F491604

General Info

Members Datasets Scaffolds Average Seq Length
1202 425 1202 252

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100541609|Ga0068854_1005416092
Length 234
Sequence MTGRLSGKRAFITAAGQGIGAAIAATFIAEGADVIATDLDASKLKALKTDKVIDSYGAPHILVNCAGYVHQGSILDCSEKDWDFSFDLNVKSMHRTLTAFLPAMLKNGGGSIVNISSIVSSLRGVPKRYAYGATKAAVIGLTKAVAADFIREGIRCNCICPGTIQSPSLDERVDANAKATGQTRDKAYADFVARQPIGRLGTAQEVANLALFLASDESSYITGQPHLVDGGMGL

Samples

Sample ID Description Type Environment
1 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
6 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
7 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
8 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
14 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
19 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
20 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
21 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
22 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
23 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
71 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
72 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
100 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
101 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
102 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
107 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
108 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
109 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
110 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
118 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
141 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
142 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
143 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
144 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
145 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
146 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
147 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
151 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
152 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
153 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
154 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
155 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
159 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
237 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
238 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
239 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
240 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
241 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
242 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
243 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
244 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
245 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
246 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
247 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
248 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
249 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
250 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
251 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
252 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
253 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
254 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
255 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
256 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
257 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
258 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
260 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
261 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
262 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
263 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
264 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
265 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
266 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
267 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
268 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
269 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
270 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
271 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
272 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
273 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
274 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
275 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
276 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
277 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
278 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
279 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
280 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
281 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
282 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
283 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
284 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
285 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
286 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
287 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
288 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
289 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
290 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
291 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
292 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
293 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
294 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
295 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
296 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
297 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
298 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
299 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
300 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
301 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
302 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
303 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
304 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
305 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
306 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
307 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
308 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
309 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
310 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
311 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
312 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
313 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
314 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
315 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
316 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
317 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
318 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
319 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
320 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
321 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
322 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
323 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
324 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
325 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
326 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
327 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
328 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
329 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
330 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
331 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
332 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
333 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
334 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
335 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
336 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
337 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
338 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
339 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
340 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
341 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
342 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
343 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
344 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
345 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
346 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
347 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
348 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
349 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
350 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
351 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
352 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
353 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
354 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
355 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
356 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
357 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
358 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
359 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
360 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
361 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
362 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
363 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
364 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
365 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
366 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
367 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
368 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
369 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
370 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
371 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
372 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
373 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
374 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
375 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
376 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
377 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
378 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
379 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
380 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
381 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
382 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
383 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
384 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
385 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
386 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
392 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
393 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
394 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
395 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
396 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
397 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
398 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
399 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
400 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
401 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
402 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
403 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
404 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
405 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
406 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
407 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
408 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
409 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
410 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
411 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
412 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
413 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
414 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
415 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
416 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
417 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
418 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
419 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
420 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
421 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
422 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
423 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
424 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
425 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2
Nodule 0
Rhizoplane 7.32
Rhizosphere 90.52
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c000939 3300000041 Bacteria 3180
2 ARcpr5oldR_c006380 3300000041 Bacteria 1007
3 ARcpr5yngRDRAFT_c001001 3300000043 Bacteria 3240
4 ARSoilOldRDRAFT_c000297 3300000044 Bacteria 6916
5 ARCol0yngRDRAFT_1000069 3300000652 Bacteria 18965
6 JGI24032J14994_101229 3300001430 Bacteria 1126
7 JGI24752J21851_1004116 3300001976 Bacteria 1908
8 JGI24746J21847_1000078 3300001977 Bacteria 10426
9 JGI24747J21853_1000030 3300001978 Bacteria 5385
10 JGI24739J22299_10002225 3300001989 Bacteria 7452
11 JGI24737J22298_10001972 3300001990 Bacteria 7332
12 JGI24737J22298_10026703 3300001990 Bacteria 1823
13 JGI24743J22301_10003246 3300001991 Bacteria 2557
14 JGI24750J21931_1000188 3300002070 Bacteria 10321
15 JGI24750J21931_1001805 3300002070 Bacteria 2609
16 JGI24745J21846_1000126 3300002073 Bacteria 5829
17 JGI24748J21848_1006879 3300002074 Bacteria 1328
18 JGI24748J21848_1014790 3300002074 Bacteria 927
19 JGI24738J21930_10000068 3300002075 Bacteria 21789
20 JGI24738J21930_10005515 3300002075 Bacteria 3026
21 JGI24749J21850_1000122 3300002076 Bacteria 13176
22 JGI24744J21845_10003010 3300002077 Bacteria 3455
23 JGI24744J21845_10004022 3300002077 Bacteria 3034
24 JGI24035J26624_1000121 3300002126 Bacteria 6818
25 JGI24033J26618_1002438 3300002155 Bacteria 1905
26 JGI24034J26672_10000519 3300002239 Bacteria 4969
27 JGI24034J26672_10004919 3300002239 Bacteria 1904
28 JGI24742J22300_10000082 3300002244 Bacteria 13679
29 JGI24742J22300_10001792 3300002244 Bacteria 3427
30 JGI24751J29686_10008626 3300002459 Bacteria 2088
31 JGI24751J29686_10029822 3300002459 Bacteria 1132
32 JGI24751J29686_10041519 3300002459 Bacteria 952
33 JGI25405J52794_10003641 3300003911 Bacteria 2715
34 Ga0065712_10001352 3300005290 Bacteria 6650
35 Ga0065712_10013324 3300005290 Bacteria 1902
36 Ga0065712_10104339 3300005290 Bacteria 1963
37 Ga0065715_10089172 3300005293 Bacteria 13154
38 Ga0070658_10068112 3300005327 Bacteria 2909
39 Ga0070676_10000363 3300005328 Bacteria 20801
40 Ga0070683_100004718 3300005329 Bacteria 11267
41 Ga0070683_100208384 3300005329 Bacteria 1856
42 Ga0070690_100001828 3300005330 Bacteria 11279
43 Ga0070690_100038771 3300005330 Bacteria 3008
44 Ga0070690_100057719 3300005330 Bacteria 2491
45 Ga0070670_100001134 3300005331 Bacteria 21148
46 Ga0070670_100006490 3300005331 Bacteria 9902
47 Ga0070670_100064312 3300005331 Bacteria 3148
48 Ga0070670_100182814 3300005331 Bacteria 1820
49 Ga0070677_10000301 3300005333 Bacteria 17280
50 Ga0068869_100006712 3300005334 Bacteria 7314
51 Ga0068869_100138987 3300005334 Bacteria 1874
52 Ga0068869_100348428 3300005334 Bacteria 1207
53 Ga0070666_10022647 3300005335 Bacteria 4082
54 Ga0070666_10032235 3300005335 Bacteria 3460
55 Ga0070666_10212724 3300005335 Bacteria 1362
56 Ga0070680_100014945 3300005336 Bacteria 6076
57 Ga0070680_100057625 3300005336 Bacteria 3176
58 Ga0070682_100000719 3300005337 Bacteria 19838
59 Ga0070682_100045580 3300005337 Bacteria 2718
60 Ga0070682_100145483 3300005337 Bacteria 1621
61 Ga0070682_100177332 3300005337 Bacteria 1486
62 Ga0068868_100013587 3300005338 Bacteria 5978
63 Ga0068868_100073781 3300005338 Bacteria 2725
64 Ga0070660_100000730 3300005339 Bacteria 21778
65 Ga0070660_100037257 3300005339 Bacteria 3687
66 Ga0070660_100050497 3300005339 Bacteria 3200
67 Ga0070689_100000601 3300005340 Bacteria 21783
68 Ga0070689_100013621 3300005340 Bacteria 5889
69 Ga0070689_100086701 3300005340 Bacteria 2462
70 Ga0070689_100142282 3300005340 Bacteria 1929
71 Ga0070691_10001015 3300005341 Bacteria 11523
72 Ga0070691_10171305 3300005341 Bacteria 1125
73 Ga0070687_100000253 3300005343 Bacteria 18199
74 Ga0070687_100003704 3300005343 Bacteria 5982
75 Ga0070661_100003564 3300005344 Bacteria 10720
76 Ga0070692_10000060 3300005345 Bacteria 21392
77 Ga0070668_100001851 3300005347 Bacteria 15430
78 Ga0070668_100087704 3300005347 Bacteria 2448
79 Ga0070669_100000888 3300005353 Bacteria 21753
80 Ga0070669_100026939 3300005353 Bacteria 4136
81 Ga0070669_100537628 3300005353 Bacteria 973
82 Ga0070675_100000441 3300005354 Bacteria 28206
83 Ga0070675_100008895 3300005354 Bacteria 7806
84 Ga0070671_100001180 3300005355 Bacteria 19534
85 Ga0070671_100011505 3300005355 Bacteria 7114
86 Ga0070671_100012122 3300005355 Bacteria 6937
87 Ga0070674_100000723 3300005356 Bacteria 16855
88 Ga0070674_100052446 3300005356 Bacteria 2814
89 Ga0070673_100000456 3300005364 Bacteria 21637
90 Ga0070688_100000483 3300005365 Bacteria 20204
91 Ga0070688_100010309 3300005365 Bacteria 5149
92 Ga0070688_100015266 3300005365 Bacteria 4364
93 Ga0070659_100001763 3300005366 Bacteria 15553
94 Ga0070659_100020482 3300005366 Bacteria 5024
95 Ga0070659_100064724 3300005366 Bacteria 2894
96 Ga0070659_100167244 3300005366 Bacteria 1800
97 Ga0070667_100004366 3300005367 Bacteria 11932
98 Ga0070667_100029031 3300005367 Bacteria 4606
99 Ga0070667_100053332 3300005367 Bacteria 3413
100 Ga0070667_100472184 3300005367 Bacteria 1148
101 Ga0070703_10002031 3300005406 Bacteria 5916
102 Ga0070703_10020218 3300005406 Bacteria 1936
103 Ga0070709_10007969 3300005434 Bacteria 5819
104 Ga0070709_10242814 3300005434 Bacteria 1294
105 Ga0070714_100089770 3300005435 Bacteria 2691
106 Ga0070714_100236796 3300005435 Bacteria 1684
107 Ga0070714_100456706 3300005435 Bacteria 1214
108 Ga0070713_100052199 3300005436 Bacteria 3384
109 Ga0070713_100141795 3300005436 Bacteria 2129
110 Ga0070713_100292797 3300005436 Bacteria 1497
111 Ga0070713_100467309 3300005436 Bacteria 1187
112 Ga0070713_100472116 3300005436 Bacteria 1181
113 Ga0070713_100487380 3300005436 Bacteria 1162
114 Ga0070710_10019850 3300005437 Bacteria 3479
115 Ga0070710_10026259 3300005437 Bacteria 3092
116 Ga0070701_10000150 3300005438 Bacteria 21357
117 Ga0070701_10018237 3300005438 Bacteria 3295
118 Ga0070711_100009998 3300005439 Bacteria 5854
119 Ga0070711_100027082 3300005439 Bacteria 3761
120 Ga0070711_100043909 3300005439 Bacteria 3030
121 Ga0070711_100062480 3300005439 Bacteria 2596
122 Ga0070711_100304933 3300005439 Bacteria 1267
123 Ga0070711_100419281 3300005439 Bacteria 1090
124 Ga0070705_100003099 3300005440 Bacteria 8178
125 Ga0070705_100127316 3300005440 Bacteria 1655
126 Ga0070705_100177461 3300005440 Bacteria 1440
127 Ga0070700_100001083 3300005441 Bacteria 13532
128 Ga0070700_100035299 3300005441 Bacteria 3025
129 Ga0070694_100001678 3300005444 Bacteria 13024
130 Ga0070708_100013928 3300005445 Bacteria 6606
131 Ga0070663_100001801 3300005455 Bacteria 11920
132 Ga0070663_100108736 3300005455 Bacteria 2080
133 Ga0070678_100000199 3300005456 Bacteria 26434
134 Ga0070678_100031746 3300005456 Bacteria 3648
135 Ga0070678_100048354 3300005456 Bacteria 3062
136 Ga0070678_100075457 3300005456 Bacteria 2536
137 Ga0070662_100016138 3300005457 Bacteria 5011
138 Ga0070662_100030935 3300005457 Bacteria 3751
139 Ga0070662_100102736 3300005457 Bacteria 2166
140 Ga0070681_10001398 3300005458 Bacteria 21148
141 Ga0070681_10061363 3300005458 Bacteria 3734
142 Ga0068867_100001623 3300005459 Bacteria 15640
143 Ga0068867_100021030 3300005459 Bacteria 4654
144 Ga0068867_100160027 3300005459 Bacteria 1775
145 Ga0070685_10000782 3300005466 Bacteria 17256
146 Ga0070685_10001511 3300005466 Bacteria 12252
147 Ga0070685_10045926 3300005466 Bacteria 2506
148 Ga0070706_100458705 3300005467 Bacteria 1186
149 Ga0070707_100200688 3300005468 Bacteria 1944
150 Ga0070698_100720832 3300005471 Bacteria 940
151 Ga0070699_100216835 3300005518 Bacteria 1705
152 Ga0070679_100213260 3300005530 Bacteria 1894
153 Ga0070684_100001802 3300005535 Bacteria 15671
154 Ga0070684_100060250 3300005535 Bacteria 3319
155 Ga0070684_100137558 3300005535 Bacteria 2207
156 Ga0070684_100212866 3300005535 Bacteria 1762
157 Ga0068853_100002281 3300005539 Bacteria 14329
158 Ga0070672_100001622 3300005543 Bacteria 13990
159 Ga0070672_100060325 3300005543 Bacteria 2986
160 Ga0070686_100000746 3300005544 Bacteria 18847
161 Ga0070686_100004148 3300005544 Bacteria 7974
162 Ga0070686_100061519 3300005544 Bacteria 2426
163 Ga0070686_100378590 3300005544 Bacteria 1071
164 Ga0070695_100000553 3300005545 Bacteria 19808
165 Ga0070696_100001299 3300005546 Bacteria 16280
166 Ga0070696_100030835 3300005546 Bacteria 3672
167 Ga0070693_100000613 3300005547 Bacteria 15823
168 Ga0070693_100038637 3300005547 Bacteria 2669
169 Ga0070693_100041191 3300005547 Bacteria 2597
170 Ga0070693_100096173 3300005547 Bacteria 1795
171 Ga0070665_100373235 3300005548 Bacteria 1433
172 Ga0070704_100000423 3300005549 Bacteria 19666
173 Ga0070704_100095947 3300005549 Bacteria 2222
174 Ga0070704_100136880 3300005549 Bacteria 1906
175 Ga0070704_100199897 3300005549 Bacteria 1613
176 Ga0070704_100335192 3300005549 Bacteria 1272
177 Ga0068855_100004415 3300005563 Bacteria 17183
178 Ga0068855_100245922 3300005563 Bacteria 1997
179 Ga0068855_100412421 3300005563 Bacteria 1479
180 Ga0068855_100605940 3300005563 Bacteria 1180
181 Ga0070664_100001312 3300005564 Bacteria 19866
182 Ga0070664_100024128 3300005564 Bacteria 5028
183 Ga0068857_100007906 3300005577 Bacteria 9173
184 Ga0068857_100144242 3300005577 Bacteria 2154
185 Ga0068857_100244687 3300005577 Bacteria 1643
186 Ga0068854_100000827 3300005578 Bacteria 18476
187 Ga0068854_100044204 3300005578 Bacteria 3160
188 Ga0068854_100541609 3300005578 Bacteria 986
189 Ga0068856_100001340 3300005614 Bacteria 25903
190 Ga0068856_100024759 3300005614 Bacteria 5846
191 Ga0068856_100085111 3300005614 Bacteria 3141
192 Ga0068856_100523899 3300005614 Bacteria 1206
193 Ga0070702_100001213 3300005615 Bacteria 10437
194 Ga0070702_100021853 3300005615 Bacteria 3374
195 Ga0070702_100029869 3300005615 Bacteria 2968
196 Ga0070702_100255369 3300005615 Bacteria 1190
197 Ga0068852_100007064 3300005616 Bacteria 8177
198 Ga0068852_100039827 3300005616 Bacteria 3959
199 Ga0068852_100288873 3300005616 Bacteria 1583
200 Ga0068859_100001767 3300005617 Bacteria 21986
201 Ga0068859_100009332 3300005617 Bacteria 9902
202 Ga0068859_100284133 3300005617 Bacteria 1747
203 Ga0068864_100003544 3300005618 Bacteria 12907
204 Ga0068864_100052324 3300005618 Bacteria 3519
205 Ga0068866_10000372 3300005718 Bacteria 21128
206 Ga0068866_10045509 3300005718 Bacteria 2201
207 Ga0068866_10055926 3300005718 Bacteria 2028
208 Ga0068861_100001202 3300005719 Bacteria 16126
209 Ga0068870_10000207 3300005840 Bacteria 21125
210 Ga0068870_10093149 3300005840 Bacteria 1689
211 Ga0068863_100003062 3300005841 Bacteria 16530
212 Ga0068863_100103435 3300005841 Bacteria 2709
213 Ga0068858_100009856 3300005842 Bacteria 9079
214 Ga0068860_100007079 3300005843 Bacteria 11224
215 Ga0068860_100027232 3300005843 Bacteria 5506
216 Ga0068862_100002236 3300005844 Bacteria 17352
217 Ga0068862_100015217 3300005844 Bacteria 6388
218 Ga0081455_10005862 3300005937 Bacteria 13359
219 Ga0081455_10006016 3300005937 Bacteria 13146
220 Ga0081455_10006534 3300005937 Bacteria 12482
221 Ga0081455_10010698 3300005937 Bacteria 9280
222 Ga0081455_10012847 3300005937 Bacteria 8316
223 Ga0081455_10061621 3300005937 Bacteria 3156
224 Ga0081455_10167172 3300005937 Bacteria 1679
225 Ga0081538_10013962 3300005981 Bacteria 6324
226 Ga0081538_10024573 3300005981 Bacteria 4288
227 Ga0081538_10030004 3300005981 Bacteria 3701
228 Ga0081538_10077823 3300005981 Bacteria 1784
229 Ga0081540_1027376 3300005983 Bacteria 3231
230 Ga0081540_1133036 3300005983 Bacteria 1012
231 Ga0070717_10047085 3300006028 Bacteria 3531
232 Ga0070717_10184932 3300006028 Bacteria 1818
233 Ga0070717_10358002 3300006028 Bacteria 1306
234 Ga0075365_10001784 3300006038 Bacteria 10036
235 Ga0075365_10017017 3300006038 Bacteria 4439
236 Ga0075365_10037350 3300006038 Bacteria 3153
237 Ga0075365_10259840 3300006038 Bacteria 1221
238 Ga0075363_100192963 3300006048 Bacteria 1162
239 Ga0075364_10058565 3300006051 Bacteria 2525
240 Ga0075432_10013777 3300006058 Bacteria 2751
241 Ga0070715_10099465 3300006163 Bacteria 1354
242 Ga0070715_10199282 3300006163 Bacteria 1016
243 Ga0070715_10320153 3300006163 Bacteria 837
244 Ga0070716_100043247 3300006173 Bacteria 2517
245 Ga0070716_100121396 3300006173 Bacteria 1636
246 Ga0070712_100007234 3300006175 Bacteria 6926
247 Ga0070712_100113727 3300006175 Bacteria 2025
248 Ga0075367_10021834 3300006178 Bacteria 3584
249 Ga0075367_10105375 3300006178 Bacteria 1727
250 Ga0075367_10243277 3300006178 Bacteria 1128
251 Ga0097621_100002408 3300006237 Bacteria 12812
252 Ga0075370_10144277 3300006353 Bacteria 1393
253 Ga0068871_100002267 3300006358 Bacteria 13082
254 Ga0068871_100034059 3300006358 Bacteria 4038
255 Ga0075428_100234280 3300006844 Bacteria 1981
256 Ga0075428_100340154 3300006844 Bacteria 1611
257 Ga0075428_100789534 3300006844 Bacteria 1009
258 Ga0075430_100013448 3300006846 Bacteria 6977
259 Ga0075430_100078649 3300006846 Bacteria 2764
260 Ga0075430_100342962 3300006846 Bacteria 1234
261 Ga0075431_100005769 3300006847 Bacteria 12247
262 Ga0075431_100023620 3300006847 Bacteria 6293
263 Ga0075431_100113391 3300006847 Bacteria 2798
264 Ga0075431_100131562 3300006847 Bacteria 2580
265 Ga0075433_10039549 3300006852 Bacteria 4079
266 Ga0075433_10082850 3300006852 Bacteria 2830
267 Ga0075433_10146797 3300006852 Bacteria 2097
268 Ga0075433_10232618 3300006852 Bacteria 1636
269 Ga0075433_10411442 3300006852 Bacteria 1193
270 Ga0075434_100007264 3300006871 Bacteria 10249
271 Ga0075434_100016025 3300006871 Bacteria 7201
272 Ga0075434_100029369 3300006871 Bacteria 5408
273 Ga0075434_100044598 3300006871 Bacteria 4398
274 Ga0075434_100104976 3300006871 Bacteria 2835
275 Ga0075429_100011165 3300006880 Bacteria 7776
276 Ga0075429_100069547 3300006880 Bacteria 3065
277 Ga0075429_100069699 3300006880 Bacteria 3061
278 Ga0075429_100370584 3300006880 Bacteria 1254
279 Ga0068865_100000537 3300006881 Bacteria 21125
280 Ga0068865_100010539 3300006881 Bacteria 5757
281 Ga0075436_100023694 3300006914 Bacteria 4217
282 Ga0075436_100123650 3300006914 Bacteria 1812
283 Ga0097620_100001767 3300006931 Bacteria 21986
284 Ga0097620_100009332 3300006931 Bacteria 9902
285 Ga0097620_100284125 3300006931 Bacteria 1747
286 Ga0075435_100014461 3300007076 Bacteria 5899
287 Ga0075435_100165067 3300007076 Bacteria 1867
288 Ga0105251_10037885 3300009011 Bacteria 2364
289 Ga0105244_10052114 3300009036 Bacteria 2084
290 Ga0105240_10089436 3300009093 Bacteria 3766
291 Ga0105240_10605519 3300009093 Bacteria 1206
292 Ga0111539_10004508 3300009094 Bacteria 18213
293 Ga0111539_10008569 3300009094 Bacteria 12982
294 Ga0111539_10048979 3300009094 Bacteria 5043
295 Ga0111539_10061855 3300009094 Bacteria 4434
296 Ga0111539_10244902 3300009094 Bacteria 2087
297 Ga0111539_10256588 3300009094 Bacteria 2036
298 Ga0111539_10543210 3300009094 Bacteria 1354
299 Ga0105245_10000888 3300009098 Bacteria 27206
300 Ga0105245_10021572 3300009098 Bacteria 5652
301 Ga0105247_10001292 3300009101 Bacteria 18486
302 Ga0105247_10086321 3300009101 Bacteria 1986
303 Ga0105247_10339098 3300009101 Bacteria 1054
304 Ga0105247_10406313 3300009101 Bacteria 972
305 Ga0114129_10003043 3300009147 Bacteria 23503
306 Ga0114129_10006042 3300009147 Bacteria 17168
307 Ga0114129_10011980 3300009147 Bacteria 12334
308 Ga0114129_10037803 3300009147 Bacteria 6813
309 Ga0114129_10064901 3300009147 Bacteria 5096
310 Ga0114129_10080507 3300009147 Bacteria 4527
311 Ga0105243_10004521 3300009148 Bacteria 10993
312 Ga0105243_10072224 3300009148 Bacteria 2793
313 Ga0105243_10110850 3300009148 Bacteria 2296
314 Ga0105243_10302157 3300009148 Bacteria 1451
315 Ga0105243_10364696 3300009148 Bacteria 1331
316 Ga0105241_10000662 3300009174 Bacteria 25854
317 Ga0105241_10062168 3300009174 Bacteria 2878
318 Ga0105242_10001202 3300009176 Bacteria 20446
319 Ga0105242_10033477 3300009176 Bacteria 4114
320 Ga0105248_10002336 3300009177 Bacteria 21042
321 Ga0105248_10040793 3300009177 Bacteria 5204
322 Ga0105248_10061774 3300009177 Bacteria 4207
323 Ga0105248_10420636 3300009177 Bacteria 1505
324 Ga0105237_10020331 3300009545 Bacteria 6847
325 Ga0105237_10086525 3300009545 Bacteria 3124
326 Ga0105237_10230003 3300009545 Bacteria 1855
327 Ga0105238_10131783 3300009551 Bacteria 2478
328 Ga0105238_10143856 3300009551 Bacteria 2361
329 Ga0105249_10001808 3300009553 Bacteria 18605
330 Ga0105249_10195476 3300009553 Bacteria 1977
331 Ga0105249_10243964 3300009553 Bacteria 1777
332 Ga0105239_10018370 3300010375 Bacteria 7730
333 Ga0105239_10060609 3300010375 Bacteria 4153
334 Ga0105239_10103533 3300010375 Bacteria 3151
335 Ga0105239_10260680 3300010375 Bacteria 1948
336 Ga0105239_10541513 3300010375 Bacteria 1325
337 Ga0105239_10801476 3300010375 Bacteria 1079
338 Ga0105246_10689388 3300011119 Bacteria 894
339 Ga0157335_1006657 3300012492 Bacteria 844
340 Ga0157342_1000478 3300012507 Bacteria 2451
341 Ga0157373_10006024 3300013100 Bacteria 9067
342 Ga0157373_10198989 3300013100 Bacteria 1412
343 Ga0157371_10027329 3300013102 Bacteria 4139
344 Ga0157371_10165951 3300013102 Bacteria 1577
345 Ga0157370_10470781 3300013104 Bacteria 1155
346 Ga0157369_10535210 3300013105 Bacteria 1211
347 Ga0157374_10002267 3300013296 Bacteria 16192
348 Ga0157374_10053178 3300013296 Bacteria 3774
349 Ga0157374_10140876 3300013296 Bacteria 2341
350 Ga0157378_10003851 3300013297 Bacteria 13270
351 Ga0157378_10023127 3300013297 Bacteria 5469
352 Ga0157378_10243787 3300013297 Bacteria 1718
353 Ga0163162_10009182 3300013306 Bacteria 9623
354 Ga0163162_10015064 3300013306 Bacteria 7553
355 Ga0157372_10011471 3300013307 Bacteria 9424
356 Ga0157372_10088626 3300013307 Bacteria 3514
357 Ga0157372_10172507 3300013307 Bacteria 2502
358 Ga0157372_10487716 3300013307 Bacteria 1437
359 Ga0157372_11105963 3300013307 Bacteria 917
360 Ga0157375_10001031 3300013308 Bacteria 24026
361 Ga0157375_10012658 3300013308 Bacteria 7488
362 Ga0157375_10473737 3300013308 Bacteria 1417
363 Ga0163163_10003323 3300014325 Bacteria 13641
364 Ga0163163_10026839 3300014325 Bacteria 5509
365 Ga0163163_10038122 3300014325 Bacteria 4680
366 Ga0163163_10139060 3300014325 Bacteria 2470
367 Ga0163163_10779657 3300014325 Bacteria 1019
368 Ga0163163_11079087 3300014325 Bacteria 866
369 Ga0157380_10000726 3300014326 Bacteria 20528
370 Ga0157380_10012046 3300014326 Bacteria 6259
371 Ga0157377_10000324 3300014745 Bacteria 21481
372 Ga0157377_10009317 3300014745 Bacteria 4810
373 Ga0157379_10001193 3300014968 Bacteria 21154
374 Ga0157379_10013061 3300014968 Bacteria 7273
375 Ga0157379_10027074 3300014968 Bacteria 5103
376 Ga0157379_10375791 3300014968 Bacteria 1303
377 Ga0157379_10446829 3300014968 Bacteria 1193
378 Ga0157376_10003383 3300014969 Bacteria 10978
379 Ga0157376_10036675 3300014969 Bacteria 3974
380 Ga0157376_10066060 3300014969 Bacteria 3056
381 Ga0163161_10001040 3300017792 Bacteria 21136
382 Ga0163161_10077137 3300017792 Bacteria 2447
383 Ga0163161_10194105 3300017792 Bacteria 1562
384 Ga0207666_1000034 3300025271 Bacteria 28645
385 Ga0207673_1000073 3300025290 Bacteria 8700
386 Ga0207697_10000280 3300025315 Bacteria 28276
387 Ga0207656_10122431 3300025321 Bacteria 1212
388 Ga0207655_1054113 3300025728 Bacteria 1598
389 Ga0207653_10001427 3300025885 Bacteria 7746
390 Ga0207653_10031182 3300025885 Bacteria 1722
391 Ga0207682_10000134 3300025893 Bacteria 33520
392 Ga0207692_10113652 3300025898 Bacteria 1505
393 Ga0207692_10129449 3300025898 Bacteria 1423
394 Ga0207642_10110202 3300025899 Bacteria 1400
395 Ga0207710_10001541 3300025900 Bacteria 11350
396 Ga0207710_10080676 3300025900 Bacteria 1509
397 Ga0207688_10000033 3300025901 Bacteria 46898
398 Ga0207688_10000526 3300025901 Bacteria 18554
399 Ga0207680_10003687 3300025903 Bacteria 7196
400 Ga0207680_10011913 3300025903 Bacteria 4414
401 Ga0207680_10037146 3300025903 Bacteria 2810
402 Ga0207680_10095201 3300025903 Bacteria 1902
403 Ga0207647_10003350 3300025904 Bacteria 12019
404 Ga0207647_10011872 3300025904 Bacteria 6086
405 Ga0207647_10023449 3300025904 Bacteria 4080
406 Ga0207699_10024497 3300025906 Bacteria 3301
407 Ga0207699_10025852 3300025906 Bacteria 3229
408 Ga0207699_10080753 3300025906 Bacteria 2015
409 Ga0207699_10238507 3300025906 Bacteria 1248
410 Ga0207699_10387889 3300025906 Bacteria 993
411 Ga0207645_10001617 3300025907 Bacteria 18370
412 Ga0207645_10114448 3300025907 Bacteria 1748
413 Ga0207643_10000756 3300025908 Bacteria 19870
414 Ga0207643_10004718 3300025908 Bacteria 7314
415 Ga0207705_10270689 3300025909 Bacteria 1299
416 Ga0207684_10193478 3300025910 Bacteria 1754
417 Ga0207684_10408408 3300025910 Bacteria 1167
418 Ga0207654_10004513 3300025911 Bacteria 7031
419 Ga0207707_10002112 3300025912 Bacteria 17984
420 Ga0207707_10390291 3300025912 Bacteria 1196
421 Ga0207695_10063206 3300025913 Bacteria 3817
422 Ga0207671_10088716 3300025914 Bacteria 2327
423 Ga0207671_10218462 3300025914 Bacteria 1493
424 Ga0207693_10009432 3300025915 Bacteria 7955
425 Ga0207693_10027020 3300025915 Bacteria 4539
426 Ga0207693_10039890 3300025915 Bacteria 3698
427 Ga0207693_10100762 3300025915 Bacteria 2265
428 Ga0207693_10111817 3300025915 Bacteria 2142
429 Ga0207693_10126504 3300025915 Bacteria 2009
430 Ga0207693_10458870 3300025915 Bacteria 995
431 Ga0207663_10034861 3300025916 Bacteria 3014
432 Ga0207663_10175795 3300025916 Bacteria 1525
433 Ga0207663_10183236 3300025916 Bacteria 1497
434 Ga0207660_10001335 3300025917 Bacteria 16500
435 Ga0207660_10129815 3300025917 Bacteria 1917
436 Ga0207660_10294683 3300025917 Bacteria 1291
437 Ga0207660_10311272 3300025917 Bacteria 1256
438 Ga0207662_10000341 3300025918 Bacteria 21083
439 Ga0207662_10003898 3300025918 Bacteria 7771
440 Ga0207662_10007966 3300025918 Bacteria 5773
441 Ga0207657_10002888 3300025919 Bacteria 18459
442 Ga0207657_10022947 3300025919 Bacteria 5823
443 Ga0207657_10054672 3300025919 Bacteria 3451
444 Ga0207657_10055265 3300025919 Bacteria 3430
445 Ga0207657_10147877 3300025919 Bacteria 1915
446 Ga0207657_10397641 3300025919 Bacteria 1084
447 Ga0207649_10000271 3300025920 Bacteria 40924
448 Ga0207652_10001830 3300025921 Bacteria 18431
449 Ga0207652_10210529 3300025921 Bacteria 1750
450 Ga0207681_10000658 3300025923 Bacteria 22886
451 Ga0207681_10052178 3300025923 Bacteria 2773
452 Ga0207681_10114924 3300025923 Bacteria 1964
453 Ga0207694_10077300 3300025924 Bacteria 2608
454 Ga0207694_10112188 3300025924 Bacteria 2170
455 Ga0207694_10137781 3300025924 Bacteria 1961
456 Ga0207650_10002267 3300025925 Bacteria 13424
457 Ga0207650_10006007 3300025925 Bacteria 8283
458 Ga0207650_10041801 3300025925 Bacteria 3361
459 Ga0207650_10146997 3300025925 Bacteria 1857
460 Ga0207659_10000177 3300025926 Bacteria 38217
461 Ga0207659_10349933 3300025926 Bacteria 1226
462 Ga0207687_10000495 3300025927 Bacteria 26551
463 Ga0207687_10006623 3300025927 Bacteria 7642
464 Ga0207687_10029641 3300025927 Bacteria 3683
465 Ga0207700_10114017 3300025928 Bacteria 2180
466 Ga0207700_10141346 3300025928 Bacteria 1978
467 Ga0207700_10188564 3300025928 Bacteria 1731
468 Ga0207700_10253591 3300025928 Bacteria 1504
469 Ga0207664_10271689 3300025929 Bacteria 1485
470 Ga0207644_10000279 3300025931 Bacteria 33969
471 Ga0207644_10062434 3300025931 Bacteria 2702
472 Ga0207644_10074660 3300025931 Bacteria 2489
473 Ga0207644_10523311 3300025931 Unclassified 980
474 Ga0207690_10001557 3300025932 Bacteria 14369
475 Ga0207690_10144034 3300025932 Bacteria 1759
476 Ga0207706_10003167 3300025933 Bacteria 15802
477 Ga0207706_10005939 3300025933 Bacteria 11357
478 Ga0207706_10065929 3300025933 Bacteria 3187
479 Ga0207686_10001383 3300025934 Bacteria 13773
480 Ga0207686_10052401 3300025934 Bacteria 2546
481 Ga0207686_10300817 3300025934 Bacteria 1191
482 Ga0207709_10000952 3300025935 Bacteria 21659
483 Ga0207709_10130124 3300025935 Bacteria 1714
484 Ga0207709_10189751 3300025935 Bacteria 1459
485 Ga0207670_10000491 3300025936 Bacteria 21793
486 Ga0207670_10130196 3300025936 Bacteria 1842
487 Ga0207670_10325591 3300025936 Bacteria 1210
488 Ga0207669_10000649 3300025937 Bacteria 15064
489 Ga0207669_10057728 3300025937 Bacteria 2364
490 Ga0207704_10001342 3300025938 Bacteria 10974
491 Ga0207704_10016141 3300025938 Bacteria 3829
492 Ga0207704_10164606 3300025938 Bacteria 1582
493 Ga0207704_10221957 3300025938 Bacteria 1399
494 Ga0207665_10004210 3300025939 Bacteria 9576
495 Ga0207665_10182378 3300025939 Bacteria 1521
496 Ga0207665_10204402 3300025939 Bacteria 1440
497 Ga0207691_10002815 3300025940 Bacteria 16961
498 Ga0207691_10012526 3300025940 Bacteria 8129
499 Ga0207691_10155691 3300025940 Bacteria 2007
500 Ga0207691_10207640 3300025940 Bacteria 1702
501 Ga0207711_10001570 3300025941 Bacteria 21117
502 Ga0207711_10011263 3300025941 Bacteria 7432
503 Ga0207711_10016743 3300025941 Bacteria 6088
504 Ga0207711_10068152 3300025941 Bacteria 3081
505 Ga0207689_10002449 3300025942 Bacteria 17292
506 Ga0207689_10003816 3300025942 Bacteria 13733
507 Ga0207689_10131020 3300025942 Bacteria 2064
508 Ga0207661_10000642 3300025944 Bacteria 22523
509 Ga0207661_10218373 3300025944 Bacteria 1684
510 Ga0207661_10677803 3300025944 Bacteria 948
511 Ga0207679_10000046 3300025945 Bacteria 119975
512 Ga0207679_10044409 3300025945 Bacteria 3206
513 Ga0207667_10007962 3300025949 Bacteria 12641
514 Ga0207667_10047435 3300025949 Bacteria 4547
515 Ga0207667_10226942 3300025949 Bacteria 1913
516 Ga0207651_10000214 3300025960 Bacteria 24891
517 Ga0207651_10054490 3300025960 Bacteria 2741
518 Ga0207651_10085066 3300025960 Bacteria 2293
519 Ga0207712_10003297 3300025961 Bacteria 10236
520 Ga0207712_10113898 3300025961 Bacteria 2033
521 Ga0207712_10165498 3300025961 Bacteria 1723
522 Ga0207712_10378142 3300025961 Bacteria 1184
523 Ga0207668_10000537 3300025972 Bacteria 23803
524 Ga0207668_10045783 3300025972 Bacteria 2985
525 Ga0207668_10458514 3300025972 Bacteria 1089
526 Ga0207668_10665727 3300025972 Bacteria 912
527 Ga0207640_10000765 3300025981 Bacteria 18401
528 Ga0207640_10072606 3300025981 Bacteria 2322
529 Ga0207658_10001147 3300025986 Bacteria 21223
530 Ga0207658_10014386 3300025986 Bacteria 5419
531 Ga0207677_10003377 3300026023 Bacteria 8450
532 Ga0207677_10020914 3300026023 Bacteria 3987
533 Ga0207677_10245657 3300026023 Bacteria 1450
534 Ga0207703_10000940 3300026035 Bacteria 28248
535 Ga0207703_10021815 3300026035 Bacteria 5014
536 Ga0207639_10000852 3300026041 Bacteria 20713
537 Ga0207639_10084643 3300026041 Bacteria 2519
538 Ga0207639_10300042 3300026041 Bacteria 1420
539 Ga0207678_10002525 3300026067 Bacteria 16674
540 Ga0207678_10011036 3300026067 Bacteria 7935
541 Ga0207678_10014774 3300026067 Bacteria 6871
542 Ga0207678_10073591 3300026067 Bacteria 2928
543 Ga0207678_10089495 3300026067 Bacteria 2631
544 Ga0207678_10246758 3300026067 Bacteria 1529
545 Ga0207708_10000124 3300026075 Bacteria 59953
546 Ga0207708_10001006 3300026075 Bacteria 21086
547 Ga0207708_10005549 3300026075 Bacteria 9308
548 Ga0207702_10002642 3300026078 Bacteria 16821
549 Ga0207702_10161024 3300026078 Bacteria 2049
550 Ga0207702_10219674 3300026078 Bacteria 1770
551 Ga0207702_10304987 3300026078 Bacteria 1512
552 Ga0207702_10370211 3300026078 Bacteria 1375
553 Ga0207641_10001370 3300026088 Bacteria 24094
554 Ga0207641_10294594 3300026088 Bacteria 1530
555 Ga0207648_10001663 3300026089 Bacteria 24358
556 Ga0207648_10002036 3300026089 Bacteria 22064
557 Ga0207676_10004314 3300026095 Bacteria 10058
558 Ga0207676_10018460 3300026095 Bacteria 5070
559 Ga0207674_10002956 3300026116 Bacteria 21106
560 Ga0207674_10184058 3300026116 Bacteria 2039
561 Ga0207674_10196229 3300026116 Bacteria 1968
562 Ga0207675_100006209 3300026118 Bacteria 11346
563 Ga0207675_100007875 3300026118 Bacteria 10055
564 Ga0207675_100075048 3300026118 Bacteria 3165
565 Ga0207675_100528153 3300026118 Bacteria 1177
566 Ga0207683_10001904 3300026121 Bacteria 18455
567 Ga0207683_10009531 3300026121 Bacteria 8276
568 Ga0207683_10067251 3300026121 Bacteria 3161
569 Ga0207698_10001980 3300026142 Bacteria 12051
570 Ga0207698_10003723 3300026142 Bacteria 9223
571 Ga0207698_10026412 3300026142 Bacteria 4107
572 Ga0209973_1011826 3300027252 Bacteria 1053
573 Ga0210002_1000354 3300027617 Bacteria 6258
574 Ga0210002_1014531 3300027617 Bacteria 1235
575 Ga0209971_1005583 3300027682 Bacteria 2986
576 Ga0209966_1001997 3300027695 Bacteria 3413
577 Ga0209998_10001696 3300027717 Bacteria 5264
578 Ga0209998_10002995 3300027717 Bacteria 3758
579 Ga0209974_10000502 3300027876 Bacteria 13050
580 Ga0207428_10002104 3300027907 Bacteria 20069
581 Ga0207428_10002830 3300027907 Bacteria 17218
582 Ga0207428_10002977 3300027907 Bacteria 16750
583 Ga0207428_10005357 3300027907 Bacteria 11969
584 Ga0207428_10070447 3300027907 Bacteria 2748
585 Ga0207428_10389055 3300027907 Bacteria 1022
586 Ga0268266_10019214 3300028379 Bacteria 5819
587 Ga0268266_10042402 3300028379 Bacteria 3886
588 Ga0268265_10000817 3300028380 Bacteria 29538
589 Ga0268265_10079471 3300028380 Bacteria 2583
590 Ga0268265_10366513 3300028380 Bacteria 1321
591 Ga0268264_10001227 3300028381 Bacteria 24655
592 Ga0268264_10062211 3300028381 Bacteria 3134
593 Ga0268264_10219849 3300028381 Bacteria 1748
594 Ga0268264_10262104 3300028381 Bacteria 1611
595 Ga0265337_1001372 3300028556 Bacteria 11994
596 Ga0265338_10018779 3300028800 Bacteria 7379
597 Ga0265338_10020724 3300028800 Bacteria 6897
598 Ga0265338_10038967 3300028800 Bacteria 4492
599 Ga0265338_10391317 3300028800 Bacteria 992
600 Ga0265338_10406651 3300028800 Bacteria 969
601 Ga0265325_10000043 3300031241 Bacteria 89158
602 Ga0265325_10002820 3300031241 Bacteria 11596
603 Ga0265325_10026685 3300031241 Bacteria 3126
604 Ga0265325_10027239 3300031241 Bacteria 3090
605 Ga0265325_10038759 3300031241 Bacteria 2513
606 Ga0265340_10006632 3300031247 Bacteria 6350
607 Ga0265340_10123403 3300031247 Bacteria 1191
608 Ga0265339_10000091 3300031249 Bacteria 75937
609 Ga0265339_10031675 3300031249 Bacteria 2986
610 Ga0265316_10032664 3300031344 Bacteria 4246
611 Ga0265313_10000260 3300031595 Bacteria 57581
612 Ga0265313_10024154 3300031595 Bacteria 3254
613 Ga0265314_10006712 3300031711 Bacteria 10106
614 Ga0265314_10191643 3300031711 Bacteria 1216
615 Ga0265342_10000290 3300031712 Bacteria 56854
616 Ga0265342_10014743 3300031712 Bacteria 5176
617 Ga0373930_0000266 3300034816 Bacteria 6666
618 Ga0373930_0010805 3300034816 Bacteria 1638
619 Ga0373948_0000471 3300034817 Bacteria 5018
620 Ga0373948_0006126 3300034817 Bacteria 1977
621 Ga0373950_0000324 3300034818 Bacteria 5986
622 Ga0373950_0014500 3300034818 Bacteria 1326
623 Ga0373958_0000451 3300034819 Bacteria 5021
624 Ga0373938_0000308 3300034957 Bacteria 7806
625 Ga0373938_0000348 3300034957 Bacteria 7337
626 Ga0373926_0002868 3300035083 Bacteria 5523
627 Ga0373926_0008286 3300035083 Bacteria 3458
628 Ga0373926_0085199 3300035083 Bacteria 1172
629 Ga0373928_0001853 3300035084 Bacteria 4124
630 Ga0373928_0002060 3300035084 Bacteria 3915
631 Ga0373934_0015266 3300035086 Bacteria 2913
632 Ga0373934_0027772 3300035086 Bacteria 2201
633 Ga0373934_0068018 3300035086 Bacteria 1423
634 Ga0373940_0001082 3300035088 Bacteria 4724
635 Ga0373940_0003271 3300035088 Bacteria 3283
636 Ga0373940_0008910 3300035088 Bacteria 2317
637 Ga0373944_0003210 3300035089 Bacteria 4200
638 Ga0373944_0005831 3300035089 Bacteria 3258
639 Ga0373944_0031938 3300035089 Bacteria 1587
640 Ga0373944_0038845 3300035089 Bacteria 1463
641 Ga0373944_0052200 3300035089 Bacteria 1291
642 Ga0373944_0079206 3300035089 Bacteria 1082
643 Ga0373949_0004203 3300035090 Bacteria 3325
644 Ga0373949_0034321 3300035090 Bacteria 1222
645 Ga0373951_0001125 3300035091 Bacteria 7115
646 Ga0373952_0000133 3300035092 Bacteria 10703
647 Ga0373952_0008267 3300035092 Bacteria 1971
648 Ga0373952_0010301 3300035092 Bacteria 1804
649 Ga0373923_0012826 3300035111 Bacteria 3110
650 Ga0373923_0027798 3300035111 Bacteria 2259
651 Ga0373923_0031402 3300035111 Bacteria 2141
652 Ga0373932_0001964 3300035112 Bacteria 5434
653 Ga0373936_0031194 3300035113 Bacteria 2104
654 Ga0373936_0052387 3300035113 Bacteria 1653
655 Ga0373939_0000343 3300035114 Bacteria 11867
656 Ga0373939_0005408 3300035114 Bacteria 3041
657 Ga0373939_0033924 3300035114 Bacteria 1494
658 Ga0373941_0001154 3300035115 Bacteria 5508
659 Ga0373945_0004512 3300035116 Bacteria 4424
660 Ga0373945_0042669 3300035116 Bacteria 1644
661 Ga0373953_0003117 3300035117 Bacteria 5110
662 Ga0373953_0054496 3300035117 Bacteria 1622
663 Ga0373953_0119651 3300035117 Bacteria 1118
664 Ga0373954_0006503 3300035118 Bacteria 5095
665 Ga0373954_0086937 3300035118 Bacteria 1498
666 Ga0373956_0001924 3300035119 Bacteria 8571
667 Ga0373956_0009376 3300035119 Bacteria 3982
668 Ga0373956_0021669 3300035119 Bacteria 2742
669 Ga0373956_0120090 3300035119 Bacteria 1227
670 Ga0373957_0001572 3300035120 Bacteria 6231
671 Ga0373960_0002646 3300035121 Bacteria 4050
672 Ga0373960_0007249 3300035121 Bacteria 2623
673 Ga0373943_0005039 3300035170 Bacteria 5958
674 Ga0373943_0007317 3300035170 Bacteria 4956
675 Ga0373943_0008492 3300035170 Bacteria 4606
676 Ga0373943_0034153 3300035170 Bacteria 2425
677 Ga0373946_0010820 3300035171 Bacteria 3388
678 Ga0373946_0072114 3300035171 Bacteria 1494
679 Ga0373946_0117386 3300035171 Bacteria 1211
680 Ga0373955_0002275 3300035172 Bacteria 8339
681 Ga0373955_0007053 3300035172 Bacteria 5147
682 Ga0373955_0022739 3300035172 Bacteria 3184
683 Ga0373955_0027293 3300035172 Bacteria 2949
684 Ga0373955_0052897 3300035172 Bacteria 2216
685 Ga0373942_0001912 3300035207 Bacteria 5225
686 Ga0373942_0005068 3300035207 Bacteria 3056
687 Ga0373942_0012073 3300035207 Bacteria 2057
688 Ga0373962_0000253 3300035242 Bacteria 11386
689 Ga0373962_0013895 3300035242 Bacteria 2045
690 Ga0373924_0005148 3300035410 Bacteria 4615
691 Ga0373924_0020722 3300035410 Bacteria 2558
692 Ga0373931_0000714 3300035691 Bacteria 13748
693 Ga0373931_0001610 3300035691 Bacteria 9775
694 Ga0373931_0025062 3300035691 Bacteria 3028
695 Ga0373931_0054884 3300035691 Bacteria 2131
696 Ga0373935_0004317 3300035692 Bacteria 8341
697 Ga0373935_0023439 3300035692 Bacteria 3793
698 Ga0373935_0190134 3300035692 Bacteria 1414
699 Ga0373935_0302081 3300035692 Bacteria 1131
700 Ga0373927_0007289 3300035695 Bacteria 7502
701 Ga0373927_0009357 3300035695 Bacteria 6572
702 Ga0373927_0018783 3300035695 Bacteria 4536
703 Ga0373927_0027987 3300035695 Bacteria 3678
704 Ga0373927_0047576 3300035695 Bacteria 2774
705 Ga0373927_0060880 3300035695 Bacteria 2442
706 Ga0373927_0137079 3300035695 Bacteria 1600
707 Ga0373927_0263026 3300035695 Bacteria 1135
708 Ga0373933_0001224 3300035724 Bacteria 15196
709 Ga0373933_0002515 3300035724 Bacteria 10296
710 Ga0373933_0005081 3300035724 Bacteria 7174
711 Ga0373933_0100261 3300035724 Bacteria 1796
712 Ga0373933_0189294 3300035724 Bacteria 1314
713 Ga0373933_0196441 3300035724 Bacteria 1290
714 Ga0373947_0002242 3300035725 Bacteria 11693
715 Ga0373947_0005699 3300035725 Bacteria 7261
716 Ga0373947_0029617 3300035725 Bacteria 3213
717 Ga0373947_0039388 3300035725 Bacteria 2811
718 Ga0373947_0043254 3300035725 Bacteria 2690
719 Ga0373947_0059857 3300035725 Bacteria 2310
720 Ga0373937_0000975 3300036401 Bacteria 24290
721 Ga0373937_0001146 3300036401 Bacteria 22227
722 Ga0373937_0005174 3300036401 Bacteria 11127
723 Ga0373937_0008485 3300036401 Bacteria 8929
724 Ga0373937_0052710 3300036401 Bacteria 3731
725 Ga0373937_0155073 3300036401 Bacteria 2146
726 Ga0373937_0313823 3300036401 Bacteria 1483
727 Ga0373937_0649147 3300036401 Bacteria 1001
728 Ga0373925_0000957 3300037068 Bacteria 26248
729 Ga0373925_0009418 3300037068 Bacteria 7112
730 Ga0373925_0055962 3300037068 Bacteria 2954
731 Ga0373925_0099421 3300037068 Bacteria 2234
732 Ga0373925_0168422 3300037068 Bacteria 1728
733 Ga0373925_0402600 3300037068 Bacteria 1116
734 Ga0395899_0008367 3300037312 Bacteria 7963
735 Ga0395900_0005495 3300037418 Bacteria 13263
736 Ga0395900_0024104 3300037418 Bacteria 6229
737 Ga0395898_0007621 3300037466 Bacteria 11490
738 Ga0395898_0017809 3300037466 Bacteria 7248
739 Ga0395898_0129220 3300037466 Bacteria 2420
740 Ga0395898_0132944 3300037466 Bacteria 2382
741 Ga0395901_0008887 3300038443 Bacteria 10173
742 Ga0395901_0027102 3300038443 Bacteria 5885
743 Ga0395901_0119180 3300038443 Bacteria 2773
744 Ga0395901_0174151 3300038443 Bacteria 2257
745 Ga0395901_0367506 3300038443 Bacteria 1482
746 Ga0436360_1080146 3300039438 Bacteria 1921
747 Ga0436361_0057894 3300039447 Bacteria 1086
748 Ga0436361_0112922 3300039447 Bacteria 897
749 Ga0436361_1189806 3300039447 Bacteria 31675
750 Ga0451841_1103901 3300041498 Bacteria 1129
751 Ga0466966_0138105 3300044684 Bacteria 1490
752 Ga0466963_0096029 3300044694 Bacteria 2024
753 Ga0466963_0112620 3300044694 Bacteria 1868
754 Ga0466964_0197903 3300044706 Bacteria 963
755 Ga0466971_0063342 3300044719 Bacteria 1674
756 Ga0466957_0012433 3300044842 Bacteria 4927
757 Ga0466959_0021191 3300045049 Bacteria 4792
758 Ga0451576_0091489 3300045051 Bacteria 3164
759 Ga0466958_0034909 3300045836 Bacteria 3002
760 Ga0466967_0010562 3300045976 Bacteria 6934
761 Ga0466967_0294718 3300045976 Bacteria 1559
762 Ga0466967_0448740 3300045976 Bacteria 1260
763 Ga0495617_029664 3300046452 Bacteria 1839
764 Ga0495592_0008218 3300046454 Bacteria 7837
765 Ga0495592_0026610 3300046454 Bacteria 4384
766 Ga0495592_0047700 3300046454 Bacteria 3189
767 Ga0495592_0072135 3300046454 Bacteria 2513
768 Ga0495592_0127285 3300046454 Bacteria 1785
769 Ga0495603_0007025 3300046455 Bacteria 6757
770 Ga0495603_0069549 3300046455 Bacteria 2070
771 Ga0495603_0099243 3300046455 Bacteria 1700
772 Ga0495603_0273942 3300046455 Bacteria 970
773 Ga0495629_0002009 3300046459 Bacteria 15810
774 Ga0495629_0010732 3300046459 Bacteria 6663
775 Ga0495629_0027195 3300046459 Bacteria 4063
776 Ga0495629_0043069 3300046459 Bacteria 3170
777 Ga0495629_0350973 3300046459 Bacteria 1006
778 Ga0495638_0034210 3300046460 Bacteria 3245
779 Ga0495641_0027895 3300046461 Bacteria 2738
780 Ga0495641_0029573 3300046461 Bacteria 2638
781 Ga0495641_0056413 3300046461 Bacteria 1780
782 Ga0495641_0091423 3300046461 Bacteria 1360
783 Ga0495651_0003394 3300046462 Bacteria 12218
784 Ga0495651_0036961 3300046462 Bacteria 3802
785 Ga0495651_0048365 3300046462 Bacteria 3285
786 Ga0495651_0054410 3300046462 Bacteria 3078
787 Ga0495651_0063674 3300046462 Bacteria 2818
788 Ga0495651_0189383 3300046462 Bacteria 1449
789 Ga0495653_0004970 3300046463 Bacteria 10793
790 Ga0495653_0010292 3300046463 Bacteria 7654
791 Ga0495653_0012696 3300046463 Bacteria 6881
792 Ga0495653_0079954 3300046463 Bacteria 2420
793 Ga0495653_0233014 3300046463 Bacteria 1231
794 Ga0495580_0009608 3300046472 Bacteria 7596
795 Ga0495580_0053605 3300046472 Bacteria 2845
796 Ga0495580_0057294 3300046472 Bacteria 2743
797 Ga0495582_0009496 3300046473 Bacteria 5359
798 Ga0495582_0012182 3300046473 Bacteria 4737
799 Ga0495582_0078514 3300046473 Bacteria 1831
800 Ga0495605_0082857 3300046474 Bacteria 1498
801 Ga0495639_0066440 3300046475 Bacteria 1660
802 Ga0495639_0073431 3300046475 Bacteria 1583
803 Ga0495662_0014265 3300046476 Bacteria 3864
804 Ga0495662_0114650 3300046476 Bacteria 1321
805 Ga0495664_0005349 3300046477 Bacteria 7045
806 Ga0495664_0009436 3300046477 Bacteria 5459
807 Ga0495664_0024516 3300046477 Bacteria 3507
808 Ga0495664_0042324 3300046477 Bacteria 2697
809 Ga0495584_0017374 3300046491 Bacteria 3663
810 Ga0495584_0023045 3300046491 Bacteria 3158
811 Ga0495584_0045524 3300046491 Bacteria 2213
812 Ga0495585_0057566 3300046492 Bacteria 2145
813 Ga0495594_0024127 3300046499 Bacteria 3264
814 Ga0495594_0024998 3300046499 Bacteria 3209
815 Ga0495594_0026850 3300046499 Bacteria 3100
816 Ga0495594_0139585 3300046499 Bacteria 1374
817 Ga0495607_0043208 3300046501 Bacteria 2667
818 Ga0495607_0051344 3300046501 Bacteria 2395
819 Ga0495583_0106016 3300046506 Bacteria 1195
820 Ga0495608_0002249 3300046511 Bacteria 13939
821 Ga0495608_0004206 3300046511 Bacteria 10314
822 Ga0495608_0091167 3300046511 Bacteria 1971
823 Ga0495618_0001172 3300046514 Bacteria 17756
824 Ga0495618_0001619 3300046514 Bacteria 15047
825 Ga0495618_0004363 3300046514 Bacteria 8701
826 Ga0495618_0374084 3300046514 Bacteria 875
827 Ga0495618_0426580 3300046514 Bacteria 808
828 Ga0495628_0012115 3300046516 Bacteria 7269
829 Ga0495628_0015917 3300046516 Bacteria 6275
830 Ga0495628_0036636 3300046516 Bacteria 3935
831 Ga0495628_0115301 3300046516 Bacteria 2063
832 Ga0495630_0008146 3300046517 Bacteria 7528
833 Ga0495630_0008748 3300046517 Bacteria 7273
834 Ga0495630_0062990 3300046517 Bacteria 2786
835 Ga0495630_0124544 3300046517 Bacteria 1955
836 Ga0495630_0171519 3300046517 Bacteria 1653
837 Ga0495630_0189414 3300046517 Bacteria 1569
838 Ga0495630_0413098 3300046517 Bacteria 1034
839 Ga0495631_0060265 3300046518 Bacteria 1647
840 Ga0495637_0023416 3300046520 Bacteria 2807
841 Ga0495644_0006450 3300046523 Bacteria 4546
842 Ga0495644_0018349 3300046523 Bacteria 2672
843 Ga0495666_0008087 3300046526 Bacteria 5272
844 Ga0495666_0114582 3300046526 Bacteria 1265
845 Ga0495652_0005206 3300046529 Bacteria 12292
846 Ga0495652_0009266 3300046529 Bacteria 8947
847 Ga0495652_0024740 3300046529 Bacteria 5314
848 Ga0495652_0028155 3300046529 Bacteria 4948
849 Ga0495652_0051485 3300046529 Bacteria 3516
850 Ga0495665_0030853 3300046531 Bacteria 2867
851 Ga0495665_0036404 3300046531 Bacteria 2627
852 Ga0495665_0061885 3300046531 Bacteria 1977
853 Ga0495640_0005042 3300046533 Bacteria 10490
854 Ga0495640_0010221 3300046533 Bacteria 7262
855 Ga0495640_0058007 3300046533 Bacteria 2641
856 Ga0495586_0002128 3300046535 Bacteria 10768
857 Ga0495587_0003095 3300046536 Bacteria 11115
858 Ga0495587_0009385 3300046536 Bacteria 6272
859 Ga0495587_0058871 3300046536 Bacteria 2256
860 Ga0495587_0085920 3300046536 Bacteria 1821
861 Ga0495645_0003434 3300046543 Bacteria 10742
862 Ga0495645_0010106 3300046543 Bacteria 6612
863 Ga0495645_0020403 3300046543 Bacteria 4779
864 Ga0495645_0223701 3300046543 Bacteria 1264
865 Ga0495622_0012355 3300046557 Bacteria 3952
866 Ga0495622_0089885 3300046557 Bacteria 1411
867 Ga0495622_0157356 3300046557 Bacteria 1026
868 Ga0495633_0010291 3300046558 Bacteria 5114
869 Ga0495667_0001067 3300046559 Bacteria 17817
870 Ga0495667_0014053 3300046559 Bacteria 5404
871 Ga0495667_0026810 3300046559 Bacteria 3882
872 Ga0495667_0057759 3300046559 Bacteria 2550
873 Ga0495667_0159583 3300046559 Bacteria 1450
874 Ga0495667_0288433 3300046559 Bacteria 1041
875 Ga0495656_0008765 3300046615 Bacteria 3622
876 Ga0495656_0009015 3300046615 Bacteria 3580
877 Ga0495656_0009923 3300046615 Bacteria 3443
878 Ga0495668_0188077 3300046616 Bacteria 1131
879 Ga0495634_0006047 3300046642 Bacteria 9235
880 Ga0495634_0010688 3300046642 Bacteria 6719
881 Ga0495634_0051910 3300046642 Bacteria 2750
882 Ga0495611_0167764 3300046648 Bacteria 1026
883 Ga0495635_0000394 3300046663 Bacteria 27871
884 Ga0495635_0005384 3300046663 Bacteria 8903
885 Ga0495635_0019246 3300046663 Bacteria 4761
886 Ga0495635_0021691 3300046663 Bacteria 4476
887 Ga0495635_0145178 3300046663 Bacteria 1615
888 Ga0495635_0186123 3300046663 Bacteria 1410
889 Ga0495635_0373986 3300046663 Bacteria 949
890 Ga0495659_0002989 3300046664 Bacteria 5423
891 Ga0495659_0023278 3300046664 Bacteria 2104
892 Ga0495661_0185327 3300046665 Bacteria 1100
893 Ga0495588_0028556 3300046674 Bacteria 2792
894 Ga0495588_0036562 3300046674 Bacteria 2492
895 Ga0495588_0061784 3300046674 Bacteria 1941
896 Ga0495657_0007463 3300046675 Bacteria 8451
897 Ga0495657_0028576 3300046675 Bacteria 3920
898 Ga0495599_0005526 3300046678 Bacteria 7574
899 Ga0495599_0006759 3300046678 Bacteria 6927
900 Ga0495599_0028649 3300046678 Bacteria 3489
901 Ga0495599_0063227 3300046678 Bacteria 2312
902 Ga0495599_0090628 3300046678 Bacteria 1908
903 Ga0495623_0003882 3300046679 Bacteria 9855
904 Ga0495623_0004291 3300046679 Bacteria 9385
905 Ga0495623_0070510 3300046679 Bacteria 2177
906 Ga0495623_0145164 3300046679 Bacteria 1408
907 Ga0495646_0002070 3300046680 Bacteria 12167
908 Ga0495646_0006456 3300046680 Bacteria 7438
909 Ga0495646_0019315 3300046680 Bacteria 4315
910 Ga0495647_0004254 3300046681 Bacteria 4637
911 Ga0495647_0024504 3300046681 Bacteria 2196
912 Ga0495647_0045315 3300046681 Bacteria 1689
913 Ga0495658_0001175 3300046683 Bacteria 13809
914 Ga0495658_0009413 3300046683 Bacteria 4869
915 Ga0495658_0013122 3300046683 Bacteria 4215
916 Ga0495658_0016699 3300046683 Bacteria 3780
917 Ga0495658_0172940 3300046683 Bacteria 1337
918 Ga0495669_0032935 3300046684 Bacteria 2280
919 Ga0495669_0123140 3300046684 Bacteria 1217
920 Ga0495613_0011644 3300046689 Bacteria 6538
921 Ga0495613_0012697 3300046689 Bacteria 6263
922 Ga0495613_0063318 3300046689 Bacteria 2706
923 Ga0495613_0066265 3300046689 Bacteria 2638
924 Ga0495613_0078961 3300046689 Bacteria 2393
925 Ga0495613_0180415 3300046689 Bacteria 1495
926 Ga0495613_0258265 3300046689 Bacteria 1214
927 Ga0495624_0007769 3300046690 Bacteria 7525
928 Ga0495624_0041258 3300046690 Bacteria 2952
929 Ga0495624_0051645 3300046690 Bacteria 2600
930 Ga0495624_0061672 3300046690 Bacteria 2348
931 Ga0495624_0124212 3300046690 Bacteria 1584
932 Ga0495624_0190636 3300046690 Bacteria 1247
933 Ga0495624_0248670 3300046690 Bacteria 1075
934 Ga0495670_0019898 3300046691 Bacteria 3307
935 Ga0495670_0073632 3300046691 Bacteria 1731
936 Ga0495671_0025916 3300046692 Bacteria 3044
937 Ga0495589_0018433 3300046794 Bacteria 3578
938 Ga0495589_0047695 3300046794 Bacteria 2122
939 Ga0495600_0001574 3300046809 Bacteria 12692
940 Ga0495600_0004625 3300046809 Bacteria 8248
941 Ga0495600_0016416 3300046809 Bacteria 4698
942 Ga0495600_0037714 3300046809 Bacteria 3143
943 Ga0495600_0177978 3300046809 Bacteria 1371
944 Ga0495660_0171133 3300046810 Bacteria 1058
945 Ga0495581_0108430 3300047315 Bacteria 1614
946 Ga0495581_0119535 3300047315 Bacteria 1533
947 Ga0495581_0144521 3300047315 Bacteria 1388
948 Ga0495581_0178038 3300047315 Bacteria 1243
949 Ga0495604_0000150 3300047317 Bacteria 60582
950 Ga0495604_0003694 3300047317 Bacteria 12194
951 Ga0495604_0023789 3300047317 Bacteria 4889
952 Ga0495604_0027799 3300047317 Bacteria 4498
953 Ga0495604_0170528 3300047317 Bacteria 1531
954 Ga0495674_0032084 3300047319 Bacteria 4767
955 Ga0495674_0040455 3300047319 Bacteria 4169
956 Ga0495674_0040811 3300047319 Bacteria 4148
957 Ga0495674_0044803 3300047319 Bacteria 3931
958 Ga0495674_0052198 3300047319 Bacteria 3599
959 Ga0495674_0306325 3300047319 Bacteria 1297
960 Ga0495676_0039309 3300047321 Bacteria 3919
961 Ga0495676_0121478 3300047321 Bacteria 1899
962 Ga0495676_0123925 3300047321 Bacteria 1875
963 Ga0495676_0130925 3300047321 Bacteria 1811
964 Ga0495680_0000699 3300047322 Bacteria 37651
965 Ga0495680_0012767 3300047322 Bacteria 7367
966 Ga0495680_0036916 3300047322 Bacteria 3918
967 Ga0495680_0041150 3300047322 Bacteria 3675
968 Ga0495680_0042507 3300047322 Bacteria 3605
969 Ga0495680_0093890 3300047322 Bacteria 2245
970 Ga0495680_0154834 3300047322 Bacteria 1668
971 Ga0495680_0338998 3300047322 Bacteria 1049
972 Ga0495675_0001338 3300047444 Bacteria 14916
973 Ga0495675_0004135 3300047444 Bacteria 8786
974 Ga0495675_0007130 3300047444 Bacteria 6878
975 Ga0495675_0038177 3300047444 Bacteria 3058
976 Ga0495677_0038474 3300047445 Bacteria 1748
977 Ga0495679_019083 3300047446 Bacteria 2418
978 Ga0495684_0006000 3300047471 Bacteria 9439
979 Ga0495684_0011394 3300047471 Bacteria 6866
980 Ga0495684_0064230 3300047471 Bacteria 2789
981 Ga0495684_0079614 3300047471 Bacteria 2487
982 Ga0495684_0098651 3300047471 Bacteria 2209
983 Ga0495684_0237746 3300047471 Bacteria 1330
984 Ga0495684_0347368 3300047471 Bacteria 1054
985 Ga0495684_0405297 3300047471 Bacteria 956
986 Ga0495593_0007939 3300047673 Bacteria 6183
987 Ga0495593_0009818 3300047673 Bacteria 5555
988 Ga0495593_0018341 3300047673 Bacteria 3932
989 Ga0495593_0019894 3300047673 Bacteria 3761
990 Ga0495593_0024774 3300047673 Bacteria 3322
991 Ga0495593_0164041 3300047673 Bacteria 1121
992 Ga0495602_0002392 3300048088 Bacteria 19051
993 Ga0495602_0007064 3300048088 Bacteria 11787
994 Ga0495602_0014347 3300048088 Bacteria 8047
995 Ga0495602_0018808 3300048088 Bacteria 6881
996 Ga0495602_0128720 3300048088 Bacteria 2023
997 Ga0495614_0016606 3300048089 Bacteria 3202
998 Ga0495626_0048998 3300048091 Bacteria 1958
999 Ga0495626_0173809 3300048091 Bacteria 897
1000 Ga0496100_0004244 3300048903 Bacteria 7575
1001 Ga0496100_0023159 3300048903 Bacteria 3768
1002 Ga0496100_0059421 3300048903 Bacteria 2512
1003 Ga0496100_0396793 3300048903 Bacteria 1050
1004 Ga0496101_0001185 3300048904 Bacteria 15593
1005 Ga0496101_0024670 3300048904 Bacteria 4164
1006 Ga0496101_0040403 3300048904 Bacteria 3322
1007 Ga0496101_0060997 3300048904 Bacteria 2737
1008 Ga0496102_0001427 3300048905 Bacteria 21201
1009 Ga0496102_0018136 3300048905 Bacteria 6176
1010 Ga0496102_0018426 3300048905 Bacteria 6136
1011 Ga0496102_0053452 3300048905 Bacteria 3681
1012 Ga0496102_0087263 3300048905 Bacteria 2882
1013 Ga0496102_0371997 3300048905 Bacteria 1345
1014 Ga0496103_0001145 3300048906 Bacteria 18320
1015 Ga0496103_0001524 3300048906 Bacteria 15476
1016 Ga0496103_0031477 3300048906 Bacteria 3232
1017 Ga0496103_0114348 3300048906 Bacteria 1716
1018 Ga0496103_0153280 3300048906 Bacteria 1476
1019 Ga0496103_0285618 3300048906 Bacteria 1061
1020 Ga0496104_0000800 3300048907 Bacteria 27054
1021 Ga0496104_0004650 3300048907 Bacteria 11943
1022 Ga0496104_0008602 3300048907 Bacteria 9077
1023 Ga0496104_0080146 3300048907 Bacteria 3113
1024 Ga0496104_0267042 3300048907 Bacteria 1623
1025 Ga0496105_0001601 3300048908 Bacteria 16034
1026 Ga0496105_0007169 3300048908 Bacteria 8604
1027 Ga0496105_0043840 3300048908 Bacteria 3689
1028 Ga0496105_0055640 3300048908 Bacteria 3266
1029 Ga0496105_0127762 3300048908 Bacteria 2095
1030 Ga0496105_0131368 3300048908 Bacteria 2064
1031 Ga0496105_0133812 3300048908 Bacteria 2043
1032 Ga0496105_0464510 3300048908 Bacteria 998
1033 Ga0496105_0596551 3300048908 Bacteria 857
1034 Ga0496106_0000644 3300048909 Bacteria 24997
1035 Ga0496106_0001471 3300048909 Bacteria 17692
1036 Ga0496106_0004769 3300048909 Bacteria 10023
1037 Ga0496106_0038434 3300048909 Bacteria 3581
1038 Ga0496106_0074471 3300048909 Bacteria 2599
1039 Ga0496106_0107912 3300048909 Bacteria 2165
1040 Ga0496107_0000844 3300048910 Bacteria 17921
1041 Ga0496107_0003765 3300048910 Bacteria 10189
1042 Ga0496107_0009226 3300048910 Bacteria 6836
1043 Ga0496107_0009798 3300048910 Bacteria 6645
1044 Ga0496107_0057610 3300048910 Bacteria 2809
1045 Ga0496107_0087269 3300048910 Bacteria 2278
1046 Ga0496107_0328215 3300048910 Bacteria 1138
1047 Ga0496108_0002624 3300048911 Bacteria 14402
1048 Ga0496108_0008578 3300048911 Bacteria 8288
1049 Ga0496108_0103900 3300048911 Bacteria 2424
1050 Ga0496108_0255868 3300048911 Bacteria 1523
1051 Ga0496108_0317487 3300048911 Bacteria 1358
1052 Ga0496108_0606640 3300048911 Bacteria 953
1053 Ga0496109_0003011 3300048912 Bacteria 14061
1054 Ga0496109_0003467 3300048912 Bacteria 13168
1055 Ga0496109_0007324 3300048912 Bacteria 9331
1056 Ga0496109_0017542 3300048912 Bacteria 6275
1057 Ga0496109_0040794 3300048912 Bacteria 4204
1058 Ga0496109_0169524 3300048912 Bacteria 2047
1059 Ga0496109_0274510 3300048912 Bacteria 1588
1060 Ga0496110_0002024 3300048913 Bacteria 15093
1061 Ga0496110_0007086 3300048913 Bacteria 8924
1062 Ga0496110_0020732 3300048913 Bacteria 5550
1063 Ga0496110_0148698 3300048913 Bacteria 2120
1064 Ga0496111_0001913 3300048914 Bacteria 12326
1065 Ga0496111_0010288 3300048914 Bacteria 6267
1066 Ga0496111_0028229 3300048914 Bacteria 3976
1067 Ga0496111_0029166 3300048914 Bacteria 3917
1068 Ga0496111_0559644 3300048914 Bacteria 839
1069 Ga0496112_0019149 3300048915 Bacteria 6454
1070 Ga0496112_0230062 3300048915 Bacteria 1808
1071 Ga0496112_0623309 3300048915 Bacteria 1009
1072 Ga0496113_0004226 3300048916 Bacteria 8786
1073 Ga0496113_0007869 3300048916 Bacteria 6893
1074 Ga0496113_0086459 3300048916 Bacteria 2409
1075 Ga0496113_0172048 3300048916 Bacteria 1715
1076 Ga0496113_0446123 3300048916 Bacteria 1039
1077 Ga0496114_0014349 3300048917 Bacteria 6355
1078 Ga0496114_0068992 3300048917 Bacteria 2968
1079 Ga0496114_0089006 3300048917 Bacteria 2619
1080 Ga0496114_0275581 3300048917 Bacteria 1482
1081 Ga0496115_0018826 3300048918 Bacteria 5309
1082 Ga0496115_0061514 3300048918 Bacteria 3027
1083 Ga0496115_0095801 3300048918 Bacteria 2429
1084 Ga0496115_0114500 3300048918 Bacteria 2216
1085 Ga0496115_0196993 3300048918 Bacteria 1664
1086 Ga0496115_0215546 3300048918 Bacteria 1585
1087 Ga0496115_0368967 3300048918 Bacteria 1169
1088 Ga0496125_0196111 3300048928 Bacteria 1328
1089 Ga0501034_0032933 3300049571 Bacteria 5262
1090 Ga0501034_0144463 3300049571 Bacteria 2357
1091 Ga0501036_0591718 3300049572 Bacteria 921
1092 Ga0501039_0196099 3300049575 Bacteria 1588
1093 Ga0501046_0212367 3300049580 Bacteria 1436
1094 Ga0501047_0323981 3300049581 Bacteria 1380
1095 Ga0501047_0453050 3300049581 Bacteria 1112
1096 Ga0501067_0160652 3300049583 Bacteria 1251
1097 Ga0501074_0254866 3300049590 Bacteria 1248
1098 Ga0501075_0046021 3300049591 Bacteria 3277
1099 Ga0501076_0392448 3300049592 Bacteria 1141
1100 Ga0501077_0100807 3300049593 Bacteria 1830
1101 Ga0501079_0023386 3300049741 Bacteria 4742
1102 Ga0501080_0087239 3300049742 Bacteria 2899
1103 Ga0501044_0116295 3300049823 Bacteria 2680
1104 nmdc:mga03683_13694_c1 3300050489 Bacteria 2989
1105 nmdc:mga03n38_195905_c1 3300050490 Bacteria 1043
1106 nmdc:mga0yw44_144524_c1 3300050492 Bacteria 1548
1107 nmdc:mga0yw44_15059_c1 3300050492 Bacteria 4129
1108 nmdc:mga0yw44_1739_c1 3300050492 Bacteria 8850
1109 nmdc:mga0yw44_2945_c1 3300050492 Bacteria 7413
1110 nmdc:mga06z11_109499_c1 3300050494 Bacteria 1528
1111 nmdc:mga06z11_40651_c1 3300050494 Bacteria 2322
1112 nmdc:mga04h51_168816_c1 3300050495 Bacteria 846
1113 nmdc:mga07m45_89651_c1 3300050496 Bacteria 1398
1114 nmdc:mga05p37_215917_c1 3300050507 Bacteria 2317
1115 nmdc:mga05p37_40357_c1 3300050507 Bacteria 5731
1116 nmdc:mga05p37_4809_c1 3300050507 Bacteria 15796
1117 nmdc:mga05p37_5180_c1 3300050507 Bacteria 15295
1118 nmdc:mga05p37_6528_c1 3300050507 Bacteria 10109
1119 nmdc:mga09592_18911_c1 3300050508 Bacteria 5652
1120 nmdc:mga09592_2996_c1 3300050508 Bacteria 13695
1121 nmdc:mga09592_3717_c1 3300050508 Bacteria 12298
1122 nmdc:mga09592_452935_c1 3300050508 Unclassified 1107
1123 nmdc:mga0qj67_3244_c1 3300050509 Bacteria 11709
1124 nmdc:mga0qj67_64256_c1 3300050509 Bacteria 2919
1125 nmdc:mga06r32_4964_c1 3300050510 Bacteria 11991
1126 nmdc:mga06r32_5210_c1 3300050510 Bacteria 11684
1127 nmdc:mga06r32_97073_c1 3300050510 Bacteria 2887
1128 nmdc:mga08y16_111162_c1 3300050511 Bacteria 2853
1129 nmdc:mga08y16_248692_c1 3300050511 Bacteria 1837
1130 nmdc:mga08y16_285699_c1 3300050511 Bacteria 1701
1131 nmdc:mga08y16_346068_c1 3300050511 Bacteria 1528
1132 nmdc:mga08y16_4659_c1 3300050511 Bacteria 14281
1133 nmdc:mga08y16_5147_c1 3300050511 Bacteria 13664
1134 nmdc:mga08y16_74716_c1 3300050511 Bacteria 3532
1135 nmdc:mga08y16_95441_c1 3300050511 Bacteria 3097
1136 nmdc:mga0n895_1698_c1 3300050512 Bacteria 16639
1137 nmdc:mga0n895_26906_c1 3300050512 Bacteria 5457
1138 nmdc:mga0n895_296510_c1 3300050512 Bacteria 1639
1139 nmdc:mga0n895_35962_c1 3300050512 Bacteria 4779
1140 nmdc:mga0n895_397986_c1 3300050512 Bacteria 1393
1141 nmdc:mga0n895_75261_c1 3300050512 Bacteria 3356
1142 nmdc:mga0rr50_140884_c1 3300050513 Bacteria 1940
1143 nmdc:mga0rr50_221166_c1 3300050513 Bacteria 1564
1144 nmdc:mga0rr50_241291_c1 3300050513 Bacteria 1498
1145 nmdc:mga08x19_158662_c1 3300050514 Bacteria 1535
1146 nmdc:mga08x19_32342_c1 3300050514 Bacteria 3295
1147 nmdc:mga0a205_151450_c1 3300050515 Bacteria 2219
1148 nmdc:mga0a205_228243_c1 3300050515 Bacteria 1746
1149 nmdc:mga0a205_377641_c1 3300050515 Bacteria 1283
1150 nmdc:mga0a205_39881_c2 3300050515 Bacteria 3323
1151 nmdc:mga0a205_5270_c1 3300050515 Bacteria 11646
1152 nmdc:mga0a205_81900_c1 3300050515 Bacteria 3118
1153 Ga0495601_0000069 3300053077 Bacteria 56291
1154 Ga0495601_0010394 3300053077 Bacteria 5537
1155 Ga0495601_0012835 3300053077 Bacteria 5028
1156 Ga0495601_0028733 3300053077 Bacteria 3445
1157 Ga0495601_0030043 3300053077 Bacteria 3373
1158 Ga0495601_0031923 3300053077 Bacteria 3276
1159 Ga0495601_0061488 3300053077 Bacteria 2384
1160 Ga0495601_0161288 3300053077 Bacteria 1465
1161 Ga0495601_0277156 3300053077 Bacteria 1093
1162 Ga0495612_0000175 3300053078 Bacteria 26975
1163 Ga0495612_0001538 3300053078 Bacteria 9512
1164 Ga0495612_0003729 3300053078 Bacteria 6330
1165 Ga0495612_0013349 3300053078 Bacteria 3309
1166 Ga0495612_0021353 3300053078 Bacteria 2597
1167 Ga0495612_0048575 3300053078 Bacteria 1740
1168 Ga0495612_0055743 3300053078 Bacteria 1630
1169 Ga0495655_0017879 3300053083 Bacteria 1550
1170 Ga0495595_0000221 3300053084 Bacteria 22745
1171 Ga0495595_0002192 3300053084 Bacteria 7589
1172 Ga0495595_0004944 3300053084 Bacteria 5373
1173 Ga0495595_0010549 3300053084 Bacteria 3842
1174 Ga0495595_0019399 3300053084 Bacteria 2949
1175 Ga0495595_0022642 3300053084 Bacteria 2760
1176 Ga0495595_0049289 3300053084 Bacteria 1947
1177 Ga0495595_0063523 3300053084 Bacteria 1733
1178 Ga0495619_0000510 3300053085 Bacteria 25902
1179 Ga0495619_0000546 3300053085 Bacteria 24865
1180 Ga0495619_0001997 3300053085 Bacteria 13578
1181 Ga0495619_0005933 3300053085 Bacteria 7737
1182 Ga0495619_0018617 3300053085 Bacteria 4407
1183 Ga0495619_0023782 3300053085 Bacteria 3927
1184 Ga0495619_0030190 3300053085 Bacteria 3508
1185 Ga0495619_0031858 3300053085 Bacteria 3417
1186 Ga0495619_0033469 3300053085 Bacteria 3338
1187 Ga0495619_0054034 3300053085 Bacteria 2657
1188 Ga0495619_0059368 3300053085 Bacteria 2541
1189 Ga0495619_0157535 3300053085 Bacteria 1567
1190 Ga0495619_0177313 3300053085 Bacteria 1474
1191 Ga0495619_0346024 3300053085 Bacteria 1028
1192 Ga0500566_0136844 3300053094 Bacteria 1304
1193 Ga0500593_035004 3300053117 Bacteria 2248
1194 Ga0500616_0012330 3300053153 Bacteria 5004
1195 Ga0500657_101060 3300053728 Bacteria 1190
1196 Ga0501082_0068379 3300060353 Bacteria 3058
1197 Ga0501082_0153093 3300060353 Bacteria 2003
1198 Ga0501082_0665614 3300060353 Bacteria 911
1199 Ga0466962_0024798 3300061719 Bacteria 2880
1200 Ga0530510_0044639 3300061734 Bacteria 3203
1201 Ga0530510_0083639 3300061734 Bacteria 2324
1202 Ga0530510_0336849 3300061734 Bacteria 1132

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005578 Ga0068854_100541609 Ga0068854_1005416092 234
2 3300025916 Ga0207663_10175795 Ga0207663_101757952 236
3 3300046533 Ga0495640_0010221 Ga0495640_0010221_5655_6413 238
4 3300046642 Ga0495634_0010688 Ga0495634_0010688_5508_6266 238
5 3300028800 Ga0265338_10391317 Ga0265338_103913171 239
6 3300031241 Ga0265325_10000043 Ga0265325_1000004380 241
7 3300046514 Ga0495618_0426580 Ga0495618_0426580_60_785 241
8 3300000044 ARSoilOldRDRAFT_c000297 ARSoilOldRDRAFT_0002973 242
9 3300005439 Ga0070711_100062480 Ga0070711_1000624801 242
10 3300005616 Ga0068852_100288873 Ga0068852_1002888732 242
11 3300009094 Ga0111539_10004508 Ga0111539_100045085 242
12 3300025910 Ga0207684_10408408 Ga0207684_104084081 242
13 3300025940 Ga0207691_10155691 Ga0207691_101556912 242
14 3300027252 Ga0209973_1011826 Ga0209973_10118262 242
15 3300009101 Ga0105247_10339098 Ga0105247_103390982 244
16 3300010375 Ga0105239_10801476 Ga0105239_108014761 244
17 3300013296 Ga0157374_10140876 Ga0157374_101408762 244
18 3300048928 Ga0496125_0196111 Ga0496125_0196111_23_757 244
19 3300009147 Ga0114129_10011980 Ga0114129_100119802 248
20 3300009147 Ga0114129_10080507 Ga0114129_100805074 248
21 3300035084 Ga0373928_0002060 Ga0373928_0002060_2460_3206 248
22 3300035089 Ga0373944_0005831 Ga0373944_0005831_1985_2731 248
23 3300035695 Ga0373927_0018783 Ga0373927_0018783_3011_3757 248
24 3300035725 Ga0373947_0005699 Ga0373947_0005699_3759_4505 248
25 3300046455 Ga0495603_0007025 Ga0495603_0007025_2304_3050 248
26 3300046459 Ga0495629_0002009 Ga0495629_0002009_11104_11850 248
27 3300046461 Ga0495641_0027895 Ga0495641_0027895_440_1186 248
28 3300046499 Ga0495594_0139585 Ga0495594_0139585_221_967 248
29 3300046683 Ga0495658_0001175 Ga0495658_0001175_4449_5195 248
30 3300046684 Ga0495669_0032935 Ga0495669_0032935_771_1559 248
31 3300047315 Ga0495581_0108430 Ga0495581_0108430_693_1439 248
32 3300047321 Ga0495676_0130925 Ga0495676_0130925_692_1438 248
33 3300047322 Ga0495680_0042507 Ga0495680_0042507_1189_1935 248
34 3300047471 Ga0495684_0237746 Ga0495684_0237746_298_1044 248
35 3300049583 Ga0501067_0160652 Ga0501067_0160652_12_758 248
36 3300050507 nmdc:mga05p37_4809_c1 nmdc:mga05p37_4809_c1_14354_15100 248
37 3300050507 nmdc:mga05p37_6528_c1 nmdc:mga05p37_6528_c1_3998_4744 248
38 3300050508 nmdc:mga09592_2996_c1 nmdc:mga09592_2996_c1_12600_13346 248
39 3300050508 nmdc:mga09592_3717_c1 nmdc:mga09592_3717_c1_11206_11952 248
40 3300050509 nmdc:mga0qj67_3244_c1 nmdc:mga0qj67_3244_c1_10868_11614 248
41 3300050509 nmdc:mga0qj67_64256_c1 nmdc:mga0qj67_64256_c1_1335_2081 248
42 3300050510 nmdc:mga06r32_4964_c1 nmdc:mga06r32_4964_c1_350_1096 248
43 3300050510 nmdc:mga06r32_5210_c1 nmdc:mga06r32_5210_c1_10592_11338 248
44 3300050511 nmdc:mga08y16_4659_c1 nmdc:mga08y16_4659_c1_12297_13043 248
45 3300050511 nmdc:mga08y16_5147_c1 nmdc:mga08y16_5147_c1_318_1064 248
46 3300050512 nmdc:mga0n895_35962_c1 nmdc:mga0n895_35962_c1_3684_4430 248
47 3300050512 nmdc:mga0n895_75261_c1 nmdc:mga0n895_75261_c1_172_918 248
48 3300050515 nmdc:mga0a205_81900_c1 nmdc:mga0a205_81900_c1_283_1029 248
49 3300053085 Ga0495619_0000546 Ga0495619_0000546_7097_7843 248
50 3300005434 Ga0070709_10242814 Ga0070709_102428142 250
51 3300006028 Ga0070717_10184932 Ga0070717_101849322 250
52 3300026067 Ga0207678_10246758 Ga0207678_102467581 250
53 3300035089 Ga0373944_0038845 Ga0373944_0038845_664_1416 250
54 3300035111 Ga0373923_0012826 Ga0373923_0012826_811_1563 250
55 3300035117 Ga0373953_0003117 Ga0373953_0003117_3433_4185 250
56 3300035118 Ga0373954_0006503 Ga0373954_0006503_1899_2651 250
57 3300035119 Ga0373956_0001924 Ga0373956_0001924_1230_1982 250
58 3300035172 Ga0373955_0007053 Ga0373955_0007053_4359_5111 250
59 3300035410 Ga0373924_0020722 Ga0373924_0020722_384_1136 250
60 3300035695 Ga0373927_0007289 Ga0373927_0007289_3798_4550 250
61 3300035724 Ga0373933_0002515 Ga0373933_0002515_7191_7943 250
62 3300036401 Ga0373937_0001146 Ga0373937_0001146_17740_18492 250
63 3300037068 Ga0373925_0402600 Ga0373925_0402600_114_866 250
64 3300039447 Ga0436361_0057894 Ga0436361_0057894_290_1042 250
65 3300046454 Ga0495592_0008218 Ga0495592_0008218_2446_3198 250
66 3300046459 Ga0495629_0010732 Ga0495629_0010732_3177_3929 250
67 3300046462 Ga0495651_0003394 Ga0495651_0003394_7290_8042 250
68 3300046463 Ga0495653_0012696 Ga0495653_0012696_3198_3950 250
69 3300046473 Ga0495582_0078514 Ga0495582_0078514_699_1451 250
70 3300046477 Ga0495664_0042324 Ga0495664_0042324_428_1180 250
71 3300046511 Ga0495608_0002249 Ga0495608_0002249_5170_5922 250
72 3300046514 Ga0495618_0001172 Ga0495618_0001172_4777_5529 250
73 3300046516 Ga0495628_0036636 Ga0495628_0036636_672_1424 250
74 3300046517 Ga0495630_0062990 Ga0495630_0062990_1729_2481 250
75 3300046529 Ga0495652_0028155 Ga0495652_0028155_2195_2947 250
76 3300046533 Ga0495640_0005042 Ga0495640_0005042_4883_5635 250
77 3300046536 Ga0495587_0009385 Ga0495587_0009385_3099_3851 250
78 3300046543 Ga0495645_0223701 Ga0495645_0223701_86_838 250
79 3300046559 Ga0495667_0014053 Ga0495667_0014053_1522_2274 250
80 3300046642 Ga0495634_0006047 Ga0495634_0006047_5941_6693 250
81 3300046663 Ga0495635_0005384 Ga0495635_0005384_7202_7954 250
82 3300046678 Ga0495599_0005526 Ga0495599_0005526_2787_3539 250
83 3300046679 Ga0495623_0003882 Ga0495623_0003882_5236_5988 250
84 3300046680 Ga0495646_0019315 Ga0495646_0019315_2872_3624 250
85 3300046689 Ga0495613_0063318 Ga0495613_0063318_1317_2069 250
86 3300046690 Ga0495624_0190636 Ga0495624_0190636_88_840 250
87 3300046809 Ga0495600_0001574 Ga0495600_0001574_6164_6916 250
88 3300047317 Ga0495604_0000150 Ga0495604_0000150_50041_50793 250
89 3300047319 Ga0495674_0040455 Ga0495674_0040455_2080_2832 250
90 3300047322 Ga0495680_0000699 Ga0495680_0000699_27972_28724 250
91 3300047444 Ga0495675_0007130 Ga0495675_0007130_596_1348 250
92 3300047471 Ga0495684_0011394 Ga0495684_0011394_3233_3985 250
93 3300047673 Ga0495593_0024774 Ga0495593_0024774_1088_1840 250
94 3300048088 Ga0495602_0018808 Ga0495602_0018808_3024_3776 250
95 3300053077 Ga0495601_0010394 Ga0495601_0010394_459_1211 250
96 3300053078 Ga0495612_0003729 Ga0495612_0003729_4708_5460 250
97 3300053084 Ga0495595_0000221 Ga0495595_0000221_17999_18751 250
98 3300053085 Ga0495619_0001997 Ga0495619_0001997_8595_9347 250
99 3300037466 Ga0395898_0129220 Ga0395898_0129220_1346_2137 251
100 3300038443 Ga0395901_0119180 Ga0395901_0119180_135_926 251
101 3300046462 Ga0495651_0054410 Ga0495651_0054410_2122_2877 251
102 3300000041 ARcpr5oldR_c000939 ARcpr5oldR_0009392 252
103 3300000041 ARcpr5oldR_c006380 ARcpr5oldR_0063802 252
104 3300000043 ARcpr5yngRDRAFT_c001001 ARcpr5yngRDRAFT_0010012 252
105 3300000652 ARCol0yngRDRAFT_1000069 ARCol0yngRDRAFT_100006929 252
106 3300001430 JGI24032J14994_101229 JGI24032J14994_1012292 252
107 3300001976 JGI24752J21851_1004116 JGI24752J21851_10041162 252
108 3300001977 JGI24746J21847_1000078 JGI24746J21847_10000783 252
109 3300001978 JGI24747J21853_1000030 JGI24747J21853_10000302 252
110 3300001989 JGI24739J22299_10002225 JGI24739J22299_100022252 252
111 3300001990 JGI24737J22298_10001972 JGI24737J22298_100019722 252
112 3300001990 JGI24737J22298_10026703 JGI24737J22298_100267032 252
113 3300001991 JGI24743J22301_10003246 JGI24743J22301_100032462 252
114 3300002070 JGI24750J21931_1000188 JGI24750J21931_100018812 252
115 3300002070 JGI24750J21931_1001805 JGI24750J21931_10018052 252
116 3300002073 JGI24745J21846_1000126 JGI24745J21846_10001262 252
117 3300002074 JGI24748J21848_1006879 JGI24748J21848_10068792 252
118 3300002074 JGI24748J21848_1014790 JGI24748J21848_10147902 252
119 3300002075 JGI24738J21930_10000068 JGI24738J21930_100000685 252
120 3300002075 JGI24738J21930_10005515 JGI24738J21930_100055152 252
121 3300002076 JGI24749J21850_1000122 JGI24749J21850_10001224 252
122 3300002077 JGI24744J21845_10003010 JGI24744J21845_100030102 252
123 3300002077 JGI24744J21845_10004022 JGI24744J21845_100040222 252
124 3300002126 JGI24035J26624_1000121 JGI24035J26624_10001214 252
125 3300002155 JGI24033J26618_1002438 JGI24033J26618_10024382 252
126 3300002239 JGI24034J26672_10000519 JGI24034J26672_100005194 252
127 3300002239 JGI24034J26672_10004919 JGI24034J26672_100049191 252
128 3300002244 JGI24742J22300_10000082 JGI24742J22300_100000823 252
129 3300002244 JGI24742J22300_10001792 JGI24742J22300_100017923 252
130 3300002459 JGI24751J29686_10008626 JGI24751J29686_100086262 252
131 3300002459 JGI24751J29686_10029822 JGI24751J29686_100298221 252
132 3300002459 JGI24751J29686_10041519 JGI24751J29686_100415191 252
133 3300003911 JGI25405J52794_10003641 JGI25405J52794_100036412 252
134 3300005290 Ga0065712_10001352 Ga0065712_100013525 252
135 3300005290 Ga0065712_10013324 Ga0065712_100133241 252
136 3300005290 Ga0065712_10104339 Ga0065712_101043391 252
137 3300005293 Ga0065715_10089172 Ga0065715_100891723 252
138 3300005327 Ga0070658_10068112 Ga0070658_100681123 252
139 3300005328 Ga0070676_10000363 Ga0070676_100003636 252
140 3300005329 Ga0070683_100004718 Ga0070683_1000047182 252
141 3300005329 Ga0070683_100208384 Ga0070683_1002083842 252
142 3300005330 Ga0070690_100001828 Ga0070690_10000182812 252
143 3300005330 Ga0070690_100038771 Ga0070690_1000387712 252
144 3300005330 Ga0070690_100057719 Ga0070690_1000577192 252
145 3300005331 Ga0070670_100001134 Ga0070670_10000113412 252
146 3300005331 Ga0070670_100006490 Ga0070670_1000064909 252
147 3300005331 Ga0070670_100064312 Ga0070670_1000643122 252
148 3300005331 Ga0070670_100182814 Ga0070670_1001828141 252
149 3300005333 Ga0070677_10000301 Ga0070677_100003016 252
150 3300005334 Ga0068869_100006712 Ga0068869_1000067122 252
151 3300005334 Ga0068869_100138987 Ga0068869_1001389872 252
152 3300005334 Ga0068869_100348428 Ga0068869_1003484282 252
153 3300005335 Ga0070666_10022647 Ga0070666_100226472 252
154 3300005335 Ga0070666_10032235 Ga0070666_100322351 252
155 3300005335 Ga0070666_10212724 Ga0070666_102127242 252
156 3300005336 Ga0070680_100014945 Ga0070680_1000149452 252
157 3300005336 Ga0070680_100057625 Ga0070680_1000576252 252
158 3300005337 Ga0070682_100000719 Ga0070682_10000071911 252
159 3300005337 Ga0070682_100045580 Ga0070682_1000455801 252
160 3300005337 Ga0070682_100145483 Ga0070682_1001454832 252
161 3300005337 Ga0070682_100177332 Ga0070682_1001773322 252
162 3300005338 Ga0068868_100013587 Ga0068868_1000135872 252
163 3300005338 Ga0068868_100073781 Ga0068868_1000737811 252
164 3300005339 Ga0070660_100000730 Ga0070660_10000073014 252
165 3300005339 Ga0070660_100037257 Ga0070660_1000372578 252
166 3300005339 Ga0070660_100050497 Ga0070660_1000504973 252
167 3300005340 Ga0070689_100000601 Ga0070689_10000060114 252
168 3300005340 Ga0070689_100013621 Ga0070689_1000136213 252
169 3300005340 Ga0070689_100086701 Ga0070689_1000867011 252
170 3300005340 Ga0070689_100142282 Ga0070689_1001422821 252
171 3300005341 Ga0070691_10001015 Ga0070691_100010153 252
172 3300005341 Ga0070691_10171305 Ga0070691_101713051 252
173 3300005343 Ga0070687_100000253 Ga0070687_10000025312 252
174 3300005343 Ga0070687_100003704 Ga0070687_1000037043 252
175 3300005344 Ga0070661_100003564 Ga0070661_10000356411 252
176 3300005345 Ga0070692_10000060 Ga0070692_1000006013 252
177 3300005347 Ga0070668_100001851 Ga0070668_1000018516 252
178 3300005347 Ga0070668_100087704 Ga0070668_1000877042 252
179 3300005353 Ga0070669_100000888 Ga0070669_1000008886 252
180 3300005353 Ga0070669_100026939 Ga0070669_1000269393 252
181 3300005353 Ga0070669_100537628 Ga0070669_1005376281 252
182 3300005354 Ga0070675_100000441 Ga0070675_10000044120 252
183 3300005354 Ga0070675_100008895 Ga0070675_1000088954 252
184 3300005355 Ga0070671_100001180 Ga0070671_10000118011 252
185 3300005355 Ga0070671_100011505 Ga0070671_1000115054 252
186 3300005355 Ga0070671_100012122 Ga0070671_1000121224 252
187 3300005356 Ga0070674_100000723 Ga0070674_10000072312 252
188 3300005356 Ga0070674_100052446 Ga0070674_1000524463 252
189 3300005364 Ga0070673_100000456 Ga0070673_1000004566 252
190 3300005365 Ga0070688_100000483 Ga0070688_1000004836 252
191 3300005365 Ga0070688_100010309 Ga0070688_1000103095 252
192 3300005365 Ga0070688_100015266 Ga0070688_1000152663 252
193 3300005366 Ga0070659_100001763 Ga0070659_1000017636 252
194 3300005366 Ga0070659_100020482 Ga0070659_1000204823 252
195 3300005366 Ga0070659_100064724 Ga0070659_1000647242 252
196 3300005366 Ga0070659_100167244 Ga0070659_1001672442 252
197 3300005367 Ga0070667_100004366 Ga0070667_1000043662 252
198 3300005367 Ga0070667_100029031 Ga0070667_1000290313 252
199 3300005367 Ga0070667_100053332 Ga0070667_1000533322 252
200 3300005367 Ga0070667_100472184 Ga0070667_1004721841 252
201 3300005406 Ga0070703_10002031 Ga0070703_100020314 252
202 3300005406 Ga0070703_10020218 Ga0070703_100202182 252
203 3300005434 Ga0070709_10007969 Ga0070709_100079696 252
204 3300005435 Ga0070714_100089770 Ga0070714_1000897701 252
205 3300005435 Ga0070714_100236796 Ga0070714_1002367961 252
206 3300005435 Ga0070714_100456706 Ga0070714_1004567061 252
207 3300005436 Ga0070713_100052199 Ga0070713_1000521991 252
208 3300005436 Ga0070713_100141795 Ga0070713_1001417952 252
209 3300005436 Ga0070713_100292797 Ga0070713_1002927971 252
210 3300005436 Ga0070713_100467309 Ga0070713_1004673091 252
211 3300005436 Ga0070713_100472116 Ga0070713_1004721161 252
212 3300005436 Ga0070713_100487380 Ga0070713_1004873802 252
213 3300005437 Ga0070710_10019850 Ga0070710_100198503 252
214 3300005437 Ga0070710_10026259 Ga0070710_100262593 252
215 3300005438 Ga0070701_10000150 Ga0070701_100001506 252
216 3300005438 Ga0070701_10018237 Ga0070701_100182372 252
217 3300005439 Ga0070711_100009998 Ga0070711_1000099985 252
218 3300005439 Ga0070711_100027082 Ga0070711_1000270823 252
219 3300005439 Ga0070711_100043909 Ga0070711_1000439092 252
220 3300005439 Ga0070711_100304933 Ga0070711_1003049331 252
221 3300005439 Ga0070711_100419281 Ga0070711_1004192811 252
222 3300005440 Ga0070705_100003099 Ga0070705_1000030994 252
223 3300005440 Ga0070705_100127316 Ga0070705_1001273161 252
224 3300005440 Ga0070705_100177461 Ga0070705_1001774612 252
225 3300005441 Ga0070700_100001083 Ga0070700_1000010833 252
226 3300005441 Ga0070700_100035299 Ga0070700_1000352992 252
227 3300005444 Ga0070694_100001678 Ga0070694_1000016782 252
228 3300005445 Ga0070708_100013928 Ga0070708_1000139282 252
229 3300005455 Ga0070663_100001801 Ga0070663_1000018019 252
230 3300005455 Ga0070663_100108736 Ga0070663_1001087362 252
231 3300005456 Ga0070678_100000199 Ga0070678_10000019919 252
232 3300005456 Ga0070678_100031746 Ga0070678_1000317462 252
233 3300005456 Ga0070678_100048354 Ga0070678_1000483542 252
234 3300005456 Ga0070678_100075457 Ga0070678_1000754572 252
235 3300005457 Ga0070662_100016138 Ga0070662_1000161382 252
236 3300005457 Ga0070662_100030935 Ga0070662_1000309352 252
237 3300005457 Ga0070662_100102736 Ga0070662_1001027362 252
238 3300005458 Ga0070681_10001398 Ga0070681_1000139812 252
239 3300005458 Ga0070681_10061363 Ga0070681_100613632 252
240 3300005459 Ga0068867_100001623 Ga0068867_10000162310 252
241 3300005459 Ga0068867_100021030 Ga0068867_1000210303 252
242 3300005459 Ga0068867_100160027 Ga0068867_1001600272 252
243 3300005466 Ga0070685_10000782 Ga0070685_100007826 252
244 3300005466 Ga0070685_10001511 Ga0070685_100015119 252
245 3300005466 Ga0070685_10045926 Ga0070685_100459263 252
246 3300005467 Ga0070706_100458705 Ga0070706_1004587051 252
247 3300005468 Ga0070707_100200688 Ga0070707_1002006882 252
248 3300005471 Ga0070698_100720832 Ga0070698_1007208321 252
249 3300005518 Ga0070699_100216835 Ga0070699_1002168352 252
250 3300005530 Ga0070679_100213260 Ga0070679_1002132602 252
251 3300005535 Ga0070684_100001802 Ga0070684_1000018026 252
252 3300005535 Ga0070684_100060250 Ga0070684_1000602502 252
253 3300005535 Ga0070684_100137558 Ga0070684_1001375581 252
254 3300005535 Ga0070684_100212866 Ga0070684_1002128662 252
255 3300005539 Ga0068853_100002281 Ga0068853_1000022814 252
256 3300005543 Ga0070672_100001622 Ga0070672_1000016225 252
257 3300005543 Ga0070672_100060325 Ga0070672_1000603253 252
258 3300005544 Ga0070686_100000746 Ga0070686_1000007466 252
259 3300005544 Ga0070686_100004148 Ga0070686_1000041486 252
260 3300005544 Ga0070686_100061519 Ga0070686_1000615192 252
261 3300005544 Ga0070686_100378590 Ga0070686_1003785901 252
262 3300005545 Ga0070695_100000553 Ga0070695_10000055311 252
263 3300005546 Ga0070696_100001299 Ga0070696_1000012995 252
264 3300005546 Ga0070696_100030835 Ga0070696_1000308353 252
265 3300005547 Ga0070693_100000613 Ga0070693_1000006135 252
266 3300005547 Ga0070693_100038637 Ga0070693_1000386373 252
267 3300005547 Ga0070693_100041191 Ga0070693_1000411912 252
268 3300005547 Ga0070693_100096173 Ga0070693_1000961732 252
269 3300005548 Ga0070665_100373235 Ga0070665_1003732352 252
270 3300005549 Ga0070704_100000423 Ga0070704_1000004236 252
271 3300005549 Ga0070704_100095947 Ga0070704_1000959471 252
272 3300005549 Ga0070704_100136880 Ga0070704_1001368802 252
273 3300005549 Ga0070704_100199897 Ga0070704_1001998972 252
274 3300005549 Ga0070704_100335192 Ga0070704_1003351922 252
275 3300005563 Ga0068855_100004415 Ga0068855_1000044155 252
276 3300005563 Ga0068855_100245922 Ga0068855_1002459222 252
277 3300005563 Ga0068855_100412421 Ga0068855_1004124212 252
278 3300005563 Ga0068855_100605940 Ga0068855_1006059401 252
279 3300005564 Ga0070664_100001312 Ga0070664_10000131210 252
280 3300005564 Ga0070664_100024128 Ga0070664_1000241284 252
281 3300005577 Ga0068857_100007906 Ga0068857_1000079065 252
282 3300005577 Ga0068857_100144242 Ga0068857_1001442421 252
283 3300005577 Ga0068857_100244687 Ga0068857_1002446872 252
284 3300005578 Ga0068854_100000827 Ga0068854_1000008278 252
285 3300005578 Ga0068854_100044204 Ga0068854_1000442043 252
286 3300005614 Ga0068856_100001340 Ga0068856_10000134017 252
287 3300005614 Ga0068856_100024759 Ga0068856_1000247592 252
288 3300005614 Ga0068856_100085111 Ga0068856_1000851112 252
289 3300005614 Ga0068856_100523899 Ga0068856_1005238992 252
290 3300005615 Ga0070702_100001213 Ga0070702_1000012133 252
291 3300005615 Ga0070702_100021853 Ga0070702_1000218532 252
292 3300005615 Ga0070702_100029869 Ga0070702_1000298692 252
293 3300005615 Ga0070702_100255369 Ga0070702_1002553692 252
294 3300005616 Ga0068852_100007064 Ga0068852_1000070644 252
295 3300005616 Ga0068852_100039827 Ga0068852_1000398273 252
296 3300005617 Ga0068859_100001767 Ga0068859_10000176713 252
297 3300005617 Ga0068859_100009332 Ga0068859_1000093325 252
298 3300005617 Ga0068859_100284133 Ga0068859_1002841332 252
299 3300005618 Ga0068864_100003544 Ga0068864_1000035443 252
300 3300005618 Ga0068864_100052324 Ga0068864_1000523242 252
301 3300005718 Ga0068866_10000372 Ga0068866_1000037211 252
302 3300005718 Ga0068866_10045509 Ga0068866_100455091 252
303 3300005718 Ga0068866_10055926 Ga0068866_100559262 252
304 3300005719 Ga0068861_100001202 Ga0068861_1000012025 252
305 3300005840 Ga0068870_10000207 Ga0068870_1000020711 252
306 3300005840 Ga0068870_10093149 Ga0068870_100931492 252
307 3300005841 Ga0068863_100003062 Ga0068863_1000030625 252
308 3300005841 Ga0068863_100103435 Ga0068863_1001034353 252
309 3300005842 Ga0068858_100009856 Ga0068858_1000098563 252
310 3300005843 Ga0068860_100007079 Ga0068860_1000070794 252
311 3300005843 Ga0068860_100027232 Ga0068860_1000272323 252
312 3300005844 Ga0068862_100002236 Ga0068862_10000223611 252
313 3300005844 Ga0068862_100015217 Ga0068862_1000152173 252
314 3300005937 Ga0081455_10005862 Ga0081455_100058621 252
315 3300005937 Ga0081455_10006016 Ga0081455_100060164 252
316 3300005937 Ga0081455_10006534 Ga0081455_100065347 252
317 3300005937 Ga0081455_10010698 Ga0081455_100106984 252
318 3300005937 Ga0081455_10012847 Ga0081455_100128478 252
319 3300005937 Ga0081455_10061621 Ga0081455_100616212 252
320 3300005937 Ga0081455_10167172 Ga0081455_101671722 252
321 3300005981 Ga0081538_10013962 Ga0081538_100139625 252
322 3300005981 Ga0081538_10024573 Ga0081538_100245734 252
323 3300005981 Ga0081538_10030004 Ga0081538_100300044 252
324 3300005981 Ga0081538_10077823 Ga0081538_100778232 252
325 3300005983 Ga0081540_1027376 Ga0081540_10273763 252
326 3300005983 Ga0081540_1133036 Ga0081540_11330362 252
327 3300006028 Ga0070717_10047085 Ga0070717_100470853 252
328 3300006028 Ga0070717_10358002 Ga0070717_103580022 252
329 3300006038 Ga0075365_10001784 Ga0075365_100017844 252
330 3300006038 Ga0075365_10017017 Ga0075365_100170174 252
331 3300006038 Ga0075365_10037350 Ga0075365_100373503 252
332 3300006038 Ga0075365_10259840 Ga0075365_102598402 252
333 3300006048 Ga0075363_100192963 Ga0075363_1001929631 252
334 3300006051 Ga0075364_10058565 Ga0075364_100585652 252
335 3300006058 Ga0075432_10013777 Ga0075432_100137772 252
336 3300006163 Ga0070715_10099465 Ga0070715_100994652 252
337 3300006163 Ga0070715_10199282 Ga0070715_101992822 252
338 3300006163 Ga0070715_10320153 Ga0070715_103201531 252
339 3300006173 Ga0070716_100043247 Ga0070716_1000432472 252
340 3300006173 Ga0070716_100121396 Ga0070716_1001213962 252
341 3300006175 Ga0070712_100007234 Ga0070712_1000072346 252
342 3300006175 Ga0070712_100113727 Ga0070712_1001137273 252
343 3300006178 Ga0075367_10021834 Ga0075367_100218342 252
344 3300006178 Ga0075367_10105375 Ga0075367_101053753 252
345 3300006178 Ga0075367_10243277 Ga0075367_102432772 252
346 3300006237 Ga0097621_100002408 Ga0097621_1000024085 252
347 3300006353 Ga0075370_10144277 Ga0075370_101442772 252
348 3300006358 Ga0068871_100002267 Ga0068871_1000022675 252
349 3300006358 Ga0068871_100034059 Ga0068871_1000340595 252
350 3300006844 Ga0075428_100234280 Ga0075428_1002342802 252
351 3300006844 Ga0075428_100340154 Ga0075428_1003401541 252
352 3300006844 Ga0075428_100789534 Ga0075428_1007895342 252
353 3300006846 Ga0075430_100013448 Ga0075430_1000134485 252
354 3300006846 Ga0075430_100078649 Ga0075430_1000786492 252
355 3300006846 Ga0075430_100342962 Ga0075430_1003429621 252
356 3300006847 Ga0075431_100005769 Ga0075431_1000057695 252
357 3300006847 Ga0075431_100023620 Ga0075431_1000236205 252
358 3300006847 Ga0075431_100113391 Ga0075431_1001133912 252
359 3300006847 Ga0075431_100131562 Ga0075431_1001315622 252
360 3300006852 Ga0075433_10039549 Ga0075433_100395494 252
361 3300006852 Ga0075433_10082850 Ga0075433_100828502 252
362 3300006852 Ga0075433_10146797 Ga0075433_101467972 252
363 3300006852 Ga0075433_10232618 Ga0075433_102326182 252
364 3300006852 Ga0075433_10411442 Ga0075433_104114422 252
365 3300006871 Ga0075434_100007264 Ga0075434_1000072642 252
366 3300006871 Ga0075434_100016025 Ga0075434_1000160252 252
367 3300006871 Ga0075434_100029369 Ga0075434_1000293693 252
368 3300006871 Ga0075434_100044598 Ga0075434_1000445982 252
369 3300006871 Ga0075434_100104976 Ga0075434_1001049762 252
370 3300006880 Ga0075429_100011165 Ga0075429_1000111652 252
371 3300006880 Ga0075429_100069547 Ga0075429_1000695472 252
372 3300006880 Ga0075429_100069699 Ga0075429_1000696992 252
373 3300006880 Ga0075429_100370584 Ga0075429_1003705842 252
374 3300006881 Ga0068865_100000537 Ga0068865_1000005376 252
375 3300006881 Ga0068865_100010539 Ga0068865_1000105393 252
376 3300006914 Ga0075436_100023694 Ga0075436_1000236942 252
377 3300006914 Ga0075436_100123650 Ga0075436_1001236501 252
378 3300006931 Ga0097620_100001767 Ga0097620_10000176713 252
379 3300006931 Ga0097620_100009332 Ga0097620_1000093325 252
380 3300006931 Ga0097620_100284125 Ga0097620_1002841252 252
381 3300007076 Ga0075435_100014461 Ga0075435_1000144613 252
382 3300007076 Ga0075435_100165067 Ga0075435_1001650672 252
383 3300009011 Ga0105251_10037885 Ga0105251_100378853 252
384 3300009036 Ga0105244_10052114 Ga0105244_100521142 252
385 3300009093 Ga0105240_10089436 Ga0105240_100894362 252
386 3300009093 Ga0105240_10605519 Ga0105240_106055192 252
387 3300009094 Ga0111539_10008569 Ga0111539_100085697 252
388 3300009094 Ga0111539_10048979 Ga0111539_100489792 252
389 3300009094 Ga0111539_10061855 Ga0111539_100618553 252
390 3300009094 Ga0111539_10244902 Ga0111539_102449022 252
391 3300009094 Ga0111539_10256588 Ga0111539_102565882 252
392 3300009094 Ga0111539_10543210 Ga0111539_105432102 252
393 3300009098 Ga0105245_10000888 Ga0105245_1000088822 252
394 3300009098 Ga0105245_10021572 Ga0105245_100215723 252
395 3300009101 Ga0105247_10001292 Ga0105247_100012929 252
396 3300009101 Ga0105247_10086321 Ga0105247_100863212 252
397 3300009101 Ga0105247_10406313 Ga0105247_104063131 252
398 3300009147 Ga0114129_10003043 Ga0114129_1000304310 252
399 3300009147 Ga0114129_10006042 Ga0114129_100060426 252
400 3300009147 Ga0114129_10037803 Ga0114129_100378033 252
401 3300009147 Ga0114129_10064901 Ga0114129_100649015 252
402 3300009148 Ga0105243_10004521 Ga0105243_100045215 252
403 3300009148 Ga0105243_10072224 Ga0105243_100722242 252
404 3300009148 Ga0105243_10110850 Ga0105243_101108501 252
405 3300009148 Ga0105243_10302157 Ga0105243_103021572 252
406 3300009148 Ga0105243_10364696 Ga0105243_103646961 252
407 3300009174 Ga0105241_10000662 Ga0105241_1000066221 252
408 3300009174 Ga0105241_10062168 Ga0105241_100621681 252
409 3300009176 Ga0105242_10001202 Ga0105242_100012026 252
410 3300009176 Ga0105242_10033477 Ga0105242_100334772 252
411 3300009177 Ga0105248_10002336 Ga0105248_100023366 252
412 3300009177 Ga0105248_10040793 Ga0105248_100407933 252
413 3300009177 Ga0105248_10061774 Ga0105248_100617743 252
414 3300009177 Ga0105248_10420636 Ga0105248_104206362 252
415 3300009545 Ga0105237_10020331 Ga0105237_100203317 252
416 3300009545 Ga0105237_10086525 Ga0105237_100865252 252
417 3300009545 Ga0105237_10230003 Ga0105237_102300032 252
418 3300009551 Ga0105238_10131783 Ga0105238_101317832 252
419 3300009551 Ga0105238_10143856 Ga0105238_101438562 252
420 3300009553 Ga0105249_10001808 Ga0105249_100018086 252
421 3300009553 Ga0105249_10195476 Ga0105249_101954762 252
422 3300009553 Ga0105249_10243964 Ga0105249_102439642 252
423 3300010375 Ga0105239_10018370 Ga0105239_100183708 252
424 3300010375 Ga0105239_10060609 Ga0105239_100606093 252
425 3300010375 Ga0105239_10103533 Ga0105239_101035333 252
426 3300010375 Ga0105239_10260680 Ga0105239_102606801 252
427 3300010375 Ga0105239_10541513 Ga0105239_105415132 252
428 3300011119 Ga0105246_10689388 Ga0105246_106893881 252
429 3300012492 Ga0157335_1006657 Ga0157335_10066571 252
430 3300012507 Ga0157342_1000478 Ga0157342_10004782 252
431 3300013100 Ga0157373_10006024 Ga0157373_100060242 252
432 3300013100 Ga0157373_10198989 Ga0157373_101989892 252
433 3300013102 Ga0157371_10027329 Ga0157371_100273293 252
434 3300013102 Ga0157371_10165951 Ga0157371_101659512 252
435 3300013104 Ga0157370_10470781 Ga0157370_104707812 252
436 3300013105 Ga0157369_10535210 Ga0157369_105352102 252
437 3300013296 Ga0157374_10002267 Ga0157374_100022676 252
438 3300013296 Ga0157374_10053178 Ga0157374_100531783 252
439 3300013297 Ga0157378_10003851 Ga0157378_100038512 252
440 3300013297 Ga0157378_10023127 Ga0157378_100231273 252
441 3300013297 Ga0157378_10243787 Ga0157378_102437872 252
442 3300013306 Ga0163162_10009182 Ga0163162_100091823 252
443 3300013306 Ga0163162_10015064 Ga0163162_100150649 252
444 3300013307 Ga0157372_10011471 Ga0157372_100114715 252
445 3300013307 Ga0157372_10088626 Ga0157372_100886262 252
446 3300013307 Ga0157372_10172507 Ga0157372_101725072 252
447 3300013307 Ga0157372_10487716 Ga0157372_104877162 252
448 3300013307 Ga0157372_11105963 Ga0157372_111059632 252
449 3300013308 Ga0157375_10001031 Ga0157375_100010316 252
450 3300013308 Ga0157375_10012658 Ga0157375_100126582 252
451 3300013308 Ga0157375_10473737 Ga0157375_104737371 252
452 3300014325 Ga0163163_10003323 Ga0163163_1000332311 252
453 3300014325 Ga0163163_10026839 Ga0163163_100268392 252
454 3300014325 Ga0163163_10038122 Ga0163163_100381224 252
455 3300014325 Ga0163163_10139060 Ga0163163_101390602 252
456 3300014325 Ga0163163_10779657 Ga0163163_107796571 252
457 3300014325 Ga0163163_11079087 Ga0163163_110790871 252
458 3300014326 Ga0157380_10000726 Ga0157380_1000072611 252
459 3300014326 Ga0157380_10012046 Ga0157380_100120463 252
460 3300014745 Ga0157377_10000324 Ga0157377_1000032412 252
461 3300014745 Ga0157377_10009317 Ga0157377_100093172 252
462 3300014968 Ga0157379_10001193 Ga0157379_1000119311 252
463 3300014968 Ga0157379_10013061 Ga0157379_100130612 252
464 3300014968 Ga0157379_10027074 Ga0157379_100270743 252
465 3300014968 Ga0157379_10375791 Ga0157379_103757912 252
466 3300014968 Ga0157379_10446829 Ga0157379_104468291 252
467 3300014969 Ga0157376_10003383 Ga0157376_100033835 252
468 3300014969 Ga0157376_10036675 Ga0157376_100366751 252
469 3300014969 Ga0157376_10066060 Ga0157376_100660601 252
470 3300017792 Ga0163161_10001040 Ga0163161_100010406 252
471 3300017792 Ga0163161_10077137 Ga0163161_100771372 252
472 3300017792 Ga0163161_10194105 Ga0163161_101941052 252
473 3300025271 Ga0207666_1000034 Ga0207666_10000346 252
474 3300025290 Ga0207673_1000073 Ga0207673_10000735 252
475 3300025315 Ga0207697_10000280 Ga0207697_100002806 252
476 3300025321 Ga0207656_10122431 Ga0207656_101224312 252
477 3300025728 Ga0207655_1054113 Ga0207655_10541132 252
478 3300025885 Ga0207653_10001427 Ga0207653_100014272 252
479 3300025885 Ga0207653_10031182 Ga0207653_100311822 252
480 3300025893 Ga0207682_10000134 Ga0207682_1000013425 252
481 3300025898 Ga0207692_10113652 Ga0207692_101136521 252
482 3300025898 Ga0207692_10129449 Ga0207692_101294492 252
483 3300025899 Ga0207642_10110202 Ga0207642_101102022 252
484 3300025900 Ga0207710_10001541 Ga0207710_100015414 252
485 3300025900 Ga0207710_10080676 Ga0207710_100806762 252
486 3300025901 Ga0207688_10000033 Ga0207688_1000003331 252
487 3300025901 Ga0207688_10000526 Ga0207688_1000052611 252
488 3300025903 Ga0207680_10003687 Ga0207680_100036875 252
489 3300025903 Ga0207680_10011913 Ga0207680_100119133 252
490 3300025903 Ga0207680_10037146 Ga0207680_100371462 252
491 3300025903 Ga0207680_10095201 Ga0207680_100952012 252
492 3300025904 Ga0207647_10003350 Ga0207647_100033505 252
493 3300025904 Ga0207647_10011872 Ga0207647_100118722 252
494 3300025904 Ga0207647_10023449 Ga0207647_100234493 252
495 3300025906 Ga0207699_10024497 Ga0207699_100244973 252
496 3300025906 Ga0207699_10025852 Ga0207699_100258522 252
497 3300025906 Ga0207699_10080753 Ga0207699_100807531 252
498 3300025906 Ga0207699_10238507 Ga0207699_102385072 252
499 3300025906 Ga0207699_10387889 Ga0207699_103878891 252
500 3300025907 Ga0207645_10001617 Ga0207645_100016176 252
501 3300025907 Ga0207645_10114448 Ga0207645_101144482 252
502 3300025908 Ga0207643_10000756 Ga0207643_100007566 252
503 3300025908 Ga0207643_10004718 Ga0207643_100047185 252
504 3300025909 Ga0207705_10270689 Ga0207705_102706892 252
505 3300025910 Ga0207684_10193478 Ga0207684_101934781 252
506 3300025911 Ga0207654_10004513 Ga0207654_100045134 252
507 3300025912 Ga0207707_10002112 Ga0207707_100021126 252
508 3300025912 Ga0207707_10390291 Ga0207707_103902912 252
509 3300025913 Ga0207695_10063206 Ga0207695_100632062 252
510 3300025914 Ga0207671_10088716 Ga0207671_100887162 252
511 3300025914 Ga0207671_10218462 Ga0207671_102184622 252
512 3300025915 Ga0207693_10009432 Ga0207693_100094324 252
513 3300025915 Ga0207693_10027020 Ga0207693_100270203 252
514 3300025915 Ga0207693_10039890 Ga0207693_100398902 252
515 3300025915 Ga0207693_10100762 Ga0207693_101007622 252
516 3300025915 Ga0207693_10111817 Ga0207693_101118172 252
517 3300025915 Ga0207693_10126504 Ga0207693_101265042 252
518 3300025915 Ga0207693_10458870 Ga0207693_104588702 252
519 3300025916 Ga0207663_10034861 Ga0207663_100348612 252
520 3300025916 Ga0207663_10183236 Ga0207663_101832361 252
521 3300025917 Ga0207660_10001335 Ga0207660_1000133511 252
522 3300025917 Ga0207660_10129815 Ga0207660_101298152 252
523 3300025917 Ga0207660_10294683 Ga0207660_102946832 252
524 3300025917 Ga0207660_10311272 Ga0207660_103112722 252
525 3300025918 Ga0207662_10000341 Ga0207662_1000034111 252
526 3300025918 Ga0207662_10003898 Ga0207662_100038985 252
527 3300025918 Ga0207662_10007966 Ga0207662_100079661 252
528 3300025919 Ga0207657_10002888 Ga0207657_100028889 252
529 3300025919 Ga0207657_10022947 Ga0207657_100229475 252
530 3300025919 Ga0207657_10054672 Ga0207657_100546722 252
531 3300025919 Ga0207657_10055265 Ga0207657_100552654 252
532 3300025919 Ga0207657_10147877 Ga0207657_101478772 252
533 3300025919 Ga0207657_10397641 Ga0207657_103976411 252
534 3300025920 Ga0207649_10000271 Ga0207649_100002716 252
535 3300025921 Ga0207652_10001830 Ga0207652_100018306 252
536 3300025921 Ga0207652_10210529 Ga0207652_102105292 252
537 3300025923 Ga0207681_10000658 Ga0207681_100006586 252
538 3300025923 Ga0207681_10052178 Ga0207681_100521782 252
539 3300025923 Ga0207681_10114924 Ga0207681_101149242 252
540 3300025924 Ga0207694_10077300 Ga0207694_100773002 252
541 3300025924 Ga0207694_10112188 Ga0207694_101121881 252
542 3300025924 Ga0207694_10137781 Ga0207694_101377812 252
543 3300025925 Ga0207650_10002267 Ga0207650_100022676 252
544 3300025925 Ga0207650_10006007 Ga0207650_100060076 252
545 3300025925 Ga0207650_10041801 Ga0207650_100418012 252
546 3300025925 Ga0207650_10146997 Ga0207650_101469972 252
547 3300025926 Ga0207659_10000177 Ga0207659_1000017718 252
548 3300025926 Ga0207659_10349933 Ga0207659_103499331 252
549 3300025927 Ga0207687_10000495 Ga0207687_100004956 252
550 3300025927 Ga0207687_10006623 Ga0207687_100066231 252
551 3300025927 Ga0207687_10029641 Ga0207687_100296413 252
552 3300025928 Ga0207700_10114017 Ga0207700_101140172 252
553 3300025928 Ga0207700_10141346 Ga0207700_101413462 252
554 3300025928 Ga0207700_10188564 Ga0207700_101885642 252
555 3300025928 Ga0207700_10253591 Ga0207700_102535912 252
556 3300025929 Ga0207664_10271689 Ga0207664_102716891 252
557 3300025931 Ga0207644_10000279 Ga0207644_100002795 252
558 3300025931 Ga0207644_10062434 Ga0207644_100624342 252
559 3300025931 Ga0207644_10074660 Ga0207644_100746601 252
560 3300025931 Ga0207644_10523311 Ga0207644_105233111 252
561 3300025932 Ga0207690_10001557 Ga0207690_100015576 252
562 3300025932 Ga0207690_10144034 Ga0207690_101440342 252
563 3300025933 Ga0207706_10003167 Ga0207706_100031676 252
564 3300025933 Ga0207706_10005939 Ga0207706_1000593911 252
565 3300025933 Ga0207706_10065929 Ga0207706_100659292 252
566 3300025934 Ga0207686_10001383 Ga0207686_1000138310 252
567 3300025934 Ga0207686_10052401 Ga0207686_100524013 252
568 3300025934 Ga0207686_10300817 Ga0207686_103008172 252
569 3300025935 Ga0207709_10000952 Ga0207709_100009526 252
570 3300025935 Ga0207709_10130124 Ga0207709_101301242 252
571 3300025935 Ga0207709_10189751 Ga0207709_101897512 252
572 3300025936 Ga0207670_10000491 Ga0207670_100004916 252
573 3300025936 Ga0207670_10130196 Ga0207670_101301962 252
574 3300025936 Ga0207670_10325591 Ga0207670_103255912 252
575 3300025937 Ga0207669_10000649 Ga0207669_100006495 252
576 3300025937 Ga0207669_10057728 Ga0207669_100577283 252
577 3300025938 Ga0207704_10001342 Ga0207704_100013425 252
578 3300025938 Ga0207704_10016141 Ga0207704_100161413 252
579 3300025938 Ga0207704_10164606 Ga0207704_101646062 252
580 3300025938 Ga0207704_10221957 Ga0207704_102219572 252
581 3300025939 Ga0207665_10004210 Ga0207665_100042105 252
582 3300025939 Ga0207665_10182378 Ga0207665_101823782 252
583 3300025939 Ga0207665_10204402 Ga0207665_102044022 252
584 3300025940 Ga0207691_10002815 Ga0207691_100028155 252
585 3300025940 Ga0207691_10012526 Ga0207691_100125262 252
586 3300025940 Ga0207691_10207640 Ga0207691_102076402 252
587 3300025941 Ga0207711_10001570 Ga0207711_100015706 252
588 3300025941 Ga0207711_10011263 Ga0207711_100112632 252
589 3300025941 Ga0207711_10016743 Ga0207711_100167432 252
590 3300025941 Ga0207711_10068152 Ga0207711_100681523 252
591 3300025942 Ga0207689_10002449 Ga0207689_100024496 252
592 3300025942 Ga0207689_10003816 Ga0207689_1000381611 252
593 3300025942 Ga0207689_10131020 Ga0207689_101310202 252
594 3300025944 Ga0207661_10000642 Ga0207661_1000064211 252
595 3300025944 Ga0207661_10218373 Ga0207661_102183732 252
596 3300025944 Ga0207661_10677803 Ga0207661_106778031 252
597 3300025945 Ga0207679_10000046 Ga0207679_1000004616 252
598 3300025945 Ga0207679_10044409 Ga0207679_100444092 252
599 3300025949 Ga0207667_10007962 Ga0207667_100079623 252
600 3300025949 Ga0207667_10047435 Ga0207667_100474353 252
601 3300025949 Ga0207667_10226942 Ga0207667_102269421 252
602 3300025960 Ga0207651_10000214 Ga0207651_100002146 252
603 3300025960 Ga0207651_10054490 Ga0207651_100544902 252
604 3300025960 Ga0207651_10085066 Ga0207651_100850661 252
605 3300025961 Ga0207712_10003297 Ga0207712_100032972 252
606 3300025961 Ga0207712_10113898 Ga0207712_101138982 252
607 3300025961 Ga0207712_10165498 Ga0207712_101654982 252
608 3300025961 Ga0207712_10378142 Ga0207712_103781423 252
609 3300025972 Ga0207668_10000537 Ga0207668_100005376 252
610 3300025972 Ga0207668_10045783 Ga0207668_100457831 252
611 3300025972 Ga0207668_10458514 Ga0207668_104585142 252
612 3300025972 Ga0207668_10665727 Ga0207668_106657271 252
613 3300025981 Ga0207640_10000765 Ga0207640_100007656 252
614 3300025981 Ga0207640_10072606 Ga0207640_100726063 252
615 3300025986 Ga0207658_10001147 Ga0207658_1000114712 252
616 3300025986 Ga0207658_10014386 Ga0207658_100143862 252
617 3300026023 Ga0207677_10003377 Ga0207677_100033779 252
618 3300026023 Ga0207677_10020914 Ga0207677_100209142 252
619 3300026023 Ga0207677_10245657 Ga0207677_102456572 252
620 3300026035 Ga0207703_10000940 Ga0207703_1000094020 252
621 3300026035 Ga0207703_10021815 Ga0207703_100218153 252
622 3300026041 Ga0207639_10000852 Ga0207639_100008526 252
623 3300026041 Ga0207639_10084643 Ga0207639_100846432 252
624 3300026041 Ga0207639_10300042 Ga0207639_103000422 252
625 3300026067 Ga0207678_10002525 Ga0207678_100025256 252
626 3300026067 Ga0207678_10011036 Ga0207678_100110362 252
627 3300026067 Ga0207678_10014774 Ga0207678_100147742 252
628 3300026067 Ga0207678_10073591 Ga0207678_100735912 252
629 3300026067 Ga0207678_10089495 Ga0207678_100894952 252
630 3300026075 Ga0207708_10000124 Ga0207708_1000012450 252
631 3300026075 Ga0207708_10001006 Ga0207708_1000100611 252
632 3300026075 Ga0207708_10005549 Ga0207708_100055492 252
633 3300026078 Ga0207702_10002642 Ga0207702_1000264218 252
634 3300026078 Ga0207702_10161024 Ga0207702_101610241 252
635 3300026078 Ga0207702_10219674 Ga0207702_102196742 252
636 3300026078 Ga0207702_10304987 Ga0207702_103049872 252
637 3300026078 Ga0207702_10370211 Ga0207702_103702111 252
638 3300026088 Ga0207641_10001370 Ga0207641_100013706 252
639 3300026088 Ga0207641_10294594 Ga0207641_102945942 252
640 3300026089 Ga0207648_10001663 Ga0207648_100016636 252
641 3300026089 Ga0207648_10002036 Ga0207648_100020366 252
642 3300026095 Ga0207676_10004314 Ga0207676_100043143 252
643 3300026095 Ga0207676_10018460 Ga0207676_100184604 252
644 3300026116 Ga0207674_10002956 Ga0207674_100029566 252
645 3300026116 Ga0207674_10184058 Ga0207674_101840581 252
646 3300026116 Ga0207674_10196229 Ga0207674_101962292 252
647 3300026118 Ga0207675_100006209 Ga0207675_10000620911 252
648 3300026118 Ga0207675_100007875 Ga0207675_1000078753 252
649 3300026118 Ga0207675_100075048 Ga0207675_1000750482 252
650 3300026118 Ga0207675_100528153 Ga0207675_1005281531 252
651 3300026121 Ga0207683_10001904 Ga0207683_100019049 252
652 3300026121 Ga0207683_10009531 Ga0207683_100095313 252
653 3300026121 Ga0207683_10067251 Ga0207683_100672513 252
654 3300026142 Ga0207698_10001980 Ga0207698_100019804 252
655 3300026142 Ga0207698_10003723 Ga0207698_100037235 252
656 3300026142 Ga0207698_10026412 Ga0207698_100264122 252
657 3300027617 Ga0210002_1000354 Ga0210002_10003544 252
658 3300027617 Ga0210002_1014531 Ga0210002_10145312 252
659 3300027682 Ga0209971_1005583 Ga0209971_10055832 252
660 3300027695 Ga0209966_1001997 Ga0209966_10019972 252
661 3300027717 Ga0209998_10001696 Ga0209998_100016963 252
662 3300027717 Ga0209998_10002995 Ga0209998_100029952 252
663 3300027876 Ga0209974_10000502 Ga0209974_100005025 252
664 3300027907 Ga0207428_10002104 Ga0207428_100021046 252
665 3300027907 Ga0207428_10002830 Ga0207428_1000283016 252
666 3300027907 Ga0207428_10002977 Ga0207428_100029777 252
667 3300027907 Ga0207428_10005357 Ga0207428_100053572 252
668 3300027907 Ga0207428_10070447 Ga0207428_100704471 252
669 3300027907 Ga0207428_10389055 Ga0207428_103890551 252
670 3300028379 Ga0268266_10019214 Ga0268266_100192142 252
671 3300028379 Ga0268266_10042402 Ga0268266_100424024 252
672 3300028380 Ga0268265_10000817 Ga0268265_1000081720 252
673 3300028380 Ga0268265_10079471 Ga0268265_100794713 252
674 3300028380 Ga0268265_10366513 Ga0268265_103665131 252
675 3300028381 Ga0268264_10001227 Ga0268264_100012276 252
676 3300028381 Ga0268264_10062211 Ga0268264_100622113 252
677 3300028381 Ga0268264_10219849 Ga0268264_102198492 252
678 3300028381 Ga0268264_10262104 Ga0268264_102621042 252
679 3300028556 Ga0265337_1001372 Ga0265337_10013727 252
680 3300028800 Ga0265338_10018779 Ga0265338_100187793 252
681 3300028800 Ga0265338_10020724 Ga0265338_100207243 252
682 3300028800 Ga0265338_10038967 Ga0265338_100389674 252
683 3300028800 Ga0265338_10406651 Ga0265338_104066511 252
684 3300031241 Ga0265325_10002820 Ga0265325_100028208 252
685 3300031241 Ga0265325_10026685 Ga0265325_100266852 252
686 3300031241 Ga0265325_10027239 Ga0265325_100272392 252
687 3300031241 Ga0265325_10038759 Ga0265325_100387593 252
688 3300031247 Ga0265340_10006632 Ga0265340_100066325 252
689 3300031247 Ga0265340_10123403 Ga0265340_101234032 252
690 3300031249 Ga0265339_10000091 Ga0265339_1000009153 252
691 3300031249 Ga0265339_10031675 Ga0265339_100316752 252
692 3300031344 Ga0265316_10032664 Ga0265316_100326642 252
693 3300031595 Ga0265313_10000260 Ga0265313_1000026027 252
694 3300031595 Ga0265313_10024154 Ga0265313_100241542 252
695 3300031711 Ga0265314_10006712 Ga0265314_100067124 252
696 3300031711 Ga0265314_10191643 Ga0265314_101916432 252
697 3300031712 Ga0265342_10000290 Ga0265342_1000029056 252
698 3300031712 Ga0265342_10014743 Ga0265342_100147432 252
699 3300034816 Ga0373930_0000266 Ga0373930_0000266_1594_2352 252
700 3300034816 Ga0373930_0010805 Ga0373930_0010805_71_829 252
701 3300034817 Ga0373948_0000471 Ga0373948_0000471_2812_3570 252
702 3300034817 Ga0373948_0006126 Ga0373948_0006126_869_1627 252
703 3300034818 Ga0373950_0000324 Ga0373950_0000324_4277_5035 252
704 3300034818 Ga0373950_0014500 Ga0373950_0014500_289_1047 252
705 3300034819 Ga0373958_0000451 Ga0373958_0000451_704_1462 252
706 3300034957 Ga0373938_0000308 Ga0373938_0000308_5984_6742 252
707 3300034957 Ga0373938_0000348 Ga0373938_0000348_2081_2839 252
708 3300035083 Ga0373926_0002868 Ga0373926_0002868_4286_5044 252
709 3300035083 Ga0373926_0008286 Ga0373926_0008286_1947_2705 252
710 3300035083 Ga0373926_0085199 Ga0373926_0085199_370_1128 252
711 3300035084 Ga0373928_0001853 Ga0373928_0001853_2891_3649 252
712 3300035086 Ga0373934_0015266 Ga0373934_0015266_1090_1848 252
713 3300035086 Ga0373934_0027772 Ga0373934_0027772_1111_1869 252
714 3300035086 Ga0373934_0068018 Ga0373934_0068018_340_1098 252
715 3300035088 Ga0373940_0001082 Ga0373940_0001082_1966_2724 252
716 3300035088 Ga0373940_0003271 Ga0373940_0003271_1858_2616 252
717 3300035088 Ga0373940_0008910 Ga0373940_0008910_1370_2128 252
718 3300035089 Ga0373944_0003210 Ga0373944_0003210_1571_2329 252
719 3300035089 Ga0373944_0031938 Ga0373944_0031938_416_1174 252
720 3300035089 Ga0373944_0052200 Ga0373944_0052200_180_956 252
721 3300035089 Ga0373944_0079206 Ga0373944_0079206_255_1013 252
722 3300035090 Ga0373949_0004203 Ga0373949_0004203_814_1572 252
723 3300035090 Ga0373949_0034321 Ga0373949_0034321_43_801 252
724 3300035091 Ga0373951_0001125 Ga0373951_0001125_3558_4316 252
725 3300035092 Ga0373952_0000133 Ga0373952_0000133_3994_4752 252
726 3300035092 Ga0373952_0008267 Ga0373952_0008267_326_1084 252
727 3300035092 Ga0373952_0010301 Ga0373952_0010301_1002_1760 252
728 3300035111 Ga0373923_0027798 Ga0373923_0027798_166_924 252
729 3300035111 Ga0373923_0031402 Ga0373923_0031402_1119_1877 252
730 3300035112 Ga0373932_0001964 Ga0373932_0001964_3083_3841 252
731 3300035113 Ga0373936_0031194 Ga0373936_0031194_1082_1840 252
732 3300035113 Ga0373936_0052387 Ga0373936_0052387_864_1622 252
733 3300035114 Ga0373939_0000343 Ga0373939_0000343_4000_4758 252
734 3300035114 Ga0373939_0005408 Ga0373939_0005408_2081_2839 252
735 3300035114 Ga0373939_0033924 Ga0373939_0033924_194_952 252
736 3300035115 Ga0373941_0001154 Ga0373941_0001154_2325_3083 252
737 3300035116 Ga0373945_0004512 Ga0373945_0004512_3265_4023 252
738 3300035116 Ga0373945_0042669 Ga0373945_0042669_324_1082 252
739 3300035117 Ga0373953_0054496 Ga0373953_0054496_221_979 252
740 3300035117 Ga0373953_0119651 Ga0373953_0119651_294_1052 252
741 3300035118 Ga0373954_0086937 Ga0373954_0086937_226_984 252
742 3300035119 Ga0373956_0009376 Ga0373956_0009376_2314_3072 252
743 3300035119 Ga0373956_0021669 Ga0373956_0021669_1614_2372 252
744 3300035119 Ga0373956_0120090 Ga0373956_0120090_228_986 252
745 3300035120 Ga0373957_0001572 Ga0373957_0001572_1033_1791 252
746 3300035121 Ga0373960_0002646 Ga0373960_0002646_1719_2477 252
747 3300035121 Ga0373960_0007249 Ga0373960_0007249_1129_1887 252
748 3300035170 Ga0373943_0005039 Ga0373943_0005039_3969_4727 252
749 3300035170 Ga0373943_0007317 Ga0373943_0007317_519_1277 252
750 3300035170 Ga0373943_0008492 Ga0373943_0008492_2428_3186 252
751 3300035170 Ga0373943_0034153 Ga0373943_0034153_448_1206 252
752 3300035171 Ga0373946_0010820 Ga0373946_0010820_2092_2850 252
753 3300035171 Ga0373946_0072114 Ga0373946_0072114_342_1100 252
754 3300035171 Ga0373946_0117386 Ga0373946_0117386_245_1021 252
755 3300035172 Ga0373955_0002275 Ga0373955_0002275_7463_8221 252
756 3300035172 Ga0373955_0022739 Ga0373955_0022739_655_1413 252
757 3300035172 Ga0373955_0027293 Ga0373955_0027293_2149_2907 252
758 3300035172 Ga0373955_0052897 Ga0373955_0052897_16_774 252
759 3300035207 Ga0373942_0001912 Ga0373942_0001912_1609_2367 252
760 3300035207 Ga0373942_0005068 Ga0373942_0005068_705_1463 252
761 3300035207 Ga0373942_0012073 Ga0373942_0012073_215_973 252
762 3300035242 Ga0373962_0000253 Ga0373962_0000253_4836_5594 252
763 3300035242 Ga0373962_0013895 Ga0373962_0013895_71_829 252
764 3300035410 Ga0373924_0005148 Ga0373924_0005148_2323_3081 252
765 3300035691 Ga0373931_0000714 Ga0373931_0000714_8552_9310 252
766 3300035691 Ga0373931_0001610 Ga0373931_0001610_3568_4326 252
767 3300035691 Ga0373931_0025062 Ga0373931_0025062_676_1434 252
768 3300035691 Ga0373931_0054884 Ga0373931_0054884_1100_1858 252
769 3300035692 Ga0373935_0004317 Ga0373935_0004317_6689_7447 252
770 3300035692 Ga0373935_0023439 Ga0373935_0023439_2593_3351 252
771 3300035692 Ga0373935_0190134 Ga0373935_0190134_643_1401 252
772 3300035692 Ga0373935_0302081 Ga0373935_0302081_127_885 252
773 3300035695 Ga0373927_0009357 Ga0373927_0009357_3633_4391 252
774 3300035695 Ga0373927_0027987 Ga0373927_0027987_454_1212 252
775 3300035695 Ga0373927_0047576 Ga0373927_0047576_1563_2321 252
776 3300035695 Ga0373927_0060880 Ga0373927_0060880_799_1557 252
777 3300035695 Ga0373927_0137079 Ga0373927_0137079_535_1311 252
778 3300035695 Ga0373927_0263026 Ga0373927_0263026_260_1018 252
779 3300035724 Ga0373933_0001224 Ga0373933_0001224_12106_12864 252
780 3300035724 Ga0373933_0005081 Ga0373933_0005081_6226_6984 252
781 3300035724 Ga0373933_0100261 Ga0373933_0100261_259_1017 252
782 3300035724 Ga0373933_0189294 Ga0373933_0189294_137_895 252
783 3300035724 Ga0373933_0196441 Ga0373933_0196441_217_975 252
784 3300035725 Ga0373947_0002242 Ga0373947_0002242_8979_9737 252
785 3300035725 Ga0373947_0029617 Ga0373947_0029617_1020_1778 252
786 3300035725 Ga0373947_0039388 Ga0373947_0039388_416_1174 252
787 3300035725 Ga0373947_0043254 Ga0373947_0043254_1351_2109 252
788 3300035725 Ga0373947_0059857 Ga0373947_0059857_442_1200 252
789 3300036401 Ga0373937_0000975 Ga0373937_0000975_4683_5441 252
790 3300036401 Ga0373937_0005174 Ga0373937_0005174_2133_2891 252
791 3300036401 Ga0373937_0008485 Ga0373937_0008485_102_878 252
792 3300036401 Ga0373937_0052710 Ga0373937_0052710_1018_1776 252
793 3300036401 Ga0373937_0155073 Ga0373937_0155073_297_1055 252
794 3300036401 Ga0373937_0313823 Ga0373937_0313823_640_1398 252
795 3300036401 Ga0373937_0649147 Ga0373937_0649147_229_987 252
796 3300037068 Ga0373925_0000957 Ga0373925_0000957_3020_3778 252
797 3300037068 Ga0373925_0009418 Ga0373925_0009418_3713_4489 252
798 3300037068 Ga0373925_0055962 Ga0373925_0055962_2130_2888 252
799 3300037068 Ga0373925_0099421 Ga0373925_0099421_1105_1863 252
800 3300037068 Ga0373925_0168422 Ga0373925_0168422_529_1287 252
801 3300037312 Ga0395899_0008367 Ga0395899_0008367_5310_6068 252
802 3300037418 Ga0395900_0005495 Ga0395900_0005495_7441_8199 252
803 3300037418 Ga0395900_0024104 Ga0395900_0024104_451_1209 252
804 3300037466 Ga0395898_0007621 Ga0395898_0007621_1447_2205 252
805 3300037466 Ga0395898_0017809 Ga0395898_0017809_2130_2888 252
806 3300037466 Ga0395898_0132944 Ga0395898_0132944_646_1404 252
807 3300038443 Ga0395901_0008887 Ga0395901_0008887_4819_5577 252
808 3300038443 Ga0395901_0027102 Ga0395901_0027102_4637_5395 252
809 3300038443 Ga0395901_0174151 Ga0395901_0174151_627_1385 252
810 3300038443 Ga0395901_0367506 Ga0395901_0367506_18_776 252
811 3300039438 Ga0436360_1080146 Ga0436360_1080146_797_1555 252
812 3300039447 Ga0436361_0112922 Ga0436361_0112922_103_861 252
813 3300039447 Ga0436361_1189806 Ga0436361_1189806_12105_12944 252
814 3300041498 Ga0451841_1103901 Ga0451841_1103901_354_1112 252
815 3300044684 Ga0466966_0138105 Ga0466966_0138105_160_918 252
816 3300044694 Ga0466963_0096029 Ga0466963_0096029_503_1261 252
817 3300044694 Ga0466963_0112620 Ga0466963_0112620_567_1325 252
818 3300044706 Ga0466964_0197903 Ga0466964_0197903_139_897 252
819 3300044719 Ga0466971_0063342 Ga0466971_0063342_131_907 252
820 3300044842 Ga0466957_0012433 Ga0466957_0012433_3625_4383 252
821 3300045049 Ga0466959_0021191 Ga0466959_0021191_625_1383 252
822 3300045051 Ga0451576_0091489 Ga0451576_0091489_564_1322 252
823 3300045836 Ga0466958_0034909 Ga0466958_0034909_12_770 252
824 3300045976 Ga0466967_0010562 Ga0466967_0010562_3455_4213 252
825 3300045976 Ga0466967_0294718 Ga0466967_0294718_637_1395 252
826 3300045976 Ga0466967_0448740 Ga0466967_0448740_333_1091 252
827 3300046452 Ga0495617_029664 Ga0495617_029664_242_1000 252
828 3300046454 Ga0495592_0026610 Ga0495592_0026610_1494_2252 252
829 3300046454 Ga0495592_0047700 Ga0495592_0047700_633_1391 252
830 3300046454 Ga0495592_0072135 Ga0495592_0072135_205_963 252
831 3300046454 Ga0495592_0127285 Ga0495592_0127285_258_1016 252
832 3300046455 Ga0495603_0069549 Ga0495603_0069549_839_1597 252
833 3300046455 Ga0495603_0099243 Ga0495603_0099243_457_1215 252
834 3300046455 Ga0495603_0273942 Ga0495603_0273942_126_884 252
835 3300046459 Ga0495629_0027195 Ga0495629_0027195_3097_3855 252
836 3300046459 Ga0495629_0043069 Ga0495629_0043069_2132_2890 252
837 3300046459 Ga0495629_0350973 Ga0495629_0350973_89_847 252
838 3300046460 Ga0495638_0034210 Ga0495638_0034210_1425_2183 252
839 3300046461 Ga0495641_0029573 Ga0495641_0029573_1634_2392 252
840 3300046461 Ga0495641_0056413 Ga0495641_0056413_532_1290 252
841 3300046461 Ga0495641_0091423 Ga0495641_0091423_177_935 252
842 3300046462 Ga0495651_0036961 Ga0495651_0036961_2112_2870 252
843 3300046462 Ga0495651_0048365 Ga0495651_0048365_1252_2028 252
844 3300046462 Ga0495651_0063674 Ga0495651_0063674_423_1181 252
845 3300046462 Ga0495651_0189383 Ga0495651_0189383_135_893 252
846 3300046463 Ga0495653_0004970 Ga0495653_0004970_8792_9550 252
847 3300046463 Ga0495653_0010292 Ga0495653_0010292_601_1359 252
848 3300046463 Ga0495653_0079954 Ga0495653_0079954_1530_2306 252
849 3300046463 Ga0495653_0233014 Ga0495653_0233014_453_1211 252
850 3300046472 Ga0495580_0009608 Ga0495580_0009608_5191_5949 252
851 3300046472 Ga0495580_0053605 Ga0495580_0053605_747_1505 252
852 3300046472 Ga0495580_0057294 Ga0495580_0057294_377_1135 252
853 3300046473 Ga0495582_0009496 Ga0495582_0009496_2303_3061 252
854 3300046473 Ga0495582_0012182 Ga0495582_0012182_1805_2563 252
855 3300046474 Ga0495605_0082857 Ga0495605_0082857_671_1429 252
856 3300046475 Ga0495639_0066440 Ga0495639_0066440_864_1622 252
857 3300046475 Ga0495639_0073431 Ga0495639_0073431_44_802 252
858 3300046476 Ga0495662_0014265 Ga0495662_0014265_2980_3738 252
859 3300046476 Ga0495662_0114650 Ga0495662_0114650_551_1309 252
860 3300046477 Ga0495664_0005349 Ga0495664_0005349_3778_4536 252
861 3300046477 Ga0495664_0009436 Ga0495664_0009436_2217_2975 252
862 3300046477 Ga0495664_0024516 Ga0495664_0024516_1565_2323 252
863 3300046491 Ga0495584_0017374 Ga0495584_0017374_1828_2586 252
864 3300046491 Ga0495584_0023045 Ga0495584_0023045_476_1234 252
865 3300046491 Ga0495584_0045524 Ga0495584_0045524_1245_2003 252
866 3300046492 Ga0495585_0057566 Ga0495585_0057566_1228_1986 252
867 3300046499 Ga0495594_0024127 Ga0495594_0024127_1666_2424 252
868 3300046499 Ga0495594_0024998 Ga0495594_0024998_2205_2963 252
869 3300046499 Ga0495594_0026850 Ga0495594_0026850_133_891 252
870 3300046501 Ga0495607_0043208 Ga0495607_0043208_257_1015 252
871 3300046501 Ga0495607_0051344 Ga0495607_0051344_733_1491 252
872 3300046506 Ga0495583_0106016 Ga0495583_0106016_16_774 252
873 3300046511 Ga0495608_0004206 Ga0495608_0004206_8392_9150 252
874 3300046511 Ga0495608_0091167 Ga0495608_0091167_878_1636 252
875 3300046514 Ga0495618_0001619 Ga0495618_0001619_10944_11702 252
876 3300046514 Ga0495618_0004363 Ga0495618_0004363_4602_5360 252
877 3300046514 Ga0495618_0374084 Ga0495618_0374084_40_816 252
878 3300046516 Ga0495628_0012115 Ga0495628_0012115_2616_3392 252
879 3300046516 Ga0495628_0015917 Ga0495628_0015917_560_1318 252
880 3300046516 Ga0495628_0115301 Ga0495628_0115301_601_1359 252
881 3300046517 Ga0495630_0008146 Ga0495630_0008146_6374_7132 252
882 3300046517 Ga0495630_0008748 Ga0495630_0008748_1587_2345 252
883 3300046517 Ga0495630_0124544 Ga0495630_0124544_952_1710 252
884 3300046517 Ga0495630_0171519 Ga0495630_0171519_311_1069 252
885 3300046517 Ga0495630_0189414 Ga0495630_0189414_557_1315 252
886 3300046517 Ga0495630_0413098 Ga0495630_0413098_239_1015 252
887 3300046518 Ga0495631_0060265 Ga0495631_0060265_545_1303 252
888 3300046520 Ga0495637_0023416 Ga0495637_0023416_171_929 252
889 3300046523 Ga0495644_0006450 Ga0495644_0006450_1774_2532 252
890 3300046523 Ga0495644_0018349 Ga0495644_0018349_1765_2523 252
891 3300046526 Ga0495666_0008087 Ga0495666_0008087_1933_2691 252
892 3300046526 Ga0495666_0114582 Ga0495666_0114582_18_776 252
893 3300046529 Ga0495652_0005206 Ga0495652_0005206_11420_12196 252
894 3300046529 Ga0495652_0009266 Ga0495652_0009266_4848_5606 252
895 3300046529 Ga0495652_0024740 Ga0495652_0024740_2856_3614 252
896 3300046529 Ga0495652_0051485 Ga0495652_0051485_467_1225 252
897 3300046531 Ga0495665_0030853 Ga0495665_0030853_1651_2409 252
898 3300046531 Ga0495665_0036404 Ga0495665_0036404_462_1220 252
899 3300046531 Ga0495665_0061885 Ga0495665_0061885_726_1484 252
900 3300046533 Ga0495640_0058007 Ga0495640_0058007_687_1445 252
901 3300046535 Ga0495586_0002128 Ga0495586_0002128_8105_8863 252
902 3300046536 Ga0495587_0003095 Ga0495587_0003095_2122_2880 252
903 3300046536 Ga0495587_0058871 Ga0495587_0058871_538_1296 252
904 3300046536 Ga0495587_0085920 Ga0495587_0085920_821_1579 252
905 3300046543 Ga0495645_0003434 Ga0495645_0003434_7218_7976 252
906 3300046543 Ga0495645_0010106 Ga0495645_0010106_3021_3779 252
907 3300046543 Ga0495645_0020403 Ga0495645_0020403_1373_2149 252
908 3300046557 Ga0495622_0012355 Ga0495622_0012355_2476_3234 252
909 3300046557 Ga0495622_0089885 Ga0495622_0089885_591_1349 252
910 3300046557 Ga0495622_0157356 Ga0495622_0157356_200_958 252
911 3300046558 Ga0495633_0010291 Ga0495633_0010291_1990_2748 252
912 3300046559 Ga0495667_0001067 Ga0495667_0001067_2333_3091 252
913 3300046559 Ga0495667_0026810 Ga0495667_0026810_868_1626 252
914 3300046559 Ga0495667_0057759 Ga0495667_0057759_1764_2522 252
915 3300046559 Ga0495667_0159583 Ga0495667_0159583_456_1214 252
916 3300046559 Ga0495667_0288433 Ga0495667_0288433_14_772 252
917 3300046615 Ga0495656_0008765 Ga0495656_0008765_512_1270 252
918 3300046615 Ga0495656_0009015 Ga0495656_0009015_2214_2972 252
919 3300046615 Ga0495656_0009923 Ga0495656_0009923_783_1541 252
920 3300046616 Ga0495668_0188077 Ga0495668_0188077_224_982 252
921 3300046642 Ga0495634_0051910 Ga0495634_0051910_454_1212 252
922 3300046648 Ga0495611_0167764 Ga0495611_0167764_180_938 252
923 3300046663 Ga0495635_0000394 Ga0495635_0000394_22496_23254 252
924 3300046663 Ga0495635_0019246 Ga0495635_0019246_2048_2806 252
925 3300046663 Ga0495635_0021691 Ga0495635_0021691_2483_3241 252
926 3300046663 Ga0495635_0145178 Ga0495635_0145178_64_840 252
927 3300046663 Ga0495635_0186123 Ga0495635_0186123_396_1154 252
928 3300046663 Ga0495635_0373986 Ga0495635_0373986_91_849 252
929 3300046664 Ga0495659_0002989 Ga0495659_0002989_1982_2740 252
930 3300046664 Ga0495659_0023278 Ga0495659_0023278_1138_1896 252
931 3300046665 Ga0495661_0185327 Ga0495661_0185327_108_866 252
932 3300046674 Ga0495588_0028556 Ga0495588_0028556_1238_1996 252
933 3300046674 Ga0495588_0036562 Ga0495588_0036562_1443_2201 252
934 3300046674 Ga0495588_0061784 Ga0495588_0061784_894_1652 252
935 3300046675 Ga0495657_0007463 Ga0495657_0007463_249_1007 252
936 3300046675 Ga0495657_0028576 Ga0495657_0028576_1200_1976 252
937 3300046678 Ga0495599_0006759 Ga0495599_0006759_5676_6452 252
938 3300046678 Ga0495599_0028649 Ga0495599_0028649_1438_2196 252
939 3300046678 Ga0495599_0063227 Ga0495599_0063227_896_1654 252
940 3300046678 Ga0495599_0090628 Ga0495599_0090628_735_1493 252
941 3300046679 Ga0495623_0004291 Ga0495623_0004291_7823_8581 252
942 3300046679 Ga0495623_0070510 Ga0495623_0070510_227_1003 252
943 3300046679 Ga0495623_0145164 Ga0495623_0145164_416_1174 252
944 3300046680 Ga0495646_0002070 Ga0495646_0002070_2105_2863 252
945 3300046680 Ga0495646_0006456 Ga0495646_0006456_4693_5451 252
946 3300046681 Ga0495647_0004254 Ga0495647_0004254_1063_1821 252
947 3300046681 Ga0495647_0024504 Ga0495647_0024504_1025_1783 252
948 3300046681 Ga0495647_0045315 Ga0495647_0045315_263_1021 252
949 3300046683 Ga0495658_0009413 Ga0495658_0009413_887_1645 252
950 3300046683 Ga0495658_0013122 Ga0495658_0013122_2809_3567 252
951 3300046683 Ga0495658_0016699 Ga0495658_0016699_33_791 252
952 3300046683 Ga0495658_0172940 Ga0495658_0172940_219_977 252
953 3300046684 Ga0495669_0123140 Ga0495669_0123140_430_1188 252
954 3300046689 Ga0495613_0011644 Ga0495613_0011644_2350_3108 252
955 3300046689 Ga0495613_0012697 Ga0495613_0012697_3507_4265 252
956 3300046689 Ga0495613_0066265 Ga0495613_0066265_997_1755 252
957 3300046689 Ga0495613_0078961 Ga0495613_0078961_1552_2310 252
958 3300046689 Ga0495613_0180415 Ga0495613_0180415_375_1133 252
959 3300046689 Ga0495613_0258265 Ga0495613_0258265_324_1082 252
960 3300046690 Ga0495624_0007769 Ga0495624_0007769_6334_7092 252
961 3300046690 Ga0495624_0041258 Ga0495624_0041258_1638_2396 252
962 3300046690 Ga0495624_0051645 Ga0495624_0051645_1172_1930 252
963 3300046690 Ga0495624_0061672 Ga0495624_0061672_947_1705 252
964 3300046690 Ga0495624_0124212 Ga0495624_0124212_199_957 252
965 3300046690 Ga0495624_0248670 Ga0495624_0248670_194_952 252
966 3300046691 Ga0495670_0019898 Ga0495670_0019898_368_1126 252
967 3300046691 Ga0495670_0073632 Ga0495670_0073632_413_1171 252
968 3300046692 Ga0495671_0025916 Ga0495671_0025916_1880_2638 252
969 3300046794 Ga0495589_0018433 Ga0495589_0018433_120_878 252
970 3300046794 Ga0495589_0047695 Ga0495589_0047695_449_1207 252
971 3300046809 Ga0495600_0004625 Ga0495600_0004625_5369_6127 252
972 3300046809 Ga0495600_0016416 Ga0495600_0016416_3013_3771 252
973 3300046809 Ga0495600_0037714 Ga0495600_0037714_674_1432 252
974 3300046809 Ga0495600_0177978 Ga0495600_0177978_448_1206 252
975 3300046810 Ga0495660_0171133 Ga0495660_0171133_65_823 252
976 3300047315 Ga0495581_0119535 Ga0495581_0119535_513_1271 252
977 3300047315 Ga0495581_0144521 Ga0495581_0144521_536_1294 252
978 3300047315 Ga0495581_0178038 Ga0495581_0178038_56_814 252
979 3300047317 Ga0495604_0003694 Ga0495604_0003694_9304_10062 252
980 3300047317 Ga0495604_0023789 Ga0495604_0023789_2451_3209 252
981 3300047317 Ga0495604_0027799 Ga0495604_0027799_1881_2657 252
982 3300047317 Ga0495604_0170528 Ga0495604_0170528_122_880 252
983 3300047319 Ga0495674_0032084 Ga0495674_0032084_2117_2875 252
984 3300047319 Ga0495674_0040811 Ga0495674_0040811_1851_2609 252
985 3300047319 Ga0495674_0044803 Ga0495674_0044803_13_771 252
986 3300047319 Ga0495674_0052198 Ga0495674_0052198_1743_2501 252
987 3300047319 Ga0495674_0306325 Ga0495674_0306325_231_989 252
988 3300047321 Ga0495676_0039309 Ga0495676_0039309_220_978 252
989 3300047321 Ga0495676_0121478 Ga0495676_0121478_85_843 252
990 3300047321 Ga0495676_0123925 Ga0495676_0123925_871_1629 252
991 3300047322 Ga0495680_0012767 Ga0495680_0012767_3123_3881 252
992 3300047322 Ga0495680_0036916 Ga0495680_0036916_531_1307 252
993 3300047322 Ga0495680_0041150 Ga0495680_0041150_928_1686 252
994 3300047322 Ga0495680_0093890 Ga0495680_0093890_841_1599 252
995 3300047322 Ga0495680_0154834 Ga0495680_0154834_864_1622 252
996 3300047322 Ga0495680_0338998 Ga0495680_0338998_276_1034 252
997 3300047444 Ga0495675_0001338 Ga0495675_0001338_2125_2883 252
998 3300047444 Ga0495675_0004135 Ga0495675_0004135_6157_6933 252
999 3300047444 Ga0495675_0038177 Ga0495675_0038177_1813_2571 252
1000 3300047445 Ga0495677_0038474 Ga0495677_0038474_669_1427 252
1001 3300047446 Ga0495679_019083 Ga0495679_019083_783_1541 252
1002 3300047471 Ga0495684_0006000 Ga0495684_0006000_6043_6801 252
1003 3300047471 Ga0495684_0064230 Ga0495684_0064230_734_1492 252
1004 3300047471 Ga0495684_0079614 Ga0495684_0079614_1569_2327 252
1005 3300047471 Ga0495684_0098651 Ga0495684_0098651_588_1346 252
1006 3300047471 Ga0495684_0347368 Ga0495684_0347368_277_1035 252
1007 3300047471 Ga0495684_0405297 Ga0495684_0405297_149_907 252
1008 3300047673 Ga0495593_0007939 Ga0495593_0007939_3631_4389 252
1009 3300047673 Ga0495593_0009818 Ga0495593_0009818_2184_2942 252
1010 3300047673 Ga0495593_0018341 Ga0495593_0018341_2737_3495 252
1011 3300047673 Ga0495593_0019894 Ga0495593_0019894_1509_2267 252
1012 3300047673 Ga0495593_0164041 Ga0495593_0164041_70_828 252
1013 3300048088 Ga0495602_0002392 Ga0495602_0002392_16161_16919 252
1014 3300048088 Ga0495602_0007064 Ga0495602_0007064_2624_3400 252
1015 3300048088 Ga0495602_0014347 Ga0495602_0014347_7235_7993 252
1016 3300048088 Ga0495602_0128720 Ga0495602_0128720_497_1255 252
1017 3300048089 Ga0495614_0016606 Ga0495614_0016606_374_1132 252
1018 3300048091 Ga0495626_0048998 Ga0495626_0048998_241_999 252
1019 3300048091 Ga0495626_0173809 Ga0495626_0173809_45_803 252
1020 3300048903 Ga0496100_0004244 Ga0496100_0004244_329_1087 252
1021 3300048903 Ga0496100_0023159 Ga0496100_0023159_1998_2756 252
1022 3300048903 Ga0496100_0059421 Ga0496100_0059421_1338_2096 252
1023 3300048903 Ga0496100_0396793 Ga0496100_0396793_14_772 252
1024 3300048904 Ga0496101_0001185 Ga0496101_0001185_11421_12179 252
1025 3300048904 Ga0496101_0024670 Ga0496101_0024670_1795_2553 252
1026 3300048904 Ga0496101_0040403 Ga0496101_0040403_358_1116 252
1027 3300048904 Ga0496101_0060997 Ga0496101_0060997_745_1503 252
1028 3300048905 Ga0496102_0001427 Ga0496102_0001427_8965_9723 252
1029 3300048905 Ga0496102_0018136 Ga0496102_0018136_2619_3377 252
1030 3300048905 Ga0496102_0018426 Ga0496102_0018426_1483_2241 252
1031 3300048905 Ga0496102_0053452 Ga0496102_0053452_583_1341 252
1032 3300048905 Ga0496102_0087263 Ga0496102_0087263_989_1747 252
1033 3300048905 Ga0496102_0371997 Ga0496102_0371997_277_1035 252
1034 3300048906 Ga0496103_0001145 Ga0496103_0001145_5313_6071 252
1035 3300048906 Ga0496103_0001524 Ga0496103_0001524_1135_1893 252
1036 3300048906 Ga0496103_0031477 Ga0496103_0031477_962_1720 252
1037 3300048906 Ga0496103_0114348 Ga0496103_0114348_927_1685 252
1038 3300048906 Ga0496103_0153280 Ga0496103_0153280_74_832 252
1039 3300048906 Ga0496103_0285618 Ga0496103_0285618_269_1027 252
1040 3300048907 Ga0496104_0000800 Ga0496104_0000800_9947_10723 252
1041 3300048907 Ga0496104_0004650 Ga0496104_0004650_5013_5771 252
1042 3300048907 Ga0496104_0008602 Ga0496104_0008602_5592_6350 252
1043 3300048907 Ga0496104_0080146 Ga0496104_0080146_1758_2516 252
1044 3300048907 Ga0496104_0267042 Ga0496104_0267042_50_808 252
1045 3300048908 Ga0496105_0001601 Ga0496105_0001601_1667_2425 252
1046 3300048908 Ga0496105_0007169 Ga0496105_0007169_7087_7863 252
1047 3300048908 Ga0496105_0043840 Ga0496105_0043840_2108_2866 252
1048 3300048908 Ga0496105_0055640 Ga0496105_0055640_1678_2436 252
1049 3300048908 Ga0496105_0127762 Ga0496105_0127762_665_1423 252
1050 3300048908 Ga0496105_0131368 Ga0496105_0131368_154_912 252
1051 3300048908 Ga0496105_0133812 Ga0496105_0133812_794_1552 252
1052 3300048908 Ga0496105_0464510 Ga0496105_0464510_204_962 252
1053 3300048908 Ga0496105_0596551 Ga0496105_0596551_75_833 252
1054 3300048909 Ga0496106_0000644 Ga0496106_0000644_11505_12263 252
1055 3300048909 Ga0496106_0001471 Ga0496106_0001471_13798_14556 252
1056 3300048909 Ga0496106_0004769 Ga0496106_0004769_4677_5435 252
1057 3300048909 Ga0496106_0038434 Ga0496106_0038434_199_957 252
1058 3300048909 Ga0496106_0074471 Ga0496106_0074471_81_839 252
1059 3300048909 Ga0496106_0107912 Ga0496106_0107912_564_1322 252
1060 3300048910 Ga0496107_0000844 Ga0496107_0000844_8875_9633 252
1061 3300048910 Ga0496107_0003765 Ga0496107_0003765_5568_6326 252
1062 3300048910 Ga0496107_0009226 Ga0496107_0009226_5899_6657 252
1063 3300048910 Ga0496107_0009798 Ga0496107_0009798_2062_2820 252
1064 3300048910 Ga0496107_0057610 Ga0496107_0057610_1197_1955 252
1065 3300048910 Ga0496107_0087269 Ga0496107_0087269_1004_1762 252
1066 3300048910 Ga0496107_0328215 Ga0496107_0328215_84_842 252
1067 3300048911 Ga0496108_0002624 Ga0496108_0002624_6096_6854 252
1068 3300048911 Ga0496108_0008578 Ga0496108_0008578_2078_2836 252
1069 3300048911 Ga0496108_0103900 Ga0496108_0103900_200_958 252
1070 3300048911 Ga0496108_0255868 Ga0496108_0255868_207_965 252
1071 3300048911 Ga0496108_0317487 Ga0496108_0317487_399_1157 252
1072 3300048911 Ga0496108_0606640 Ga0496108_0606640_34_792 252
1073 3300048912 Ga0496109_0003011 Ga0496109_0003011_9581_10339 252
1074 3300048912 Ga0496109_0003467 Ga0496109_0003467_1227_1985 252
1075 3300048912 Ga0496109_0007324 Ga0496109_0007324_1176_1934 252
1076 3300048912 Ga0496109_0017542 Ga0496109_0017542_1050_1808 252
1077 3300048912 Ga0496109_0040794 Ga0496109_0040794_3122_3880 252
1078 3300048912 Ga0496109_0169524 Ga0496109_0169524_291_1049 252
1079 3300048912 Ga0496109_0274510 Ga0496109_0274510_181_939 252
1080 3300048913 Ga0496110_0002024 Ga0496110_0002024_7355_8113 252
1081 3300048913 Ga0496110_0007086 Ga0496110_0007086_1565_2323 252
1082 3300048913 Ga0496110_0020732 Ga0496110_0020732_226_984 252
1083 3300048913 Ga0496110_0148698 Ga0496110_0148698_726_1484 252
1084 3300048914 Ga0496111_0001913 Ga0496111_0001913_6625_7383 252
1085 3300048914 Ga0496111_0010288 Ga0496111_0010288_4157_4915 252
1086 3300048914 Ga0496111_0028229 Ga0496111_0028229_267_1025 252
1087 3300048914 Ga0496111_0029166 Ga0496111_0029166_2396_3154 252
1088 3300048914 Ga0496111_0559644 Ga0496111_0559644_58_816 252
1089 3300048915 Ga0496112_0019149 Ga0496112_0019149_323_1081 252
1090 3300048915 Ga0496112_0230062 Ga0496112_0230062_692_1450 252
1091 3300048915 Ga0496112_0623309 Ga0496112_0623309_45_803 252
1092 3300048916 Ga0496113_0004226 Ga0496113_0004226_2270_3028 252
1093 3300048916 Ga0496113_0007869 Ga0496113_0007869_2047_2805 252
1094 3300048916 Ga0496113_0086459 Ga0496113_0086459_442_1200 252
1095 3300048916 Ga0496113_0172048 Ga0496113_0172048_60_818 252
1096 3300048916 Ga0496113_0446123 Ga0496113_0446123_207_965 252
1097 3300048917 Ga0496114_0014349 Ga0496114_0014349_5204_5962 252
1098 3300048917 Ga0496114_0068992 Ga0496114_0068992_535_1293 252
1099 3300048917 Ga0496114_0089006 Ga0496114_0089006_1795_2553 252
1100 3300048917 Ga0496114_0275581 Ga0496114_0275581_681_1439 252
1101 3300048918 Ga0496115_0018826 Ga0496115_0018826_1291_2049 252
1102 3300048918 Ga0496115_0061514 Ga0496115_0061514_398_1174 252
1103 3300048918 Ga0496115_0095801 Ga0496115_0095801_950_1708 252
1104 3300048918 Ga0496115_0114500 Ga0496115_0114500_354_1112 252
1105 3300048918 Ga0496115_0196993 Ga0496115_0196993_88_846 252
1106 3300048918 Ga0496115_0215546 Ga0496115_0215546_242_1000 252
1107 3300048918 Ga0496115_0368967 Ga0496115_0368967_14_772 252
1108 3300049571 Ga0501034_0032933 Ga0501034_0032933_665_1423 252
1109 3300049571 Ga0501034_0144463 Ga0501034_0144463_971_1729 252
1110 3300049572 Ga0501036_0591718 Ga0501036_0591718_145_903 252
1111 3300049575 Ga0501039_0196099 Ga0501039_0196099_165_923 252
1112 3300049580 Ga0501046_0212367 Ga0501046_0212367_556_1314 252
1113 3300049581 Ga0501047_0323981 Ga0501047_0323981_103_861 252
1114 3300049581 Ga0501047_0453050 Ga0501047_0453050_308_1066 252
1115 3300049590 Ga0501074_0254866 Ga0501074_0254866_52_810 252
1116 3300049591 Ga0501075_0046021 Ga0501075_0046021_68_826 252
1117 3300049592 Ga0501076_0392448 Ga0501076_0392448_287_1045 252
1118 3300049593 Ga0501077_0100807 Ga0501077_0100807_614_1372 252
1119 3300049741 Ga0501079_0023386 Ga0501079_0023386_2245_3003 252
1120 3300049742 Ga0501080_0087239 Ga0501080_0087239_1441_2199 252
1121 3300049823 Ga0501044_0116295 Ga0501044_0116295_1576_2334 252
1122 3300050489 nmdc:mga03683_13694_c1 nmdc:mga03683_13694_c1_618_1376 252
1123 3300050490 nmdc:mga03n38_195905_c1 nmdc:mga03n38_195905_c1_115_873 252
1124 3300050492 nmdc:mga0yw44_144524_c1 nmdc:mga0yw44_144524_c1_103_861 252
1125 3300050492 nmdc:mga0yw44_15059_c1 nmdc:mga0yw44_15059_c1_765_1523 252
1126 3300050492 nmdc:mga0yw44_1739_c1 nmdc:mga0yw44_1739_c1_6838_7596 252
1127 3300050492 nmdc:mga0yw44_2945_c1 nmdc:mga0yw44_2945_c1_569_1327 252
1128 3300050494 nmdc:mga06z11_109499_c1 nmdc:mga06z11_109499_c1_369_1127 252
1129 3300050494 nmdc:mga06z11_40651_c1 nmdc:mga06z11_40651_c1_1366_2124 252
1130 3300050495 nmdc:mga04h51_168816_c1 nmdc:mga04h51_168816_c1_71_829 252
1131 3300050496 nmdc:mga07m45_89651_c1 nmdc:mga07m45_89651_c1_221_979 252
1132 3300050507 nmdc:mga05p37_215917_c1 nmdc:mga05p37_215917_c1_312_1070 252
1133 3300050507 nmdc:mga05p37_40357_c1 nmdc:mga05p37_40357_c1_3750_4508 252
1134 3300050507 nmdc:mga05p37_5180_c1 nmdc:mga05p37_5180_c1_10065_10823 252
1135 3300050508 nmdc:mga09592_18911_c1 nmdc:mga09592_18911_c1_66_824 252
1136 3300050508 nmdc:mga09592_452935_c1 nmdc:mga09592_452935_c1_292_1050 252
1137 3300050510 nmdc:mga06r32_97073_c1 nmdc:mga06r32_97073_c1_628_1440 252
1138 3300050511 nmdc:mga08y16_111162_c1 nmdc:mga08y16_111162_c1_851_1609 252
1139 3300050511 nmdc:mga08y16_248692_c1 nmdc:mga08y16_248692_c1_48_806 252
1140 3300050511 nmdc:mga08y16_285699_c1 nmdc:mga08y16_285699_c1_308_1072 252
1141 3300050511 nmdc:mga08y16_346068_c1 nmdc:mga08y16_346068_c1_276_1034 252
1142 3300050511 nmdc:mga08y16_74716_c1 nmdc:mga08y16_74716_c1_1143_1901 252
1143 3300050511 nmdc:mga08y16_95441_c1 nmdc:mga08y16_95441_c1_1747_2505 252
1144 3300050512 nmdc:mga0n895_1698_c1 nmdc:mga0n895_1698_c1_8696_9454 252
1145 3300050512 nmdc:mga0n895_26906_c1 nmdc:mga0n895_26906_c1_2180_2938 252
1146 3300050512 nmdc:mga0n895_296510_c1 nmdc:mga0n895_296510_c1_669_1427 252
1147 3300050512 nmdc:mga0n895_397986_c1 nmdc:mga0n895_397986_c1_16_810 252
1148 3300050513 nmdc:mga0rr50_140884_c1 nmdc:mga0rr50_140884_c1_287_1045 252
1149 3300050513 nmdc:mga0rr50_221166_c1 nmdc:mga0rr50_221166_c1_396_1154 252
1150 3300050513 nmdc:mga0rr50_241291_c1 nmdc:mga0rr50_241291_c1_693_1451 252
1151 3300050514 nmdc:mga08x19_158662_c1 nmdc:mga08x19_158662_c1_557_1315 252
1152 3300050514 nmdc:mga08x19_32342_c1 nmdc:mga08x19_32342_c1_2298_3056 252
1153 3300050515 nmdc:mga0a205_151450_c1 nmdc:mga0a205_151450_c1_235_993 252
1154 3300050515 nmdc:mga0a205_228243_c1 nmdc:mga0a205_228243_c1_40_921 252
1155 3300050515 nmdc:mga0a205_377641_c1 nmdc:mga0a205_377641_c1_247_1005 252
1156 3300050515 nmdc:mga0a205_39881_c2 nmdc:mga0a205_39881_c2_1766_2524 252
1157 3300050515 nmdc:mga0a205_5270_c1 nmdc:mga0a205_5270_c1_60_824 252
1158 3300053077 Ga0495601_0000069 Ga0495601_0000069_6256_7032 252
1159 3300053077 Ga0495601_0012835 Ga0495601_0012835_2110_2868 252
1160 3300053077 Ga0495601_0028733 Ga0495601_0028733_2128_2886 252
1161 3300053077 Ga0495601_0030043 Ga0495601_0030043_1884_2642 252
1162 3300053077 Ga0495601_0031923 Ga0495601_0031923_2461_3219 252
1163 3300053077 Ga0495601_0061488 Ga0495601_0061488_1281_2039 252
1164 3300053077 Ga0495601_0161288 Ga0495601_0161288_586_1344 252
1165 3300053077 Ga0495601_0277156 Ga0495601_0277156_127_885 252
1166 3300053078 Ga0495612_0000175 Ga0495612_0000175_10566_11324 252
1167 3300053078 Ga0495612_0001538 Ga0495612_0001538_2569_3345 252
1168 3300053078 Ga0495612_0013349 Ga0495612_0013349_919_1677 252
1169 3300053078 Ga0495612_0021353 Ga0495612_0021353_1366_2124 252
1170 3300053078 Ga0495612_0048575 Ga0495612_0048575_799_1557 252
1171 3300053078 Ga0495612_0055743 Ga0495612_0055743_527_1285 252
1172 3300053083 Ga0495655_0017879 Ga0495655_0017879_756_1514 252
1173 3300053084 Ga0495595_0002192 Ga0495595_0002192_2112_2870 252
1174 3300053084 Ga0495595_0004944 Ga0495595_0004944_2108_2866 252
1175 3300053084 Ga0495595_0010549 Ga0495595_0010549_238_1014 252
1176 3300053084 Ga0495595_0019399 Ga0495595_0019399_1750_2508 252
1177 3300053084 Ga0495595_0022642 Ga0495595_0022642_643_1401 252
1178 3300053084 Ga0495595_0049289 Ga0495595_0049289_679_1437 252
1179 3300053084 Ga0495595_0063523 Ga0495595_0063523_565_1323 252
1180 3300053085 Ga0495619_0000510 Ga0495619_0000510_24418_25176 252
1181 3300053085 Ga0495619_0005933 Ga0495619_0005933_2619_3395 252
1182 3300053085 Ga0495619_0018617 Ga0495619_0018617_1470_2228 252
1183 3300053085 Ga0495619_0023782 Ga0495619_0023782_194_952 252
1184 3300053085 Ga0495619_0030190 Ga0495619_0030190_1361_2119 252
1185 3300053085 Ga0495619_0031858 Ga0495619_0031858_1294_2052 252
1186 3300053085 Ga0495619_0033469 Ga0495619_0033469_85_843 252
1187 3300053085 Ga0495619_0054034 Ga0495619_0054034_270_1028 252
1188 3300053085 Ga0495619_0059368 Ga0495619_0059368_1731_2489 252
1189 3300053085 Ga0495619_0157535 Ga0495619_0157535_601_1359 252
1190 3300053085 Ga0495619_0177313 Ga0495619_0177313_61_819 252
1191 3300053085 Ga0495619_0346024 Ga0495619_0346024_178_936 252
1192 3300053094 Ga0500566_0136844 Ga0500566_0136844_413_1171 252
1193 3300053117 Ga0500593_035004 Ga0500593_035004_957_1715 252
1194 3300053153 Ga0500616_0012330 Ga0500616_0012330_2048_2806 252
1195 3300053728 Ga0500657_101060 Ga0500657_101060_237_995 252
1196 3300060353 Ga0501082_0068379 Ga0501082_0068379_847_1605 252
1197 3300060353 Ga0501082_0153093 Ga0501082_0153093_1011_1769 252
1198 3300060353 Ga0501082_0665614 Ga0501082_0665614_107_865 252
1199 3300061719 Ga0466962_0024798 Ga0466962_0024798_956_1714 252
1200 3300061734 Ga0530510_0044639 Ga0530510_0044639_2331_3089 252
1201 3300061734 Ga0530510_0083639 Ga0530510_0083639_1295_2053 252
1202 3300061734 Ga0530510_0336849 Ga0530510_0336849_339_1097 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

47

177

0.95

PF00106

adh_short

short chain dehydrogenase

8

51

0.92

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

46

233

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fwm-assembly1.cif.gz_X crystal structure of e. coli enta, a 2,3-dihydrodihydroxy benzoate dehydrogenase 0.9486 6 242
8dt1-assembly1.cif.gz_C crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with nad 0.936 5 242
4ni5-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from brucella suis 0.9352 4 241
4cqm-assembly4.cif.gz_G crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9343 11 241
6t65-assembly1.cif.gz_B crsytal structure of acinetobacter baumannii fabg inhibitor complex at 2.35 a resolution 0.934 8 241
ID Description Score Start End Superfamily
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9583 53 172 3.40.50.720
2fwmX00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9486 6 242 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9467 5 176 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9385 5 176 3.40.50.720
af_Q2QLP7_18_222_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9376 9 179 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V6CHQ7-F1-model_v4 Short-chain dehydrogenase/reductase 0.9579 4 179 GO:0016491
AF-A0A6J6LV11-F1-model_v4 Unannotated protein 0.9572 3 241 GO:0006633
GO:0016616
GO:0048038
AF-A0A6I2Y422-F1-model_v4 SDR family oxidoreductase 0.9566 1 241 GO:0016491
AF-A0A2E1JDC0-F1-model_v4 Short-chain dehydrogenase 0.9559 3 241
AF-A0A537MRI7-F1-model_v4 SDR family oxidoreductase 0.9548 1 230 GO:0016491

Feature Viewer

pLDDT pTM Quality
92.19 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map