 |
| 887 | 3300046518 | Ga0495631_0060265 | Ga0495631_0060265_545_1303 | 252 |
| 888 | 3300046520 | Ga0495637_0023416 | Ga0495637_0023416_171_929 | 252 |
| 889 | 3300046523 | Ga0495644_0006450 | Ga0495644_0006450_1774_2532 | 252 |
| 890 | 3300046523 | Ga0495644_0018349 | Ga0495644_0018349_1765_2523 | 252 |
| 891 | 3300046526 | Ga0495666_0008087 | Ga0495666_0008087_1933_2691 | 252 |
| 892 | 3300046526 | Ga0495666_0114582 | Ga0495666_0114582_18_776 | 252 |
| 893 | 3300046529 | Ga0495652_0005206 | Ga0495652_0005206_11420_12196 | 252 |
| 894 | 3300046529 | Ga0495652_0009266 | Ga0495652_0009266_4848_5606 | 252 |
| 895 | 3300046529 | Ga0495652_0024740 | Ga0495652_0024740_2856_3614 | 252 |
| 896 | 3300046529 | Ga0495652_0051485 | Ga0495652_0051485_467_1225 | 252 |
| 897 | 3300046531 | Ga0495665_0030853 | Ga0495665_0030853_1651_2409 | 252 |
| 898 | 3300046531 | Ga0495665_0036404 | Ga0495665_0036404_462_1220 | 252 |
| 899 | 3300046531 | Ga0495665_0061885 | Ga0495665_0061885_726_1484 | 252 |
| 900 | 3300046533 | Ga0495640_0058007 | Ga0495640_0058007_687_1445 | 252 |
| 901 | 3300046535 | Ga0495586_0002128 | Ga0495586_0002128_8105_8863 | 252 |
| 902 | 3300046536 | Ga0495587_0003095 | Ga0495587_0003095_2122_2880 | 252 |
| 903 | 3300046536 | Ga0495587_0058871 | Ga0495587_0058871_538_1296 | 252 |
| 904 | 3300046536 | Ga0495587_0085920 | Ga0495587_0085920_821_1579 | 252 |
| 905 | 3300046543 | Ga0495645_0003434 | Ga0495645_0003434_7218_7976 | 252 |
| 906 | 3300046543 | Ga0495645_0010106 | Ga0495645_0010106_3021_3779 | 252 |
| 907 | 3300046543 | Ga0495645_0020403 | Ga0495645_0020403_1373_2149 | 252 |
| 908 | 3300046557 | Ga0495622_0012355 | Ga0495622_0012355_2476_3234 | 252 |
| 909 | 3300046557 | Ga0495622_0089885 | Ga0495622_0089885_591_1349 | 252 |
| 910 | 3300046557 | Ga0495622_0157356 | Ga0495622_0157356_200_958 | 252 |
| 911 | 3300046558 | Ga0495633_0010291 | Ga0495633_0010291_1990_2748 | 252 |
| 912 | 3300046559 | Ga0495667_0001067 | Ga0495667_0001067_2333_3091 | 252 |
| 913 | 3300046559 | Ga0495667_0026810 | Ga0495667_0026810_868_1626 | 252 |
| 914 | 3300046559 | Ga0495667_0057759 | Ga0495667_0057759_1764_2522 | 252 |
| 915 | 3300046559 | Ga0495667_0159583 | Ga0495667_0159583_456_1214 | 252 |
| 916 | 3300046559 | Ga0495667_0288433 | Ga0495667_0288433_14_772 | 252 |
| 917 | 3300046615 | Ga0495656_0008765 | Ga0495656_0008765_512_1270 | 252 |
| 918 | 3300046615 | Ga0495656_0009015 | Ga0495656_0009015_2214_2972 | 252 |
| 919 | 3300046615 | Ga0495656_0009923 | Ga0495656_0009923_783_1541 | 252 |
| 920 | 3300046616 | Ga0495668_0188077 | Ga0495668_0188077_224_982 | 252 |
| 921 | 3300046642 | Ga0495634_0051910 | Ga0495634_0051910_454_1212 | 252 |
| 922 | 3300046648 | Ga0495611_0167764 | Ga0495611_0167764_180_938 | 252 |
| 923 | 3300046663 | Ga0495635_0000394 | Ga0495635_0000394_22496_23254 | 252 |
| 924 | 3300046663 | Ga0495635_0019246 | Ga0495635_0019246_2048_2806 | 252 |
| 925 | 3300046663 | Ga0495635_0021691 | Ga0495635_0021691_2483_3241 | 252 |
| 926 | 3300046663 | Ga0495635_0145178 | Ga0495635_0145178_64_840 | 252 |
| 927 | 3300046663 | Ga0495635_0186123 | Ga0495635_0186123_396_1154 | 252 |
| 928 | 3300046663 | Ga0495635_0373986 | Ga0495635_0373986_91_849 | 252 |
| 929 | 3300046664 | Ga0495659_0002989 | Ga0495659_0002989_1982_2740 | 252 |
| 930 | 3300046664 | Ga0495659_0023278 | Ga0495659_0023278_1138_1896 | 252 |
| 931 | 3300046665 | Ga0495661_0185327 | Ga0495661_0185327_108_866 | 252 |
| 932 | 3300046674 | Ga0495588_0028556 | Ga0495588_0028556_1238_1996 | 252 |
| 933 | 3300046674 | Ga0495588_0036562 | Ga0495588_0036562_1443_2201 | 252 |
| 934 | 3300046674 | Ga0495588_0061784 | Ga0495588_0061784_894_1652 | 252 |
| 935 | 3300046675 | Ga0495657_0007463 | Ga0495657_0007463_249_1007 | 252 |
| 936 | 3300046675 | Ga0495657_0028576 | Ga0495657_0028576_1200_1976 | 252 |
| 937 | 3300046678 | Ga0495599_0006759 | Ga0495599_0006759_5676_6452 | 252 |
| 938 | 3300046678 | Ga0495599_0028649 | Ga0495599_0028649_1438_2196 | 252 |
| 939 | 3300046678 | Ga0495599_0063227 | Ga0495599_0063227_896_1654 | 252 |
| 940 | 3300046678 | Ga0495599_0090628 | Ga0495599_0090628_735_1493 | 252 |
| 941 | 3300046679 | Ga0495623_0004291 | Ga0495623_0004291_7823_8581 | 252 |
| 942 | 3300046679 | Ga0495623_0070510 | Ga0495623_0070510_227_1003 | 252 |
| 943 | 3300046679 | Ga0495623_0145164 | Ga0495623_0145164_416_1174 | 252 |
| 944 | 3300046680 | Ga0495646_0002070 | Ga0495646_0002070_2105_2863 | 252 |
| 945 | 3300046680 | Ga0495646_0006456 | Ga0495646_0006456_4693_5451 | 252 |
| 946 | 3300046681 | Ga0495647_0004254 | Ga0495647_0004254_1063_1821 | 252 |
| 947 | 3300046681 | Ga0495647_0024504 | Ga0495647_0024504_1025_1783 | 252 |
| 948 | 3300046681 | Ga0495647_0045315 | Ga0495647_0045315_263_1021 | 252 |
| 949 | 3300046683 | Ga0495658_0009413 | Ga0495658_0009413_887_1645 | 252 |
| 950 | 3300046683 | Ga0495658_0013122 | Ga0495658_0013122_2809_3567 | 252 |
| 951 | 3300046683 | Ga0495658_0016699 | Ga0495658_0016699_33_791 | 252 |
| 952 | 3300046683 | Ga0495658_0172940 | Ga0495658_0172940_219_977 | 252 |
| 953 | 3300046684 | Ga0495669_0123140 | Ga0495669_0123140_430_1188 | 252 |
| 954 | 3300046689 | Ga0495613_0011644 | Ga0495613_0011644_2350_3108 | 252 |
| 955 | 3300046689 | Ga0495613_0012697 | Ga0495613_0012697_3507_4265 | 252 |
| 956 | 3300046689 | Ga0495613_0066265 | Ga0495613_0066265_997_1755 | 252 |
| 957 | 3300046689 | Ga0495613_0078961 | Ga0495613_0078961_1552_2310 | 252 |
| 958 | 3300046689 | Ga0495613_0180415 | Ga0495613_0180415_375_1133 | 252 |
| 959 | 3300046689 | Ga0495613_0258265 | Ga0495613_0258265_324_1082 | 252 |
| 960 | 3300046690 | Ga0495624_0007769 | Ga0495624_0007769_6334_7092 | 252 |
| 961 | 3300046690 | Ga0495624_0041258 | Ga0495624_0041258_1638_2396 | 252 |
| 962 | 3300046690 | Ga0495624_0051645 | Ga0495624_0051645_1172_1930 | 252 |
| 963 | 3300046690 | Ga0495624_0061672 | Ga0495624_0061672_947_1705 | 252 |
| 964 | 3300046690 | Ga0495624_0124212 | Ga0495624_0124212_199_957 | 252 |
| 965 | 3300046690 | Ga0495624_0248670 | Ga0495624_0248670_194_952 | 252 |
| 966 | 3300046691 | Ga0495670_0019898 | Ga0495670_0019898_368_1126 | 252 |
| 967 | 3300046691 | Ga0495670_0073632 | Ga0495670_0073632_413_1171 | 252 |
| 968 | 3300046692 | Ga0495671_0025916 | Ga0495671_0025916_1880_2638 | 252 |
| 969 | 3300046794 | Ga0495589_0018433 | Ga0495589_0018433_120_878 | 252 |
| 970 | 3300046794 | Ga0495589_0047695 | Ga0495589_0047695_449_1207 | 252 |
| 971 | 3300046809 | Ga0495600_0004625 | Ga0495600_0004625_5369_6127 | 252 |
| 972 | 3300046809 | Ga0495600_0016416 | Ga0495600_0016416_3013_3771 | 252 |
| 973 | 3300046809 | Ga0495600_0037714 | Ga0495600_0037714_674_1432 | 252 |
| 974 | 3300046809 | Ga0495600_0177978 | Ga0495600_0177978_448_1206 | 252 |
| 975 | 3300046810 | Ga0495660_0171133 | Ga0495660_0171133_65_823 | 252 |
| 976 | 3300047315 | Ga0495581_0119535 | Ga0495581_0119535_513_1271 | 252 |
| 977 | 3300047315 | Ga0495581_0144521 | Ga0495581_0144521_536_1294 | 252 |
| 978 | 3300047315 | Ga0495581_0178038 | Ga0495581_0178038_56_814 | 252 |
| 979 | 3300047317 | Ga0495604_0003694 | Ga0495604_0003694_9304_10062 | 252 |
| 980 | 3300047317 | Ga0495604_0023789 | Ga0495604_0023789_2451_3209 | 252 |
| 981 | 3300047317 | Ga0495604_0027799 | Ga0495604_0027799_1881_2657 | 252 |
| 982 | 3300047317 | Ga0495604_0170528 | Ga0495604_0170528_122_880 | 252 |
| 983 | 3300047319 | Ga0495674_0032084 | Ga0495674_0032084_2117_2875 | 252 |
| 984 | 3300047319 | Ga0495674_0040811 | Ga0495674_0040811_1851_2609 | 252 |
| 985 | 3300047319 | Ga0495674_0044803 | Ga0495674_0044803_13_771 | 252 |
| 986 | 3300047319 | Ga0495674_0052198 | Ga0495674_0052198_1743_2501 | 252 |
| 987 | 3300047319 | Ga0495674_0306325 | Ga0495674_0306325_231_989 | 252 |
| 988 | 3300047321 | Ga0495676_0039309 | Ga0495676_0039309_220_978 | 252 |
| 989 | 3300047321 | Ga0495676_0121478 | Ga0495676_0121478_85_843 | 252 |
| 990 | 3300047321 | Ga0495676_0123925 | Ga0495676_0123925_871_1629 | 252 |
| 991 | 3300047322 | Ga0495680_0012767 | Ga0495680_0012767_3123_3881 | 252 |
| 992 | 3300047322 | Ga0495680_0036916 | Ga0495680_0036916_531_1307 | 252 |
| 993 | 3300047322 | Ga0495680_0041150 | Ga0495680_0041150_928_1686 | 252 |
| 994 | 3300047322 | Ga0495680_0093890 | Ga0495680_0093890_841_1599 | 252 |
| 995 | 3300047322 | Ga0495680_0154834 | Ga0495680_0154834_864_1622 | 252 |
| 996 | 3300047322 | Ga0495680_0338998 | Ga0495680_0338998_276_1034 | 252 |
| 997 | 3300047444 | Ga0495675_0001338 | Ga0495675_0001338_2125_2883 | 252 |
| 998 | 3300047444 | Ga0495675_0004135 | Ga0495675_0004135_6157_6933 | 252 |
| 999 | 3300047444 | Ga0495675_0038177 | Ga0495675_0038177_1813_2571 | 252 |
| 1000 | 3300047445 | Ga0495677_0038474 | Ga0495677_0038474_669_1427 | 252 |
| 1001 | 3300047446 | Ga0495679_019083 | Ga0495679_019083_783_1541 | 252 |
| 1002 | 3300047471 | Ga0495684_0006000 | Ga0495684_0006000_6043_6801 | 252 |
| 1003 | 3300047471 | Ga0495684_0064230 | Ga0495684_0064230_734_1492 | 252 |
| 1004 | 3300047471 | Ga0495684_0079614 | Ga0495684_0079614_1569_2327 | 252 |
| 1005 | 3300047471 | Ga0495684_0098651 | Ga0495684_0098651_588_1346 | 252 |
| 1006 | 3300047471 | Ga0495684_0347368 | Ga0495684_0347368_277_1035 | 252 |
| 1007 | 3300047471 | Ga0495684_0405297 | Ga0495684_0405297_149_907 | 252 |
| 1008 | 3300047673 | Ga0495593_0007939 | Ga0495593_0007939_3631_4389 | 252 |
| 1009 | 3300047673 | Ga0495593_0009818 | Ga0495593_0009818_2184_2942 | 252 |
| 1010 | 3300047673 | Ga0495593_0018341 | Ga0495593_0018341_2737_3495 | 252 |
| 1011 | 3300047673 | Ga0495593_0019894 | Ga0495593_0019894_1509_2267 | 252 |
| 1012 | 3300047673 | Ga0495593_0164041 | Ga0495593_0164041_70_828 | 252 |
| 1013 | 3300048088 | Ga0495602_0002392 | Ga0495602_0002392_16161_16919 | 252 |
| 1014 | 3300048088 | Ga0495602_0007064 | Ga0495602_0007064_2624_3400 | 252 |
| 1015 | 3300048088 | Ga0495602_0014347 | Ga0495602_0014347_7235_7993 | 252 |
| 1016 | 3300048088 | Ga0495602_0128720 | Ga0495602_0128720_497_1255 | 252 |
| 1017 | 3300048089 | Ga0495614_0016606 | Ga0495614_0016606_374_1132 | 252 |
| 1018 | 3300048091 | Ga0495626_0048998 | Ga0495626_0048998_241_999 | 252 |
| 1019 | 3300048091 | Ga0495626_0173809 | Ga0495626_0173809_45_803 | 252 |
| 1020 | 3300048903 | Ga0496100_0004244 | Ga0496100_0004244_329_1087 | 252 |
| 1021 | 3300048903 | Ga0496100_0023159 | Ga0496100_0023159_1998_2756 | 252 |
| 1022 | 3300048903 | Ga0496100_0059421 | Ga0496100_0059421_1338_2096 | 252 |
| 1023 | 3300048903 | Ga0496100_0396793 | Ga0496100_0396793_14_772 | 252 |
| 1024 | 3300048904 | Ga0496101_0001185 | Ga0496101_0001185_11421_12179 | 252 |
| 1025 | 3300048904 | Ga0496101_0024670 | Ga0496101_0024670_1795_2553 | 252 |
| 1026 | 3300048904 | Ga0496101_0040403 | Ga0496101_0040403_358_1116 | 252 |
| 1027 | 3300048904 | Ga0496101_0060997 | Ga0496101_0060997_745_1503 | 252 |
| 1028 | 3300048905 | Ga0496102_0001427 | Ga0496102_0001427_8965_9723 | 252 |
| 1029 | 3300048905 | Ga0496102_0018136 | Ga0496102_0018136_2619_3377 | 252 |
| 1030 | 3300048905 | Ga0496102_0018426 | Ga0496102_0018426_1483_2241 | 252 |
| 1031 | 3300048905 | Ga0496102_0053452 | Ga0496102_0053452_583_1341 | 252 |
| 1032 | 3300048905 | Ga0496102_0087263 | Ga0496102_0087263_989_1747 | 252 |
| 1033 | 3300048905 | Ga0496102_0371997 | Ga0496102_0371997_277_1035 | 252 |
| 1034 | 3300048906 | Ga0496103_0001145 | Ga0496103_0001145_5313_6071 | 252 |
| 1035 | 3300048906 | Ga0496103_0001524 | Ga0496103_0001524_1135_1893 | 252 |
| 1036 | 3300048906 | Ga0496103_0031477 | Ga0496103_0031477_962_1720 | 252 |
| 1037 | 3300048906 | Ga0496103_0114348 | Ga0496103_0114348_927_1685 | 252 |
| 1038 | 3300048906 | Ga0496103_0153280 | Ga0496103_0153280_74_832 | 252 |
| 1039 | 3300048906 | Ga0496103_0285618 | Ga0496103_0285618_269_1027 | 252 |
| 1040 | 3300048907 | Ga0496104_0000800 | Ga0496104_0000800_9947_10723 | 252 |
| 1041 | 3300048907 | Ga0496104_0004650 | Ga0496104_0004650_5013_5771 | 252 |
| 1042 | 3300048907 | Ga0496104_0008602 | Ga0496104_0008602_5592_6350 | 252 |
| 1043 | 3300048907 | Ga0496104_0080146 | Ga0496104_0080146_1758_2516 | 252 |
| 1044 | 3300048907 | Ga0496104_0267042 | Ga0496104_0267042_50_808 | 252 |
| 1045 | 3300048908 | Ga0496105_0001601 | Ga0496105_0001601_1667_2425 | 252 |
| 1046 | 3300048908 | Ga0496105_0007169 | Ga0496105_0007169_7087_7863 | 252 |
| 1047 | 3300048908 | Ga0496105_0043840 | Ga0496105_0043840_2108_2866 | 252 |
| 1048 | 3300048908 | Ga0496105_0055640 | Ga0496105_0055640_1678_2436 | 252 |
| 1049 | 3300048908 | Ga0496105_0127762 | Ga0496105_0127762_665_1423 | 252 |
| 1050 | 3300048908 | Ga0496105_0131368 | Ga0496105_0131368_154_912 | 252 |
| 1051 | 3300048908 | Ga0496105_0133812 | Ga0496105_0133812_794_1552 | 252 |
| 1052 | 3300048908 | Ga0496105_0464510 | Ga0496105_0464510_204_962 | 252 |
| 1053 | 3300048908 | Ga0496105_0596551 | Ga0496105_0596551_75_833 | 252 |
| 1054 | 3300048909 | Ga0496106_0000644 | Ga0496106_0000644_11505_12263 | 252 |
| 1055 | 3300048909 | Ga0496106_0001471 | Ga0496106_0001471_13798_14556 | 252 |
| 1056 | 3300048909 | Ga0496106_0004769 | Ga0496106_0004769_4677_5435 | 252 |
| 1057 | 3300048909 | Ga0496106_0038434 | Ga0496106_0038434_199_957 | 252 |
| 1058 | 3300048909 | Ga0496106_0074471 | Ga0496106_0074471_81_839 | 252 |
| 1059 | 3300048909 | Ga0496106_0107912 | Ga0496106_0107912_564_1322 | 252 |
| 1060 | 3300048910 | Ga0496107_0000844 | Ga0496107_0000844_8875_9633 | 252 |
| 1061 | 3300048910 | Ga0496107_0003765 | Ga0496107_0003765_5568_6326 | 252 |
| 1062 | 3300048910 | Ga0496107_0009226 | Ga0496107_0009226_5899_6657 | 252 |
| 1063 | 3300048910 | Ga0496107_0009798 | Ga0496107_0009798_2062_2820 | 252 |
| 1064 | 3300048910 | Ga0496107_0057610 | Ga0496107_0057610_1197_1955 | 252 |
| 1065 | 3300048910 | Ga0496107_0087269 | Ga0496107_0087269_1004_1762 | 252 |
| 1066 | 3300048910 | Ga0496107_0328215 | Ga0496107_0328215_84_842 | 252 |
| 1067 | 3300048911 | Ga0496108_0002624 | Ga0496108_0002624_6096_6854 | 252 |
| 1068 | 3300048911 | Ga0496108_0008578 | Ga0496108_0008578_2078_2836 | 252 |
| 1069 | 3300048911 | Ga0496108_0103900 | Ga0496108_0103900_200_958 | 252 |
| 1070 | 3300048911 | Ga0496108_0255868 | Ga0496108_0255868_207_965 | 252 |
| 1071 | 3300048911 | Ga0496108_0317487 | Ga0496108_0317487_399_1157 | 252 |
| 1072 | 3300048911 | Ga0496108_0606640 | Ga0496108_0606640_34_792 | 252 |
| 1073 | 3300048912 | Ga0496109_0003011 | Ga0496109_0003011_9581_10339 | 252 |
| 1074 | 3300048912 | Ga0496109_0003467 | Ga0496109_0003467_1227_1985 | 252 |
| 1075 | 3300048912 | Ga0496109_0007324 | Ga0496109_0007324_1176_1934 | 252 |
| 1076 | 3300048912 | Ga0496109_0017542 | Ga0496109_0017542_1050_1808 | 252 |
| 1077 | 3300048912 | Ga0496109_0040794 | Ga0496109_0040794_3122_3880 | 252 |
| 1078 | 3300048912 | Ga0496109_0169524 | Ga0496109_0169524_291_1049 | 252 |
| 1079 | 3300048912 | Ga0496109_0274510 | Ga0496109_0274510_181_939 | 252 |
| 1080 | 3300048913 | Ga0496110_0002024 | Ga0496110_0002024_7355_8113 | 252 |
| 1081 | 3300048913 | Ga0496110_0007086 | Ga0496110_0007086_1565_2323 | 252 |
| 1082 | 3300048913 | Ga0496110_0020732 | Ga0496110_0020732_226_984 | 252 |
| 1083 | 3300048913 | Ga0496110_0148698 | Ga0496110_0148698_726_1484 | 252 |
| 1084 | 3300048914 | Ga0496111_0001913 | Ga0496111_0001913_6625_7383 | 252 |
| 1085 | 3300048914 | Ga0496111_0010288 | Ga0496111_0010288_4157_4915 | 252 |
| 1086 | 3300048914 | Ga0496111_0028229 | Ga0496111_0028229_267_1025 | 252 |
| 1087 | 3300048914 | Ga0496111_0029166 | Ga0496111_0029166_2396_3154 | 252 |
| 1088 | 3300048914 | Ga0496111_0559644 | Ga0496111_0559644_58_816 | 252 |
| 1089 | 3300048915 | Ga0496112_0019149 | Ga0496112_0019149_323_1081 | 252 |
| 1090 | 3300048915 | Ga0496112_0230062 | Ga0496112_0230062_692_1450 | 252 |
| 1091 | 3300048915 | Ga0496112_0623309 | Ga0496112_0623309_45_803 | 252 |
| 1092 | 3300048916 | Ga0496113_0004226 | Ga0496113_0004226_2270_3028 | 252 |
| 1093 | 3300048916 | Ga0496113_0007869 | Ga0496113_0007869_2047_2805 | 252 |
| 1094 | 3300048916 | Ga0496113_0086459 | Ga0496113_0086459_442_1200 | 252 |
| 1095 | 3300048916 | Ga0496113_0172048 | Ga0496113_0172048_60_818 | 252 |
| 1096 | 3300048916 | Ga0496113_0446123 | Ga0496113_0446123_207_965 | 252 |
| 1097 | 3300048917 | Ga0496114_0014349 | Ga0496114_0014349_5204_5962 | 252 |
| 1098 | 3300048917 | Ga0496114_0068992 | Ga0496114_0068992_535_1293 | 252 |
| 1099 | 3300048917 | Ga0496114_0089006 | Ga0496114_0089006_1795_2553 | 252 |
| 1100 | 3300048917 | Ga0496114_0275581 | Ga0496114_0275581_681_1439 | 252 |
| 1101 | 3300048918 | Ga0496115_0018826 | Ga0496115_0018826_1291_2049 | 252 |
| 1102 | 3300048918 | Ga0496115_0061514 | Ga0496115_0061514_398_1174 | 252 |
| 1103 | 3300048918 | Ga0496115_0095801 | Ga0496115_0095801_950_1708 | 252 |
| 1104 | 3300048918 | Ga0496115_0114500 | Ga0496115_0114500_354_1112 | 252 |
| 1105 | 3300048918 | Ga0496115_0196993 | Ga0496115_0196993_88_846 | 252 |
| 1106 | 3300048918 | Ga0496115_0215546 | Ga0496115_0215546_242_1000 | 252 |
| 1107 | 3300048918 | Ga0496115_0368967 | Ga0496115_0368967_14_772 | 252 |
| 1108 | 3300049571 | Ga0501034_0032933 | Ga0501034_0032933_665_1423 | 252 |
| 1109 | 3300049571 | Ga0501034_0144463 | Ga0501034_0144463_971_1729 | 252 |
| 1110 | 3300049572 | Ga0501036_0591718 | Ga0501036_0591718_145_903 | 252 |
| 1111 | 3300049575 | Ga0501039_0196099 | Ga0501039_0196099_165_923 | 252 |
| 1112 | 3300049580 | Ga0501046_0212367 | Ga0501046_0212367_556_1314 | 252 |
| 1113 | 3300049581 | Ga0501047_0323981 | Ga0501047_0323981_103_861 | 252 |
| 1114 | 3300049581 | Ga0501047_0453050 | Ga0501047_0453050_308_1066 | 252 |
| 1115 | 3300049590 | Ga0501074_0254866 | Ga0501074_0254866_52_810 | 252 |
| 1116 | 3300049591 | Ga0501075_0046021 | Ga0501075_0046021_68_826 | 252 |
| 1117 | 3300049592 | Ga0501076_0392448 | Ga0501076_0392448_287_1045 | 252 |
| 1118 | 3300049593 | Ga0501077_0100807 | Ga0501077_0100807_614_1372 | 252 |
| 1119 | 3300049741 | Ga0501079_0023386 | Ga0501079_0023386_2245_3003 | 252 |
| 1120 | 3300049742 | Ga0501080_0087239 | Ga0501080_0087239_1441_2199 | 252 |
| 1121 | 3300049823 | Ga0501044_0116295 | Ga0501044_0116295_1576_2334 | 252 |
| 1122 | 3300050489 | nmdc:mga03683_13694_c1 | nmdc:mga03683_13694_c1_618_1376 | 252 |
| 1123 | 3300050490 | nmdc:mga03n38_195905_c1 | nmdc:mga03n38_195905_c1_115_873 | 252 |
| 1124 | 3300050492 | nmdc:mga0yw44_144524_c1 | nmdc:mga0yw44_144524_c1_103_861 | 252 |
| 1125 | 3300050492 | nmdc:mga0yw44_15059_c1 | nmdc:mga0yw44_15059_c1_765_1523 | 252 |
| 1126 | 3300050492 | nmdc:mga0yw44_1739_c1 | nmdc:mga0yw44_1739_c1_6838_7596 | 252 |
| 1127 | 3300050492 | nmdc:mga0yw44_2945_c1 | nmdc:mga0yw44_2945_c1_569_1327 | 252 |
| 1128 | 3300050494 | nmdc:mga06z11_109499_c1 | nmdc:mga06z11_109499_c1_369_1127 | 252 |
| 1129 | 3300050494 | nmdc:mga06z11_40651_c1 | nmdc:mga06z11_40651_c1_1366_2124 | 252 |
| 1130 | 3300050495 | nmdc:mga04h51_168816_c1 | nmdc:mga04h51_168816_c1_71_829 | 252 |
| 1131 | 3300050496 | nmdc:mga07m45_89651_c1 | nmdc:mga07m45_89651_c1_221_979 | 252 |
| 1132 | 3300050507 | nmdc:mga05p37_215917_c1 | nmdc:mga05p37_215917_c1_312_1070 | 252 |
| 1133 | 3300050507 | nmdc:mga05p37_40357_c1 | nmdc:mga05p37_40357_c1_3750_4508 | 252 |
| 1134 | 3300050507 | nmdc:mga05p37_5180_c1 | nmdc:mga05p37_5180_c1_10065_10823 | 252 |
| 1135 | 3300050508 | nmdc:mga09592_18911_c1 | nmdc:mga09592_18911_c1_66_824 | 252 |
| 1136 | 3300050508 | nmdc:mga09592_452935_c1 | nmdc:mga09592_452935_c1_292_1050 | 252 |
| 1137 | 3300050510 | nmdc:mga06r32_97073_c1 | nmdc:mga06r32_97073_c1_628_1440 | 252 |
| 1138 | 3300050511 | nmdc:mga08y16_111162_c1 | nmdc:mga08y16_111162_c1_851_1609 | 252 |
| 1139 | 3300050511 | nmdc:mga08y16_248692_c1 | nmdc:mga08y16_248692_c1_48_806 | 252 |
| 1140 | 3300050511 | nmdc:mga08y16_285699_c1 | nmdc:mga08y16_285699_c1_308_1072 | 252 |
| 1141 | 3300050511 | nmdc:mga08y16_346068_c1 | nmdc:mga08y16_346068_c1_276_1034 | 252 |
| 1142 | 3300050511 | nmdc:mga08y16_74716_c1 | nmdc:mga08y16_74716_c1_1143_1901 | 252 |
| 1143 | 3300050511 | nmdc:mga08y16_95441_c1 | nmdc:mga08y16_95441_c1_1747_2505 | 252 |
| 1144 | 3300050512 | nmdc:mga0n895_1698_c1 | nmdc:mga0n895_1698_c1_8696_9454 | 252 |
| 1145 | 3300050512 | nmdc:mga0n895_26906_c1 | nmdc:mga0n895_26906_c1_2180_2938 | 252 |
| 1146 | 3300050512 | nmdc:mga0n895_296510_c1 | nmdc:mga0n895_296510_c1_669_1427 | 252 |
| 1147 | 3300050512 | nmdc:mga0n895_397986_c1 | nmdc:mga0n895_397986_c1_16_810 | 252 |
| 1148 | 3300050513 | nmdc:mga0rr50_140884_c1 | nmdc:mga0rr50_140884_c1_287_1045 | 252 |
| 1149 | 3300050513 | nmdc:mga0rr50_221166_c1 | nmdc:mga0rr50_221166_c1_396_1154 | 252 |
| 1150 | 3300050513 | nmdc:mga0rr50_241291_c1 | nmdc:mga0rr50_241291_c1_693_1451 | 252 |
| 1151 | 3300050514 | nmdc:mga08x19_158662_c1 | nmdc:mga08x19_158662_c1_557_1315 | 252 |
| 1152 | 3300050514 | nmdc:mga08x19_32342_c1 | nmdc:mga08x19_32342_c1_2298_3056 | 252 |
| 1153 | 3300050515 | nmdc:mga0a205_151450_c1 | nmdc:mga0a205_151450_c1_235_993 | 252 |
| 1154 | 3300050515 | nmdc:mga0a205_228243_c1 | nmdc:mga0a205_228243_c1_40_921 | 252 |
| 1155 | 3300050515 | nmdc:mga0a205_377641_c1 | nmdc:mga0a205_377641_c1_247_1005 | 252 |
| 1156 | 3300050515 | nmdc:mga0a205_39881_c2 | nmdc:mga0a205_39881_c2_1766_2524 | 252 |
| 1157 | 3300050515 | nmdc:mga0a205_5270_c1 | nmdc:mga0a205_5270_c1_60_824 | 252 |
| 1158 | 3300053077 | Ga0495601_0000069 | Ga0495601_0000069_6256_7032 | 252 |
| 1159 | 3300053077 | Ga0495601_0012835 | Ga0495601_0012835_2110_2868 | 252 |
| 1160 | 3300053077 | Ga0495601_0028733 | Ga0495601_0028733_2128_2886 | 252 |
| 1161 | 3300053077 | Ga0495601_0030043 | Ga0495601_0030043_1884_2642 | 252 |
| 1162 | 3300053077 | Ga0495601_0031923 | Ga0495601_0031923_2461_3219 | 252 |
| 1163 | 3300053077 | Ga0495601_0061488 | Ga0495601_0061488_1281_2039 | 252 |
| 1164 | 3300053077 | Ga0495601_0161288 | Ga0495601_0161288_586_1344 | 252 |
| 1165 | 3300053077 | Ga0495601_0277156 | Ga0495601_0277156_127_885 | 252 |
| 1166 | 3300053078 | Ga0495612_0000175 | Ga0495612_0000175_10566_11324 | 252 |
| 1167 | 3300053078 | Ga0495612_0001538 | Ga0495612_0001538_2569_3345 | 252 |
| 1168 | 3300053078 | Ga0495612_0013349 | Ga0495612_0013349_919_1677 | 252 |
| 1169 | 3300053078 | Ga0495612_0021353 | Ga0495612_0021353_1366_2124 | 252 |
| 1170 | 3300053078 | Ga0495612_0048575 | Ga0495612_0048575_799_1557 | 252 |
| 1171 | 3300053078 | Ga0495612_0055743 | Ga0495612_0055743_527_1285 | 252 |
| 1172 | 3300053083 | Ga0495655_0017879 | Ga0495655_0017879_756_1514 | 252 |
| 1173 | 3300053084 | Ga0495595_0002192 | Ga0495595_0002192_2112_2870 | 252 |
| 1174 | 3300053084 | Ga0495595_0004944 | Ga0495595_0004944_2108_2866 | 252 |
| 1175 | 3300053084 | Ga0495595_0010549 | Ga0495595_0010549_238_1014 | 252 |
| 1176 | 3300053084 | Ga0495595_0019399 | Ga0495595_0019399_1750_2508 | 252 |
| 1177 | 3300053084 | Ga0495595_0022642 | Ga0495595_0022642_643_1401 | 252 |
| 1178 | 3300053084 | Ga0495595_0049289 | Ga0495595_0049289_679_1437 | 252 |
| 1179 | 3300053084 | Ga0495595_0063523 | Ga0495595_0063523_565_1323 | 252 |
| 1180 | 3300053085 | Ga0495619_0000510 | Ga0495619_0000510_24418_25176 | 252 |
| 1181 | 3300053085 | Ga0495619_0005933 | Ga0495619_0005933_2619_3395 | 252 |
| 1182 | 3300053085 | Ga0495619_0018617 | Ga0495619_0018617_1470_2228 | 252 |
| 1183 | 3300053085 | Ga0495619_0023782 | Ga0495619_0023782_194_952 | 252 |
| 1184 | 3300053085 | Ga0495619_0030190 | Ga0495619_0030190_1361_2119 | 252 |
| 1185 | 3300053085 | Ga0495619_0031858 | Ga0495619_0031858_1294_2052 | 252 |
| 1186 | 3300053085 | Ga0495619_0033469 | Ga0495619_0033469_85_843 | 252 |
| 1187 | 3300053085 | Ga0495619_0054034 | Ga0495619_0054034_270_1028 | 252 |
| 1188 | 3300053085 | Ga0495619_0059368 | Ga0495619_0059368_1731_2489 | 252 |
| 1189 | 3300053085 | Ga0495619_0157535 | Ga0495619_0157535_601_1359 | 252 |
| 1190 | 3300053085 | Ga0495619_0177313 | Ga0495619_0177313_61_819 | 252 |
| 1191 | 3300053085 | Ga0495619_0346024 | Ga0495619_0346024_178_936 | 252 |
| 1192 | 3300053094 | Ga0500566_0136844 | Ga0500566_0136844_413_1171 | 252 |
| 1193 | 3300053117 | Ga0500593_035004 | Ga0500593_035004_957_1715 | 252 |
| 1194 | 3300053153 | Ga0500616_0012330 | Ga0500616_0012330_2048_2806 | 252 |
| 1195 | 3300053728 | Ga0500657_101060 | Ga0500657_101060_237_995 | 252 |
| 1196 | 3300060353 | Ga0501082_0068379 | Ga0501082_0068379_847_1605 | 252 |
| 1197 | 3300060353 | Ga0501082_0153093 | Ga0501082_0153093_1011_1769 | 252 |
| 1198 | 3300060353 | Ga0501082_0665614 | Ga0501082_0665614_107_865 | 252 |
| 1199 | 3300061719 | Ga0466962_0024798 | Ga0466962_0024798_956_1714 | 252 |
| 1200 | 3300061734 | Ga0530510_0044639 | Ga0530510_0044639_2331_3089 | 252 |
| 1201 | 3300061734 | Ga0530510_0083639 | Ga0530510_0083639_1295_2053 | 252 |
| 1202 | 3300061734 | Ga0530510_0336849 | Ga0530510_0336849_339_1097 | 252 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fwm-assembly1.cif.gz_X | crystal structure of e. coli enta, a 2,3-dihydrodihydroxy benzoate dehydrogenase | 0.9486 | 6 | 242 |
| 8dt1-assembly1.cif.gz_C | crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with nad | 0.936 | 5 | 242 |
| 4ni5-assembly1.cif.gz_A | crystal structure of a short chain dehydrogenase from brucella suis | 0.9352 | 4 | 241 |
| 4cqm-assembly4.cif.gz_G | crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp | 0.9343 | 11 | 241 |
| 6t65-assembly1.cif.gz_B | crsytal structure of acinetobacter baumannii fabg inhibitor complex at 2.35 a resolution | 0.934 | 8 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54N15_5_159_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9583 | 53 | 172 | 3.40.50.720 |
| 2fwmX00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9486 | 6 | 242 | 3.40.50.720 |
| af_A0A1D6ED38_49_231_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9467 | 5 | 176 | 3.40.50.720 |
| af_Q6PKH6_18_219_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9385 | 5 | 176 | 3.40.50.720 |
| af_Q2QLP7_18_222_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9376 | 9 | 179 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6CHQ7-F1-model_v4 | Short-chain dehydrogenase/reductase | 0.9579 | 4 | 179 |
GO:0016491
|
| AF-A0A6J6LV11-F1-model_v4 | Unannotated protein | 0.9572 | 3 | 241 |
GO:0006633
GO:0016616 GO:0048038 |
| AF-A0A6I2Y422-F1-model_v4 | SDR family oxidoreductase | 0.9566 | 1 | 241 |
GO:0016491
|
| AF-A0A2E1JDC0-F1-model_v4 | Short-chain dehydrogenase | 0.9559 | 3 | 241 |
|
| AF-A0A537MRI7-F1-model_v4 | SDR family oxidoreductase | 0.9548 | 1 | 230 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar