F491600

General Info

Members Datasets Scaffolds Average Seq Length
1201 948 532 540

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2510461069|2510842912
Length 466
Sequence FGKVLVGQGGILSTPAASHVIRKYKAFGGIVLSASHNPGGPTEDFGIKYNIGNGGPAPEKITDAIYARSKVIDTYKTVNAADIDLDKVGTFELAGMKVAVIDPVADYAELMESLFDFNAIRNMFGLGFRMVFDAMSAVTGPYAKDIIEGRLGAPEGTVRNFIPLPDFGGHHPDPNLVHAKDLYDEMMSGAGAPDFGAASDGDGDRNLIIGKGIFVTPSDSLAILAANAHLAPGYSGGIAGIARSMPTSAAADRVAEKLGIGIYETPTGWKFFGNLLDAGKVTICGEESAGTGSSHVREKDGLWAVLLWLNILAVRGESVSDIVHQHWATYGRNYYSRHDYEGVDTERANGLVAMLRDKLATLPGTKVGDLTVAAADDFSYHDPVDHSVSNNQGIRILFEGGSRVVFRLSGTGTSGATLRVYIERYEPDASRHDIETQAALADLIAAAETLAEIKSRTAFDEPTVIT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
9 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
10 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
11 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
12 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
16 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
17 2512875024 Mesorhizobium loti R88b Isolate Nodule
18 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
19 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
20 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
21 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
22 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
23 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
24 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
25 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
26 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
27 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
28 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
29 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
30 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
31 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
32 2516143018 Ensifer sp. BR816 Isolate Nodule
33 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
34 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
35 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
36 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
37 2534681786 Brucella suis 92/29 Isolate Unclassified
38 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
39 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
40 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
41 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
42 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
43 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
44 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
45 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
46 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
47 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
48 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
49 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
50 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
51 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
52 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
53 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
54 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
55 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
56 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
57 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
58 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
59 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
60 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
61 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
62 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
63 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
64 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
65 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
66 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
67 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
68 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
69 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
70 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
71 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
72 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
73 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
74 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
75 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
76 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
77 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
78 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
79 2643221557 Ensifer sp. Root558 Isolate Unclassified
80 2643221558 Rhizobium sp. Root149 Isolate Unclassified
81 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
82 2643221568 Rhizobium sp. Root564 Isolate Unclassified
83 2643221580 Devosia sp. Root635 Isolate Unclassified
84 2643221582 Rhizobium sp. Root651 Isolate Unclassified
85 2643221591 Devosia sp. Root685 Isolate Unclassified
86 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
87 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
88 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
89 2643221607 Rhizobium sp. Root73 Isolate Unclassified
90 2643221610 Ensifer sp. Root74 Isolate Unclassified
91 2643221618 Ensifer sp. Root231 Isolate Unclassified
92 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
93 2643221626 Ensifer sp. Root31 Isolate Unclassified
94 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
95 2643221629 Devosia sp. Root105 Isolate Unclassified
96 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
97 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
98 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
99 2643221655 Ensifer sp. Root1252 Isolate Unclassified
100 2643221659 Ensifer sp. Root127 Isolate Unclassified
101 2643221662 Devosia sp. Root413D1 Isolate Unclassified
102 2643221668 Ensifer sp. Root423 Isolate Unclassified
103 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
104 2643221674 Devosia sp. Root436 Isolate Unclassified
105 2643221675 Ensifer sp. Root1298 Isolate Unclassified
106 2643221680 Ensifer sp. Root1312 Isolate Unclassified
107 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
108 2643221688 Rhizobium sp. Root482 Isolate Unclassified
109 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
110 2643221693 Rhizobium sp. Root491 Isolate Unclassified
111 2643221698 Ensifer sp. Root142 Isolate Unclassified
112 2643221712 Ensifer sp. Root258 Isolate Unclassified
113 2643221718 Rhizobium sp. Root268 Isolate Unclassified
114 2643221719 Rhizobium sp. Root274 Isolate Unclassified
115 2643221723 Ensifer sp. Root278 Isolate Unclassified
116 2643221726 Ensifer sp. Root954 Isolate Unclassified
117 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
118 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
119 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
120 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
121 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
122 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
123 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
124 2738543024 Aminobacter sp. AP02 Isolate Unclassified
125 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
126 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
127 2751185800 Brucella pituitosa AA2 Isolate Unclassified
128 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
129 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
130 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
131 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
132 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
133 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
134 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
135 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
136 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
137 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
138 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
139 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
140 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
141 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
142 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
143 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
144 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
145 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
146 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
147 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
148 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
149 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
150 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
151 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
152 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
153 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
154 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
155 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
156 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
157 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
158 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
159 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
160 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
161 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
162 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
163 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
164 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
165 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
166 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
167 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
168 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
169 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
170 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
171 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
172 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
173 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
174 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
175 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
176 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
177 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
178 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
179 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
180 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
181 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
182 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
183 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
184 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
185 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
186 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
187 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
188 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
189 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
190 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
191 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
192 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
193 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
194 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
195 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
196 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
197 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
198 2844163670 Ensifer sp. 1H6 Isolate Unclassified
199 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
200 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
201 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
202 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
203 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
204 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
205 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
206 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
207 2854911287 Brucella lupini LUP21 Isolate Unclassified
208 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
209 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
210 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
211 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
212 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
213 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
214 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
215 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
216 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
217 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
218 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
219 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
220 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
221 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
222 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
223 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
224 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
225 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
226 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
227 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
228 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
229 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
230 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
231 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
232 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
233 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
234 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
235 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
236 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
237 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
238 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
239 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
240 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
241 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
242 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
243 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
244 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
245 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
246 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
247 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
248 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
249 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
250 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
251 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
252 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
253 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
254 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
255 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
256 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
257 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
258 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
259 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
260 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
261 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
262 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
263 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
264 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
265 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
266 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
267 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
268 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
269 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
270 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
271 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
272 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
273 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
274 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
275 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
276 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
277 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
278 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
279 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
280 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
281 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
282 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
283 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
284 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
285 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
286 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
287 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
288 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
289 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
290 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
291 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
292 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
293 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
294 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
295 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
296 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
297 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
298 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
299 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
300 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
301 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
302 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
303 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
304 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
305 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
306 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
307 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
308 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
309 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
310 2909042592 Labrys sp. LIt4 Isolate Nodule
311 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
312 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
313 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
314 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
315 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
316 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
317 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
318 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
319 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
320 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
321 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
322 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
323 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
324 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
325 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
326 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
327 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
328 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
329 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
330 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
331 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
332 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
333 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
334 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
335 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
336 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
337 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
338 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
339 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
340 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
341 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
342 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
343 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
344 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
345 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
346 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
347 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
348 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
349 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
350 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
351 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
352 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
353 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
354 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
355 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
356 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
357 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
358 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
359 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
360 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
361 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
362 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
363 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
364 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
365 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
366 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
367 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
368 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
369 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
370 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
371 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
372 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
373 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
374 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
375 2932401849 Devosia sp. 2618 Isolate Rhizosphere
376 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
377 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
378 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
379 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
380 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
381 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
382 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
383 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
384 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
385 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
386 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
387 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
388 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
389 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
390 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
391 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
392 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
393 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
394 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
395 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
396 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
397 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
398 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
399 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
400 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
401 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
402 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
403 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
404 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
405 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
406 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
407 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
408 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
409 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
410 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
411 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
412 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
413 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
414 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
415 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
416 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
417 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
418 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
419 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
420 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
421 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
422 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
423 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
424 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
425 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
426 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
427 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
428 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
429 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
430 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
431 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
432 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
433 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
434 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
435 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
436 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
437 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
438 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
439 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
440 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
441 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
442 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
443 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
444 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
445 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
446 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
447 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
448 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
449 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
450 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
451 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
452 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
453 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
454 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
455 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
456 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
457 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
458 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
459 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
460 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
461 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
462 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
463 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
464 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
465 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
466 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
467 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
468 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
469 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
470 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
471 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
472 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
473 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
474 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
475 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
476 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
477 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
478 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
479 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
480 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
481 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
482 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
483 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
484 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
485 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
486 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
487 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
488 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
489 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
490 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
491 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
492 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
493 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
494 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
495 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
496 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
497 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
498 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
499 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
500 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
501 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
502 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
503 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
504 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
505 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
506 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
507 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
508 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
509 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
510 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
511 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
512 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
513 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
514 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
515 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
516 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
517 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
518 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
519 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
520 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
521 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
522 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
523 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
524 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
525 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
526 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
527 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
528 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
529 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
530 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
531 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
532 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
533 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
534 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
535 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
536 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
537 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
538 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
539 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
540 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
541 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
542 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
543 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
544 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
545 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
546 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
547 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
548 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
549 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
550 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
551 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
552 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
553 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
554 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
555 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
556 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
557 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
558 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
559 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
560 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
561 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
562 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
563 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
564 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
565 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
566 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
567 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
568 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
569 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
570 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
571 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
572 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
573 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
574 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
575 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
576 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
577 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
578 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
579 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
580 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
581 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
582 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
583 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
584 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
585 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
586 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
587 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
588 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
589 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
590 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
591 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
592 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
593 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
594 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
595 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
596 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
597 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
598 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
599 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
600 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
601 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
602 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
603 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
604 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
605 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
606 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
607 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
608 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
609 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
610 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
611 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
612 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
613 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
614 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
615 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
616 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
617 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
618 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
619 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
620 3004167301 Mesorhizobium loti 582 Isolate Unclassified
621 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
622 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
623 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
624 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
625 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
626 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
627 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
628 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
629 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
630 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
631 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
632 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
633 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
634 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
635 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
636 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
637 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
638 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
639 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
640 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
641 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
642 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
643 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
644 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
645 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
646 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
647 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
648 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
649 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
650 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
651 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
652 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
653 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
654 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
655 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
656 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
657 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
658 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
659 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
660 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
661 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
662 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
663 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
664 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
665 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
666 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
667 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
668 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
669 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
670 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
671 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
672 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
673 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
674 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
675 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
676 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
677 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
678 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
679 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
680 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
681 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
682 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
683 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
684 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
685 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
686 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
687 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
688 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
689 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
690 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
691 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
692 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
693 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
694 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
695 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
696 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
697 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
698 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
699 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
700 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
701 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
702 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
703 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
704 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
705 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
706 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
707 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
708 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
709 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
710 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
711 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
712 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
713 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
714 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
715 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
716 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
717 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
718 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
719 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
720 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
721 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
722 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
723 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
724 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
725 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
726 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
727 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
728 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
729 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
730 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
731 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
732 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
733 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
734 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
735 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
736 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
737 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
738 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
739 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
740 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
741 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
742 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
743 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
744 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
745 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
746 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
747 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
748 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
749 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
750 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
751 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
752 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
753 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
754 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
755 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
756 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
757 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
758 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
759 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
760 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
761 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
762 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
763 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
764 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
765 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
766 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
767 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
768 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
769 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
770 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
771 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
772 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
773 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
774 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
775 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
776 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
777 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
778 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
779 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
780 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
781 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
782 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
783 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
784 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
785 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
786 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
787 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
788 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
789 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
790 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
791 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
792 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
793 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
794 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
795 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
796 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
797 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
798 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
799 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
800 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
801 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
802 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
803 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
804 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
805 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
806 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
807 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
808 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
809 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
810 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
811 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
812 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
813 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
814 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
815 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
816 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
817 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
818 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
819 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
820 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
821 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
822 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
823 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
824 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
825 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
826 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
827 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
828 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
829 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
830 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
831 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
832 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
833 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
834 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
835 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
836 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
837 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
838 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
839 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
840 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
841 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
842 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
843 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
844 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
845 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
846 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
847 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
848 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
849 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
850 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
851 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
852 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
853 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
854 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
855 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
856 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
857 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
858 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
859 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
860 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
861 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
862 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
863 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
864 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
865 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
866 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
867 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
868 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
869 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
870 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
871 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
872 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
873 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
874 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
875 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
876 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
877 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
878 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
879 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
880 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
881 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
882 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
883 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
884 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
885 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
886 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
887 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
888 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
889 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
890 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
891 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
892 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
893 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
894 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
895 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
896 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
897 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
898 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
899 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
900 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
901 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
902 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
903 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
904 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
905 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
906 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
907 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
908 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
909 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
910 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
911 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
912 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
913 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
914 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
915 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
916 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
917 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
918 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
919 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
920 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
921 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
922 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
923 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
924 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
925 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
926 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
927 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
928 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
929 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
930 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
931 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
932 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
933 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
934 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
935 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
936 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
937 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
938 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
939 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
940 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
941 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
942 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
943 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
944 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
945 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
946 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
947 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
948 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.96
Metatranscriptomes 0.33
Isolates 55.7

Biome Distribution

Category Percentage (%)
Aerial Root 0.42
Bulb 0
Endosphere 7.91
Nodule 40.72
Rhizoplane 1.92
Rhizosphere 32.72
Stem 0
Stem Tuber 0
Unclassified 16.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3683601 2162886007 Bacteria 6535
2 JGI24741J21665_1001749 3300001915 Bacteria 5978
3 JGI24740J21852_10016205 3300001979 Bacteria 2698
4 JGI24739J22299_10001947 3300001989 Bacteria 7897
5 JGI24735J21928_10003491 3300002067 Bacteria 5353
6 JGI24749J21850_1000140 3300002076 Bacteria 11609
7 JGI24751J29686_10000002 3300002459 Bacteria 160619
8 JGI25155J39150_1000007 3300002704 Bacteria 238857
9 JGI25155J39150_1000012 3300002704 Bacteria 199435
10 JGI25156J39149_1000036 3300002705 Bacteria 110527
11 JGI25162J39368_1000719 3300002737 Bacteria 22831
12 JGI25162J39368_1002558 3300002737 Bacteria 6903
13 JGI25154J39366_1000033 3300002738 Bacteria 184379
14 JGI25158J39367_1001179 3300002739 Bacteria 4713
15 JGI25157J39369_1000124 3300002741 Bacteria 65844
16 JGI25159J45721_1000032 3300002987 Bacteria 90158
17 JGI25159J45721_1000471 3300002987 Bacteria 18569
18 JGI25151J46595_10002604 3300003187 Bacteria 10650
19 JGI25406J46586_10008780 3300003203 Bacteria 4553
20 JGI25165J46597_1000016 3300003214 Bacteria 377866
21 JGI25165J46597_1000598 3300003214 Bacteria 30961
22 JGI25165J46597_1001390 3300003214 Bacteria 13254
23 JGI25160J50197_1000006 3300003354 Bacteria 316247
24 JGI25160J50197_1000009 3300003354 Bacteria 282862
25 JGI25161J50226_1000004 3300003374 Bacteria 316212
26 JGI25161J50226_1000240 3300003374 Bacteria 32956
27 Ga0055542_1000452 3300003762 Bacteria 38888
28 Ga0055524_1001608 3300003775 Bacteria 12637
29 Ga0055536_1000808 3300003781 Bacteria 20707
30 Ga0055536_1000890 3300003781 Bacteria 19455
31 Ga0055536_1007545 3300003781 Bacteria 4845
32 Ga0055530_10010289 3300003791 Bacteria 3479
33 Ga0055540_1000988 3300003792 Bacteria 18354
34 Ga0055531_10010623 3300003794 Bacteria 4550
35 Ga0058692_1001375 3300003856 Bacteria 9008
36 Ga0058692_1001590 3300003856 Bacteria 8185
37 Ga0055543_1000002 3300004625 Bacteria 390020
38 Ga0055543_1000055 3300004625 Bacteria 103837
39 Ga0065165_1000020 3300005262 Bacteria 265570
40 Ga0065165_1000391 3300005262 Bacteria 71184
41 Ga0065165_1002742 3300005262 Bacteria 14058
42 Ga0065704_10072336 3300005289 Bacteria 8720
43 Ga0065704_10079957 3300005289 Bacteria 4043
44 Ga0065707_10082484 3300005295 Bacteria 14611
45 Ga0070658_10043203 3300005327 Bacteria 3642
46 Ga0070658_10049911 3300005327 Bacteria 3391
47 Ga0070658_10053212 3300005327 Bacteria 3285
48 Ga0070670_100000012 3300005331 Bacteria 256314
49 Ga0070660_100005401 3300005339 Bacteria 8846
50 Ga0070661_100015071 3300005344 Bacteria 5453
51 Ga0070661_100021909 3300005344 Bacteria 4570
52 Ga0070661_100077814 3300005344 Bacteria 2446
53 Ga0070668_100000004 3300005347 Bacteria 189408
54 Ga0070668_100061855 3300005347 Bacteria 2901
55 Ga0070669_100000041 3300005353 Bacteria 127426
56 Ga0070669_100030363 3300005353 Bacteria 3900
57 Ga0070671_100000441 3300005355 Bacteria 28883
58 Ga0070674_100004462 3300005356 Bacteria 7981
59 Ga0070673_100056587 3300005364 Bacteria 3095
60 Ga0070667_100000037 3300005367 Bacteria 172343
61 Ga0070667_100000045 3300005367 Bacteria 164821
62 Ga0070663_100044009 3300005455 Bacteria 3145
63 Ga0070685_10021466 3300005466 Bacteria 3510
64 Ga0070699_100080177 3300005518 Bacteria 2845
65 Ga0068853_100001387 3300005539 Bacteria 17507
66 Ga0068853_100010670 3300005539 Bacteria 7435
67 Ga0070665_100004575 3300005548 Bacteria 14483
68 Ga0070665_100007021 3300005548 Bacteria 11442
69 Ga0070665_100037169 3300005548 Bacteria 4898
70 Ga0070665_100047835 3300005548 Bacteria 4293
71 Ga0068855_100141062 3300005563 Bacteria 2747
72 Ga0068855_100169901 3300005563 Bacteria 2470
73 Ga0068854_100008328 3300005578 Bacteria 6662
74 Ga0068856_100002980 3300005614 Bacteria 17344
75 Ga0068856_100033227 3300005614 Bacteria 5051
76 Ga0068852_100000578 3300005616 Bacteria 24126
77 Ga0068864_100000010 3300005618 Bacteria 358723
78 Ga0068864_100014044 3300005618 Bacteria 6642
79 Ga0068851_10007577 3300005834 Bacteria 4989
80 Ga0068851_10012961 3300005834 Bacteria 3938
81 Ga0068851_10014685 3300005834 Bacteria 3721
82 Ga0068863_100004471 3300005841 Bacteria 13781
83 Ga0068863_100019178 3300005841 Bacteria 6547
84 Ga0068858_100000466 3300005842 Bacteria 42207
85 Ga0068860_100000002 3300005843 Bacteria 627849
86 Ga0068860_100000073 3300005843 Bacteria 173235
87 Ga0068860_100052296 3300005843 Bacteria 3885
88 Ga0068862_100000016 3300005844 Bacteria 250031
89 Ga0068862_100000208 3300005844 Bacteria 65480
90 Ga0068862_100001423 3300005844 Bacteria 22170
91 Ga0081540_1004499 3300005983 Bacteria 10589
92 Ga0081539_10003049 3300005985 Bacteria 21640
93 Ga0075365_10014528 3300006038 Bacteria 4738
94 Ga0075368_10000169 3300006042 Bacteria 17703
95 Ga0075363_100003056 3300006048 Bacteria 7015
96 Ga0075363_100017379 3300006048 Bacteria 3566
97 Ga0075364_10000197 3300006051 Bacteria 27872
98 Ga0075364_10042907 3300006051 Bacteria 2939
99 Ga0075364_10110367 3300006051 Bacteria 1835
100 Ga0075362_10001832 3300006177 Bacteria 6945
101 Ga0075362_10022538 3300006177 Bacteria 2654
102 Ga0075362_10035910 3300006177 Bacteria 2165
103 Ga0075367_10002319 3300006178 Bacteria 8651
104 Ga0075369_10011135 3300006186 Bacteria 3530
105 Ga0075369_10014425 3300006186 Bacteria 3156
106 Ga0075431_100004625 3300006847 Bacteria 13512
107 Ga0079104_1000042 3300006946 Bacteria 185991
108 Ga0079104_1001097 3300006946 Bacteria 20211
109 Ga0079104_1007902 3300006946 Bacteria 3791
110 Ga0099826_10001501 3300006948 Bacteria 14062
111 Ga0099826_10012183 3300006948 Bacteria 6476
112 Ga0105240_10000019 3300009093 Bacteria 406211
113 Ga0105240_10002579 3300009093 Bacteria 29023
114 Ga0105240_10003889 3300009093 Bacteria 23062
115 Ga0105240_10202318 3300009093 Bacteria 2327
116 Ga0105247_10023880 3300009101 Bacteria 3684
117 Ga0114129_10009933 3300009147 Bacteria 13566
118 Ga0105241_10159830 3300009174 Bacteria 1851
119 Ga0105248_10000053 3300009177 Bacteria 143972
120 Ga0105237_10000333 3300009545 Bacteria 66671
121 Ga0105237_10001085 3300009545 Bacteria 36406
122 Ga0105237_10027612 3300009545 Bacteria 5790
123 Ga0105238_10015775 3300009551 Bacteria 7648
124 Ga0105238_10040925 3300009551 Bacteria 4695
125 Ga0105249_10000184 3300009553 Bacteria 71944
126 Ga0105249_10116183 3300009553 Bacteria 2536
127 Ga0105148_100007 3300009978 Bacteria 39454
128 Ga0105239_10000366 3300010375 Bacteria 66301
129 Ga0105239_10000846 3300010375 Bacteria 43563
130 Ga0105239_10028356 3300010375 Bacteria 6159
131 Ga0105239_10047006 3300010375 Bacteria 4729
132 Ga0105239_10095033 3300010375 Bacteria 3293
133 Ga0157373_10001083 3300013100 Bacteria 20976
134 Ga0157373_10013052 3300013100 Bacteria 6097
135 Ga0157371_10000219 3300013102 Bacteria 83847
136 Ga0157371_10014027 3300013102 Bacteria 6064
137 Ga0157370_10000037 3300013104 Bacteria 136803
138 Ga0157370_10000824 3300013104 Bacteria 39223
139 Ga0157370_10007830 3300013104 Bacteria 11578
140 Ga0157370_10024754 3300013104 Bacteria 5943
141 Ga0157369_10002685 3300013105 Bacteria 21230
142 Ga0157369_10185724 3300013105 Bacteria 2186
143 Ga0171463_1006 3300013249 Bacteria 336402
144 Ga0157380_10000134 3300014326 Bacteria 41479
145 Ga0157380_10033757 3300014326 Bacteria 3942
146 Ga0157379_10043295 3300014968 Bacteria 4019
147 Ga0182007_10000679 3300015262 Bacteria 19538
148 Ga0183363_1195 3300015690 Bacteria 12763
149 Ga0163161_10025315 3300017792 Bacteria 4199
150 Ga0214544_1000063 3300021320 Bacteria 129929
151 Ga0214542_1000095 3300021321 Bacteria 116012
152 Ga0214543_1000008 3300021327 Bacteria 385680
153 Ga0214543_1000026 3300021327 Bacteria 220652
154 Ga0228711_1000003 3300022739 Bacteria 258118
155 Ga0228710_1000003 3300022740 Bacteria 262981
156 Ga0209435_100005 3300025206 Bacteria 573745
157 Ga0209147_100518 3300025229 Bacteria 22374
158 Ga0207427_102362 3300025231 Bacteria 5164
159 Ga0209437_100078 3300025233 Bacteria 278088
160 Ga0209437_100291 3300025233 Bacteria 72764
161 Ga0209646_1000011 3300025246 Bacteria 573745
162 Ga0209646_1003337 3300025246 Bacteria 3197
163 Ga0209026_1000008 3300025250 Bacteria 573745
164 Ga0209677_103659 3300025253 Bacteria 4839
165 Ga0209148_1000056 3300025254 Bacteria 363380
166 Ga0209759_1000004 3300025256 Bacteria 573745
167 Ga0209233_1000068 3300025261 Bacteria 377969
168 Ga0209233_1000157 3300025261 Bacteria 164269
169 Ga0209233_1000192 3300025261 Bacteria 127171
170 Ga0209233_1000194 3300025261 Bacteria 126185
171 Ga0209233_1000480 3300025261 Bacteria 24397
172 Ga0209455_1000285 3300025272 Bacteria 54489
173 Ga0209130_1000032 3300025284 Bacteria 316240
174 Ga0209130_1000037 3300025284 Bacteria 284019
175 Ga0209676_1001584 3300025292 Bacteria 20274
176 Ga0209025_1000052 3300025294 Bacteria 324648
177 Ga0209025_1000196 3300025294 Bacteria 147356
178 Ga0209025_1000277 3300025294 Bacteria 117930
179 Ga0209564_1000086 3300025295 Bacteria 251385
180 Ga0209758_1000576 3300025297 Bacteria 57318
181 Ga0209758_1007656 3300025297 Bacteria 7280
182 Ga0209050_1000370 3300025298 Bacteria 85916
183 Ga0209050_1002937 3300025298 Bacteria 13341
184 Ga0209256_1000321 3300025299 Bacteria 82735
185 Ga0209256_1001676 3300025299 Bacteria 21473
186 Ga0207426_1000048 3300025302 Bacteria 409127
187 Ga0207426_1000077 3300025302 Bacteria 316246
188 Ga0209051_1001367 3300025303 Bacteria 21083
189 Ga0209051_1007845 3300025303 Bacteria 5760
190 Ga0209257_1001330 3300025304 Bacteria 30051
191 Ga0209257_1005220 3300025304 Bacteria 9300
192 Ga0207647_10015537 3300025904 Bacteria 5216
193 Ga0207705_10000004 3300025909 Bacteria 705756
194 Ga0207705_10001504 3300025909 Bacteria 18521
195 Ga0207705_10055854 3300025909 Bacteria 2847
196 Ga0207654_10012470 3300025911 Bacteria 4356
197 Ga0207695_10000049 3300025913 Bacteria 406233
198 Ga0207695_10016374 3300025913 Bacteria 8677
199 Ga0207695_10026378 3300025913 Bacteria 6485
200 Ga0207695_10044625 3300025913 Bacteria 4713
201 Ga0207671_10000107 3300025914 Bacteria 128950
202 Ga0207671_10000361 3300025914 Bacteria 64792
203 Ga0207671_10010693 3300025914 Bacteria 7547
204 Ga0207657_10011321 3300025919 Bacteria 8858
205 Ga0207657_10015965 3300025919 Bacteria 7252
206 Ga0207649_10067406 3300025920 Bacteria 2272
207 Ga0207681_10000013 3300025923 Bacteria 357411
208 Ga0207694_10016708 3300025924 Bacteria 5547
209 Ga0207694_10036721 3300025924 Bacteria 3760
210 Ga0207650_10000008 3300025925 Bacteria 498534
211 Ga0207650_10001003 3300025925 Bacteria 21229
212 Ga0207644_10000424 3300025931 Bacteria 27437
213 Ga0207711_10006215 3300025941 Bacteria 10089
214 Ga0207667_10003331 3300025949 Bacteria 19830
215 Ga0207667_10012071 3300025949 Bacteria 9991
216 Ga0207667_10116595 3300025949 Bacteria 2752
217 Ga0207712_10000059 3300025961 Bacteria 137849
218 Ga0207668_10000122 3300025972 Bacteria 54614
219 Ga0207640_10004035 3300025981 Bacteria 7931
220 Ga0207640_10005794 3300025981 Bacteria 6736
221 Ga0207640_10031937 3300025981 Bacteria 3260
222 Ga0207658_10000002 3300025986 Bacteria 1364188
223 Ga0207658_10000025 3300025986 Bacteria 182470
224 Ga0207658_10008204 3300025986 Bacteria 7115
225 Ga0207703_10002501 3300026035 Bacteria 15928
226 Ga0207703_10009799 3300026035 Bacteria 7515
227 Ga0207639_10000752 3300026041 Bacteria 22089
228 Ga0207639_10003348 3300026041 Bacteria 10779
229 Ga0207639_10136590 3300026041 Bacteria 2037
230 Ga0207678_10002692 3300026067 Bacteria 16117
231 Ga0207678_10112879 3300026067 Bacteria 2318
232 Ga0207702_10000774 3300026078 Bacteria 33893
233 Ga0207702_10001580 3300026078 Bacteria 22559
234 Ga0207702_10086723 3300026078 Bacteria 2730
235 Ga0207641_10000557 3300026088 Bacteria 41685
236 Ga0207641_10010897 3300026088 Bacteria 7450
237 Ga0207676_10000012 3300026095 Bacteria 353971
238 Ga0207676_10010193 3300026095 Bacteria 6687
239 Ga0207674_10010673 3300026116 Bacteria 10384
240 Ga0207674_10105739 3300026116 Bacteria 2792
241 Ga0207674_10140549 3300026116 Bacteria 2374
242 Ga0207683_10059378 3300026121 Bacteria 3360
243 Ga0207698_10000431 3300026142 Bacteria 24133
244 Ga0207698_10014125 3300026142 Bacteria 5295
245 Ga0209281_1000081 3300027111 Bacteria 258084
246 Ga0209281_1000141 3300027111 Bacteria 175634
247 Ga0209281_1000194 3300027111 Bacteria 139318
248 Ga0209371_1000035 3300027312 Bacteria 368979
249 Ga0209371_1001388 3300027312 Bacteria 16639
250 Ga0209282_1000036 3300027666 Bacteria 130242
251 Ga0209282_1000230 3300027666 Bacteria 28914
252 Ga0209282_1009311 3300027666 Bacteria 6209
253 Ga0209813_10000024 3300027866 Bacteria 72716
254 Ga0268266_10000086 3300028379 Bacteria 199443
255 Ga0268266_10003563 3300028379 Bacteria 15426
256 Ga0268266_10037051 3300028379 Bacteria 4156
257 Ga0268266_10104148 3300028379 Bacteria 2505
258 Ga0268265_10000006 3300028380 Bacteria 466482
259 Ga0268265_10000225 3300028380 Bacteria 65493
260 Ga0268265_10000849 3300028380 Bacteria 28736
261 Ga0268264_10000001 3300028381 Bacteria 1221000
262 Ga0268264_10000120 3300028381 Bacteria 191138
263 Ga0268264_10000691 3300028381 Bacteria 39209
264 Ga0265318_10004967 3300028577 Bacteria 6333
265 Ga0307515_10000006 3300028794 Bacteria 725810
266 Ga0307515_10000263 3300028794 Bacteria 130303
267 Ga0307515_10008205 3300028794 Bacteria 20435
268 Ga0265324_10001826 3300029957 Bacteria 11553
269 Ga0265324_10008268 3300029957 Bacteria 4146
270 Ga0268256_1000037 3300030500 Bacteria 367024
271 Ga0268256_1001900 3300030500 Bacteria 11529
272 Ga0265330_10018642 3300031235 Bacteria 3186
273 Ga0265328_10000449 3300031239 Bacteria 19146
274 Ga0265325_10012251 3300031241 Bacteria 4907
275 Ga0265325_10021265 3300031241 Bacteria 3567
276 Ga0265340_10011383 3300031247 Bacteria 4726
277 Ga0265339_10023092 3300031249 Bacteria 3597
278 Ga0265339_10026323 3300031249 Bacteria 3332
279 Ga0265331_10000109 3300031250 Bacteria 108845
280 Ga0265331_10000377 3300031250 Bacteria 46393
281 Ga0265327_10000100 3300031251 Bacteria 189591
282 Ga0265327_10000243 3300031251 Bacteria 108869
283 Ga0265327_10003763 3300031251 Bacteria 14080
284 Ga0265327_10014812 3300031251 Bacteria 5079
285 Ga0265316_10012791 3300031344 Bacteria 7497
286 Ga0265316_10060140 3300031344 Bacteria 2953
287 Ga0307513_10001607 3300031456 Bacteria 32450
288 Ga0307513_10078170 3300031456 Bacteria 3423
289 Ga0307509_10043922 3300031507 Bacteria 4831
290 Ga0307408_100010969 3300031548 Bacteria 5978
291 Ga0265313_10000781 3300031595 Bacteria 32156
292 Ga0265313_10013224 3300031595 Bacteria 4969
293 Ga0265342_10015557 3300031712 Bacteria 5001
294 Ga0307405_10068784 3300031731 Bacteria 2267
295 Ga0307412_10001365 3300031911 Bacteria 13577
296 Ga0307412_10033535 3300031911 Bacteria 3264
297 Ga0315914_1000002 3300031967 Bacteria 365357
298 Ga0315913_1000009 3300033430 Bacteria 149770
299 Ga0315915_1000005 3300033464 Bacteria 397591
300 Ga0373927_0000822 3300035695 Bacteria 23743
301 Ga0373925_0007056 3300037068 Bacteria 8209
302 Ga0395899_0000090 3300037312 Bacteria 156587
303 Ga0395899_0114177 3300037312 Bacteria 1939
304 Ga0395900_0000017 3300037418 Bacteria 369602
305 Ga0395900_0021967 3300037418 Bacteria 6524
306 Ga0395900_0062551 3300037418 Bacteria 3826
307 Ga0395900_0157016 3300037418 Bacteria 2323
308 Ga0395898_0000030 3300037466 Bacteria 369577
309 Ga0395898_0022622 3300037466 Bacteria 6365
310 Ga0395905_0000081 3300037471 Bacteria 160409
311 Ga0395905_0003702 3300037471 Bacteria 16188
312 Ga0395905_0006130 3300037471 Bacteria 12139
313 Ga0395901_0000015 3300038443 Bacteria 373388
314 Ga0395901_0113368 3300038443 Bacteria 2847
315 Ga0436360_1160663 3300039438 Bacteria 1833
316 Ga0439449_0000555 3300042007 Bacteria 14026
317 Ga0451577_0037775 3300042876 Bacteria 4346
318 Ga0466973_0080647 3300044659 Bacteria 2850
319 Ga0453684_0000006 3300044712 Bacteria 1364191
320 Ga0453684_0000048 3300044712 Bacteria 559743
321 Ga0453684_0008423 3300044712 Bacteria 18474
322 Ga0466968_0075243 3300044735 Bacteria 1476
323 Ga0466960_0034799 3300044901 Bacteria 2350
324 Ga0451576_0000227 3300045051 Bacteria 137818
325 Ga0495627_000800 3300046453 Bacteria 22980
326 Ga0495603_0007661 3300046455 Bacteria 6503
327 Ga0495629_0002307 3300046459 Bacteria 14715
328 Ga0495629_0054430 3300046459 Bacteria 2798
329 Ga0495638_0012855 3300046460 Bacteria 5719
330 Ga0495650_0003413 3300046471 Bacteria 11617
331 Ga0495650_0003566 3300046471 Bacteria 11255
332 Ga0495580_0033496 3300046472 Bacteria 3701
333 Ga0495582_0004524 3300046473 Bacteria 7812
334 Ga0495639_0009534 3300046475 Bacteria 4167
335 Ga0495583_0000088 3300046506 Bacteria 164073
336 Ga0495583_0000625 3300046506 Bacteria 47513
337 Ga0495583_0019645 3300046506 Bacteria 3521
338 Ga0495610_0000095 3300046512 Bacteria 104629
339 Ga0495630_0056174 3300046517 Bacteria 2950
340 Ga0495632_0000328 3300046519 Bacteria 45623
341 Ga0495632_0001666 3300046519 Bacteria 18198
342 Ga0495637_0006095 3300046520 Bacteria 6070
343 Ga0495637_0020445 3300046520 Bacteria 3046
344 Ga0495643_0000014 3300046522 Bacteria 314632
345 Ga0495643_0071276 3300046522 Bacteria 1824
346 Ga0495648_0000308 3300046524 Bacteria 54286
347 Ga0495648_0002254 3300046524 Bacteria 18031
348 Ga0495663_0000007 3300046525 Bacteria 262438
349 Ga0495642_0001260 3300046528 Bacteria 11512
350 Ga0495654_0002299 3300046530 Bacteria 12357
351 Ga0495586_0014478 3300046535 Bacteria 4189
352 Ga0495645_0001395 3300046543 Bacteria 16327
353 Ga0495633_0000112 3300046558 Bacteria 109485
354 Ga0495633_0000398 3300046558 Bacteria 45509
355 Ga0495633_0005773 3300046558 Bacteria 7473
356 Ga0495633_0047331 3300046558 Bacteria 2032
357 Ga0495588_0001064 3300046674 Bacteria 11908
358 Ga0495613_0015634 3300046689 Bacteria 5648
359 Ga0495671_0000032 3300046692 Bacteria 201185
360 Ga0495671_0000034 3300046692 Bacteria 195385
361 Ga0495589_0003359 3300046794 Bacteria 8677
362 Ga0495604_0005557 3300047317 Bacteria 9996
363 Ga0495636_0019335 3300047318 Bacteria 2737
364 Ga0495636_0026358 3300047318 Bacteria 2364
365 Ga0495683_0019282 3300047323 Bacteria 3521
366 Ga0495675_0038110 3300047444 Bacteria 3062
367 Ga0495673_0000013 3300047469 Bacteria 612902
368 Ga0495681_0000008 3300047470 Bacteria 215295
369 Ga0495681_0000057 3300047470 Bacteria 103340
370 Ga0495681_0049280 3300047470 Bacteria 1992
371 Ga0495686_0001495 3300047472 Bacteria 25320
372 Ga0495593_0012920 3300047673 Bacteria 4769
373 Ga0496101_0027661 3300048904 Bacteria 3953
374 Ga0496102_0000088 3300048905 Bacteria 129762
375 Ga0496102_0114742 3300048905 Bacteria 2513
376 Ga0496104_0099974 3300048907 Bacteria 2777
377 Ga0496108_0019437 3300048911 Bacteria 5579
378 Ga0496110_0001911 3300048913 Bacteria 15417
379 Ga0496110_0090111 3300048913 Bacteria 2742
380 Ga0496112_0007768 3300048915 Bacteria 9543
381 Ga0496112_0181812 3300048915 Bacteria 2066
382 Ga0496113_0000241 3300048916 Bacteria 25760
383 Ga0496114_0015662 3300048917 Bacteria 6100
384 Ga0496116_0000028 3300048919 Bacteria 424086
385 Ga0496116_0000097 3300048919 Bacteria 200658
386 Ga0496117_0000066 3300048920 Bacteria 253534
387 Ga0496117_0002381 3300048920 Bacteria 23937
388 Ga0496117_0074251 3300048920 Bacteria 2264
389 Ga0496117_0109357 3300048920 Bacteria 1726
390 Ga0496118_0003408 3300048921 Bacteria 20089
391 Ga0496118_0007823 3300048921 Bacteria 11211
392 Ga0496118_0062082 3300048921 Bacteria 2762
393 Ga0496118_0125764 3300048921 Bacteria 1660
394 Ga0496119_0005553 3300048922 Bacteria 12002
395 Ga0496119_0090993 3300048922 Bacteria 1733
396 Ga0496121_0000003 3300048924 Bacteria 1191431
397 Ga0496121_0000682 3300048924 Bacteria 63266
398 Ga0496121_0005781 3300048924 Bacteria 15691
399 Ga0496121_0008021 3300048924 Bacteria 12594
400 Ga0496121_0055972 3300048924 Bacteria 3280
401 Ga0496121_0057655 3300048924 Bacteria 3217
402 Ga0496121_0098706 3300048924 Bacteria 2259
403 Ga0496122_0000024 3300048925 Bacteria 372400
404 Ga0496122_0000057 3300048925 Bacteria 253452
405 Ga0496122_0000107 3300048925 Bacteria 193163
406 Ga0496122_0003171 3300048925 Bacteria 21952
407 Ga0496122_0005520 3300048925 Bacteria 15019
408 Ga0496123_0000063 3300048926 Bacteria 216072
409 Ga0496123_0000086 3300048926 Bacteria 183266
410 Ga0496123_0000096 3300048926 Bacteria 173914
411 Ga0496123_0001326 3300048926 Bacteria 34955
412 Ga0496123_0006646 3300048926 Bacteria 11152
413 Ga0496123_0038991 3300048926 Bacteria 3329
414 Ga0496124_0000413 3300048927 Bacteria 76781
415 Ga0496124_0006506 3300048927 Bacteria 12712
416 Ga0496124_0021788 3300048927 Bacteria 5894
417 Ga0496124_0036929 3300048927 Bacteria 4255
418 Ga0496124_0066728 3300048927 Bacteria 2995
419 Ga0496124_0083363 3300048927 Bacteria 2623
420 Ga0496124_0095267 3300048927 Bacteria 2420
421 Ga0496124_0110200 3300048927 Bacteria 2216
422 Ga0496125_0000345 3300048928 Bacteria 88357
423 Ga0496125_0000651 3300048928 Bacteria 58001
424 Ga0496125_0000898 3300048928 Bacteria 47075
425 Ga0496125_0002640 3300048928 Bacteria 22927
426 Ga0496125_0118760 3300048928 Bacteria 1893
427 Ga0496126_0000079 3300048929 Bacteria 222463
428 Ga0496126_0000119 3300048929 Bacteria 184211
429 Ga0496126_0001430 3300048929 Bacteria 37517
430 Ga0496126_0064254 3300048929 Bacteria 3288
431 Ga0496126_0152560 3300048929 Bacteria 1979
432 Ga0501031_0008271 3300049568 Bacteria 6767
433 Ga0501032_0000008 3300049569 Bacteria 240313
434 Ga0501032_0000156 3300049569 Bacteria 55416
435 Ga0501032_0018295 3300049569 Bacteria 4909
436 Ga0501032_0025815 3300049569 Bacteria 4048
437 Ga0501033_0000012 3300049570 Bacteria 241599
438 Ga0501033_0000423 3300049570 Bacteria 40417
439 Ga0501033_0000967 3300049570 Bacteria 26078
440 Ga0501033_0017829 3300049570 Bacteria 5361
441 Ga0501033_0040138 3300049570 Bacteria 3494
442 Ga0501034_0000035 3300049571 Bacteria 241623
443 Ga0501034_0000087 3300049571 Bacteria 166714
444 Ga0501034_0001581 3300049571 Bacteria 29672
445 Ga0501034_0005300 3300049571 Bacteria 14140
446 Ga0501034_0072305 3300049571 Bacteria 3458
447 Ga0501034_0084264 3300049571 Bacteria 3180
448 Ga0501034_0162278 3300049571 Bacteria 2205
449 Ga0501036_0000006 3300049572 Bacteria 241623
450 Ga0501036_0000885 3300049572 Bacteria 22376
451 Ga0501036_0119520 3300049572 Bacteria 2225
452 Ga0501037_0000014 3300049573 Bacteria 171015
453 Ga0501037_0000072 3300049573 Bacteria 94452
454 Ga0501037_0000386 3300049573 Bacteria 36578
455 Ga0501038_0000007 3300049574 Bacteria 210775
456 Ga0501038_0000023 3300049574 Bacteria 151469
457 Ga0501039_0000012 3300049575 Bacteria 241623
458 Ga0501039_0000101 3300049575 Bacteria 59353
459 Ga0501043_0000022 3300049579 Bacteria 154467
460 Ga0501043_0000194 3300049579 Bacteria 55458
461 Ga0501043_0000211 3300049579 Bacteria 53464
462 Ga0501043_0025797 3300049579 Bacteria 4610
463 Ga0501046_0006281 3300049580 Bacteria 10536
464 Ga0501047_0001346 3300049581 Bacteria 24128
465 Ga0501047_0012399 3300049581 Bacteria 8068
466 Ga0501047_0013458 3300049581 Bacteria 7755
467 Ga0501047_0108091 3300049581 Bacteria 2663
468 Ga0501067_0001395 3300049583 Bacteria 13094
469 Ga0501068_0029719 3300049584 Bacteria 3238
470 Ga0501069_0000035 3300049585 Bacteria 88215
471 Ga0501069_0007570 3300049585 Bacteria 5699
472 Ga0501069_0019293 3300049585 Bacteria 3686
473 Ga0501070_0000103 3300049586 Bacteria 74597
474 Ga0501070_0004303 3300049586 Bacteria 12238
475 Ga0501070_0017416 3300049586 Bacteria 6032
476 Ga0501070_0019274 3300049586 Bacteria 5721
477 Ga0501070_0021642 3300049586 Bacteria 5392
478 Ga0501070_0028028 3300049586 Bacteria 4723
479 Ga0501070_0097608 3300049586 Bacteria 2430
480 Ga0501071_0007568 3300049587 Bacteria 7150
481 Ga0501071_0022244 3300049587 Bacteria 4420
482 Ga0501073_0087934 3300049589 Bacteria 2161
483 Ga0501074_0000530 3300049590 Bacteria 23465
484 Ga0501225_0000041 3300049705 Bacteria 43072
485 Ga0501225_0002520 3300049705 Bacteria 5665
486 Ga0501080_0002529 3300049742 Bacteria 16008
487 Ga0501080_0059072 3300049742 Bacteria 3569
488 Ga0501080_0110528 3300049742 Bacteria 2547
489 Ga0501083_0001316 3300049744 Bacteria 16825
490 Ga0501083_0011220 3300049744 Bacteria 6288
491 Ga0501035_0000035 3300049822 Bacteria 166916
492 Ga0501035_0000139 3300049822 Bacteria 88322
493 Ga0501035_0003975 3300049822 Bacteria 14090
494 Ga0501035_0005080 3300049822 Bacteria 12468
495 Ga0501035_0007697 3300049822 Bacteria 10061
496 Ga0501035_0020763 3300049822 Bacteria 6035
497 Ga0501035_0021403 3300049822 Bacteria 5945
498 Ga0501035_0098783 3300049822 Bacteria 2563
499 Ga0501044_0000015 3300049823 Bacteria 241623
500 Ga0501044_0000578 3300049823 Bacteria 44504
501 Ga0501044_0025845 3300049823 Bacteria 6224
502 Ga0501044_0054117 3300049823 Bacteria 4127
503 nmdc:mga03683_17874_c1 3300050489 Bacteria 2689
504 nmdc:mga00v17_186_c2 3300050491 Bacteria 35842
505 nmdc:mga00v17_59_c2 3300050491 Bacteria 33192
506 nmdc:mga0yw44_215_c1 3300050492 Bacteria 20484
507 nmdc:mga0k408_53436_c1 3300050493 Bacteria 2342
508 nmdc:mga06z11_50_c1 3300050494 Bacteria 50140
509 nmdc:mga04h51_64_c1 3300050495 Bacteria 33433
510 nmdc:mga0sz30_2883_c1 3300050516 Bacteria 6153
511 Ga0500647_0048447 3300053091 Bacteria 2043
512 Ga0500572_001775 3300053111 Bacteria 5548
513 Ga0500561_0000021 3300053137 Bacteria 39116
514 Ga0500573_0001779 3300053140 Bacteria 10470
515 Ga0500604_0000133 3300053151 Bacteria 22566
516 Ga0500616_0000709 3300053153 Bacteria 38615
517 Ga0500616_0022258 3300053153 Bacteria 3541
518 Ga0500616_0035918 3300053153 Bacteria 2692
519 Ga0500622_0000286 3300053156 Bacteria 51508
520 Ga0500624_000052 3300053157 Bacteria 74126
521 Ga0500624_000444 3300053157 Bacteria 12471
522 Ga0500634_0000053 3300053161 Bacteria 52099
523 Ga0500634_0008242 3300053161 Bacteria 5199
524 Ga0500634_0047382 3300053161 Bacteria 2320
525 Ga0500636_0000005 3300053177 Bacteria 197561
526 Ga0500625_000002 3300053729 Bacteria 371909
527 Ga0501084_0105017 3300054114 Bacteria 2372
528 Ga0587083_0000805 3300059505 Bacteria 3135
529 Ga0587106_001679 3300059605 Bacteria 2027
530 Ga0587107_001384 3300059652 Bacteria 1957
531 Ga0587071_004023 3300060344 Bacteria 2161
532 Ga0501082_0027147 3300060353 Bacteria 4932

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049587 Ga0501071_0022244 Ga0501071_0022244_15_1400 461
2 iso_pu_bacteria 2510461069 2510842912 465
3 3300044735 Ga0466968_0075243 Ga0466968_0075243_12_1427 471
4 3300046459 Ga0495629_0054430 Ga0495629_0054430_23_1438 471
5 3300048920 Ga0496117_0109357 Ga0496117_0109357_294_1709 471
6 3300048921 Ga0496118_0125764 Ga0496118_0125764_17_1432 471
7 iso_pu_bacteria 2979742915 2979746109 485
8 3300048928 Ga0496125_0118760 Ga0496125_0118760_400_1875 491
9 iso_pu_bacteria 2878730984 2878733721 493
10 iso_pu_bacteria 2977971508 2977979564 500
11 3300048924 Ga0496121_0005781 Ga0496121_0005781_11568_13214 504
12 iso_pu_bacteria 2977858184 2977862360 507
13 3300025298 Ga0209050_1000370 Ga0209050_100037070 513
14 3300028794 Ga0307515_10000006 Ga0307515_10000006312 514
15 3300048919 Ga0496116_0000028 Ga0496116_0000028_184284_185924 514
16 3300048926 Ga0496123_0001326 Ga0496123_0001326_11975_13615 514
17 3300048927 Ga0496124_0066728 Ga0496124_0066728_571_2211 514
18 3300048928 Ga0496125_0002640 Ga0496125_0002640_12823_14463 514
19 3300048929 Ga0496126_0000079 Ga0496126_0000079_56895_58535 514
20 3300046506 Ga0495583_0000088 Ga0495583_0000088_138572_140203 517
21 3300025294 Ga0209025_1000277 Ga0209025_100027717 521
22 3300027312 Ga0209371_1000035 Ga0209371_1000035101 521
23 3300030500 Ga0268256_1000037 Ga0268256_1000037100 521
24 iso_pu_bacteria 2924718760 2924726297 527
25 3300047318 Ga0495636_0019335 Ga0495636_0019335_404_2035 528
26 3300003203 JGI25406J46586_10008780 JGI25406J46586_100087802 532
27 3300005985 Ga0081539_10003049 Ga0081539_1000304914 532
28 3300049744 Ga0501083_0011220 Ga0501083_0011220_2642_4249 533
29 iso_pu_bacteria 2508501127 2509141179 534
30 3300029957 Ga0265324_10008268 Ga0265324_100082682 537
31 3300031241 Ga0265325_10012251 Ga0265325_100122512 537
32 3300031344 Ga0265316_10012791 Ga0265316_100127914 537
33 3300031595 Ga0265313_10000781 Ga0265313_100007813 537
34 iso_pu_bacteria 2881161766 2881163025 537
35 iso_pu_bacteria 2996310559 2996313114 537
36 iso_pu_bacteria 3003665799 3003670110 537
37 iso_pu_bacteria 8018150411 8018151489 537
38 3300031251 Ga0265327_10014812 Ga0265327_100148122 538
39 iso_pu_bacteria 2503198000 2503203509 538
40 iso_pu_bacteria 2508501122 2509110257 538
41 iso_pu_bacteria 2509276018 2509370956 538
42 iso_pu_bacteria 2509276019 2509379015 538
43 iso_pu_bacteria 2509276022 2509397926 538
44 iso_pu_bacteria 2510065057 2510303696 538
45 iso_pu_bacteria 2510065059 2510316505 538
46 iso_pu_bacteria 2510917022 2511136564 538
47 iso_pu_bacteria 2511231027 2511391732 538
48 iso_pu_bacteria 2511231052 2511502992 538
49 iso_pu_bacteria 2512047086 2512534256 538
50 iso_pu_bacteria 2512875016 2512929601 538
51 iso_pu_bacteria 2512875024 2512964384 538
52 iso_pu_bacteria 2512875026 2512973921 538
53 iso_pu_bacteria 2513237086 2513586849 538
54 iso_pu_bacteria 2513237089 2513602362 538
55 iso_pu_bacteria 2513237090 2513608203 538
56 iso_pu_bacteria 2513237091 2513617162 538
57 iso_pu_bacteria 2513237140 2513882903 538
58 iso_pu_bacteria 2513237143 2513902932 538
59 iso_pu_bacteria 2513237156 2513985909 538
60 iso_pu_bacteria 2513237159 2513998093 538
61 iso_pu_bacteria 2513237160 2514004005 538
62 iso_pu_bacteria 2513237164 2514036917 538
63 iso_pu_bacteria 2513237305 2514422846 538
64 iso_pu_bacteria 2513237351 2514591561 538
65 iso_pu_bacteria 2515154107 2515610335 538
66 iso_pu_bacteria 2516143018 2516205255 538
67 iso_pu_bacteria 2516653046 2516894396 538
68 iso_pu_bacteria 2517487022 2517571017 538
69 iso_pu_bacteria 2524023207 2524451882 538
70 iso_pu_bacteria 2524023209 2524460072 538
71 iso_pu_bacteria 2537561587 2537875391 538
72 iso_pu_bacteria 2551306084 2551677896 538
73 iso_pu_bacteria 2551306085 2551690010 538
74 iso_pu_bacteria 2551306086 2551692030 538
75 iso_pu_bacteria 2551306086 2551692293 538
76 iso_pu_bacteria 2554235003 2554244887 538
77 iso_pu_bacteria 2558860100 2558860408 538
78 iso_pu_bacteria 2558860242 2559297279 538
79 iso_pu_bacteria 2558860983 2561469306 538
80 iso_pu_bacteria 2582581283 2585168036 538
81 iso_pu_bacteria 2582581306 2585265328 538
82 iso_pu_bacteria 2582581307 2585274280 538
83 iso_pu_bacteria 2582581308 2585280306 538
84 iso_pu_bacteria 2582581315 2585322584 538
85 iso_pu_bacteria 2582581316 2585335201 538
86 iso_pu_bacteria 2582581865 2585388580 538
87 iso_pu_bacteria 2582581866 2585392428 538
88 iso_pu_bacteria 2585427527 2585532536 538
89 iso_pu_bacteria 2585427530 2585554448 538
90 iso_pu_bacteria 2585427531 2585560729 538
91 iso_pu_bacteria 2585427608 2585898932 538
92 iso_pu_bacteria 2585427609 2585903473 538
93 iso_pu_bacteria 2585427633 2585997145 538
94 iso_pu_bacteria 2585427634 2586001745 538
95 iso_pu_bacteria 2585428125 2587981408 538
96 iso_pu_bacteria 2588253730 2588515173 538
97 iso_pu_bacteria 2597489875 2597815903 538
98 iso_pu_bacteria 2599185156 2599334741 538
99 iso_pu_bacteria 2599185210 2599605103 538
100 iso_pu_bacteria 2599185236 2599723957 538
101 iso_pu_bacteria 2599185301 2599939906 538
102 iso_pu_bacteria 2599185352 2600194089 538
103 iso_pu_bacteria 2600255279 2601611618 538
104 iso_pu_bacteria 2600255308 2601748830 538
105 iso_pu_bacteria 2615840626 2616307393 538
106 iso_pu_bacteria 2615840698 2616554936 538
107 iso_pu_bacteria 2617270742 2617383388 538
108 iso_pu_bacteria 2643221550 2643774133 538
109 iso_pu_bacteria 2643221551 2643774768 538
110 iso_pu_bacteria 2643221555 2643793212 538
111 iso_pu_bacteria 2643221557 2643809770 538
112 iso_pu_bacteria 2643221558 2643813249 538
113 iso_pu_bacteria 2643221564 2643838602 538
114 iso_pu_bacteria 2643221582 2643921820 538
115 iso_pu_bacteria 2643221595 2643989058 538
116 iso_pu_bacteria 2643221607 2644051123 538
117 iso_pu_bacteria 2643221610 2644063951 538
118 iso_pu_bacteria 2643221618 2644108479 538
119 iso_pu_bacteria 2643221623 2644132717 538
120 iso_pu_bacteria 2643221626 2644145525 538
121 iso_pu_bacteria 2643221627 2644152243 538
122 iso_pu_bacteria 2643221636 2644205603 538
123 iso_pu_bacteria 2643221653 2644299240 538
124 iso_pu_bacteria 2643221655 2644312398 538
125 iso_pu_bacteria 2643221659 2644336026 538
126 iso_pu_bacteria 2643221668 2644381472 538
127 iso_pu_bacteria 2643221675 2644415784 538
128 iso_pu_bacteria 2643221680 2644448824 538
129 iso_pu_bacteria 2643221686 2644484027 538
130 iso_pu_bacteria 2643221688 2644496372 538
131 iso_pu_bacteria 2643221689 2644500193 538
132 iso_pu_bacteria 2643221693 2644519788 538
133 iso_pu_bacteria 2643221698 2644546883 538
134 iso_pu_bacteria 2643221712 2644618081 538
135 iso_pu_bacteria 2643221719 2644657468 538
136 iso_pu_bacteria 2643221723 2644676742 538
137 iso_pu_bacteria 2643221726 2644686782 538
138 iso_pu_bacteria 2657244999 2657683982 538
139 iso_pu_bacteria 2667528174 2671112186 538
140 iso_pu_bacteria 2687453392 2688600339 538
141 iso_pu_bacteria 2690316117 2692314498 538
142 iso_pu_bacteria 2693429783 2694632513 538
143 iso_pu_bacteria 2693429784 2694639756 538
144 iso_pu_bacteria 2721755686 2723577631 538
145 iso_pu_bacteria 2738543024 2739308598 538
146 iso_pu_bacteria 2739367664 2739651793 538
147 iso_pu_bacteria 2739367865 2740030267 538
148 iso_pu_bacteria 2751185821 2753458602 538
149 iso_pu_bacteria 2751185897 2753767221 538
150 iso_pu_bacteria 2756170246 2756673097 538
151 iso_pu_bacteria 2765235802 2765463851 538
152 iso_pu_bacteria 2767802442 2770197891 538
153 iso_pu_bacteria 2775506902 2776269036 538
154 iso_pu_bacteria 2775506904 2776283826 538
155 iso_pu_bacteria 2775507049 2776914563 538
156 iso_pu_bacteria 2775507255 2778124140 538
157 iso_pu_bacteria 2775507266 2778176002 538
158 iso_pu_bacteria 2791355082 2792582547 538
159 iso_pu_bacteria 2791355091 2792623009 538
160 iso_pu_bacteria 2791355092 2792629261 538
161 iso_pu_bacteria 2791355094 2792642725 538
162 iso_pu_bacteria 2802428858 2802717894 538
163 iso_pu_bacteria 2802428859 2802725255 538
164 iso_pu_bacteria 2802428860 2802730621 538
165 iso_pu_bacteria 2802428861 2802737968 538
166 iso_pu_bacteria 2802428862 2802744162 538
167 iso_pu_bacteria 2802428863 2802753153 538
168 iso_pu_bacteria 2802429268 2804753325 538
169 iso_pu_bacteria 2808606387 2808988763 538
170 iso_pu_bacteria 2808606401 2809063743 538
171 iso_pu_bacteria 2808606404 2809079639 538
172 iso_pu_bacteria 2808606405 2809084004 538
173 iso_pu_bacteria 2818991272 2819243809 538
174 iso_pu_bacteria 2818991439 2819561373 538
175 iso_pu_bacteria 2818991448 2819609607 538
176 iso_pu_bacteria 2818991453 2819639705 538
177 iso_pu_bacteria 2818991461 2819686414 538
178 iso_pu_bacteria 2818991466 2819714954 538
179 iso_pu_bacteria 2821123053 2821126152 538
180 iso_pu_bacteria 2838029111 2838033124 538
181 iso_pu_bacteria 2838074704 2838077437 538
182 iso_pu_bacteria 2838675328 2838679475 538
183 iso_pu_bacteria 2838714209 2838718832 538
184 iso_pu_bacteria 2838719591 2838723831 538
185 iso_pu_bacteria 2838724970 2838729153 538
186 iso_pu_bacteria 2839993093 2839993799 538
187 iso_pu_bacteria 2840764183 2840766823 538
188 iso_pu_bacteria 2841734538 2841734957 538
189 iso_pu_bacteria 2841840854 2841842258 538
190 iso_pu_bacteria 2841846520 2841851078 538
191 iso_pu_bacteria 2841859092 2841863883 538
192 iso_pu_bacteria 2842124991 2842129851 538
193 iso_pu_bacteria 2842130223 2842134406 538
194 iso_pu_bacteria 2842152218 2842156402 538
195 iso_pu_bacteria 2842170452 2842175078 538
196 iso_pu_bacteria 2842175837 2842179994 538
197 iso_pu_bacteria 2842187318 2842191587 538
198 iso_pu_bacteria 2842211629 2842215904 538
199 iso_pu_bacteria 2842224351 2842228596 538
200 iso_pu_bacteria 2842298080 2842298703 538
201 iso_pu_bacteria 2842357229 2842359430 538
202 iso_pu_bacteria 2842475841 2842479857 538
203 iso_pu_bacteria 2842482326 2842483397 538
204 iso_pu_bacteria 2842502639 2842507033 538
205 iso_pu_bacteria 2842509118 2842510726 538
206 iso_pu_bacteria 2842515876 2842520665 538
207 iso_pu_bacteria 2842521101 2842523198 538
208 iso_pu_bacteria 2842871566 2842875317 538
209 iso_pu_bacteria 2842922631 2842925865 538
210 iso_pu_bacteria 2844002411 2844005546 538
211 iso_pu_bacteria 2844009547 2844015651 538
212 iso_pu_bacteria 2844163670 2844169253 538
213 iso_pu_bacteria 2847417321 2847420448 538
214 iso_pu_bacteria 2847670302 2847672023 538
215 iso_pu_bacteria 2847686936 2847688333 538
216 iso_pu_bacteria 2848297114 2848300333 538
217 iso_pu_bacteria 2848992105 2848995321 538
218 iso_pu_bacteria 2850079185 2850082306 538
219 iso_pu_bacteria 2852387548 2852391210 538
220 iso_pu_bacteria 2855825444 2855827032 538
221 iso_pu_bacteria 2855839649 2855842429 538
222 iso_pu_bacteria 2855872281 2855878424 538
223 iso_pu_bacteria 2856314179 2856318237 538
224 iso_pu_bacteria 2856320880 2856324205 538
225 iso_pu_bacteria 2856328259 2856328633 538
226 iso_pu_bacteria 2856334872 2856341655 538
227 iso_pu_bacteria 2856342000 2856345364 538
228 iso_pu_bacteria 2856364286 2856364866 538
229 iso_pu_bacteria 2857349434 2857354878 538
230 iso_pu_bacteria 2857367948 2857370959 538
231 iso_pu_bacteria 2857531043 2857532713 538
232 iso_pu_bacteria 2858800743 2858803245 538
233 iso_pu_bacteria 2869162929 2869168116 538
234 iso_pu_bacteria 2869169390 2869171153 538
235 iso_pu_bacteria 2869234852 2869241007 538
236 iso_pu_bacteria 2869249662 2869251173 538
237 iso_pu_bacteria 2869256925 2869259420 538
238 iso_pu_bacteria 2869264136 2869271181 538
239 iso_pu_bacteria 2869271264 2869278533 538
240 iso_pu_bacteria 2869278585 2869281797 538
241 iso_pu_bacteria 2869285874 2869289685 538
242 iso_pu_bacteria 2871429161 2871431751 538
243 iso_pu_bacteria 2871444079 2871448418 538
244 iso_pu_bacteria 2871451962 2871453857 538
245 iso_pu_bacteria 2871459585 2871466058 538
246 iso_pu_bacteria 2871466892 2871474349 538
247 iso_pu_bacteria 2871474448 2871477062 538
248 iso_pu_bacteria 2871481445 2871482748 538
249 iso_pu_bacteria 2871488783 2871494133 538
250 iso_pu_bacteria 2871495908 2871498995 538
251 iso_pu_bacteria 2874102143 2874103957 538
252 iso_pu_bacteria 2874109183 2874110938 538
253 iso_pu_bacteria 2874116593 2874116936 538
254 iso_pu_bacteria 2874123672 2874127764 538
255 iso_pu_bacteria 2874139085 2874140525 538
256 iso_pu_bacteria 2874146452 2874155429 538
257 iso_pu_bacteria 2874155637 2874162286 538
258 iso_pu_bacteria 2874162495 2874166600 538
259 iso_pu_bacteria 2874168670 2874173101 538
260 iso_pu_bacteria 2876363079 2876366837 538
261 iso_pu_bacteria 2876369609 2876375112 538
262 iso_pu_bacteria 2876386047 2876387431 538
263 iso_pu_bacteria 2876392853 2876398812 538
264 iso_pu_bacteria 2876399893 2876404647 538
265 iso_pu_bacteria 2876413966 2876420774 538
266 iso_pu_bacteria 2876420981 2876427002 538
267 iso_pu_bacteria 2878035449 2878037549 538
268 iso_pu_bacteria 2878738818 2878739471 538
269 iso_pu_bacteria 2878745973 2878748357 538
270 iso_pu_bacteria 2878753008 2878756708 538
271 iso_pu_bacteria 2878760144 2878763205 538
272 iso_pu_bacteria 2878767105 2878770183 538
273 iso_pu_bacteria 2878774303 2878776233 538
274 iso_pu_bacteria 2878781027 2878786677 538
275 iso_pu_bacteria 2878788777 2878796645 538
276 iso_pu_bacteria 2880518877 2880519327 538
277 iso_pu_bacteria 2881147464 2881153952 538
278 iso_pu_bacteria 2881155292 2881157658 538
279 iso_pu_bacteria 2881845957 2881849650 538
280 iso_pu_bacteria 2881861095 2881862435 538
281 iso_pu_bacteria 2882632389 2882636938 538
282 iso_pu_bacteria 2882912400 2882913516 538
283 iso_pu_bacteria 2885305155 2885311960 538
284 iso_pu_bacteria 2885318864 2885320940 538
285 iso_pu_bacteria 2885326080 2885331744 538
286 iso_pu_bacteria 2885342637 2885347761 538
287 iso_pu_bacteria 2885350715 2885352697 538
288 iso_pu_bacteria 2888337043 2888341714 538
289 iso_pu_bacteria 2888343758 2888349006 538
290 iso_pu_bacteria 2888350351 2888350858 538
291 iso_pu_bacteria 2889010040 2889013204 538
292 iso_pu_bacteria 2889016732 2889021943 538
293 iso_pu_bacteria 2891048133 2891050803 538
294 iso_pu_bacteria 2894652903 2894653254 538
295 iso_pu_bacteria 2896384573 2896390002 538
296 iso_pu_bacteria 2899792073 2899794930 538
297 iso_pu_bacteria 2899803654 2899806428 538
298 iso_pu_bacteria 2899845264 2899850442 538
299 iso_pu_bacteria 2903448605 2903453695 538
300 iso_pu_bacteria 2903492973 2903502363 538
301 iso_pu_bacteria 2903492973 2903506034 538
302 iso_pu_bacteria 2903521522 2903524704 538
303 iso_pu_bacteria 2903528002 2903531053 538
304 iso_pu_bacteria 2903540706 2903543796 538
305 iso_pu_bacteria 2904578770 2904579508 538
306 iso_pu_bacteria 2904659560 2904665344 538
307 iso_pu_bacteria 2906308376 2906311974 538
308 iso_pu_bacteria 2906321335 2906323712 538
309 iso_pu_bacteria 2906328253 2906331497 538
310 iso_pu_bacteria 2906363423 2906366568 538
311 iso_pu_bacteria 2906370794 2906371144 538
312 iso_pu_bacteria 2906378014 2906382373 538
313 iso_pu_bacteria 2906386501 2906389228 538
314 iso_pu_bacteria 2906393657 2906394062 538
315 iso_pu_bacteria 2906401398 2906405891 538
316 iso_pu_bacteria 2906408224 2906408434 538
317 iso_pu_bacteria 2906414383 2906418274 538
318 iso_pu_bacteria 2906427513 2906431406 538
319 iso_pu_bacteria 2909042592 2909048300 538
320 iso_pu_bacteria 2913295892 2913299842 538
321 iso_pu_bacteria 2915980308 2915980565 538
322 iso_pu_bacteria 2915986958 2915991040 538
323 iso_pu_bacteria 2915993759 2915994942 538
324 iso_pu_bacteria 2916000859 2916001148 538
325 iso_pu_bacteria 2916007675 2916012251 538
326 iso_pu_bacteria 2916014648 2916016916 538
327 iso_pu_bacteria 2916021584 2916027779 538
328 iso_pu_bacteria 2916028427 2916030208 538
329 iso_pu_bacteria 2916035215 2916040812 538
330 iso_pu_bacteria 2916041962 2916044941 538
331 iso_pu_bacteria 2916048683 2916049295 538
332 iso_pu_bacteria 2916055098 2916058334 538
333 iso_pu_bacteria 2916061851 2916066290 538
334 iso_pu_bacteria 2916068649 2916071407 538
335 iso_pu_bacteria 2916076590 2916082027 538
336 iso_pu_bacteria 2919114240 2919118793 538
337 iso_pu_bacteria 2919119836 2919120828 538
338 iso_pu_bacteria 2919171160 2919173439 538
339 iso_pu_bacteria 2919408235 2919410672 538
340 iso_pu_bacteria 2919709256 2919710065 538
341 iso_pu_bacteria 2920760137 2920760756 538
342 iso_pu_bacteria 2920822456 2920828484 538
343 iso_pu_bacteria 2921201388 2921208402 538
344 iso_pu_bacteria 2921208531 2921212827 538
345 iso_pu_bacteria 2921237296 2921241898 538
346 iso_pu_bacteria 2921244191 2921244220 538
347 iso_pu_bacteria 2921250672 2921252505 538
348 iso_pu_bacteria 2921257292 2921260629 538
349 iso_pu_bacteria 2921263974 2921265999 538
350 iso_pu_bacteria 2921282425 2921287765 538
351 iso_pu_bacteria 2921289301 2921292842 538
352 iso_pu_bacteria 2921296804 2921302579 538
353 iso_pu_bacteria 2922151315 2922153482 538
354 iso_pu_bacteria 2922158528 2922159393 538
355 iso_pu_bacteria 2922172374 2922178143 538
356 iso_pu_bacteria 2922185730 2922192370 538
357 iso_pu_bacteria 2924144063 2924148817 538
358 iso_pu_bacteria 2924150972 2924152140 538
359 iso_pu_bacteria 2924158325 2924164076 538
360 iso_pu_bacteria 2924165586 2924172650 538
361 iso_pu_bacteria 2924172951 2924174456 538
362 iso_pu_bacteria 2924186466 2924191918 538
363 iso_pu_bacteria 2924193448 2924193776 538
364 iso_pu_bacteria 2924200457 2924206697 538
365 iso_pu_bacteria 2924207177 2924213129 538
366 iso_pu_bacteria 2924214083 2924214783 538
367 iso_pu_bacteria 2924221636 2924223982 538
368 iso_pu_bacteria 2924228884 2924232080 538
369 iso_pu_bacteria 2924726620 2924733144 538
370 iso_pu_bacteria 2924733363 2924736036 538
371 iso_pu_bacteria 2924741084 2924741299 538
372 iso_pu_bacteria 2924748358 2924751410 538
373 iso_pu_bacteria 2924754689 2924758618 538
374 iso_pu_bacteria 2924762789 2924764406 538
375 iso_pu_bacteria 2924776078 2924776996 538
376 iso_pu_bacteria 2924784321 2924788297 538
377 iso_pu_bacteria 2926754445 2926758186 538
378 iso_pu_bacteria 2926760298 2926764248 538
379 iso_pu_bacteria 2928521798 2928522304 538
380 iso_pu_bacteria 2929138655 2929141372 538
381 iso_pu_bacteria 2933006813 2933011176 538
382 iso_pu_bacteria 2933011516 2933016286 538
383 iso_pu_bacteria 2933594066 2933598997 538
384 iso_pu_bacteria 2936996657 2937000052 538
385 iso_pu_bacteria 2937002841 2937006987 538
386 iso_pu_bacteria 2937009748 2937015457 538
387 iso_pu_bacteria 2937016420 2937018176 538
388 iso_pu_bacteria 2937023124 2937024380 538
389 iso_pu_bacteria 2937029754 2937032992 538
390 iso_pu_bacteria 2937036028 2937042226 538
391 iso_pu_bacteria 2937042894 2937046727 538
392 iso_pu_bacteria 2937049772 2937052343 538
393 iso_pu_bacteria 2937056579 2937063152 538
394 iso_pu_bacteria 2937063883 2937067587 538
395 iso_pu_bacteria 2937071275 2937071401 538
396 iso_pu_bacteria 2937078374 2937078632 538
397 iso_pu_bacteria 2937084907 2937087309 538
398 iso_pu_bacteria 2937091812 2937093395 538
399 iso_pu_bacteria 2937098957 2937104714 538
400 iso_pu_bacteria 2937106411 2937106694 538
401 iso_pu_bacteria 2937113482 2937114575 538
402 iso_pu_bacteria 2937119839 2937123698 538
403 iso_pu_bacteria 2937126314 2937129324 538
404 iso_pu_bacteria 2937813078 2937818203 538
405 iso_pu_bacteria 2937822353 2937828407 538
406 iso_pu_bacteria 2937836603 2937838564 538
407 iso_pu_bacteria 2937848649 2937850650 538
408 iso_pu_bacteria 2937868953 2937872247 538
409 iso_pu_bacteria 2937877337 2937880301 538
410 iso_pu_bacteria 2937891427 2937896424 538
411 iso_pu_bacteria 2937972304 2937976166 538
412 iso_pu_bacteria 2937994558 2937997646 538
413 iso_pu_bacteria 2938014810 2938017994 538
414 iso_pu_bacteria 2941499720 2941501693 538
415 iso_pu_bacteria 2954011201 2954014274 538
416 iso_pu_bacteria 2957375807 2957376930 538
417 iso_pu_bacteria 2957382221 2957386085 538
418 iso_pu_bacteria 2957388812 2957390169 538
419 iso_pu_bacteria 2957395598 2957396767 538
420 iso_pu_bacteria 2957402308 2957406266 538
421 iso_pu_bacteria 2957408893 2957409019 538
422 iso_pu_bacteria 2957415311 2957422203 538
423 iso_pu_bacteria 2957422303 2957429556 538
424 iso_pu_bacteria 2957430029 2957436700 538
425 iso_pu_bacteria 2957437181 2957437390 538
426 iso_pu_bacteria 2957443900 2957449551 538
427 iso_pu_bacteria 2957450854 2957452780 538
428 iso_pu_bacteria 2957457609 2957459103 538
429 iso_pu_bacteria 2957464669 2957468195 538
430 iso_pu_bacteria 2957471148 2957471959 538
431 iso_pu_bacteria 2957478035 2957481020 538
432 iso_pu_bacteria 2957484790 2957488449 538
433 iso_pu_bacteria 2957491536 2957495273 538
434 iso_pu_bacteria 2957498199 2957501877 538
435 iso_pu_bacteria 2957505466 2957511425 538
436 iso_pu_bacteria 2958034702 2958037758 538
437 iso_pu_bacteria 2958041894 2958047470 538
438 iso_pu_bacteria 2958064165 2958066140 538
439 iso_pu_bacteria 2958071322 2958074608 538
440 iso_pu_bacteria 2958084443 2958087437 538
441 iso_pu_bacteria 2958100919 2958104024 538
442 iso_pu_bacteria 2958108152 2958112661 538
443 iso_pu_bacteria 2958115193 2958116707 538
444 iso_pu_bacteria 2958122699 2958128836 538
445 iso_pu_bacteria 2958130278 2958134058 538
446 iso_pu_bacteria 2958137437 2958143185 538
447 iso_pu_bacteria 2958144490 2958149067 538
448 iso_pu_bacteria 2958158011 2958160764 538
449 iso_pu_bacteria 2958165035 2958168120 538
450 iso_pu_bacteria 2958172287 2958175324 538
451 iso_pu_bacteria 2958179912 2958183704 538
452 iso_pu_bacteria 2960584000 2960584368 538
453 iso_pu_bacteria 2960591022 2960591280 538
454 iso_pu_bacteria 2960597568 2960598778 538
455 iso_pu_bacteria 2960603979 2960610216 538
456 iso_pu_bacteria 2960610863 2960617249 538
457 iso_pu_bacteria 2960617483 2960618759 538
458 iso_pu_bacteria 2960624210 2960629523 538
459 iso_pu_bacteria 2960631154 2960632532 538
460 iso_pu_bacteria 2960637947 2960639548 538
461 iso_pu_bacteria 2960645483 2960649391 538
462 iso_pu_bacteria 2960652885 2960653025 538
463 iso_pu_bacteria 2960660292 2960665272 538
464 iso_pu_bacteria 2960667422 2960671498 538
465 iso_pu_bacteria 2960674078 2960677374 538
466 iso_pu_bacteria 2960680706 2960681362 538
467 iso_pu_bacteria 2960687367 2960687934 538
468 iso_pu_bacteria 2960693952 2960697135 538
469 iso_pu_bacteria 2961077736 2961081670 538
470 iso_pu_bacteria 2961114664 2961120344 538
471 iso_pu_bacteria 2961127735 2961134131 538
472 iso_pu_bacteria 2961136820 2961143792 538
473 iso_pu_bacteria 2961163497 2961166585 538
474 iso_pu_bacteria 2961170736 2961172998 538
475 iso_pu_bacteria 2961183825 2961190661 538
476 iso_pu_bacteria 2963644680 2963649631 538
477 iso_pu_bacteria 2964607997 2964610855 538
478 iso_pu_bacteria 2964615318 2964620404 538
479 iso_pu_bacteria 2964621998 2964622784 538
480 iso_pu_bacteria 2964628898 2964632463 538
481 iso_pu_bacteria 2964636051 2964642640 538
482 iso_pu_bacteria 2964643177 2964647243 538
483 iso_pu_bacteria 2964649959 2964652267 538
484 iso_pu_bacteria 2964656573 2964658972 538
485 iso_pu_bacteria 2964663802 2964668859 538
486 iso_pu_bacteria 2964670856 2964677550 538
487 iso_pu_bacteria 2964678106 2964681793 538
488 iso_pu_bacteria 2964685014 2964690928 538
489 iso_pu_bacteria 2964691889 2964693198 538
490 iso_pu_bacteria 2964698721 2964705194 538
491 iso_pu_bacteria 2964705432 2964706192 538
492 iso_pu_bacteria 2964712639 2964719117 538
493 iso_pu_bacteria 2964719344 2964724783 538
494 iso_pu_bacteria 2965018300 2965021408 538
495 iso_pu_bacteria 2965025482 2965026254 538
496 iso_pu_bacteria 2965040258 2965046571 538
497 iso_pu_bacteria 2965047637 2965048134 538
498 iso_pu_bacteria 2965062239 2965070160 538
499 iso_pu_bacteria 2965089291 2965094975 538
500 iso_pu_bacteria 2965102966 2965106513 538
501 iso_pu_bacteria 2965119406 2965125059 538
502 iso_pu_bacteria 2967664464 2967666712 538
503 iso_pu_bacteria 2967671571 2967674346 538
504 iso_pu_bacteria 2967678726 2967685630 538
505 iso_pu_bacteria 2967686174 2967686511 538
506 iso_pu_bacteria 2967693043 2967696161 538
507 iso_pu_bacteria 2967699805 2967705622 538
508 iso_pu_bacteria 2967706974 2967708381 538
509 iso_pu_bacteria 2967714385 2967715779 538
510 iso_pu_bacteria 2967721400 2967721968 538
511 iso_pu_bacteria 2967728569 2967732484 538
512 iso_pu_bacteria 2967735183 2967735385 538
513 iso_pu_bacteria 2967742019 2967746872 538
514 iso_pu_bacteria 2967748971 2967755026 538
515 iso_pu_bacteria 2967755722 2967759045 538
516 iso_pu_bacteria 2967762386 2967768815 538
517 iso_pu_bacteria 2967769361 2967774589 538
518 iso_pu_bacteria 2967775926 2967781366 538
519 iso_pu_bacteria 2967996073 2967998209 538
520 iso_pu_bacteria 2968003550 2968008861 538
521 iso_pu_bacteria 2968016561 2968019394 538
522 iso_pu_bacteria 2968083720 2968087059 538
523 iso_pu_bacteria 2968091066 2968095703 538
524 iso_pu_bacteria 2968097103 2968099623 538
525 iso_pu_bacteria 2968110612 2968116811 538
526 iso_pu_bacteria 2968117919 2968118537 538
527 iso_pu_bacteria 2968128360 2968131869 538
528 iso_pu_bacteria 2968138860 2968145478 538
529 iso_pu_bacteria 2968171901 2968174990 538
530 iso_pu_bacteria 2970019648 2970022180 538
531 iso_pu_bacteria 2970026789 2970030226 538
532 iso_pu_bacteria 2970033650 2970040615 538
533 iso_pu_bacteria 2970040964 2970044329 538
534 iso_pu_bacteria 2970047711 2970050543 538
535 iso_pu_bacteria 2970054988 2970061094 538
536 iso_pu_bacteria 2970061556 2970067017 538
537 iso_pu_bacteria 2970068827 2970069483 538
538 iso_pu_bacteria 2970076120 2970079118 538
539 iso_pu_bacteria 2970082768 2970083426 538
540 iso_pu_bacteria 2970088815 2970090036 538
541 iso_pu_bacteria 2970095765 2970099122 538
542 iso_pu_bacteria 2970102677 2970108867 538
543 iso_pu_bacteria 2970109326 2970115294 538
544 iso_pu_bacteria 2970116247 2970121601 538
545 iso_pu_bacteria 2970122695 2970126462 538
546 iso_pu_bacteria 2970129317 2970134336 538
547 iso_pu_bacteria 2970136068 2970140712 538
548 iso_pu_bacteria 2970143518 2970144545 538
549 iso_pu_bacteria 2970149975 2970155609 538
550 iso_pu_bacteria 2970156795 2970160265 538
551 iso_pu_bacteria 2970164137 2970166725 538
552 iso_pu_bacteria 2970170962 2970173384 538
553 iso_pu_bacteria 2970177841 2970183306 538
554 iso_pu_bacteria 2970184632 2970191299 538
555 iso_pu_bacteria 2970191845 2970195642 538
556 iso_pu_bacteria 2970469710 2970472715 538
557 iso_pu_bacteria 2970489779 2970494722 538
558 iso_pu_bacteria 2970503327 2970505592 538
559 iso_pu_bacteria 2970510686 2970515893 538
560 iso_pu_bacteria 2970524798 2970529212 538
561 iso_pu_bacteria 2970540015 2970544105 538
562 iso_pu_bacteria 2970547951 2970550662 538
563 iso_pu_bacteria 2970554993 2970558049 538
564 iso_pu_bacteria 2970593180 2970596401 538
565 iso_pu_bacteria 2970627176 2970627440 538
566 iso_pu_bacteria 2977516862 2977522106 538
567 iso_pu_bacteria 2977523885 2977530046 538
568 iso_pu_bacteria 2977530762 2977532474 538
569 iso_pu_bacteria 2977537788 2977541006 538
570 iso_pu_bacteria 2977544691 2977551087 538
571 iso_pu_bacteria 2977551784 2977556886 538
572 iso_pu_bacteria 2977558990 2977564105 538
573 iso_pu_bacteria 2977565890 2977569148 538
574 iso_pu_bacteria 2977572785 2977577973 538
575 iso_pu_bacteria 2977579622 2977579749 538
576 iso_pu_bacteria 2977821940 2977825888 538
577 iso_pu_bacteria 2977843712 2977851299 538
578 iso_pu_bacteria 2977851361 2977854973 538
579 iso_pu_bacteria 2977864932 2977869118 538
580 iso_pu_bacteria 2977872689 2977874979 538
581 iso_pu_bacteria 2977898635 2977906753 538
582 iso_pu_bacteria 2977907340 2977909601 538
583 iso_pu_bacteria 2977915119 2977915806 538
584 iso_pu_bacteria 2977922695 2977927661 538
585 iso_pu_bacteria 2977935797 2977938614 538
586 iso_pu_bacteria 2977942078 2977946661 538
587 iso_pu_bacteria 2977950692 2977955364 538
588 iso_pu_bacteria 2977957713 2977960418 538
589 iso_pu_bacteria 2977986579 2977988407 538
590 iso_pu_bacteria 2979089926 2979090651 538
591 iso_pu_bacteria 2979100975 2979101702 538
592 iso_pu_bacteria 2979710463 2979711941 538
593 iso_pu_bacteria 2979764755 2979766495 538
594 iso_pu_bacteria 2979772303 2979776260 538
595 iso_pu_bacteria 2979779861 2979781254 538
596 iso_pu_bacteria 2979793036 2979799060 538
597 iso_pu_bacteria 2979808191 2979810313 538
598 iso_pu_bacteria 2984509177 2984510345 538
599 iso_pu_bacteria 2984518228 2984518950 538
600 iso_pu_bacteria 2984537506 2984538693 538
601 iso_pu_bacteria 2984601300 2984605401 538
602 iso_pu_bacteria 2987636660 2987643480 538
603 iso_pu_bacteria 2987645492 2987646271 538
604 iso_pu_bacteria 2987652177 2987654961 538
605 iso_pu_bacteria 2987659509 2987662596 538
606 iso_pu_bacteria 2987666974 2987672748 538
607 iso_pu_bacteria 2987673487 2987679207 538
608 iso_pu_bacteria 2989771324 2989773534 538
609 iso_pu_bacteria 2989776772 2989780341 538
610 iso_pu_bacteria 2996336353 2996340114 538
611 iso_pu_bacteria 2996341866 2996347103 538
612 iso_pu_bacteria 2996348954 2996352152 538
613 iso_pu_bacteria 2996386984 2996391957 538
614 iso_pu_bacteria 3000135777 3000142066 538
615 iso_pu_bacteria 3003930520 3003934934 538
616 iso_pu_bacteria 3004167301 3004171130 538
617 iso_pu_bacteria 3004188549 3004191647 538
618 iso_pu_bacteria 3004195979 3004196161 538
619 iso_pu_bacteria 3004203850 3004207025 538
620 iso_pu_bacteria 3004211236 3004213945 538
621 iso_pu_bacteria 3004218560 3004223536 538
622 iso_pu_bacteria 3004232784 3004234148 538
623 iso_pu_bacteria 3004239961 3004245161 538
624 iso_pu_bacteria 3004248173 3004252682 538
625 iso_pu_bacteria 3004268573 3004273277 538
626 iso_pu_bacteria 3004275668 3004278850 538
627 iso_pu_bacteria 3004334049 3004339182 538
628 iso_pu_bacteria 3005416602 3005418493 538
629 iso_pu_bacteria 637000159 637079347 538
630 iso_pu_bacteria 648276728 648735844 538
631 iso_pu_bacteria 649633066 649874801 538
632 iso_pu_bacteria 650716007 650843709 538
633 iso_pu_bacteria 8002285264 8002288006 538
634 iso_pu_bacteria 8003570095 8003574029 538
635 iso_pu_bacteria 8003992118 8003994970 538
636 iso_pu_bacteria 8003999396 8004002733 538
637 iso_pu_bacteria 8004300914 8004306068 538
638 iso_pu_bacteria 8004312739 8004313995 538
639 iso_pu_bacteria 8004361976 8004367360 538
640 iso_pu_bacteria 8004374579 8004378296 538
641 iso_pu_bacteria 8004387939 8004391563 538
642 iso_pu_bacteria 8004445564 8004448520 538
643 iso_pu_bacteria 8004633249 8004634615 538
644 iso_pu_bacteria 8004640170 8004646152 538
645 iso_pu_bacteria 8004703790 8004705034 538
646 iso_pu_bacteria 8004714634 8004716932 538
647 iso_pu_bacteria 8004727605 8004733486 538
648 iso_pu_bacteria 8005246636 8005249572 538
649 iso_pu_bacteria 8005314921 8005318615 538
650 iso_pu_bacteria 8005484373 8005488500 538
651 iso_pu_bacteria 8005645114 8005648967 538
652 iso_pu_bacteria 8005658619 8005662459 538
653 iso_pu_bacteria 8005682033 8005682207 538
654 iso_pu_bacteria 8024486573 8024487014 538
655 iso_pu_bacteria 8046767195 8046773227 538
656 iso_pu_bacteria 8049293176 8049295940 538
657 iso_pu_bacteria 8054558443 8054563398 538
658 iso_pu_bacteria 8055431914 8055432039 538
659 iso_pu_bacteria 8055617313 8055623275 538
660 iso_pu_bacteria 8056875544 8056876154 538
661 iso_pu_bacteria 8057575449 8057581037 538
662 iso_pu_bacteria 2534681786 2535485677 539
663 iso_pu_bacteria 2643221541 2643727653 539
664 iso_pu_bacteria 2643221568 2643858138 539
665 iso_pu_bacteria 2643221580 2643913070 539
666 iso_pu_bacteria 2643221591 2643962873 539
667 iso_pu_bacteria 2643221605 2644037273 539
668 iso_pu_bacteria 2643221606 2644041187 539
669 iso_pu_bacteria 2643221629 2644166973 539
670 iso_pu_bacteria 2643221637 2644209872 539
671 iso_pu_bacteria 2643221662 2644349486 539
672 iso_pu_bacteria 2643221671 2644394726 539
673 iso_pu_bacteria 2643221674 2644411476 539
674 iso_pu_bacteria 2643221718 2644653423 539
675 iso_pu_bacteria 2751185800 2753358401 539
676 iso_pu_bacteria 2757320392 2757570207 539
677 iso_pu_bacteria 2854911287 2854913918 539
678 iso_pu_bacteria 2891373044 2891377518 539
679 iso_pu_bacteria 2915650412 2915650787 539
680 iso_pu_bacteria 2919166419 2919169885 539
681 iso_pu_bacteria 2932401849 2932402605 539
682 iso_pu_bacteria 2978969890 2978972348 539
683 iso_pu_bacteria 2984587000 2984590579 539
684 iso_pu_bacteria 2989349275 2989354643 539
685 iso_pu_bacteria 8054460903 8054463451 539
686 3300005518 Ga0070699_100080177 Ga0070699_1000801772 540
687 iso_pu_bacteria 2837651117 2837654216 540
688 iso_pu_bacteria 2838736955 2838737373 540
689 iso_pu_bacteria 2842140634 2842142037 540
690 iso_pu_bacteria 2854896431 2854900240 540
691 iso_pu_bacteria 2854916844 2854919158 540
692 3300006847 Ga0075431_100004625 Ga0075431_1000046255 541
693 3300009147 Ga0114129_10009933 Ga0114129_100099337 541
694 3300029957 Ga0265324_10001826 Ga0265324_1000182614 541
695 3300031250 Ga0265331_10000377 Ga0265331_1000037747 541
696 3300031251 Ga0265327_10000100 Ga0265327_10000100149 541
697 3300044712 Ga0453684_0008423 Ga0453684_0008423_7569_9197 541
698 3300053153 Ga0500616_0035918 Ga0500616_0035918_791_2428 541
699 iso_pu_bacteria 2791355253 2793281626 541
700 3300001915 JGI24741J21665_1001749 JGI24741J21665_10017495 542
701 3300001979 JGI24740J21852_10016205 JGI24740J21852_100162052 542
702 3300001989 JGI24739J22299_10001947 JGI24739J22299_100019474 542
703 3300002067 JGI24735J21928_10003491 JGI24735J21928_100034916 542
704 3300002704 JGI25155J39150_1000007 JGI25155J39150_100000710 542
705 3300002704 JGI25155J39150_1000012 JGI25155J39150_1000012163 542
706 3300002705 JGI25156J39149_1000036 JGI25156J39149_100003617 542
707 3300002737 JGI25162J39368_1000719 JGI25162J39368_10007192 542
708 3300002737 JGI25162J39368_1002558 JGI25162J39368_10025585 542
709 3300002738 JGI25154J39366_1000033 JGI25154J39366_10000339 542
710 3300002739 JGI25158J39367_1001179 JGI25158J39367_10011793 542
711 3300002741 JGI25157J39369_1000124 JGI25157J39369_100012432 542
712 3300002987 JGI25159J45721_1000032 JGI25159J45721_100003229 542
713 3300002987 JGI25159J45721_1000471 JGI25159J45721_10004714 542
714 3300003214 JGI25165J46597_1000016 JGI25165J46597_1000016123 542
715 3300003214 JGI25165J46597_1000598 JGI25165J46597_10005988 542
716 3300003214 JGI25165J46597_1001390 JGI25165J46597_10013903 542
717 3300003354 JGI25160J50197_1000006 JGI25160J50197_100000673 542
718 3300003354 JGI25160J50197_1000009 JGI25160J50197_100000956 542
719 3300003374 JGI25161J50226_1000004 JGI25161J50226_100000473 542
720 3300003374 JGI25161J50226_1000240 JGI25161J50226_100024023 542
721 3300003762 Ga0055542_1000452 Ga0055542_100045235 542
722 3300003775 Ga0055524_1001608 Ga0055524_10016087 542
723 3300003781 Ga0055536_1000808 Ga0055536_100080820 542
724 3300003781 Ga0055536_1000890 Ga0055536_10008902 542
725 3300003781 Ga0055536_1007545 Ga0055536_10075452 542
726 3300003791 Ga0055530_10010289 Ga0055530_100102892 542
727 3300003792 Ga0055540_1000988 Ga0055540_100098819 542
728 3300003794 Ga0055531_10010623 Ga0055531_100106233 542
729 3300003856 Ga0058692_1001375 Ga0058692_10013757 542
730 3300003856 Ga0058692_1001590 Ga0058692_10015902 542
731 3300004625 Ga0055543_1000002 Ga0055543_1000002261 542
732 3300004625 Ga0055543_1000055 Ga0055543_100005557 542
733 3300005262 Ga0065165_1000020 Ga0065165_1000020213 542
734 3300005262 Ga0065165_1000391 Ga0065165_100039149 542
735 3300005327 Ga0070658_10043203 Ga0070658_100432033 542
736 3300005539 Ga0068853_100010670 Ga0068853_1000106705 542
737 3300005548 Ga0070665_100004575 Ga0070665_10000457514 542
738 3300005548 Ga0070665_100037169 Ga0070665_1000371692 542
739 3300005563 Ga0068855_100169901 Ga0068855_1001699012 542
740 3300005614 Ga0068856_100033227 Ga0068856_1000332273 542
741 3300005834 Ga0068851_10007577 Ga0068851_100075774 542
742 3300005834 Ga0068851_10014685 Ga0068851_100146852 542
743 3300005844 Ga0068862_100000208 Ga0068862_10000020840 542
744 3300005983 Ga0081540_1004499 Ga0081540_10044997 542
745 3300006038 Ga0075365_10014528 Ga0075365_100145282 542
746 3300006042 Ga0075368_10000169 Ga0075368_100001695 542
747 3300006048 Ga0075363_100003056 Ga0075363_1000030562 542
748 3300006048 Ga0075363_100017379 Ga0075363_1000173792 542
749 3300006051 Ga0075364_10000197 Ga0075364_100001978 542
750 3300006177 Ga0075362_10001832 Ga0075362_100018322 542
751 3300006177 Ga0075362_10022538 Ga0075362_100225382 542
752 3300006177 Ga0075362_10035910 Ga0075362_100359101 542
753 3300006178 Ga0075367_10002319 Ga0075367_100023193 542
754 3300006186 Ga0075369_10011135 Ga0075369_100111352 542
755 3300006186 Ga0075369_10014425 Ga0075369_100144252 542
756 3300006946 Ga0079104_1000042 Ga0079104_100004299 542
757 3300006946 Ga0079104_1001097 Ga0079104_10010974 542
758 3300006946 Ga0079104_1007902 Ga0079104_10079023 542
759 3300006948 Ga0099826_10001501 Ga0099826_100015013 542
760 3300006948 Ga0099826_10012183 Ga0099826_100121832 542
761 3300009093 Ga0105240_10000019 Ga0105240_10000019165 542
762 3300009101 Ga0105247_10023880 Ga0105247_100238802 542
763 3300009174 Ga0105241_10159830 Ga0105241_101598301 542
764 3300009545 Ga0105237_10001085 Ga0105237_100010858 542
765 3300009551 Ga0105238_10040925 Ga0105238_100409253 542
766 3300009553 Ga0105249_10000184 Ga0105249_1000018433 542
767 3300010375 Ga0105239_10028356 Ga0105239_100283562 542
768 3300010375 Ga0105239_10095033 Ga0105239_100950332 542
769 3300013100 Ga0157373_10001083 Ga0157373_1000108318 542
770 3300013100 Ga0157373_10013052 Ga0157373_100130523 542
771 3300013102 Ga0157371_10000219 Ga0157371_1000021932 542
772 3300013104 Ga0157370_10000037 Ga0157370_100000375 542
773 3300013104 Ga0157370_10000824 Ga0157370_1000082410 542
774 3300013105 Ga0157369_10185724 Ga0157369_101857241 542
775 3300013249 Ga0171463_1006 Ga0171463_1006266 542
776 3300015262 Ga0182007_10000679 Ga0182007_1000067910 542
777 3300015690 Ga0183363_1195 Ga0183363_119511 542
778 3300017792 Ga0163161_10025315 Ga0163161_100253152 542
779 3300021320 Ga0214544_1000063 Ga0214544_100006330 542
780 3300021321 Ga0214542_1000095 Ga0214542_100009520 542
781 3300021327 Ga0214543_1000008 Ga0214543_1000008221 542
782 3300021327 Ga0214543_1000026 Ga0214543_100002620 542
783 3300022739 Ga0228711_1000003 Ga0228711_1000003149 542
784 3300022740 Ga0228710_1000003 Ga0228710_1000003155 542
785 3300025206 Ga0209435_100005 Ga0209435_100005163 542
786 3300025233 Ga0209437_100078 Ga0209437_100078186 542
787 3300025233 Ga0209437_100291 Ga0209437_10029149 542
788 3300025246 Ga0209646_1000011 Ga0209646_1000011163 542
789 3300025246 Ga0209646_1003337 Ga0209646_10033372 542
790 3300025250 Ga0209026_1000008 Ga0209026_1000008163 542
791 3300025253 Ga0209677_103659 Ga0209677_1036593 542
792 3300025254 Ga0209148_1000056 Ga0209148_100005628 542
793 3300025256 Ga0209759_1000004 Ga0209759_1000004163 542
794 3300025261 Ga0209233_1000068 Ga0209233_1000068124 542
795 3300025261 Ga0209233_1000157 Ga0209233_100015710 542
796 3300025261 Ga0209233_1000192 Ga0209233_100019229 542
797 3300025261 Ga0209233_1000194 Ga0209233_100019425 542
798 3300025272 Ga0209455_1000285 Ga0209455_100028529 542
799 3300025284 Ga0209130_1000032 Ga0209130_100003269 542
800 3300025284 Ga0209130_1000037 Ga0209130_1000037213 542
801 3300025292 Ga0209676_1001584 Ga0209676_100158410 542
802 3300025294 Ga0209025_1000196 Ga0209025_100019695 542
803 3300025295 Ga0209564_1000086 Ga0209564_100008657 542
804 3300025297 Ga0209758_1000576 Ga0209758_10005768 542
805 3300025297 Ga0209758_1007656 Ga0209758_10076563 542
806 3300025298 Ga0209050_1002937 Ga0209050_10029377 542
807 3300025299 Ga0209256_1000321 Ga0209256_100032128 542
808 3300025299 Ga0209256_1001676 Ga0209256_10016765 542
809 3300025302 Ga0207426_1000048 Ga0207426_1000048253 542
810 3300025302 Ga0207426_1000077 Ga0207426_100007769 542
811 3300025303 Ga0209051_1001367 Ga0209051_10013679 542
812 3300025303 Ga0209051_1007845 Ga0209051_10078452 542
813 3300025304 Ga0209257_1001330 Ga0209257_10013309 542
814 3300025304 Ga0209257_1005220 Ga0209257_10052205 542
815 3300025904 Ga0207647_10015537 Ga0207647_100155372 542
816 3300025909 Ga0207705_10055854 Ga0207705_100558542 542
817 3300025911 Ga0207654_10012470 Ga0207654_100124702 542
818 3300025913 Ga0207695_10000049 Ga0207695_10000049167 542
819 3300025914 Ga0207671_10000107 Ga0207671_100001072 542
820 3300025924 Ga0207694_10036721 Ga0207694_100367212 542
821 3300025961 Ga0207712_10000059 Ga0207712_1000005933 542
822 3300026041 Ga0207639_10003348 Ga0207639_100033485 542
823 3300026041 Ga0207639_10136590 Ga0207639_101365902 542
824 3300026067 Ga0207678_10002692 Ga0207678_100026927 542
825 3300026078 Ga0207702_10086723 Ga0207702_100867232 542
826 3300026116 Ga0207674_10010673 Ga0207674_100106731 542
827 3300026142 Ga0207698_10014125 Ga0207698_100141251 542
828 3300027111 Ga0209281_1000081 Ga0209281_1000081149 542
829 3300027111 Ga0209281_1000141 Ga0209281_100014136 542
830 3300027111 Ga0209281_1000194 Ga0209281_100019499 542
831 3300027312 Ga0209371_1001388 Ga0209371_10013888 542
832 3300027666 Ga0209282_1000036 Ga0209282_100003689 542
833 3300027666 Ga0209282_1000230 Ga0209282_100023012 542
834 3300027666 Ga0209282_1009311 Ga0209282_10093112 542
835 3300027866 Ga0209813_10000024 Ga0209813_1000002424 542
836 3300028379 Ga0268266_10003563 Ga0268266_100035632 542
837 3300028380 Ga0268265_10000225 Ga0268265_1000022517 542
838 3300028381 Ga0268264_10000691 Ga0268264_100006915 542
839 3300028794 Ga0307515_10000263 Ga0307515_1000026378 542
840 3300028794 Ga0307515_10008205 Ga0307515_1000820510 542
841 3300030500 Ga0268256_1001900 Ga0268256_10019008 542
842 3300031235 Ga0265330_10018642 Ga0265330_100186421 542
843 3300031249 Ga0265339_10023092 Ga0265339_100230923 542
844 3300031456 Ga0307513_10001607 Ga0307513_1000160731 542
845 3300031456 Ga0307513_10078170 Ga0307513_100781702 542
846 3300031548 Ga0307408_100010969 Ga0307408_1000109692 542
847 3300031731 Ga0307405_10068784 Ga0307405_100687842 542
848 3300031911 Ga0307412_10033535 Ga0307412_100335352 542
849 3300031967 Ga0315914_1000002 Ga0315914_1000002255 542
850 3300033430 Ga0315913_1000009 Ga0315913_100000989 542
851 3300033464 Ga0315915_1000005 Ga0315915_1000005255 542
852 3300035695 Ga0373927_0000822 Ga0373927_0000822_19438_21066 542
853 3300037068 Ga0373925_0007056 Ga0373925_0007056_3441_5069 542
854 3300037312 Ga0395899_0000090 Ga0395899_0000090_127526_129154 542
855 3300037418 Ga0395900_0000017 Ga0395900_0000017_340500_342128 542
856 3300037418 Ga0395900_0157016 Ga0395900_0157016_95_1723 542
857 3300037466 Ga0395898_0000030 Ga0395898_0000030_340475_342103 542
858 3300037471 Ga0395905_0000081 Ga0395905_0000081_131307_132935 542
859 3300037471 Ga0395905_0003702 Ga0395905_0003702_11016_12644 542
860 3300037471 Ga0395905_0006130 Ga0395905_0006130_8090_9718 542
861 3300038443 Ga0395901_0000015 Ga0395901_0000015_27475_29103 542
862 3300038443 Ga0395901_0113368 Ga0395901_0113368_445_2073 542
863 3300039438 Ga0436360_1160663 Ga0436360_1160663_35_1663 542
864 3300042007 Ga0439449_0000555 Ga0439449_0000555_2402_4030 542
865 3300046453 Ga0495627_000800 Ga0495627_000800_19776_21404 542
866 3300046460 Ga0495638_0012855 Ga0495638_0012855_863_2491 542
867 3300046506 Ga0495583_0000625 Ga0495583_0000625_34152_35780 542
868 3300046512 Ga0495610_0000095 Ga0495610_0000095_80630_82258 542
869 3300046519 Ga0495632_0001666 Ga0495632_0001666_11390_13018 542
870 3300046520 Ga0495637_0020445 Ga0495637_0020445_666_2294 542
871 3300046522 Ga0495643_0071276 Ga0495643_0071276_169_1797 542
872 3300046524 Ga0495648_0000308 Ga0495648_0000308_52617_54245 542
873 3300046524 Ga0495648_0002254 Ga0495648_0002254_90_1718 542
874 3300046530 Ga0495654_0002299 Ga0495654_0002299_3360_4988 542
875 3300046558 Ga0495633_0005773 Ga0495633_0005773_1691_3319 542
876 3300046692 Ga0495671_0000034 Ga0495671_0000034_179604_181232 542
877 3300047317 Ga0495604_0005557 Ga0495604_0005557_2728_4356 542
878 3300047469 Ga0495673_0000013 Ga0495673_0000013_252305_253933 542
879 3300047470 Ga0495681_0000008 Ga0495681_0000008_112282_113910 542
880 3300048913 Ga0496110_0001911 Ga0496110_0001911_7036_8664 542
881 3300048915 Ga0496112_0007768 Ga0496112_0007768_2038_3666 542
882 3300048920 Ga0496117_0074251 Ga0496117_0074251_626_2254 542
883 3300048921 Ga0496118_0007823 Ga0496118_0007823_7296_8924 542
884 3300048922 Ga0496119_0090993 Ga0496119_0090993_62_1690 542
885 3300048924 Ga0496121_0000003 Ga0496121_0000003_996538_998166 542
886 3300048924 Ga0496121_0055972 Ga0496121_0055972_1127_2755 542
887 3300048924 Ga0496121_0057655 Ga0496121_0057655_946_2574 542
888 3300048924 Ga0496121_0098706 Ga0496121_0098706_101_1729 542
889 3300048925 Ga0496122_0005520 Ga0496122_0005520_6378_8006 542
890 3300048926 Ga0496123_0006646 Ga0496123_0006646_2030_3658 542
891 3300048926 Ga0496123_0038991 Ga0496123_0038991_1655_3283 542
892 3300048927 Ga0496124_0000413 Ga0496124_0000413_30940_32568 542
893 3300048927 Ga0496124_0036929 Ga0496124_0036929_2388_4016 542
894 3300048927 Ga0496124_0083363 Ga0496124_0083363_32_1660 542
895 3300048927 Ga0496124_0110200 Ga0496124_0110200_414_2042 542
896 3300048928 Ga0496125_0000345 Ga0496125_0000345_66035_67663 542
897 3300048928 Ga0496125_0000898 Ga0496125_0000898_7984_9612 542
898 3300048929 Ga0496126_0064254 Ga0496126_0064254_398_2026 542
899 3300048929 Ga0496126_0152560 Ga0496126_0152560_269_1897 542
900 3300049568 Ga0501031_0008271 Ga0501031_0008271_3958_5586 542
901 3300049569 Ga0501032_0000008 Ga0501032_0000008_48502_50130 542
902 3300049569 Ga0501032_0000156 Ga0501032_0000156_33159_34787 542
903 3300049569 Ga0501032_0018295 Ga0501032_0018295_2349_3977 542
904 3300049570 Ga0501033_0000012 Ga0501033_0000012_191494_193122 542
905 3300049570 Ga0501033_0000423 Ga0501033_0000423_5631_7259 542
906 3300049570 Ga0501033_0000967 Ga0501033_0000967_17135_18763 542
907 3300049570 Ga0501033_0017829 Ga0501033_0017829_2113_3741 542
908 3300049570 Ga0501033_0040138 Ga0501033_0040138_934_2562 542
909 3300049571 Ga0501034_0000035 Ga0501034_0000035_191494_193122 542
910 3300049571 Ga0501034_0000087 Ga0501034_0000087_20630_22258 542
911 3300049571 Ga0501034_0005300 Ga0501034_0005300_10352_11980 542
912 3300049571 Ga0501034_0072305 Ga0501034_0072305_1815_3443 542
913 3300049572 Ga0501036_0000006 Ga0501036_0000006_191494_193122 542
914 3300049572 Ga0501036_0000885 Ga0501036_0000885_2475_4103 542
915 3300049573 Ga0501037_0000014 Ga0501037_0000014_148777_150405 542
916 3300049573 Ga0501037_0000072 Ga0501037_0000072_48502_50130 542
917 3300049573 Ga0501037_0000386 Ga0501037_0000386_27171_28799 542
918 3300049574 Ga0501038_0000007 Ga0501038_0000007_48502_50130 542
919 3300049574 Ga0501038_0000023 Ga0501038_0000023_129219_130847 542
920 3300049575 Ga0501039_0000012 Ga0501039_0000012_191494_193122 542
921 3300049575 Ga0501039_0000101 Ga0501039_0000101_20614_22242 542
922 3300049579 Ga0501043_0000022 Ga0501043_0000022_67047_68675 542
923 3300049579 Ga0501043_0000194 Ga0501043_0000194_20614_22242 542
924 3300049579 Ga0501043_0000211 Ga0501043_0000211_48502_50130 542
925 3300049579 Ga0501043_0025797 Ga0501043_0025797_1938_3566 542
926 3300049580 Ga0501046_0006281 Ga0501046_0006281_6724_8352 542
927 3300049581 Ga0501047_0012399 Ga0501047_0012399_3533_5161 542
928 3300049581 Ga0501047_0013458 Ga0501047_0013458_5958_7586 542
929 3300049581 Ga0501047_0108091 Ga0501047_0108091_998_2626 542
930 3300049583 Ga0501067_0001395 Ga0501067_0001395_1705_3333 542
931 3300049584 Ga0501068_0029719 Ga0501068_0029719_1494_3122 542
932 3300049585 Ga0501069_0000035 Ga0501069_0000035_67029_68657 542
933 3300049585 Ga0501069_0007570 Ga0501069_0007570_217_1845 542
934 3300049585 Ga0501069_0019293 Ga0501069_0019293_64_1692 542
935 3300049586 Ga0501070_0000103 Ga0501070_0000103_13803_15431 542
936 3300049586 Ga0501070_0004303 Ga0501070_0004303_7661_9289 542
937 3300049586 Ga0501070_0019274 Ga0501070_0019274_1608_3236 542
938 3300049586 Ga0501070_0021642 Ga0501070_0021642_1598_3226 542
939 3300049586 Ga0501070_0028028 Ga0501070_0028028_2259_3887 542
940 3300049586 Ga0501070_0097608 Ga0501070_0097608_462_2090 542
941 3300049587 Ga0501071_0007568 Ga0501071_0007568_2513_4141 542
942 3300049589 Ga0501073_0087934 Ga0501073_0087934_48_1676 542
943 3300049590 Ga0501074_0000530 Ga0501074_0000530_19531_21159 542
944 3300049705 Ga0501225_0000041 Ga0501225_0000041_5565_7193 542
945 3300049742 Ga0501080_0002529 Ga0501080_0002529_12946_14574 542
946 3300049742 Ga0501080_0059072 Ga0501080_0059072_1904_3532 542
947 3300049742 Ga0501080_0110528 Ga0501080_0110528_764_2392 542
948 3300049744 Ga0501083_0001316 Ga0501083_0001316_9871_11499 542
949 3300049822 Ga0501035_0000035 Ga0501035_0000035_116787_118415 542
950 3300049822 Ga0501035_0000139 Ga0501035_0000139_19648_21276 542
951 3300049822 Ga0501035_0003975 Ga0501035_0003975_8298_9926 542
952 3300049822 Ga0501035_0005080 Ga0501035_0005080_8302_9930 542
953 3300049822 Ga0501035_0007697 Ga0501035_0007697_5001_6629 542
954 3300049822 Ga0501035_0020763 Ga0501035_0020763_2882_4510 542
955 3300049822 Ga0501035_0021403 Ga0501035_0021403_933_2561 542
956 3300049822 Ga0501035_0098783 Ga0501035_0098783_693_2321 542
957 3300049823 Ga0501044_0000015 Ga0501044_0000015_48502_50130 542
958 3300049823 Ga0501044_0000578 Ga0501044_0000578_15639_17267 542
959 3300049823 Ga0501044_0025845 Ga0501044_0025845_2423_4051 542
960 3300049823 Ga0501044_0054117 Ga0501044_0054117_350_1978 542
961 3300050489 nmdc:mga03683_17874_c1 nmdc:mga03683_17874_c1_162_1790 542
962 3300050492 nmdc:mga0yw44_215_c1 nmdc:mga0yw44_215_c1_17383_19011 542
963 3300050494 nmdc:mga06z11_50_c1 nmdc:mga06z11_50_c1_23593_25221 542
964 3300050495 nmdc:mga04h51_64_c1 nmdc:mga04h51_64_c1_8152_9780 542
965 3300050516 nmdc:mga0sz30_2883_c1 nmdc:mga0sz30_2883_c1_789_2417 542
966 3300053091 Ga0500647_0048447 Ga0500647_0048447_126_1754 542
967 3300053140 Ga0500573_0001779 Ga0500573_0001779_6745_8373 542
968 3300053156 Ga0500622_0000286 Ga0500622_0000286_36415_38043 542
969 3300053157 Ga0500624_000052 Ga0500624_000052_56699_58327 542
970 3300053161 Ga0500634_0008242 Ga0500634_0008242_1668_3296 542
971 3300053729 Ga0500625_000002 Ga0500625_000002_327232_328860 542
972 3300054114 Ga0501084_0105017 Ga0501084_0105017_292_1920 542
973 3300059505 Ga0587083_0000805 Ga0587083_0000805_553_2181 542
974 3300059605 Ga0587106_001679 Ga0587106_001679_25_1653 542
975 3300059652 Ga0587107_001384 Ga0587107_001384_61_1689 542
976 3300060344 Ga0587071_004023 Ga0587071_004023_222_1850 542
977 3300060353 Ga0501082_0027147 Ga0501082_0027147_1516_3144 542
978 3300002076 JGI24749J21850_1000140 JGI24749J21850_10001402 543
979 3300002459 JGI24751J29686_10000002 JGI24751J29686_10000002114 543
980 3300003187 JGI25151J46595_10002604 JGI25151J46595_100026042 543
981 3300005289 Ga0065704_10072336 Ga0065704_100723364 543
982 3300005295 Ga0065707_10082484 Ga0065707_100824843 543
983 3300005327 Ga0070658_10049911 Ga0070658_100499112 543
984 3300005327 Ga0070658_10053212 Ga0070658_100532122 543
985 3300005331 Ga0070670_100000012 Ga0070670_10000001286 543
986 3300005339 Ga0070660_100005401 Ga0070660_1000054015 543
987 3300005344 Ga0070661_100015071 Ga0070661_1000150712 543
988 3300005344 Ga0070661_100021909 Ga0070661_1000219093 543
989 3300005344 Ga0070661_100077814 Ga0070661_1000778142 543
990 3300005347 Ga0070668_100000004 Ga0070668_10000000418 543
991 3300005347 Ga0070668_100061855 Ga0070668_1000618551 543
992 3300005353 Ga0070669_100000041 Ga0070669_10000004122 543
993 3300005355 Ga0070671_100000441 Ga0070671_10000044119 543
994 3300005356 Ga0070674_100004462 Ga0070674_1000044625 543
995 3300005364 Ga0070673_100056587 Ga0070673_1000565872 543
996 3300005367 Ga0070667_100000037 Ga0070667_10000003716 543
997 3300005367 Ga0070667_100000045 Ga0070667_10000004571 543
998 3300005455 Ga0070663_100044009 Ga0070663_1000440092 543
999 3300005539 Ga0068853_100001387 Ga0068853_1000013875 543
1000 3300005548 Ga0070665_100007021 Ga0070665_1000070219 543
1001 3300005563 Ga0068855_100141062 Ga0068855_1001410622 543
1002 3300005578 Ga0068854_100008328 Ga0068854_1000083284 543
1003 3300005614 Ga0068856_100002980 Ga0068856_10000298012 543
1004 3300005616 Ga0068852_100000578 Ga0068852_1000005787 543
1005 3300005618 Ga0068864_100000010 Ga0068864_100000010182 543
1006 3300005618 Ga0068864_100014044 Ga0068864_1000140443 543
1007 3300005834 Ga0068851_10012961 Ga0068851_100129613 543
1008 3300005841 Ga0068863_100004471 Ga0068863_1000044718 543
1009 3300005841 Ga0068863_100019178 Ga0068863_1000191784 543
1010 3300005842 Ga0068858_100000466 Ga0068858_10000046617 543
1011 3300005843 Ga0068860_100000002 Ga0068860_100000002590 543
1012 3300005843 Ga0068860_100000073 Ga0068860_10000007370 543
1013 3300005843 Ga0068860_100052296 Ga0068860_1000522962 543
1014 3300005844 Ga0068862_100000016 Ga0068862_10000001676 543
1015 3300005844 Ga0068862_100001423 Ga0068862_10000142319 543
1016 3300006051 Ga0075364_10042907 Ga0075364_100429072 543
1017 3300006051 Ga0075364_10110367 Ga0075364_101103671 543
1018 3300009093 Ga0105240_10002579 Ga0105240_100025798 543
1019 3300009093 Ga0105240_10003889 Ga0105240_100038893 543
1020 3300009093 Ga0105240_10202318 Ga0105240_102023182 543
1021 3300009177 Ga0105248_10000053 Ga0105248_1000005328 543
1022 3300009545 Ga0105237_10000333 Ga0105237_1000033363 543
1023 3300009545 Ga0105237_10027612 Ga0105237_100276121 543
1024 3300009551 Ga0105238_10015775 Ga0105238_100157756 543
1025 3300009553 Ga0105249_10116183 Ga0105249_101161832 543
1026 3300010375 Ga0105239_10000366 Ga0105239_1000036641 543
1027 3300010375 Ga0105239_10047006 Ga0105239_100470063 543
1028 3300013102 Ga0157371_10014027 Ga0157371_100140274 543
1029 3300013104 Ga0157370_10007830 Ga0157370_100078303 543
1030 3300013104 Ga0157370_10024754 Ga0157370_100247542 543
1031 3300013105 Ga0157369_10002685 Ga0157369_100026858 543
1032 3300014326 Ga0157380_10000134 Ga0157380_100001345 543
1033 3300014968 Ga0157379_10043295 Ga0157379_100432953 543
1034 3300025231 Ga0207427_102362 Ga0207427_1023622 543
1035 3300025261 Ga0209233_1000480 Ga0209233_10004805 543
1036 3300025294 Ga0209025_1000052 Ga0209025_1000052159 543
1037 3300025909 Ga0207705_10000004 Ga0207705_1000000413 543
1038 3300025909 Ga0207705_10001504 Ga0207705_100015042 543
1039 3300025913 Ga0207695_10016374 Ga0207695_100163746 543
1040 3300025913 Ga0207695_10026378 Ga0207695_100263782 543
1041 3300025913 Ga0207695_10044625 Ga0207695_100446252 543
1042 3300025914 Ga0207671_10000361 Ga0207671_1000036134 543
1043 3300025914 Ga0207671_10010693 Ga0207671_100106933 543
1044 3300025919 Ga0207657_10011321 Ga0207657_100113215 543
1045 3300025919 Ga0207657_10015965 Ga0207657_100159653 543
1046 3300025920 Ga0207649_10067406 Ga0207649_100674062 543
1047 3300025923 Ga0207681_10000013 Ga0207681_10000013168 543
1048 3300025924 Ga0207694_10016708 Ga0207694_100167084 543
1049 3300025925 Ga0207650_10000008 Ga0207650_10000008249 543
1050 3300025925 Ga0207650_10001003 Ga0207650_1000100314 543
1051 3300025931 Ga0207644_10000424 Ga0207644_1000042419 543
1052 3300025941 Ga0207711_10006215 Ga0207711_100062154 543
1053 3300025949 Ga0207667_10003331 Ga0207667_1000333112 543
1054 3300025949 Ga0207667_10012071 Ga0207667_100120715 543
1055 3300025949 Ga0207667_10116595 Ga0207667_101165952 543
1056 3300025972 Ga0207668_10000122 Ga0207668_1000012219 543
1057 3300025981 Ga0207640_10004035 Ga0207640_100040355 543
1058 3300025981 Ga0207640_10005794 Ga0207640_100057943 543
1059 3300025981 Ga0207640_10031937 Ga0207640_100319372 543
1060 3300025986 Ga0207658_10000002 Ga0207658_10000002873 543
1061 3300025986 Ga0207658_10000025 Ga0207658_1000002590 543
1062 3300025986 Ga0207658_10008204 Ga0207658_100082042 543
1063 3300026035 Ga0207703_10002501 Ga0207703_1000250117 543
1064 3300026035 Ga0207703_10009799 Ga0207703_100097992 543
1065 3300026041 Ga0207639_10000752 Ga0207639_100007525 543
1066 3300026067 Ga0207678_10112879 Ga0207678_101128792 543
1067 3300026078 Ga0207702_10000774 Ga0207702_1000077411 543
1068 3300026078 Ga0207702_10001580 Ga0207702_1000158014 543
1069 3300026088 Ga0207641_10000557 Ga0207641_1000055717 543
1070 3300026088 Ga0207641_10010897 Ga0207641_100108974 543
1071 3300026095 Ga0207676_10000012 Ga0207676_10000012148 543
1072 3300026095 Ga0207676_10010193 Ga0207676_100101933 543
1073 3300026116 Ga0207674_10105739 Ga0207674_101057394 543
1074 3300026116 Ga0207674_10140549 Ga0207674_101405492 543
1075 3300026121 Ga0207683_10059378 Ga0207683_100593782 543
1076 3300026142 Ga0207698_10000431 Ga0207698_100004317 543
1077 3300028379 Ga0268266_10000086 Ga0268266_1000008668 543
1078 3300028379 Ga0268266_10037051 Ga0268266_100370512 543
1079 3300028380 Ga0268265_10000006 Ga0268265_10000006276 543
1080 3300028380 Ga0268265_10000849 Ga0268265_1000084914 543
1081 3300028381 Ga0268264_10000001 Ga0268264_100000011198 543
1082 3300028381 Ga0268264_10000120 Ga0268264_1000012085 543
1083 3300031239 Ga0265328_10000449 Ga0265328_100004499 543
1084 3300031250 Ga0265331_10000109 Ga0265331_1000010913 543
1085 3300031251 Ga0265327_10000243 Ga0265327_1000024384 543
1086 3300031251 Ga0265327_10003763 Ga0265327_1000376311 543
1087 3300031507 Ga0307509_10043922 Ga0307509_100439222 543
1088 3300031911 Ga0307412_10001365 Ga0307412_100013656 543
1089 3300037312 Ga0395899_0114177 Ga0395899_0114177_103_1734 543
1090 3300037418 Ga0395900_0021967 Ga0395900_0021967_4560_6191 543
1091 3300042876 Ga0451577_0037775 Ga0451577_0037775_2528_4177 543
1092 3300044659 Ga0466973_0080647 Ga0466973_0080647_1118_2749 543
1093 3300044712 Ga0453684_0000006 Ga0453684_0000006_1248009_1249658 543
1094 3300044712 Ga0453684_0000048 Ga0453684_0000048_204210_205859 543
1095 3300044901 Ga0466960_0034799 Ga0466960_0034799_135_1766 543
1096 3300045051 Ga0451576_0000227 Ga0451576_0000227_76872_78515 543
1097 3300046455 Ga0495603_0007661 Ga0495603_0007661_2330_3961 543
1098 3300046459 Ga0495629_0002307 Ga0495629_0002307_3959_5590 543
1099 3300046471 Ga0495650_0003413 Ga0495650_0003413_6301_7932 543
1100 3300046471 Ga0495650_0003566 Ga0495650_0003566_1666_3297 543
1101 3300046472 Ga0495580_0033496 Ga0495580_0033496_1320_2951 543
1102 3300046473 Ga0495582_0004524 Ga0495582_0004524_1132_2763 543
1103 3300046475 Ga0495639_0009534 Ga0495639_0009534_227_1858 543
1104 3300046506 Ga0495583_0019645 Ga0495583_0019645_315_1946 543
1105 3300046517 Ga0495630_0056174 Ga0495630_0056174_659_2290 543
1106 3300046528 Ga0495642_0001260 Ga0495642_0001260_1726_3357 543
1107 3300046535 Ga0495586_0014478 Ga0495586_0014478_1053_2684 543
1108 3300046543 Ga0495645_0001395 Ga0495645_0001395_6275_7906 543
1109 3300046689 Ga0495613_0015634 Ga0495613_0015634_1554_3185 543
1110 3300046794 Ga0495589_0003359 Ga0495589_0003359_749_2380 543
1111 3300047318 Ga0495636_0026358 Ga0495636_0026358_650_2281 543
1112 3300047444 Ga0495675_0038110 Ga0495675_0038110_1358_2989 543
1113 3300047470 Ga0495681_0000057 Ga0495681_0000057_36830_38461 543
1114 3300047673 Ga0495593_0012920 Ga0495593_0012920_420_2051 543
1115 3300048904 Ga0496101_0027661 Ga0496101_0027661_371_2002 543
1116 3300048905 Ga0496102_0000088 Ga0496102_0000088_93840_95471 543
1117 3300048905 Ga0496102_0114742 Ga0496102_0114742_629_2260 543
1118 3300048915 Ga0496112_0181812 Ga0496112_0181812_154_1785 543
1119 3300048916 Ga0496113_0000241 Ga0496113_0000241_2450_4081 543
1120 3300048917 Ga0496114_0015662 Ga0496114_0015662_2142_3773 543
1121 3300048919 Ga0496116_0000097 Ga0496116_0000097_78127_79758 543
1122 3300048920 Ga0496117_0002381 Ga0496117_0002381_2652_4283 543
1123 3300048921 Ga0496118_0062082 Ga0496118_0062082_1115_2746 543
1124 3300048925 Ga0496122_0000024 Ga0496122_0000024_201900_203531 543
1125 3300048925 Ga0496122_0003171 Ga0496122_0003171_2081_3712 543
1126 3300048926 Ga0496123_0000086 Ga0496123_0000086_125499_127130 543
1127 3300048927 Ga0496124_0021788 Ga0496124_0021788_2875_4506 543
1128 3300048928 Ga0496125_0000651 Ga0496125_0000651_48555_50186 543
1129 3300048929 Ga0496126_0000119 Ga0496126_0000119_103339_104970 543
1130 3300048929 Ga0496126_0001430 Ga0496126_0001430_5554_7185 543
1131 3300049569 Ga0501032_0025815 Ga0501032_0025815_1373_3004 543
1132 3300049571 Ga0501034_0001581 Ga0501034_0001581_4891_6525 543
1133 3300049571 Ga0501034_0084264 Ga0501034_0084264_1089_2720 543
1134 3300049571 Ga0501034_0162278 Ga0501034_0162278_68_1699 543
1135 3300049572 Ga0501036_0119520 Ga0501036_0119520_336_1967 543
1136 3300049581 Ga0501047_0001346 Ga0501047_0001346_25_1656 543
1137 3300049586 Ga0501070_0017416 Ga0501070_0017416_1919_3550 543
1138 3300053111 Ga0500572_001775 Ga0500572_001775_3332_4963 543
1139 3300053151 Ga0500604_0000133 Ga0500604_0000133_3880_5514 543
1140 3300053153 Ga0500616_0022258 Ga0500616_0022258_1573_3204 543
1141 3300053161 Ga0500634_0000053 Ga0500634_0000053_43944_45578 543
1142 3300053161 Ga0500634_0047382 Ga0500634_0047382_66_1700 543
1143 3300053177 Ga0500636_0000005 Ga0500636_0000005_101049_102680 543
1144 2162886007 SwRhRL2b_contig_3683601 SwRhRL2b_0247.00001430 544
1145 3300005262 Ga0065165_1002742 Ga0065165_10027423 544
1146 3300005289 Ga0065704_10079957 Ga0065704_100799573 544
1147 3300005353 Ga0070669_100030363 Ga0070669_1000303632 544
1148 3300005466 Ga0070685_10021466 Ga0070685_100214663 544
1149 3300005548 Ga0070665_100047835 Ga0070665_1000478353 544
1150 3300009978 Ga0105148_100007 Ga0105148_1000076 544
1151 3300010375 Ga0105239_10000846 Ga0105239_1000084644 544
1152 3300014326 Ga0157380_10033757 Ga0157380_100337574 544
1153 3300025229 Ga0209147_100518 Ga0209147_10051817 544
1154 3300028379 Ga0268266_10104148 Ga0268266_101041482 544
1155 3300028577 Ga0265318_10004967 Ga0265318_100049674 544
1156 3300031241 Ga0265325_10021265 Ga0265325_100212653 544
1157 3300031247 Ga0265340_10011383 Ga0265340_100113832 544
1158 3300031249 Ga0265339_10026323 Ga0265339_100263232 544
1159 3300031344 Ga0265316_10060140 Ga0265316_100601402 544
1160 3300031595 Ga0265313_10013224 Ga0265313_100132243 544
1161 3300031712 Ga0265342_10015557 Ga0265342_100155572 544
1162 3300037418 Ga0395900_0062551 Ga0395900_0062551_1634_3304 544
1163 3300037466 Ga0395898_0022622 Ga0395898_0022622_2712_4382 544
1164 3300046519 Ga0495632_0000328 Ga0495632_0000328_24133_25812 544
1165 3300046520 Ga0495637_0006095 Ga0495637_0006095_2137_3816 544
1166 3300046522 Ga0495643_0000014 Ga0495643_0000014_292590_294269 544
1167 3300046525 Ga0495663_0000007 Ga0495663_0000007_240948_242627 544
1168 3300046558 Ga0495633_0000112 Ga0495633_0000112_58190_59884 544
1169 3300046558 Ga0495633_0000398 Ga0495633_0000398_19812_21491 544
1170 3300046558 Ga0495633_0047331 Ga0495633_0047331_78_1781 544
1171 3300046674 Ga0495588_0001064 Ga0495588_0001064_1906_3609 544
1172 3300046692 Ga0495671_0000032 Ga0495671_0000032_179143_180822 544
1173 3300047323 Ga0495683_0019282 Ga0495683_0019282_684_2333 544
1174 3300047470 Ga0495681_0049280 Ga0495681_0049280_115_1794 544
1175 3300047472 Ga0495686_0001495 Ga0495686_0001495_23555_25225 544
1176 3300048907 Ga0496104_0099974 Ga0496104_0099974_952_2601 544
1177 3300048911 Ga0496108_0019437 Ga0496108_0019437_2056_3690 544
1178 3300048913 Ga0496110_0090111 Ga0496110_0090111_383_2017 544
1179 3300048920 Ga0496117_0000066 Ga0496117_0000066_109927_111630 544
1180 3300048921 Ga0496118_0003408 Ga0496118_0003408_9556_11259 544
1181 3300048922 Ga0496119_0005553 Ga0496119_0005553_4502_6190 544
1182 3300048924 Ga0496121_0000682 Ga0496121_0000682_50105_51739 544
1183 3300048924 Ga0496121_0008021 Ga0496121_0008021_1906_3540 544
1184 3300048925 Ga0496122_0000057 Ga0496122_0000057_141820_143523 544
1185 3300048925 Ga0496122_0000107 Ga0496122_0000107_37328_38962 544
1186 3300048926 Ga0496123_0000063 Ga0496123_0000063_154147_155781 544
1187 3300048926 Ga0496123_0000096 Ga0496123_0000096_30392_32095 544
1188 3300048927 Ga0496124_0006506 Ga0496124_0006506_6541_8244 544
1189 3300048927 Ga0496124_0095267 Ga0496124_0095267_765_2399 544
1190 3300049705 Ga0501225_0002520 Ga0501225_0002520_1127_2761 544
1191 3300050491 nmdc:mga00v17_186_c2 nmdc:mga00v17_186_c2_22394_24028 544
1192 3300050491 nmdc:mga00v17_59_c2 nmdc:mga00v17_59_c2_12899_14602 544
1193 3300050493 nmdc:mga0k408_53436_c1 nmdc:mga0k408_53436_c1_65_1768 544
1194 3300053137 Ga0500561_0000021 Ga0500561_0000021_29399_31102 544
1195 3300053153 Ga0500616_0000709 Ga0500616_0000709_3446_5080 544
1196 3300053157 Ga0500624_000444 Ga0500624_000444_1851_3554 544
1197 iso_pu_bacteria 2512564014 2512643596 544
1198 iso_pu_bacteria 2600254933 2600373650 544
1199 iso_pu_bacteria 2758568016 2758640629 544
1200 iso_pu_bacteria 3002141150 3002142224 544
1201 iso_pu_bacteria 643692032 643827088 544

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02880

PGM_PMM_III

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III

217

330

0.9

PF02878

PGM_PMM_I

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I

2

76

0.88

PF02879

PGM_PMM_II

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II

105

212

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vg7-assembly1.cif.gz_A crystal structure of the r503q missense variant of human pgm1 0.9771 4 544
5vg7-assembly2.cif.gz_B crystal structure of the r503q missense variant of human pgm1 0.9771 2 544
1c47-assembly1.cif.gz_B binding driven structural changes in crystaline phosphoglucomutase associated with chemical reaction 0.9761 4 544
5vbi-assembly2.cif.gz_B crystal structure of the r515w missense variant of human pgm1 0.9751 1 544
5vec-assembly2.cif.gz_B crystal structure of the r515l missense variant of human pgm1 0.9747 4 544
ID Description Score Start End Superfamily
5vinB03 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9845 292 388 3.40.120.10
af_A0A1D6GJ73_72_271_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9586 3 188 3.40.120.10
1kfqA01 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9583 4 188 3.40.120.10
af_P33401_4_197_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9546 4 188 3.40.120.10
4qg5B03 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9523 295 406 3.40.120.10
ID Description Score Start End GO Terms
AF-A0A1Q3JFL8-F1-model_v4 deleted 0.9983 4 178
AF-A0A529LXX2-F1-model_v4 Alpha-D-glucose phosphate-specific phosphoglucomutase 0.998 260 405 GO:0004614
GO:0005829
GO:0005975
AF-A0A6P0XT78-F1-model_v4 Alpha-D-glucose phosphate-specific phosphoglucomutase 0.9973 5 129 GO:0000287
GO:0004614
GO:0005829
GO:0005975
AF-A0A531AJ32-F1-model_v4 phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent) (EC 5.4.2.2) 0.9966 4 286 GO:0000287
GO:0004614
GO:0005829
GO:0005975
AF-A0A4Q3HT85-F1-model_v4 phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent) (EC 5.4.2.2) 0.9959 4 379 GO:0000287
GO:0004614
GO:0005829
GO:0005975

Feature Viewer

pLDDT pTM Quality
95.46 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map