F491600
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1201 | 948 | 532 | 540 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2510461069|2510842912 |
| Length | 466 |
| Sequence | FGKVLVGQGGILSTPAASHVIRKYKAFGGIVLSASHNPGGPTEDFGIKYNIGNGGPAPEKITDAIYARSKVIDTYKTVNAADIDLDKVGTFELAGMKVAVIDPVADYAELMESLFDFNAIRNMFGLGFRMVFDAMSAVTGPYAKDIIEGRLGAPEGTVRNFIPLPDFGGHHPDPNLVHAKDLYDEMMSGAGAPDFGAASDGDGDRNLIIGKGIFVTPSDSLAILAANAHLAPGYSGGIAGIARSMPTSAAADRVAEKLGIGIYETPTGWKFFGNLLDAGKVTICGEESAGTGSSHVREKDGLWAVLLWLNILAVRGESVSDIVHQHWATYGRNYYSRHDYEGVDTERANGLVAMLRDKLATLPGTKVGDLTVAAADDFSYHDPVDHSVSNNQGIRILFEGGSRVVFRLSGTGTSGATLRVYIERYEPDASRHDIETQAALADLIAAAETLAEIKSRTAFDEPTVIT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 3 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 7 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 8 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 9 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 10 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 11 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 12 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 13 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 14 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 15 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 16 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 17 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 18 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 19 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 20 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 21 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 22 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 23 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 24 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 25 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 26 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 27 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 28 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 29 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 30 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 31 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 32 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 33 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 34 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 35 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 36 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 37 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 38 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 39 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 40 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 41 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 42 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 43 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 44 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 45 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 46 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 47 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 48 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 49 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 50 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 51 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 52 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 53 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 54 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 55 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 56 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 57 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 58 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 59 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 60 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 61 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 62 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 63 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 64 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 65 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 66 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 67 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 68 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 69 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 70 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 71 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 72 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 73 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 74 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 75 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 76 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 77 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 78 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 79 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 80 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 81 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 82 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 83 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 84 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 85 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 86 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 87 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 88 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 89 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 90 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 91 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 92 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 93 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 94 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 95 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 96 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 97 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 98 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 99 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 100 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 101 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 102 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 103 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 104 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 105 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 106 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 107 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 108 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 109 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 110 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 111 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 112 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 113 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 114 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 115 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 116 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 117 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 118 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 119 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 120 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 121 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 122 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 123 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 124 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 125 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 126 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 127 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 128 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 129 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 130 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 131 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 132 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 133 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 134 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 135 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 136 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 137 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 138 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 139 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 140 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 141 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 142 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 143 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 144 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 145 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 146 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 147 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 148 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 149 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 150 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 151 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 152 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 153 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 154 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 155 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 156 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 157 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 158 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 159 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 160 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 161 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 162 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 163 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 164 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 165 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 166 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 167 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 168 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 169 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 170 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 171 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 172 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 173 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 174 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 175 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 176 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 177 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 178 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 179 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 180 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 181 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 182 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 183 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 184 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 185 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 186 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 187 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 188 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 189 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 190 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 191 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 192 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 193 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 194 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 195 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 196 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 197 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 198 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 199 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 200 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 201 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 202 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 203 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 204 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 205 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 206 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 207 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 208 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 209 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 210 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 211 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 212 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 213 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 214 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 215 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 216 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 217 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 218 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 219 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 220 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 221 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 222 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 223 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 224 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 225 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 226 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 227 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 228 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 229 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 230 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 231 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 232 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 233 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 234 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 235 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 236 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 237 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 238 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 239 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 240 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 241 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 242 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 243 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 244 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 245 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 246 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 247 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 248 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 249 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 250 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 251 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 252 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 253 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 254 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 255 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 256 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 257 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 258 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 259 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 260 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 261 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 262 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 263 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 264 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 265 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 266 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 267 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 268 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 269 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 270 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 271 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 272 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 273 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 274 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 275 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 276 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 277 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 278 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 279 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 280 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 281 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 282 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 283 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 284 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 285 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 286 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 287 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 288 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 289 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 290 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 291 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 292 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 293 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 294 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 295 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 296 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 297 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 298 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 299 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 300 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 301 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 302 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 303 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 304 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 305 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 306 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 307 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 308 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 309 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 310 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 311 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 312 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 313 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 314 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 315 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 316 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 317 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 318 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 319 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 320 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 321 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 322 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 323 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 324 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 325 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 326 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 327 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 328 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 329 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 330 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 331 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 332 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 333 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 334 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 335 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 336 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 337 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 338 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 339 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 340 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 341 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 342 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 343 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 344 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 345 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 346 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 347 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 348 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 349 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 350 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 351 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 352 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 353 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 354 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 355 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 356 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 357 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 358 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 359 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 360 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 361 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 362 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 363 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 364 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 365 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 366 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 367 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 368 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 369 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 370 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 371 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 372 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 373 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 374 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 375 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 376 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 377 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 378 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 379 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 380 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 381 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 382 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 383 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 384 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 385 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 386 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 387 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 388 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 389 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 390 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 391 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 392 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 393 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 394 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 395 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 396 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 397 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 398 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 399 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 400 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 401 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 402 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 403 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 404 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 405 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 406 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 407 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 408 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 409 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 410 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 411 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 412 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 413 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 414 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 415 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 416 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 417 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 418 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 419 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 420 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 421 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 422 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 423 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 424 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 425 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 426 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 427 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 428 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 429 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 430 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 431 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 432 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 433 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 434 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 435 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 436 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 437 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 438 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 439 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 440 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 441 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 442 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 443 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 444 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 445 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 446 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 447 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 448 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 449 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 450 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 451 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 452 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 453 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 454 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 455 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 456 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 457 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 458 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 459 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 460 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 461 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 462 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 463 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 464 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 465 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 466 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 467 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 468 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 469 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 470 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 471 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 472 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 473 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 474 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 475 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 476 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 477 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 478 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 479 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 480 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 481 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 482 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 483 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 484 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 485 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 486 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 487 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 488 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 489 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 490 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 491 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 492 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 493 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 494 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 495 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 496 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 497 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 498 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 499 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 500 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 501 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 502 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 503 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 504 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 505 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 506 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 507 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 508 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 509 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 510 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 511 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 512 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 513 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 514 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 515 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 516 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 517 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 518 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 519 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 520 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 521 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 522 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 523 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 524 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 525 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 526 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 527 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 528 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 529 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 530 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 531 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 532 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 533 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 534 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 535 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 536 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 537 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 538 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 539 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 540 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 541 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 542 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 543 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 544 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 545 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 546 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 547 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 548 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 549 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 550 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 551 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 552 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 553 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 554 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 555 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 556 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 557 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 558 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 559 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 560 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 561 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 562 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 563 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 564 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 565 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 566 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 567 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 568 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 569 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 570 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 571 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 572 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 573 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 574 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 575 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 576 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 577 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 578 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 579 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 580 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 581 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 582 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 583 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 584 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 585 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 586 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 587 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 588 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 589 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 590 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 591 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 592 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 593 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 594 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 595 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 596 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 597 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 598 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 599 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 600 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 601 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 602 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 603 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 604 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 605 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 606 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 607 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 608 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 609 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 610 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 611 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 612 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 613 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 614 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 615 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 616 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 617 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 618 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 619 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 620 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 621 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 622 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 623 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 624 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 625 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 626 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 627 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 628 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 629 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 630 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 631 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 632 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 633 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 634 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 635 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 636 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 637 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 638 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 639 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 640 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 641 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 642 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 643 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 644 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 645 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 646 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 647 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 648 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 649 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 650 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 651 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 652 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 653 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 654 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 655 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 656 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 657 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 658 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 659 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 660 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 661 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 662 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 663 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 664 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 665 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 666 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 667 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 668 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 669 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 670 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 671 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 672 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 673 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 674 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 675 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 676 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 677 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 678 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 679 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 680 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 681 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 682 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 683 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 684 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 685 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 686 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 687 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 688 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 689 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 690 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 691 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 692 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 693 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 694 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 695 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 696 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 697 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 698 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 699 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 700 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 701 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 702 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 703 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 704 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 705 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 706 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 707 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 708 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 709 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 710 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 711 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 712 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 713 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 714 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 715 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 716 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 717 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 718 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 719 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 720 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 721 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 722 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 723 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 724 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 725 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 726 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 727 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 728 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 729 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 730 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 731 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 732 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 733 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 734 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 735 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 736 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 737 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 738 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 739 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 740 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 741 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 742 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 743 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 744 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 745 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 746 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 747 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 748 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 749 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 750 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 751 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 752 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 753 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 754 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 755 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 756 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 757 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 758 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 759 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 760 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 761 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 762 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 763 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 764 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 765 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 766 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 767 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 768 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 769 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 770 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 771 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 772 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 773 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 774 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 775 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 776 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 777 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 778 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 779 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 780 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 781 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 782 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 783 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 784 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 785 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 786 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 787 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 788 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 789 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 790 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 791 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 792 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 793 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 794 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 795 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 796 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 797 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 798 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 799 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 800 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 801 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 802 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 803 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 804 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 805 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 806 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 807 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 808 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 809 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 810 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 811 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 812 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 813 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 814 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 815 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 816 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 817 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 818 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 819 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 820 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 821 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 822 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 823 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 824 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 825 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 826 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 827 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 828 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 829 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 830 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 831 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 832 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 833 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 834 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 835 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 836 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 837 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 838 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 839 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 840 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 841 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 842 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 843 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 844 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 845 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 846 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 847 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 848 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 849 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 850 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 851 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 852 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 853 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 854 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 855 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 856 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 857 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 858 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 859 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 860 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 861 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 862 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 863 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 864 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 865 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 866 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 867 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 868 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 869 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 870 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 871 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 872 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 873 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 874 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 875 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 876 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 877 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 878 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 879 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 880 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 881 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 882 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 883 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 884 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 885 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 886 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 887 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 888 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 889 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 890 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 891 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 892 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 893 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 894 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 895 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 896 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 897 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 898 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 899 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 900 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 901 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 902 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 903 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 904 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 905 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 906 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 907 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 908 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 909 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 910 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 911 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 912 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 913 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 914 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 915 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 916 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 917 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 918 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 919 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 920 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 921 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 922 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 923 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 924 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 925 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 926 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 927 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 928 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 929 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 930 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 931 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 932 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 933 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 934 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 935 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 936 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 937 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 938 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 939 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 940 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 941 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 942 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 943 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 944 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 945 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 946 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 947 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 948 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 43.96 |
| Metatranscriptomes | 0.33 |
| Isolates | 55.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.42 |
| Bulb | 0 |
| Endosphere | 7.91 |
| Nodule | 40.72 |
| Rhizoplane | 1.92 |
| Rhizosphere | 32.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3683601 | 2162886007 | Bacteria | 6535 |
| 2 | JGI24741J21665_1001749 | 3300001915 | Bacteria | 5978 |
| 3 | JGI24740J21852_10016205 | 3300001979 | Bacteria | 2698 |
| 4 | JGI24739J22299_10001947 | 3300001989 | Bacteria | 7897 |
| 5 | JGI24735J21928_10003491 | 3300002067 | Bacteria | 5353 |
| 6 | JGI24749J21850_1000140 | 3300002076 | Bacteria | 11609 |
| 7 | JGI24751J29686_10000002 | 3300002459 | Bacteria | 160619 |
| 8 | JGI25155J39150_1000007 | 3300002704 | Bacteria | 238857 |
| 9 | JGI25155J39150_1000012 | 3300002704 | Bacteria | 199435 |
| 10 | JGI25156J39149_1000036 | 3300002705 | Bacteria | 110527 |
| 11 | JGI25162J39368_1000719 | 3300002737 | Bacteria | 22831 |
| 12 | JGI25162J39368_1002558 | 3300002737 | Bacteria | 6903 |
| 13 | JGI25154J39366_1000033 | 3300002738 | Bacteria | 184379 |
| 14 | JGI25158J39367_1001179 | 3300002739 | Bacteria | 4713 |
| 15 | JGI25157J39369_1000124 | 3300002741 | Bacteria | 65844 |
| 16 | JGI25159J45721_1000032 | 3300002987 | Bacteria | 90158 |
| 17 | JGI25159J45721_1000471 | 3300002987 | Bacteria | 18569 |
| 18 | JGI25151J46595_10002604 | 3300003187 | Bacteria | 10650 |
| 19 | JGI25406J46586_10008780 | 3300003203 | Bacteria | 4553 |
| 20 | JGI25165J46597_1000016 | 3300003214 | Bacteria | 377866 |
| 21 | JGI25165J46597_1000598 | 3300003214 | Bacteria | 30961 |
| 22 | JGI25165J46597_1001390 | 3300003214 | Bacteria | 13254 |
| 23 | JGI25160J50197_1000006 | 3300003354 | Bacteria | 316247 |
| 24 | JGI25160J50197_1000009 | 3300003354 | Bacteria | 282862 |
| 25 | JGI25161J50226_1000004 | 3300003374 | Bacteria | 316212 |
| 26 | JGI25161J50226_1000240 | 3300003374 | Bacteria | 32956 |
| 27 | Ga0055542_1000452 | 3300003762 | Bacteria | 38888 |
| 28 | Ga0055524_1001608 | 3300003775 | Bacteria | 12637 |
| 29 | Ga0055536_1000808 | 3300003781 | Bacteria | 20707 |
| 30 | Ga0055536_1000890 | 3300003781 | Bacteria | 19455 |
| 31 | Ga0055536_1007545 | 3300003781 | Bacteria | 4845 |
| 32 | Ga0055530_10010289 | 3300003791 | Bacteria | 3479 |
| 33 | Ga0055540_1000988 | 3300003792 | Bacteria | 18354 |
| 34 | Ga0055531_10010623 | 3300003794 | Bacteria | 4550 |
| 35 | Ga0058692_1001375 | 3300003856 | Bacteria | 9008 |
| 36 | Ga0058692_1001590 | 3300003856 | Bacteria | 8185 |
| 37 | Ga0055543_1000002 | 3300004625 | Bacteria | 390020 |
| 38 | Ga0055543_1000055 | 3300004625 | Bacteria | 103837 |
| 39 | Ga0065165_1000020 | 3300005262 | Bacteria | 265570 |
| 40 | Ga0065165_1000391 | 3300005262 | Bacteria | 71184 |
| 41 | Ga0065165_1002742 | 3300005262 | Bacteria | 14058 |
| 42 | Ga0065704_10072336 | 3300005289 | Bacteria | 8720 |
| 43 | Ga0065704_10079957 | 3300005289 | Bacteria | 4043 |
| 44 | Ga0065707_10082484 | 3300005295 | Bacteria | 14611 |
| 45 | Ga0070658_10043203 | 3300005327 | Bacteria | 3642 |
| 46 | Ga0070658_10049911 | 3300005327 | Bacteria | 3391 |
| 47 | Ga0070658_10053212 | 3300005327 | Bacteria | 3285 |
| 48 | Ga0070670_100000012 | 3300005331 | Bacteria | 256314 |
| 49 | Ga0070660_100005401 | 3300005339 | Bacteria | 8846 |
| 50 | Ga0070661_100015071 | 3300005344 | Bacteria | 5453 |
| 51 | Ga0070661_100021909 | 3300005344 | Bacteria | 4570 |
| 52 | Ga0070661_100077814 | 3300005344 | Bacteria | 2446 |
| 53 | Ga0070668_100000004 | 3300005347 | Bacteria | 189408 |
| 54 | Ga0070668_100061855 | 3300005347 | Bacteria | 2901 |
| 55 | Ga0070669_100000041 | 3300005353 | Bacteria | 127426 |
| 56 | Ga0070669_100030363 | 3300005353 | Bacteria | 3900 |
| 57 | Ga0070671_100000441 | 3300005355 | Bacteria | 28883 |
| 58 | Ga0070674_100004462 | 3300005356 | Bacteria | 7981 |
| 59 | Ga0070673_100056587 | 3300005364 | Bacteria | 3095 |
| 60 | Ga0070667_100000037 | 3300005367 | Bacteria | 172343 |
| 61 | Ga0070667_100000045 | 3300005367 | Bacteria | 164821 |
| 62 | Ga0070663_100044009 | 3300005455 | Bacteria | 3145 |
| 63 | Ga0070685_10021466 | 3300005466 | Bacteria | 3510 |
| 64 | Ga0070699_100080177 | 3300005518 | Bacteria | 2845 |
| 65 | Ga0068853_100001387 | 3300005539 | Bacteria | 17507 |
| 66 | Ga0068853_100010670 | 3300005539 | Bacteria | 7435 |
| 67 | Ga0070665_100004575 | 3300005548 | Bacteria | 14483 |
| 68 | Ga0070665_100007021 | 3300005548 | Bacteria | 11442 |
| 69 | Ga0070665_100037169 | 3300005548 | Bacteria | 4898 |
| 70 | Ga0070665_100047835 | 3300005548 | Bacteria | 4293 |
| 71 | Ga0068855_100141062 | 3300005563 | Bacteria | 2747 |
| 72 | Ga0068855_100169901 | 3300005563 | Bacteria | 2470 |
| 73 | Ga0068854_100008328 | 3300005578 | Bacteria | 6662 |
| 74 | Ga0068856_100002980 | 3300005614 | Bacteria | 17344 |
| 75 | Ga0068856_100033227 | 3300005614 | Bacteria | 5051 |
| 76 | Ga0068852_100000578 | 3300005616 | Bacteria | 24126 |
| 77 | Ga0068864_100000010 | 3300005618 | Bacteria | 358723 |
| 78 | Ga0068864_100014044 | 3300005618 | Bacteria | 6642 |
| 79 | Ga0068851_10007577 | 3300005834 | Bacteria | 4989 |
| 80 | Ga0068851_10012961 | 3300005834 | Bacteria | 3938 |
| 81 | Ga0068851_10014685 | 3300005834 | Bacteria | 3721 |
| 82 | Ga0068863_100004471 | 3300005841 | Bacteria | 13781 |
| 83 | Ga0068863_100019178 | 3300005841 | Bacteria | 6547 |
| 84 | Ga0068858_100000466 | 3300005842 | Bacteria | 42207 |
| 85 | Ga0068860_100000002 | 3300005843 | Bacteria | 627849 |
| 86 | Ga0068860_100000073 | 3300005843 | Bacteria | 173235 |
| 87 | Ga0068860_100052296 | 3300005843 | Bacteria | 3885 |
| 88 | Ga0068862_100000016 | 3300005844 | Bacteria | 250031 |
| 89 | Ga0068862_100000208 | 3300005844 | Bacteria | 65480 |
| 90 | Ga0068862_100001423 | 3300005844 | Bacteria | 22170 |
| 91 | Ga0081540_1004499 | 3300005983 | Bacteria | 10589 |
| 92 | Ga0081539_10003049 | 3300005985 | Bacteria | 21640 |
| 93 | Ga0075365_10014528 | 3300006038 | Bacteria | 4738 |
| 94 | Ga0075368_10000169 | 3300006042 | Bacteria | 17703 |
| 95 | Ga0075363_100003056 | 3300006048 | Bacteria | 7015 |
| 96 | Ga0075363_100017379 | 3300006048 | Bacteria | 3566 |
| 97 | Ga0075364_10000197 | 3300006051 | Bacteria | 27872 |
| 98 | Ga0075364_10042907 | 3300006051 | Bacteria | 2939 |
| 99 | Ga0075364_10110367 | 3300006051 | Bacteria | 1835 |
| 100 | Ga0075362_10001832 | 3300006177 | Bacteria | 6945 |
| 101 | Ga0075362_10022538 | 3300006177 | Bacteria | 2654 |
| 102 | Ga0075362_10035910 | 3300006177 | Bacteria | 2165 |
| 103 | Ga0075367_10002319 | 3300006178 | Bacteria | 8651 |
| 104 | Ga0075369_10011135 | 3300006186 | Bacteria | 3530 |
| 105 | Ga0075369_10014425 | 3300006186 | Bacteria | 3156 |
| 106 | Ga0075431_100004625 | 3300006847 | Bacteria | 13512 |
| 107 | Ga0079104_1000042 | 3300006946 | Bacteria | 185991 |
| 108 | Ga0079104_1001097 | 3300006946 | Bacteria | 20211 |
| 109 | Ga0079104_1007902 | 3300006946 | Bacteria | 3791 |
| 110 | Ga0099826_10001501 | 3300006948 | Bacteria | 14062 |
| 111 | Ga0099826_10012183 | 3300006948 | Bacteria | 6476 |
| 112 | Ga0105240_10000019 | 3300009093 | Bacteria | 406211 |
| 113 | Ga0105240_10002579 | 3300009093 | Bacteria | 29023 |
| 114 | Ga0105240_10003889 | 3300009093 | Bacteria | 23062 |
| 115 | Ga0105240_10202318 | 3300009093 | Bacteria | 2327 |
| 116 | Ga0105247_10023880 | 3300009101 | Bacteria | 3684 |
| 117 | Ga0114129_10009933 | 3300009147 | Bacteria | 13566 |
| 118 | Ga0105241_10159830 | 3300009174 | Bacteria | 1851 |
| 119 | Ga0105248_10000053 | 3300009177 | Bacteria | 143972 |
| 120 | Ga0105237_10000333 | 3300009545 | Bacteria | 66671 |
| 121 | Ga0105237_10001085 | 3300009545 | Bacteria | 36406 |
| 122 | Ga0105237_10027612 | 3300009545 | Bacteria | 5790 |
| 123 | Ga0105238_10015775 | 3300009551 | Bacteria | 7648 |
| 124 | Ga0105238_10040925 | 3300009551 | Bacteria | 4695 |
| 125 | Ga0105249_10000184 | 3300009553 | Bacteria | 71944 |
| 126 | Ga0105249_10116183 | 3300009553 | Bacteria | 2536 |
| 127 | Ga0105148_100007 | 3300009978 | Bacteria | 39454 |
| 128 | Ga0105239_10000366 | 3300010375 | Bacteria | 66301 |
| 129 | Ga0105239_10000846 | 3300010375 | Bacteria | 43563 |
| 130 | Ga0105239_10028356 | 3300010375 | Bacteria | 6159 |
| 131 | Ga0105239_10047006 | 3300010375 | Bacteria | 4729 |
| 132 | Ga0105239_10095033 | 3300010375 | Bacteria | 3293 |
| 133 | Ga0157373_10001083 | 3300013100 | Bacteria | 20976 |
| 134 | Ga0157373_10013052 | 3300013100 | Bacteria | 6097 |
| 135 | Ga0157371_10000219 | 3300013102 | Bacteria | 83847 |
| 136 | Ga0157371_10014027 | 3300013102 | Bacteria | 6064 |
| 137 | Ga0157370_10000037 | 3300013104 | Bacteria | 136803 |
| 138 | Ga0157370_10000824 | 3300013104 | Bacteria | 39223 |
| 139 | Ga0157370_10007830 | 3300013104 | Bacteria | 11578 |
| 140 | Ga0157370_10024754 | 3300013104 | Bacteria | 5943 |
| 141 | Ga0157369_10002685 | 3300013105 | Bacteria | 21230 |
| 142 | Ga0157369_10185724 | 3300013105 | Bacteria | 2186 |
| 143 | Ga0171463_1006 | 3300013249 | Bacteria | 336402 |
| 144 | Ga0157380_10000134 | 3300014326 | Bacteria | 41479 |
| 145 | Ga0157380_10033757 | 3300014326 | Bacteria | 3942 |
| 146 | Ga0157379_10043295 | 3300014968 | Bacteria | 4019 |
| 147 | Ga0182007_10000679 | 3300015262 | Bacteria | 19538 |
| 148 | Ga0183363_1195 | 3300015690 | Bacteria | 12763 |
| 149 | Ga0163161_10025315 | 3300017792 | Bacteria | 4199 |
| 150 | Ga0214544_1000063 | 3300021320 | Bacteria | 129929 |
| 151 | Ga0214542_1000095 | 3300021321 | Bacteria | 116012 |
| 152 | Ga0214543_1000008 | 3300021327 | Bacteria | 385680 |
| 153 | Ga0214543_1000026 | 3300021327 | Bacteria | 220652 |
| 154 | Ga0228711_1000003 | 3300022739 | Bacteria | 258118 |
| 155 | Ga0228710_1000003 | 3300022740 | Bacteria | 262981 |
| 156 | Ga0209435_100005 | 3300025206 | Bacteria | 573745 |
| 157 | Ga0209147_100518 | 3300025229 | Bacteria | 22374 |
| 158 | Ga0207427_102362 | 3300025231 | Bacteria | 5164 |
| 159 | Ga0209437_100078 | 3300025233 | Bacteria | 278088 |
| 160 | Ga0209437_100291 | 3300025233 | Bacteria | 72764 |
| 161 | Ga0209646_1000011 | 3300025246 | Bacteria | 573745 |
| 162 | Ga0209646_1003337 | 3300025246 | Bacteria | 3197 |
| 163 | Ga0209026_1000008 | 3300025250 | Bacteria | 573745 |
| 164 | Ga0209677_103659 | 3300025253 | Bacteria | 4839 |
| 165 | Ga0209148_1000056 | 3300025254 | Bacteria | 363380 |
| 166 | Ga0209759_1000004 | 3300025256 | Bacteria | 573745 |
| 167 | Ga0209233_1000068 | 3300025261 | Bacteria | 377969 |
| 168 | Ga0209233_1000157 | 3300025261 | Bacteria | 164269 |
| 169 | Ga0209233_1000192 | 3300025261 | Bacteria | 127171 |
| 170 | Ga0209233_1000194 | 3300025261 | Bacteria | 126185 |
| 171 | Ga0209233_1000480 | 3300025261 | Bacteria | 24397 |
| 172 | Ga0209455_1000285 | 3300025272 | Bacteria | 54489 |
| 173 | Ga0209130_1000032 | 3300025284 | Bacteria | 316240 |
| 174 | Ga0209130_1000037 | 3300025284 | Bacteria | 284019 |
| 175 | Ga0209676_1001584 | 3300025292 | Bacteria | 20274 |
| 176 | Ga0209025_1000052 | 3300025294 | Bacteria | 324648 |
| 177 | Ga0209025_1000196 | 3300025294 | Bacteria | 147356 |
| 178 | Ga0209025_1000277 | 3300025294 | Bacteria | 117930 |
| 179 | Ga0209564_1000086 | 3300025295 | Bacteria | 251385 |
| 180 | Ga0209758_1000576 | 3300025297 | Bacteria | 57318 |
| 181 | Ga0209758_1007656 | 3300025297 | Bacteria | 7280 |
| 182 | Ga0209050_1000370 | 3300025298 | Bacteria | 85916 |
| 183 | Ga0209050_1002937 | 3300025298 | Bacteria | 13341 |
| 184 | Ga0209256_1000321 | 3300025299 | Bacteria | 82735 |
| 185 | Ga0209256_1001676 | 3300025299 | Bacteria | 21473 |
| 186 | Ga0207426_1000048 | 3300025302 | Bacteria | 409127 |
| 187 | Ga0207426_1000077 | 3300025302 | Bacteria | 316246 |
| 188 | Ga0209051_1001367 | 3300025303 | Bacteria | 21083 |
| 189 | Ga0209051_1007845 | 3300025303 | Bacteria | 5760 |
| 190 | Ga0209257_1001330 | 3300025304 | Bacteria | 30051 |
| 191 | Ga0209257_1005220 | 3300025304 | Bacteria | 9300 |
| 192 | Ga0207647_10015537 | 3300025904 | Bacteria | 5216 |
| 193 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 194 | Ga0207705_10001504 | 3300025909 | Bacteria | 18521 |
| 195 | Ga0207705_10055854 | 3300025909 | Bacteria | 2847 |
| 196 | Ga0207654_10012470 | 3300025911 | Bacteria | 4356 |
| 197 | Ga0207695_10000049 | 3300025913 | Bacteria | 406233 |
| 198 | Ga0207695_10016374 | 3300025913 | Bacteria | 8677 |
| 199 | Ga0207695_10026378 | 3300025913 | Bacteria | 6485 |
| 200 | Ga0207695_10044625 | 3300025913 | Bacteria | 4713 |
| 201 | Ga0207671_10000107 | 3300025914 | Bacteria | 128950 |
| 202 | Ga0207671_10000361 | 3300025914 | Bacteria | 64792 |
| 203 | Ga0207671_10010693 | 3300025914 | Bacteria | 7547 |
| 204 | Ga0207657_10011321 | 3300025919 | Bacteria | 8858 |
| 205 | Ga0207657_10015965 | 3300025919 | Bacteria | 7252 |
| 206 | Ga0207649_10067406 | 3300025920 | Bacteria | 2272 |
| 207 | Ga0207681_10000013 | 3300025923 | Bacteria | 357411 |
| 208 | Ga0207694_10016708 | 3300025924 | Bacteria | 5547 |
| 209 | Ga0207694_10036721 | 3300025924 | Bacteria | 3760 |
| 210 | Ga0207650_10000008 | 3300025925 | Bacteria | 498534 |
| 211 | Ga0207650_10001003 | 3300025925 | Bacteria | 21229 |
| 212 | Ga0207644_10000424 | 3300025931 | Bacteria | 27437 |
| 213 | Ga0207711_10006215 | 3300025941 | Bacteria | 10089 |
| 214 | Ga0207667_10003331 | 3300025949 | Bacteria | 19830 |
| 215 | Ga0207667_10012071 | 3300025949 | Bacteria | 9991 |
| 216 | Ga0207667_10116595 | 3300025949 | Bacteria | 2752 |
| 217 | Ga0207712_10000059 | 3300025961 | Bacteria | 137849 |
| 218 | Ga0207668_10000122 | 3300025972 | Bacteria | 54614 |
| 219 | Ga0207640_10004035 | 3300025981 | Bacteria | 7931 |
| 220 | Ga0207640_10005794 | 3300025981 | Bacteria | 6736 |
| 221 | Ga0207640_10031937 | 3300025981 | Bacteria | 3260 |
| 222 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 223 | Ga0207658_10000025 | 3300025986 | Bacteria | 182470 |
| 224 | Ga0207658_10008204 | 3300025986 | Bacteria | 7115 |
| 225 | Ga0207703_10002501 | 3300026035 | Bacteria | 15928 |
| 226 | Ga0207703_10009799 | 3300026035 | Bacteria | 7515 |
| 227 | Ga0207639_10000752 | 3300026041 | Bacteria | 22089 |
| 228 | Ga0207639_10003348 | 3300026041 | Bacteria | 10779 |
| 229 | Ga0207639_10136590 | 3300026041 | Bacteria | 2037 |
| 230 | Ga0207678_10002692 | 3300026067 | Bacteria | 16117 |
| 231 | Ga0207678_10112879 | 3300026067 | Bacteria | 2318 |
| 232 | Ga0207702_10000774 | 3300026078 | Bacteria | 33893 |
| 233 | Ga0207702_10001580 | 3300026078 | Bacteria | 22559 |
| 234 | Ga0207702_10086723 | 3300026078 | Bacteria | 2730 |
| 235 | Ga0207641_10000557 | 3300026088 | Bacteria | 41685 |
| 236 | Ga0207641_10010897 | 3300026088 | Bacteria | 7450 |
| 237 | Ga0207676_10000012 | 3300026095 | Bacteria | 353971 |
| 238 | Ga0207676_10010193 | 3300026095 | Bacteria | 6687 |
| 239 | Ga0207674_10010673 | 3300026116 | Bacteria | 10384 |
| 240 | Ga0207674_10105739 | 3300026116 | Bacteria | 2792 |
| 241 | Ga0207674_10140549 | 3300026116 | Bacteria | 2374 |
| 242 | Ga0207683_10059378 | 3300026121 | Bacteria | 3360 |
| 243 | Ga0207698_10000431 | 3300026142 | Bacteria | 24133 |
| 244 | Ga0207698_10014125 | 3300026142 | Bacteria | 5295 |
| 245 | Ga0209281_1000081 | 3300027111 | Bacteria | 258084 |
| 246 | Ga0209281_1000141 | 3300027111 | Bacteria | 175634 |
| 247 | Ga0209281_1000194 | 3300027111 | Bacteria | 139318 |
| 248 | Ga0209371_1000035 | 3300027312 | Bacteria | 368979 |
| 249 | Ga0209371_1001388 | 3300027312 | Bacteria | 16639 |
| 250 | Ga0209282_1000036 | 3300027666 | Bacteria | 130242 |
| 251 | Ga0209282_1000230 | 3300027666 | Bacteria | 28914 |
| 252 | Ga0209282_1009311 | 3300027666 | Bacteria | 6209 |
| 253 | Ga0209813_10000024 | 3300027866 | Bacteria | 72716 |
| 254 | Ga0268266_10000086 | 3300028379 | Bacteria | 199443 |
| 255 | Ga0268266_10003563 | 3300028379 | Bacteria | 15426 |
| 256 | Ga0268266_10037051 | 3300028379 | Bacteria | 4156 |
| 257 | Ga0268266_10104148 | 3300028379 | Bacteria | 2505 |
| 258 | Ga0268265_10000006 | 3300028380 | Bacteria | 466482 |
| 259 | Ga0268265_10000225 | 3300028380 | Bacteria | 65493 |
| 260 | Ga0268265_10000849 | 3300028380 | Bacteria | 28736 |
| 261 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 262 | Ga0268264_10000120 | 3300028381 | Bacteria | 191138 |
| 263 | Ga0268264_10000691 | 3300028381 | Bacteria | 39209 |
| 264 | Ga0265318_10004967 | 3300028577 | Bacteria | 6333 |
| 265 | Ga0307515_10000006 | 3300028794 | Bacteria | 725810 |
| 266 | Ga0307515_10000263 | 3300028794 | Bacteria | 130303 |
| 267 | Ga0307515_10008205 | 3300028794 | Bacteria | 20435 |
| 268 | Ga0265324_10001826 | 3300029957 | Bacteria | 11553 |
| 269 | Ga0265324_10008268 | 3300029957 | Bacteria | 4146 |
| 270 | Ga0268256_1000037 | 3300030500 | Bacteria | 367024 |
| 271 | Ga0268256_1001900 | 3300030500 | Bacteria | 11529 |
| 272 | Ga0265330_10018642 | 3300031235 | Bacteria | 3186 |
| 273 | Ga0265328_10000449 | 3300031239 | Bacteria | 19146 |
| 274 | Ga0265325_10012251 | 3300031241 | Bacteria | 4907 |
| 275 | Ga0265325_10021265 | 3300031241 | Bacteria | 3567 |
| 276 | Ga0265340_10011383 | 3300031247 | Bacteria | 4726 |
| 277 | Ga0265339_10023092 | 3300031249 | Bacteria | 3597 |
| 278 | Ga0265339_10026323 | 3300031249 | Bacteria | 3332 |
| 279 | Ga0265331_10000109 | 3300031250 | Bacteria | 108845 |
| 280 | Ga0265331_10000377 | 3300031250 | Bacteria | 46393 |
| 281 | Ga0265327_10000100 | 3300031251 | Bacteria | 189591 |
| 282 | Ga0265327_10000243 | 3300031251 | Bacteria | 108869 |
| 283 | Ga0265327_10003763 | 3300031251 | Bacteria | 14080 |
| 284 | Ga0265327_10014812 | 3300031251 | Bacteria | 5079 |
| 285 | Ga0265316_10012791 | 3300031344 | Bacteria | 7497 |
| 286 | Ga0265316_10060140 | 3300031344 | Bacteria | 2953 |
| 287 | Ga0307513_10001607 | 3300031456 | Bacteria | 32450 |
| 288 | Ga0307513_10078170 | 3300031456 | Bacteria | 3423 |
| 289 | Ga0307509_10043922 | 3300031507 | Bacteria | 4831 |
| 290 | Ga0307408_100010969 | 3300031548 | Bacteria | 5978 |
| 291 | Ga0265313_10000781 | 3300031595 | Bacteria | 32156 |
| 292 | Ga0265313_10013224 | 3300031595 | Bacteria | 4969 |
| 293 | Ga0265342_10015557 | 3300031712 | Bacteria | 5001 |
| 294 | Ga0307405_10068784 | 3300031731 | Bacteria | 2267 |
| 295 | Ga0307412_10001365 | 3300031911 | Bacteria | 13577 |
| 296 | Ga0307412_10033535 | 3300031911 | Bacteria | 3264 |
| 297 | Ga0315914_1000002 | 3300031967 | Bacteria | 365357 |
| 298 | Ga0315913_1000009 | 3300033430 | Bacteria | 149770 |
| 299 | Ga0315915_1000005 | 3300033464 | Bacteria | 397591 |
| 300 | Ga0373927_0000822 | 3300035695 | Bacteria | 23743 |
| 301 | Ga0373925_0007056 | 3300037068 | Bacteria | 8209 |
| 302 | Ga0395899_0000090 | 3300037312 | Bacteria | 156587 |
| 303 | Ga0395899_0114177 | 3300037312 | Bacteria | 1939 |
| 304 | Ga0395900_0000017 | 3300037418 | Bacteria | 369602 |
| 305 | Ga0395900_0021967 | 3300037418 | Bacteria | 6524 |
| 306 | Ga0395900_0062551 | 3300037418 | Bacteria | 3826 |
| 307 | Ga0395900_0157016 | 3300037418 | Bacteria | 2323 |
| 308 | Ga0395898_0000030 | 3300037466 | Bacteria | 369577 |
| 309 | Ga0395898_0022622 | 3300037466 | Bacteria | 6365 |
| 310 | Ga0395905_0000081 | 3300037471 | Bacteria | 160409 |
| 311 | Ga0395905_0003702 | 3300037471 | Bacteria | 16188 |
| 312 | Ga0395905_0006130 | 3300037471 | Bacteria | 12139 |
| 313 | Ga0395901_0000015 | 3300038443 | Bacteria | 373388 |
| 314 | Ga0395901_0113368 | 3300038443 | Bacteria | 2847 |
| 315 | Ga0436360_1160663 | 3300039438 | Bacteria | 1833 |
| 316 | Ga0439449_0000555 | 3300042007 | Bacteria | 14026 |
| 317 | Ga0451577_0037775 | 3300042876 | Bacteria | 4346 |
| 318 | Ga0466973_0080647 | 3300044659 | Bacteria | 2850 |
| 319 | Ga0453684_0000006 | 3300044712 | Bacteria | 1364191 |
| 320 | Ga0453684_0000048 | 3300044712 | Bacteria | 559743 |
| 321 | Ga0453684_0008423 | 3300044712 | Bacteria | 18474 |
| 322 | Ga0466968_0075243 | 3300044735 | Bacteria | 1476 |
| 323 | Ga0466960_0034799 | 3300044901 | Bacteria | 2350 |
| 324 | Ga0451576_0000227 | 3300045051 | Bacteria | 137818 |
| 325 | Ga0495627_000800 | 3300046453 | Bacteria | 22980 |
| 326 | Ga0495603_0007661 | 3300046455 | Bacteria | 6503 |
| 327 | Ga0495629_0002307 | 3300046459 | Bacteria | 14715 |
| 328 | Ga0495629_0054430 | 3300046459 | Bacteria | 2798 |
| 329 | Ga0495638_0012855 | 3300046460 | Bacteria | 5719 |
| 330 | Ga0495650_0003413 | 3300046471 | Bacteria | 11617 |
| 331 | Ga0495650_0003566 | 3300046471 | Bacteria | 11255 |
| 332 | Ga0495580_0033496 | 3300046472 | Bacteria | 3701 |
| 333 | Ga0495582_0004524 | 3300046473 | Bacteria | 7812 |
| 334 | Ga0495639_0009534 | 3300046475 | Bacteria | 4167 |
| 335 | Ga0495583_0000088 | 3300046506 | Bacteria | 164073 |
| 336 | Ga0495583_0000625 | 3300046506 | Bacteria | 47513 |
| 337 | Ga0495583_0019645 | 3300046506 | Bacteria | 3521 |
| 338 | Ga0495610_0000095 | 3300046512 | Bacteria | 104629 |
| 339 | Ga0495630_0056174 | 3300046517 | Bacteria | 2950 |
| 340 | Ga0495632_0000328 | 3300046519 | Bacteria | 45623 |
| 341 | Ga0495632_0001666 | 3300046519 | Bacteria | 18198 |
| 342 | Ga0495637_0006095 | 3300046520 | Bacteria | 6070 |
| 343 | Ga0495637_0020445 | 3300046520 | Bacteria | 3046 |
| 344 | Ga0495643_0000014 | 3300046522 | Bacteria | 314632 |
| 345 | Ga0495643_0071276 | 3300046522 | Bacteria | 1824 |
| 346 | Ga0495648_0000308 | 3300046524 | Bacteria | 54286 |
| 347 | Ga0495648_0002254 | 3300046524 | Bacteria | 18031 |
| 348 | Ga0495663_0000007 | 3300046525 | Bacteria | 262438 |
| 349 | Ga0495642_0001260 | 3300046528 | Bacteria | 11512 |
| 350 | Ga0495654_0002299 | 3300046530 | Bacteria | 12357 |
| 351 | Ga0495586_0014478 | 3300046535 | Bacteria | 4189 |
| 352 | Ga0495645_0001395 | 3300046543 | Bacteria | 16327 |
| 353 | Ga0495633_0000112 | 3300046558 | Bacteria | 109485 |
| 354 | Ga0495633_0000398 | 3300046558 | Bacteria | 45509 |
| 355 | Ga0495633_0005773 | 3300046558 | Bacteria | 7473 |
| 356 | Ga0495633_0047331 | 3300046558 | Bacteria | 2032 |
| 357 | Ga0495588_0001064 | 3300046674 | Bacteria | 11908 |
| 358 | Ga0495613_0015634 | 3300046689 | Bacteria | 5648 |
| 359 | Ga0495671_0000032 | 3300046692 | Bacteria | 201185 |
| 360 | Ga0495671_0000034 | 3300046692 | Bacteria | 195385 |
| 361 | Ga0495589_0003359 | 3300046794 | Bacteria | 8677 |
| 362 | Ga0495604_0005557 | 3300047317 | Bacteria | 9996 |
| 363 | Ga0495636_0019335 | 3300047318 | Bacteria | 2737 |
| 364 | Ga0495636_0026358 | 3300047318 | Bacteria | 2364 |
| 365 | Ga0495683_0019282 | 3300047323 | Bacteria | 3521 |
| 366 | Ga0495675_0038110 | 3300047444 | Bacteria | 3062 |
| 367 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 368 | Ga0495681_0000008 | 3300047470 | Bacteria | 215295 |
| 369 | Ga0495681_0000057 | 3300047470 | Bacteria | 103340 |
| 370 | Ga0495681_0049280 | 3300047470 | Bacteria | 1992 |
| 371 | Ga0495686_0001495 | 3300047472 | Bacteria | 25320 |
| 372 | Ga0495593_0012920 | 3300047673 | Bacteria | 4769 |
| 373 | Ga0496101_0027661 | 3300048904 | Bacteria | 3953 |
| 374 | Ga0496102_0000088 | 3300048905 | Bacteria | 129762 |
| 375 | Ga0496102_0114742 | 3300048905 | Bacteria | 2513 |
| 376 | Ga0496104_0099974 | 3300048907 | Bacteria | 2777 |
| 377 | Ga0496108_0019437 | 3300048911 | Bacteria | 5579 |
| 378 | Ga0496110_0001911 | 3300048913 | Bacteria | 15417 |
| 379 | Ga0496110_0090111 | 3300048913 | Bacteria | 2742 |
| 380 | Ga0496112_0007768 | 3300048915 | Bacteria | 9543 |
| 381 | Ga0496112_0181812 | 3300048915 | Bacteria | 2066 |
| 382 | Ga0496113_0000241 | 3300048916 | Bacteria | 25760 |
| 383 | Ga0496114_0015662 | 3300048917 | Bacteria | 6100 |
| 384 | Ga0496116_0000028 | 3300048919 | Bacteria | 424086 |
| 385 | Ga0496116_0000097 | 3300048919 | Bacteria | 200658 |
| 386 | Ga0496117_0000066 | 3300048920 | Bacteria | 253534 |
| 387 | Ga0496117_0002381 | 3300048920 | Bacteria | 23937 |
| 388 | Ga0496117_0074251 | 3300048920 | Bacteria | 2264 |
| 389 | Ga0496117_0109357 | 3300048920 | Bacteria | 1726 |
| 390 | Ga0496118_0003408 | 3300048921 | Bacteria | 20089 |
| 391 | Ga0496118_0007823 | 3300048921 | Bacteria | 11211 |
| 392 | Ga0496118_0062082 | 3300048921 | Bacteria | 2762 |
| 393 | Ga0496118_0125764 | 3300048921 | Bacteria | 1660 |
| 394 | Ga0496119_0005553 | 3300048922 | Bacteria | 12002 |
| 395 | Ga0496119_0090993 | 3300048922 | Bacteria | 1733 |
| 396 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 397 | Ga0496121_0000682 | 3300048924 | Bacteria | 63266 |
| 398 | Ga0496121_0005781 | 3300048924 | Bacteria | 15691 |
| 399 | Ga0496121_0008021 | 3300048924 | Bacteria | 12594 |
| 400 | Ga0496121_0055972 | 3300048924 | Bacteria | 3280 |
| 401 | Ga0496121_0057655 | 3300048924 | Bacteria | 3217 |
| 402 | Ga0496121_0098706 | 3300048924 | Bacteria | 2259 |
| 403 | Ga0496122_0000024 | 3300048925 | Bacteria | 372400 |
| 404 | Ga0496122_0000057 | 3300048925 | Bacteria | 253452 |
| 405 | Ga0496122_0000107 | 3300048925 | Bacteria | 193163 |
| 406 | Ga0496122_0003171 | 3300048925 | Bacteria | 21952 |
| 407 | Ga0496122_0005520 | 3300048925 | Bacteria | 15019 |
| 408 | Ga0496123_0000063 | 3300048926 | Bacteria | 216072 |
| 409 | Ga0496123_0000086 | 3300048926 | Bacteria | 183266 |
| 410 | Ga0496123_0000096 | 3300048926 | Bacteria | 173914 |
| 411 | Ga0496123_0001326 | 3300048926 | Bacteria | 34955 |
| 412 | Ga0496123_0006646 | 3300048926 | Bacteria | 11152 |
| 413 | Ga0496123_0038991 | 3300048926 | Bacteria | 3329 |
| 414 | Ga0496124_0000413 | 3300048927 | Bacteria | 76781 |
| 415 | Ga0496124_0006506 | 3300048927 | Bacteria | 12712 |
| 416 | Ga0496124_0021788 | 3300048927 | Bacteria | 5894 |
| 417 | Ga0496124_0036929 | 3300048927 | Bacteria | 4255 |
| 418 | Ga0496124_0066728 | 3300048927 | Bacteria | 2995 |
| 419 | Ga0496124_0083363 | 3300048927 | Bacteria | 2623 |
| 420 | Ga0496124_0095267 | 3300048927 | Bacteria | 2420 |
| 421 | Ga0496124_0110200 | 3300048927 | Bacteria | 2216 |
| 422 | Ga0496125_0000345 | 3300048928 | Bacteria | 88357 |
| 423 | Ga0496125_0000651 | 3300048928 | Bacteria | 58001 |
| 424 | Ga0496125_0000898 | 3300048928 | Bacteria | 47075 |
| 425 | Ga0496125_0002640 | 3300048928 | Bacteria | 22927 |
| 426 | Ga0496125_0118760 | 3300048928 | Bacteria | 1893 |
| 427 | Ga0496126_0000079 | 3300048929 | Bacteria | 222463 |
| 428 | Ga0496126_0000119 | 3300048929 | Bacteria | 184211 |
| 429 | Ga0496126_0001430 | 3300048929 | Bacteria | 37517 |
| 430 | Ga0496126_0064254 | 3300048929 | Bacteria | 3288 |
| 431 | Ga0496126_0152560 | 3300048929 | Bacteria | 1979 |
| 432 | Ga0501031_0008271 | 3300049568 | Bacteria | 6767 |
| 433 | Ga0501032_0000008 | 3300049569 | Bacteria | 240313 |
| 434 | Ga0501032_0000156 | 3300049569 | Bacteria | 55416 |
| 435 | Ga0501032_0018295 | 3300049569 | Bacteria | 4909 |
| 436 | Ga0501032_0025815 | 3300049569 | Bacteria | 4048 |
| 437 | Ga0501033_0000012 | 3300049570 | Bacteria | 241599 |
| 438 | Ga0501033_0000423 | 3300049570 | Bacteria | 40417 |
| 439 | Ga0501033_0000967 | 3300049570 | Bacteria | 26078 |
| 440 | Ga0501033_0017829 | 3300049570 | Bacteria | 5361 |
| 441 | Ga0501033_0040138 | 3300049570 | Bacteria | 3494 |
| 442 | Ga0501034_0000035 | 3300049571 | Bacteria | 241623 |
| 443 | Ga0501034_0000087 | 3300049571 | Bacteria | 166714 |
| 444 | Ga0501034_0001581 | 3300049571 | Bacteria | 29672 |
| 445 | Ga0501034_0005300 | 3300049571 | Bacteria | 14140 |
| 446 | Ga0501034_0072305 | 3300049571 | Bacteria | 3458 |
| 447 | Ga0501034_0084264 | 3300049571 | Bacteria | 3180 |
| 448 | Ga0501034_0162278 | 3300049571 | Bacteria | 2205 |
| 449 | Ga0501036_0000006 | 3300049572 | Bacteria | 241623 |
| 450 | Ga0501036_0000885 | 3300049572 | Bacteria | 22376 |
| 451 | Ga0501036_0119520 | 3300049572 | Bacteria | 2225 |
| 452 | Ga0501037_0000014 | 3300049573 | Bacteria | 171015 |
| 453 | Ga0501037_0000072 | 3300049573 | Bacteria | 94452 |
| 454 | Ga0501037_0000386 | 3300049573 | Bacteria | 36578 |
| 455 | Ga0501038_0000007 | 3300049574 | Bacteria | 210775 |
| 456 | Ga0501038_0000023 | 3300049574 | Bacteria | 151469 |
| 457 | Ga0501039_0000012 | 3300049575 | Bacteria | 241623 |
| 458 | Ga0501039_0000101 | 3300049575 | Bacteria | 59353 |
| 459 | Ga0501043_0000022 | 3300049579 | Bacteria | 154467 |
| 460 | Ga0501043_0000194 | 3300049579 | Bacteria | 55458 |
| 461 | Ga0501043_0000211 | 3300049579 | Bacteria | 53464 |
| 462 | Ga0501043_0025797 | 3300049579 | Bacteria | 4610 |
| 463 | Ga0501046_0006281 | 3300049580 | Bacteria | 10536 |
| 464 | Ga0501047_0001346 | 3300049581 | Bacteria | 24128 |
| 465 | Ga0501047_0012399 | 3300049581 | Bacteria | 8068 |
| 466 | Ga0501047_0013458 | 3300049581 | Bacteria | 7755 |
| 467 | Ga0501047_0108091 | 3300049581 | Bacteria | 2663 |
| 468 | Ga0501067_0001395 | 3300049583 | Bacteria | 13094 |
| 469 | Ga0501068_0029719 | 3300049584 | Bacteria | 3238 |
| 470 | Ga0501069_0000035 | 3300049585 | Bacteria | 88215 |
| 471 | Ga0501069_0007570 | 3300049585 | Bacteria | 5699 |
| 472 | Ga0501069_0019293 | 3300049585 | Bacteria | 3686 |
| 473 | Ga0501070_0000103 | 3300049586 | Bacteria | 74597 |
| 474 | Ga0501070_0004303 | 3300049586 | Bacteria | 12238 |
| 475 | Ga0501070_0017416 | 3300049586 | Bacteria | 6032 |
| 476 | Ga0501070_0019274 | 3300049586 | Bacteria | 5721 |
| 477 | Ga0501070_0021642 | 3300049586 | Bacteria | 5392 |
| 478 | Ga0501070_0028028 | 3300049586 | Bacteria | 4723 |
| 479 | Ga0501070_0097608 | 3300049586 | Bacteria | 2430 |
| 480 | Ga0501071_0007568 | 3300049587 | Bacteria | 7150 |
| 481 | Ga0501071_0022244 | 3300049587 | Bacteria | 4420 |
| 482 | Ga0501073_0087934 | 3300049589 | Bacteria | 2161 |
| 483 | Ga0501074_0000530 | 3300049590 | Bacteria | 23465 |
| 484 | Ga0501225_0000041 | 3300049705 | Bacteria | 43072 |
| 485 | Ga0501225_0002520 | 3300049705 | Bacteria | 5665 |
| 486 | Ga0501080_0002529 | 3300049742 | Bacteria | 16008 |
| 487 | Ga0501080_0059072 | 3300049742 | Bacteria | 3569 |
| 488 | Ga0501080_0110528 | 3300049742 | Bacteria | 2547 |
| 489 | Ga0501083_0001316 | 3300049744 | Bacteria | 16825 |
| 490 | Ga0501083_0011220 | 3300049744 | Bacteria | 6288 |
| 491 | Ga0501035_0000035 | 3300049822 | Bacteria | 166916 |
| 492 | Ga0501035_0000139 | 3300049822 | Bacteria | 88322 |
| 493 | Ga0501035_0003975 | 3300049822 | Bacteria | 14090 |
| 494 | Ga0501035_0005080 | 3300049822 | Bacteria | 12468 |
| 495 | Ga0501035_0007697 | 3300049822 | Bacteria | 10061 |
| 496 | Ga0501035_0020763 | 3300049822 | Bacteria | 6035 |
| 497 | Ga0501035_0021403 | 3300049822 | Bacteria | 5945 |
| 498 | Ga0501035_0098783 | 3300049822 | Bacteria | 2563 |
| 499 | Ga0501044_0000015 | 3300049823 | Bacteria | 241623 |
| 500 | Ga0501044_0000578 | 3300049823 | Bacteria | 44504 |
| 501 | Ga0501044_0025845 | 3300049823 | Bacteria | 6224 |
| 502 | Ga0501044_0054117 | 3300049823 | Bacteria | 4127 |
| 503 | nmdc:mga03683_17874_c1 | 3300050489 | Bacteria | 2689 |
| 504 | nmdc:mga00v17_186_c2 | 3300050491 | Bacteria | 35842 |
| 505 | nmdc:mga00v17_59_c2 | 3300050491 | Bacteria | 33192 |
| 506 | nmdc:mga0yw44_215_c1 | 3300050492 | Bacteria | 20484 |
| 507 | nmdc:mga0k408_53436_c1 | 3300050493 | Bacteria | 2342 |
| 508 | nmdc:mga06z11_50_c1 | 3300050494 | Bacteria | 50140 |
| 509 | nmdc:mga04h51_64_c1 | 3300050495 | Bacteria | 33433 |
| 510 | nmdc:mga0sz30_2883_c1 | 3300050516 | Bacteria | 6153 |
| 511 | Ga0500647_0048447 | 3300053091 | Bacteria | 2043 |
| 512 | Ga0500572_001775 | 3300053111 | Bacteria | 5548 |
| 513 | Ga0500561_0000021 | 3300053137 | Bacteria | 39116 |
| 514 | Ga0500573_0001779 | 3300053140 | Bacteria | 10470 |
| 515 | Ga0500604_0000133 | 3300053151 | Bacteria | 22566 |
| 516 | Ga0500616_0000709 | 3300053153 | Bacteria | 38615 |
| 517 | Ga0500616_0022258 | 3300053153 | Bacteria | 3541 |
| 518 | Ga0500616_0035918 | 3300053153 | Bacteria | 2692 |
| 519 | Ga0500622_0000286 | 3300053156 | Bacteria | 51508 |
| 520 | Ga0500624_000052 | 3300053157 | Bacteria | 74126 |
| 521 | Ga0500624_000444 | 3300053157 | Bacteria | 12471 |
| 522 | Ga0500634_0000053 | 3300053161 | Bacteria | 52099 |
| 523 | Ga0500634_0008242 | 3300053161 | Bacteria | 5199 |
| 524 | Ga0500634_0047382 | 3300053161 | Bacteria | 2320 |
| 525 | Ga0500636_0000005 | 3300053177 | Bacteria | 197561 |
| 526 | Ga0500625_000002 | 3300053729 | Bacteria | 371909 |
| 527 | Ga0501084_0105017 | 3300054114 | Bacteria | 2372 |
| 528 | Ga0587083_0000805 | 3300059505 | Bacteria | 3135 |
| 529 | Ga0587106_001679 | 3300059605 | Bacteria | 2027 |
| 530 | Ga0587107_001384 | 3300059652 | Bacteria | 1957 |
| 531 | Ga0587071_004023 | 3300060344 | Bacteria | 2161 |
| 532 | Ga0501082_0027147 | 3300060353 | Bacteria | 4932 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049587 | Ga0501071_0022244 | Ga0501071_0022244_15_1400 | 461 |
| 2 | iso_pu_bacteria | 2510461069 | 2510842912 | 465 |
| 3 | 3300044735 | Ga0466968_0075243 | Ga0466968_0075243_12_1427 | 471 |
| 4 | 3300046459 | Ga0495629_0054430 | Ga0495629_0054430_23_1438 | 471 |
| 5 | 3300048920 | Ga0496117_0109357 | Ga0496117_0109357_294_1709 | 471 |
| 6 | 3300048921 | Ga0496118_0125764 | Ga0496118_0125764_17_1432 | 471 |
| 7 | iso_pu_bacteria | 2979742915 | 2979746109 | 485 |
| 8 | 3300048928 | Ga0496125_0118760 | Ga0496125_0118760_400_1875 | 491 |
| 9 | iso_pu_bacteria | 2878730984 | 2878733721 | 493 |
| 10 | iso_pu_bacteria | 2977971508 | 2977979564 | 500 |
| 11 | 3300048924 | Ga0496121_0005781 | Ga0496121_0005781_11568_13214 | 504 |
| 12 | iso_pu_bacteria | 2977858184 | 2977862360 | 507 |
| 13 | 3300025298 | Ga0209050_1000370 | Ga0209050_100037070 | 513 |
| 14 | 3300028794 | Ga0307515_10000006 | Ga0307515_10000006312 | 514 |
| 15 | 3300048919 | Ga0496116_0000028 | Ga0496116_0000028_184284_185924 | 514 |
| 16 | 3300048926 | Ga0496123_0001326 | Ga0496123_0001326_11975_13615 | 514 |
| 17 | 3300048927 | Ga0496124_0066728 | Ga0496124_0066728_571_2211 | 514 |
| 18 | 3300048928 | Ga0496125_0002640 | Ga0496125_0002640_12823_14463 | 514 |
| 19 | 3300048929 | Ga0496126_0000079 | Ga0496126_0000079_56895_58535 | 514 |
| 20 | 3300046506 | Ga0495583_0000088 | Ga0495583_0000088_138572_140203 | 517 |
| 21 | 3300025294 | Ga0209025_1000277 | Ga0209025_100027717 | 521 |
| 22 | 3300027312 | Ga0209371_1000035 | Ga0209371_1000035101 | 521 |
| 23 | 3300030500 | Ga0268256_1000037 | Ga0268256_1000037100 | 521 |
| 24 | iso_pu_bacteria | 2924718760 | 2924726297 | 527 |
| 25 | 3300047318 | Ga0495636_0019335 | Ga0495636_0019335_404_2035 | 528 |
| 26 | 3300003203 | JGI25406J46586_10008780 | JGI25406J46586_100087802 | 532 |
| 27 | 3300005985 | Ga0081539_10003049 | Ga0081539_1000304914 | 532 |
| 28 | 3300049744 | Ga0501083_0011220 | Ga0501083_0011220_2642_4249 | 533 |
| 29 | iso_pu_bacteria | 2508501127 | 2509141179 | 534 |
| 30 | 3300029957 | Ga0265324_10008268 | Ga0265324_100082682 | 537 |
| 31 | 3300031241 | Ga0265325_10012251 | Ga0265325_100122512 | 537 |
| 32 | 3300031344 | Ga0265316_10012791 | Ga0265316_100127914 | 537 |
| 33 | 3300031595 | Ga0265313_10000781 | Ga0265313_100007813 | 537 |
| 34 | iso_pu_bacteria | 2881161766 | 2881163025 | 537 |
| 35 | iso_pu_bacteria | 2996310559 | 2996313114 | 537 |
| 36 | iso_pu_bacteria | 3003665799 | 3003670110 | 537 |
| 37 | iso_pu_bacteria | 8018150411 | 8018151489 | 537 |
| 38 | 3300031251 | Ga0265327_10014812 | Ga0265327_100148122 | 538 |
| 39 | iso_pu_bacteria | 2503198000 | 2503203509 | 538 |
| 40 | iso_pu_bacteria | 2508501122 | 2509110257 | 538 |
| 41 | iso_pu_bacteria | 2509276018 | 2509370956 | 538 |
| 42 | iso_pu_bacteria | 2509276019 | 2509379015 | 538 |
| 43 | iso_pu_bacteria | 2509276022 | 2509397926 | 538 |
| 44 | iso_pu_bacteria | 2510065057 | 2510303696 | 538 |
| 45 | iso_pu_bacteria | 2510065059 | 2510316505 | 538 |
| 46 | iso_pu_bacteria | 2510917022 | 2511136564 | 538 |
| 47 | iso_pu_bacteria | 2511231027 | 2511391732 | 538 |
| 48 | iso_pu_bacteria | 2511231052 | 2511502992 | 538 |
| 49 | iso_pu_bacteria | 2512047086 | 2512534256 | 538 |
| 50 | iso_pu_bacteria | 2512875016 | 2512929601 | 538 |
| 51 | iso_pu_bacteria | 2512875024 | 2512964384 | 538 |
| 52 | iso_pu_bacteria | 2512875026 | 2512973921 | 538 |
| 53 | iso_pu_bacteria | 2513237086 | 2513586849 | 538 |
| 54 | iso_pu_bacteria | 2513237089 | 2513602362 | 538 |
| 55 | iso_pu_bacteria | 2513237090 | 2513608203 | 538 |
| 56 | iso_pu_bacteria | 2513237091 | 2513617162 | 538 |
| 57 | iso_pu_bacteria | 2513237140 | 2513882903 | 538 |
| 58 | iso_pu_bacteria | 2513237143 | 2513902932 | 538 |
| 59 | iso_pu_bacteria | 2513237156 | 2513985909 | 538 |
| 60 | iso_pu_bacteria | 2513237159 | 2513998093 | 538 |
| 61 | iso_pu_bacteria | 2513237160 | 2514004005 | 538 |
| 62 | iso_pu_bacteria | 2513237164 | 2514036917 | 538 |
| 63 | iso_pu_bacteria | 2513237305 | 2514422846 | 538 |
| 64 | iso_pu_bacteria | 2513237351 | 2514591561 | 538 |
| 65 | iso_pu_bacteria | 2515154107 | 2515610335 | 538 |
| 66 | iso_pu_bacteria | 2516143018 | 2516205255 | 538 |
| 67 | iso_pu_bacteria | 2516653046 | 2516894396 | 538 |
| 68 | iso_pu_bacteria | 2517487022 | 2517571017 | 538 |
| 69 | iso_pu_bacteria | 2524023207 | 2524451882 | 538 |
| 70 | iso_pu_bacteria | 2524023209 | 2524460072 | 538 |
| 71 | iso_pu_bacteria | 2537561587 | 2537875391 | 538 |
| 72 | iso_pu_bacteria | 2551306084 | 2551677896 | 538 |
| 73 | iso_pu_bacteria | 2551306085 | 2551690010 | 538 |
| 74 | iso_pu_bacteria | 2551306086 | 2551692030 | 538 |
| 75 | iso_pu_bacteria | 2551306086 | 2551692293 | 538 |
| 76 | iso_pu_bacteria | 2554235003 | 2554244887 | 538 |
| 77 | iso_pu_bacteria | 2558860100 | 2558860408 | 538 |
| 78 | iso_pu_bacteria | 2558860242 | 2559297279 | 538 |
| 79 | iso_pu_bacteria | 2558860983 | 2561469306 | 538 |
| 80 | iso_pu_bacteria | 2582581283 | 2585168036 | 538 |
| 81 | iso_pu_bacteria | 2582581306 | 2585265328 | 538 |
| 82 | iso_pu_bacteria | 2582581307 | 2585274280 | 538 |
| 83 | iso_pu_bacteria | 2582581308 | 2585280306 | 538 |
| 84 | iso_pu_bacteria | 2582581315 | 2585322584 | 538 |
| 85 | iso_pu_bacteria | 2582581316 | 2585335201 | 538 |
| 86 | iso_pu_bacteria | 2582581865 | 2585388580 | 538 |
| 87 | iso_pu_bacteria | 2582581866 | 2585392428 | 538 |
| 88 | iso_pu_bacteria | 2585427527 | 2585532536 | 538 |
| 89 | iso_pu_bacteria | 2585427530 | 2585554448 | 538 |
| 90 | iso_pu_bacteria | 2585427531 | 2585560729 | 538 |
| 91 | iso_pu_bacteria | 2585427608 | 2585898932 | 538 |
| 92 | iso_pu_bacteria | 2585427609 | 2585903473 | 538 |
| 93 | iso_pu_bacteria | 2585427633 | 2585997145 | 538 |
| 94 | iso_pu_bacteria | 2585427634 | 2586001745 | 538 |
| 95 | iso_pu_bacteria | 2585428125 | 2587981408 | 538 |
| 96 | iso_pu_bacteria | 2588253730 | 2588515173 | 538 |
| 97 | iso_pu_bacteria | 2597489875 | 2597815903 | 538 |
| 98 | iso_pu_bacteria | 2599185156 | 2599334741 | 538 |
| 99 | iso_pu_bacteria | 2599185210 | 2599605103 | 538 |
| 100 | iso_pu_bacteria | 2599185236 | 2599723957 | 538 |
| 101 | iso_pu_bacteria | 2599185301 | 2599939906 | 538 |
| 102 | iso_pu_bacteria | 2599185352 | 2600194089 | 538 |
| 103 | iso_pu_bacteria | 2600255279 | 2601611618 | 538 |
| 104 | iso_pu_bacteria | 2600255308 | 2601748830 | 538 |
| 105 | iso_pu_bacteria | 2615840626 | 2616307393 | 538 |
| 106 | iso_pu_bacteria | 2615840698 | 2616554936 | 538 |
| 107 | iso_pu_bacteria | 2617270742 | 2617383388 | 538 |
| 108 | iso_pu_bacteria | 2643221550 | 2643774133 | 538 |
| 109 | iso_pu_bacteria | 2643221551 | 2643774768 | 538 |
| 110 | iso_pu_bacteria | 2643221555 | 2643793212 | 538 |
| 111 | iso_pu_bacteria | 2643221557 | 2643809770 | 538 |
| 112 | iso_pu_bacteria | 2643221558 | 2643813249 | 538 |
| 113 | iso_pu_bacteria | 2643221564 | 2643838602 | 538 |
| 114 | iso_pu_bacteria | 2643221582 | 2643921820 | 538 |
| 115 | iso_pu_bacteria | 2643221595 | 2643989058 | 538 |
| 116 | iso_pu_bacteria | 2643221607 | 2644051123 | 538 |
| 117 | iso_pu_bacteria | 2643221610 | 2644063951 | 538 |
| 118 | iso_pu_bacteria | 2643221618 | 2644108479 | 538 |
| 119 | iso_pu_bacteria | 2643221623 | 2644132717 | 538 |
| 120 | iso_pu_bacteria | 2643221626 | 2644145525 | 538 |
| 121 | iso_pu_bacteria | 2643221627 | 2644152243 | 538 |
| 122 | iso_pu_bacteria | 2643221636 | 2644205603 | 538 |
| 123 | iso_pu_bacteria | 2643221653 | 2644299240 | 538 |
| 124 | iso_pu_bacteria | 2643221655 | 2644312398 | 538 |
| 125 | iso_pu_bacteria | 2643221659 | 2644336026 | 538 |
| 126 | iso_pu_bacteria | 2643221668 | 2644381472 | 538 |
| 127 | iso_pu_bacteria | 2643221675 | 2644415784 | 538 |
| 128 | iso_pu_bacteria | 2643221680 | 2644448824 | 538 |
| 129 | iso_pu_bacteria | 2643221686 | 2644484027 | 538 |
| 130 | iso_pu_bacteria | 2643221688 | 2644496372 | 538 |
| 131 | iso_pu_bacteria | 2643221689 | 2644500193 | 538 |
| 132 | iso_pu_bacteria | 2643221693 | 2644519788 | 538 |
| 133 | iso_pu_bacteria | 2643221698 | 2644546883 | 538 |
| 134 | iso_pu_bacteria | 2643221712 | 2644618081 | 538 |
| 135 | iso_pu_bacteria | 2643221719 | 2644657468 | 538 |
| 136 | iso_pu_bacteria | 2643221723 | 2644676742 | 538 |
| 137 | iso_pu_bacteria | 2643221726 | 2644686782 | 538 |
| 138 | iso_pu_bacteria | 2657244999 | 2657683982 | 538 |
| 139 | iso_pu_bacteria | 2667528174 | 2671112186 | 538 |
| 140 | iso_pu_bacteria | 2687453392 | 2688600339 | 538 |
| 141 | iso_pu_bacteria | 2690316117 | 2692314498 | 538 |
| 142 | iso_pu_bacteria | 2693429783 | 2694632513 | 538 |
| 143 | iso_pu_bacteria | 2693429784 | 2694639756 | 538 |
| 144 | iso_pu_bacteria | 2721755686 | 2723577631 | 538 |
| 145 | iso_pu_bacteria | 2738543024 | 2739308598 | 538 |
| 146 | iso_pu_bacteria | 2739367664 | 2739651793 | 538 |
| 147 | iso_pu_bacteria | 2739367865 | 2740030267 | 538 |
| 148 | iso_pu_bacteria | 2751185821 | 2753458602 | 538 |
| 149 | iso_pu_bacteria | 2751185897 | 2753767221 | 538 |
| 150 | iso_pu_bacteria | 2756170246 | 2756673097 | 538 |
| 151 | iso_pu_bacteria | 2765235802 | 2765463851 | 538 |
| 152 | iso_pu_bacteria | 2767802442 | 2770197891 | 538 |
| 153 | iso_pu_bacteria | 2775506902 | 2776269036 | 538 |
| 154 | iso_pu_bacteria | 2775506904 | 2776283826 | 538 |
| 155 | iso_pu_bacteria | 2775507049 | 2776914563 | 538 |
| 156 | iso_pu_bacteria | 2775507255 | 2778124140 | 538 |
| 157 | iso_pu_bacteria | 2775507266 | 2778176002 | 538 |
| 158 | iso_pu_bacteria | 2791355082 | 2792582547 | 538 |
| 159 | iso_pu_bacteria | 2791355091 | 2792623009 | 538 |
| 160 | iso_pu_bacteria | 2791355092 | 2792629261 | 538 |
| 161 | iso_pu_bacteria | 2791355094 | 2792642725 | 538 |
| 162 | iso_pu_bacteria | 2802428858 | 2802717894 | 538 |
| 163 | iso_pu_bacteria | 2802428859 | 2802725255 | 538 |
| 164 | iso_pu_bacteria | 2802428860 | 2802730621 | 538 |
| 165 | iso_pu_bacteria | 2802428861 | 2802737968 | 538 |
| 166 | iso_pu_bacteria | 2802428862 | 2802744162 | 538 |
| 167 | iso_pu_bacteria | 2802428863 | 2802753153 | 538 |
| 168 | iso_pu_bacteria | 2802429268 | 2804753325 | 538 |
| 169 | iso_pu_bacteria | 2808606387 | 2808988763 | 538 |
| 170 | iso_pu_bacteria | 2808606401 | 2809063743 | 538 |
| 171 | iso_pu_bacteria | 2808606404 | 2809079639 | 538 |
| 172 | iso_pu_bacteria | 2808606405 | 2809084004 | 538 |
| 173 | iso_pu_bacteria | 2818991272 | 2819243809 | 538 |
| 174 | iso_pu_bacteria | 2818991439 | 2819561373 | 538 |
| 175 | iso_pu_bacteria | 2818991448 | 2819609607 | 538 |
| 176 | iso_pu_bacteria | 2818991453 | 2819639705 | 538 |
| 177 | iso_pu_bacteria | 2818991461 | 2819686414 | 538 |
| 178 | iso_pu_bacteria | 2818991466 | 2819714954 | 538 |
| 179 | iso_pu_bacteria | 2821123053 | 2821126152 | 538 |
| 180 | iso_pu_bacteria | 2838029111 | 2838033124 | 538 |
| 181 | iso_pu_bacteria | 2838074704 | 2838077437 | 538 |
| 182 | iso_pu_bacteria | 2838675328 | 2838679475 | 538 |
| 183 | iso_pu_bacteria | 2838714209 | 2838718832 | 538 |
| 184 | iso_pu_bacteria | 2838719591 | 2838723831 | 538 |
| 185 | iso_pu_bacteria | 2838724970 | 2838729153 | 538 |
| 186 | iso_pu_bacteria | 2839993093 | 2839993799 | 538 |
| 187 | iso_pu_bacteria | 2840764183 | 2840766823 | 538 |
| 188 | iso_pu_bacteria | 2841734538 | 2841734957 | 538 |
| 189 | iso_pu_bacteria | 2841840854 | 2841842258 | 538 |
| 190 | iso_pu_bacteria | 2841846520 | 2841851078 | 538 |
| 191 | iso_pu_bacteria | 2841859092 | 2841863883 | 538 |
| 192 | iso_pu_bacteria | 2842124991 | 2842129851 | 538 |
| 193 | iso_pu_bacteria | 2842130223 | 2842134406 | 538 |
| 194 | iso_pu_bacteria | 2842152218 | 2842156402 | 538 |
| 195 | iso_pu_bacteria | 2842170452 | 2842175078 | 538 |
| 196 | iso_pu_bacteria | 2842175837 | 2842179994 | 538 |
| 197 | iso_pu_bacteria | 2842187318 | 2842191587 | 538 |
| 198 | iso_pu_bacteria | 2842211629 | 2842215904 | 538 |
| 199 | iso_pu_bacteria | 2842224351 | 2842228596 | 538 |
| 200 | iso_pu_bacteria | 2842298080 | 2842298703 | 538 |
| 201 | iso_pu_bacteria | 2842357229 | 2842359430 | 538 |
| 202 | iso_pu_bacteria | 2842475841 | 2842479857 | 538 |
| 203 | iso_pu_bacteria | 2842482326 | 2842483397 | 538 |
| 204 | iso_pu_bacteria | 2842502639 | 2842507033 | 538 |
| 205 | iso_pu_bacteria | 2842509118 | 2842510726 | 538 |
| 206 | iso_pu_bacteria | 2842515876 | 2842520665 | 538 |
| 207 | iso_pu_bacteria | 2842521101 | 2842523198 | 538 |
| 208 | iso_pu_bacteria | 2842871566 | 2842875317 | 538 |
| 209 | iso_pu_bacteria | 2842922631 | 2842925865 | 538 |
| 210 | iso_pu_bacteria | 2844002411 | 2844005546 | 538 |
| 211 | iso_pu_bacteria | 2844009547 | 2844015651 | 538 |
| 212 | iso_pu_bacteria | 2844163670 | 2844169253 | 538 |
| 213 | iso_pu_bacteria | 2847417321 | 2847420448 | 538 |
| 214 | iso_pu_bacteria | 2847670302 | 2847672023 | 538 |
| 215 | iso_pu_bacteria | 2847686936 | 2847688333 | 538 |
| 216 | iso_pu_bacteria | 2848297114 | 2848300333 | 538 |
| 217 | iso_pu_bacteria | 2848992105 | 2848995321 | 538 |
| 218 | iso_pu_bacteria | 2850079185 | 2850082306 | 538 |
| 219 | iso_pu_bacteria | 2852387548 | 2852391210 | 538 |
| 220 | iso_pu_bacteria | 2855825444 | 2855827032 | 538 |
| 221 | iso_pu_bacteria | 2855839649 | 2855842429 | 538 |
| 222 | iso_pu_bacteria | 2855872281 | 2855878424 | 538 |
| 223 | iso_pu_bacteria | 2856314179 | 2856318237 | 538 |
| 224 | iso_pu_bacteria | 2856320880 | 2856324205 | 538 |
| 225 | iso_pu_bacteria | 2856328259 | 2856328633 | 538 |
| 226 | iso_pu_bacteria | 2856334872 | 2856341655 | 538 |
| 227 | iso_pu_bacteria | 2856342000 | 2856345364 | 538 |
| 228 | iso_pu_bacteria | 2856364286 | 2856364866 | 538 |
| 229 | iso_pu_bacteria | 2857349434 | 2857354878 | 538 |
| 230 | iso_pu_bacteria | 2857367948 | 2857370959 | 538 |
| 231 | iso_pu_bacteria | 2857531043 | 2857532713 | 538 |
| 232 | iso_pu_bacteria | 2858800743 | 2858803245 | 538 |
| 233 | iso_pu_bacteria | 2869162929 | 2869168116 | 538 |
| 234 | iso_pu_bacteria | 2869169390 | 2869171153 | 538 |
| 235 | iso_pu_bacteria | 2869234852 | 2869241007 | 538 |
| 236 | iso_pu_bacteria | 2869249662 | 2869251173 | 538 |
| 237 | iso_pu_bacteria | 2869256925 | 2869259420 | 538 |
| 238 | iso_pu_bacteria | 2869264136 | 2869271181 | 538 |
| 239 | iso_pu_bacteria | 2869271264 | 2869278533 | 538 |
| 240 | iso_pu_bacteria | 2869278585 | 2869281797 | 538 |
| 241 | iso_pu_bacteria | 2869285874 | 2869289685 | 538 |
| 242 | iso_pu_bacteria | 2871429161 | 2871431751 | 538 |
| 243 | iso_pu_bacteria | 2871444079 | 2871448418 | 538 |
| 244 | iso_pu_bacteria | 2871451962 | 2871453857 | 538 |
| 245 | iso_pu_bacteria | 2871459585 | 2871466058 | 538 |
| 246 | iso_pu_bacteria | 2871466892 | 2871474349 | 538 |
| 247 | iso_pu_bacteria | 2871474448 | 2871477062 | 538 |
| 248 | iso_pu_bacteria | 2871481445 | 2871482748 | 538 |
| 249 | iso_pu_bacteria | 2871488783 | 2871494133 | 538 |
| 250 | iso_pu_bacteria | 2871495908 | 2871498995 | 538 |
| 251 | iso_pu_bacteria | 2874102143 | 2874103957 | 538 |
| 252 | iso_pu_bacteria | 2874109183 | 2874110938 | 538 |
| 253 | iso_pu_bacteria | 2874116593 | 2874116936 | 538 |
| 254 | iso_pu_bacteria | 2874123672 | 2874127764 | 538 |
| 255 | iso_pu_bacteria | 2874139085 | 2874140525 | 538 |
| 256 | iso_pu_bacteria | 2874146452 | 2874155429 | 538 |
| 257 | iso_pu_bacteria | 2874155637 | 2874162286 | 538 |
| 258 | iso_pu_bacteria | 2874162495 | 2874166600 | 538 |
| 259 | iso_pu_bacteria | 2874168670 | 2874173101 | 538 |
| 260 | iso_pu_bacteria | 2876363079 | 2876366837 | 538 |
| 261 | iso_pu_bacteria | 2876369609 | 2876375112 | 538 |
| 262 | iso_pu_bacteria | 2876386047 | 2876387431 | 538 |
| 263 | iso_pu_bacteria | 2876392853 | 2876398812 | 538 |
| 264 | iso_pu_bacteria | 2876399893 | 2876404647 | 538 |
| 265 | iso_pu_bacteria | 2876413966 | 2876420774 | 538 |
| 266 | iso_pu_bacteria | 2876420981 | 2876427002 | 538 |
| 267 | iso_pu_bacteria | 2878035449 | 2878037549 | 538 |
| 268 | iso_pu_bacteria | 2878738818 | 2878739471 | 538 |
| 269 | iso_pu_bacteria | 2878745973 | 2878748357 | 538 |
| 270 | iso_pu_bacteria | 2878753008 | 2878756708 | 538 |
| 271 | iso_pu_bacteria | 2878760144 | 2878763205 | 538 |
| 272 | iso_pu_bacteria | 2878767105 | 2878770183 | 538 |
| 273 | iso_pu_bacteria | 2878774303 | 2878776233 | 538 |
| 274 | iso_pu_bacteria | 2878781027 | 2878786677 | 538 |
| 275 | iso_pu_bacteria | 2878788777 | 2878796645 | 538 |
| 276 | iso_pu_bacteria | 2880518877 | 2880519327 | 538 |
| 277 | iso_pu_bacteria | 2881147464 | 2881153952 | 538 |
| 278 | iso_pu_bacteria | 2881155292 | 2881157658 | 538 |
| 279 | iso_pu_bacteria | 2881845957 | 2881849650 | 538 |
| 280 | iso_pu_bacteria | 2881861095 | 2881862435 | 538 |
| 281 | iso_pu_bacteria | 2882632389 | 2882636938 | 538 |
| 282 | iso_pu_bacteria | 2882912400 | 2882913516 | 538 |
| 283 | iso_pu_bacteria | 2885305155 | 2885311960 | 538 |
| 284 | iso_pu_bacteria | 2885318864 | 2885320940 | 538 |
| 285 | iso_pu_bacteria | 2885326080 | 2885331744 | 538 |
| 286 | iso_pu_bacteria | 2885342637 | 2885347761 | 538 |
| 287 | iso_pu_bacteria | 2885350715 | 2885352697 | 538 |
| 288 | iso_pu_bacteria | 2888337043 | 2888341714 | 538 |
| 289 | iso_pu_bacteria | 2888343758 | 2888349006 | 538 |
| 290 | iso_pu_bacteria | 2888350351 | 2888350858 | 538 |
| 291 | iso_pu_bacteria | 2889010040 | 2889013204 | 538 |
| 292 | iso_pu_bacteria | 2889016732 | 2889021943 | 538 |
| 293 | iso_pu_bacteria | 2891048133 | 2891050803 | 538 |
| 294 | iso_pu_bacteria | 2894652903 | 2894653254 | 538 |
| 295 | iso_pu_bacteria | 2896384573 | 2896390002 | 538 |
| 296 | iso_pu_bacteria | 2899792073 | 2899794930 | 538 |
| 297 | iso_pu_bacteria | 2899803654 | 2899806428 | 538 |
| 298 | iso_pu_bacteria | 2899845264 | 2899850442 | 538 |
| 299 | iso_pu_bacteria | 2903448605 | 2903453695 | 538 |
| 300 | iso_pu_bacteria | 2903492973 | 2903502363 | 538 |
| 301 | iso_pu_bacteria | 2903492973 | 2903506034 | 538 |
| 302 | iso_pu_bacteria | 2903521522 | 2903524704 | 538 |
| 303 | iso_pu_bacteria | 2903528002 | 2903531053 | 538 |
| 304 | iso_pu_bacteria | 2903540706 | 2903543796 | 538 |
| 305 | iso_pu_bacteria | 2904578770 | 2904579508 | 538 |
| 306 | iso_pu_bacteria | 2904659560 | 2904665344 | 538 |
| 307 | iso_pu_bacteria | 2906308376 | 2906311974 | 538 |
| 308 | iso_pu_bacteria | 2906321335 | 2906323712 | 538 |
| 309 | iso_pu_bacteria | 2906328253 | 2906331497 | 538 |
| 310 | iso_pu_bacteria | 2906363423 | 2906366568 | 538 |
| 311 | iso_pu_bacteria | 2906370794 | 2906371144 | 538 |
| 312 | iso_pu_bacteria | 2906378014 | 2906382373 | 538 |
| 313 | iso_pu_bacteria | 2906386501 | 2906389228 | 538 |
| 314 | iso_pu_bacteria | 2906393657 | 2906394062 | 538 |
| 315 | iso_pu_bacteria | 2906401398 | 2906405891 | 538 |
| 316 | iso_pu_bacteria | 2906408224 | 2906408434 | 538 |
| 317 | iso_pu_bacteria | 2906414383 | 2906418274 | 538 |
| 318 | iso_pu_bacteria | 2906427513 | 2906431406 | 538 |
| 319 | iso_pu_bacteria | 2909042592 | 2909048300 | 538 |
| 320 | iso_pu_bacteria | 2913295892 | 2913299842 | 538 |
| 321 | iso_pu_bacteria | 2915980308 | 2915980565 | 538 |
| 322 | iso_pu_bacteria | 2915986958 | 2915991040 | 538 |
| 323 | iso_pu_bacteria | 2915993759 | 2915994942 | 538 |
| 324 | iso_pu_bacteria | 2916000859 | 2916001148 | 538 |
| 325 | iso_pu_bacteria | 2916007675 | 2916012251 | 538 |
| 326 | iso_pu_bacteria | 2916014648 | 2916016916 | 538 |
| 327 | iso_pu_bacteria | 2916021584 | 2916027779 | 538 |
| 328 | iso_pu_bacteria | 2916028427 | 2916030208 | 538 |
| 329 | iso_pu_bacteria | 2916035215 | 2916040812 | 538 |
| 330 | iso_pu_bacteria | 2916041962 | 2916044941 | 538 |
| 331 | iso_pu_bacteria | 2916048683 | 2916049295 | 538 |
| 332 | iso_pu_bacteria | 2916055098 | 2916058334 | 538 |
| 333 | iso_pu_bacteria | 2916061851 | 2916066290 | 538 |
| 334 | iso_pu_bacteria | 2916068649 | 2916071407 | 538 |
| 335 | iso_pu_bacteria | 2916076590 | 2916082027 | 538 |
| 336 | iso_pu_bacteria | 2919114240 | 2919118793 | 538 |
| 337 | iso_pu_bacteria | 2919119836 | 2919120828 | 538 |
| 338 | iso_pu_bacteria | 2919171160 | 2919173439 | 538 |
| 339 | iso_pu_bacteria | 2919408235 | 2919410672 | 538 |
| 340 | iso_pu_bacteria | 2919709256 | 2919710065 | 538 |
| 341 | iso_pu_bacteria | 2920760137 | 2920760756 | 538 |
| 342 | iso_pu_bacteria | 2920822456 | 2920828484 | 538 |
| 343 | iso_pu_bacteria | 2921201388 | 2921208402 | 538 |
| 344 | iso_pu_bacteria | 2921208531 | 2921212827 | 538 |
| 345 | iso_pu_bacteria | 2921237296 | 2921241898 | 538 |
| 346 | iso_pu_bacteria | 2921244191 | 2921244220 | 538 |
| 347 | iso_pu_bacteria | 2921250672 | 2921252505 | 538 |
| 348 | iso_pu_bacteria | 2921257292 | 2921260629 | 538 |
| 349 | iso_pu_bacteria | 2921263974 | 2921265999 | 538 |
| 350 | iso_pu_bacteria | 2921282425 | 2921287765 | 538 |
| 351 | iso_pu_bacteria | 2921289301 | 2921292842 | 538 |
| 352 | iso_pu_bacteria | 2921296804 | 2921302579 | 538 |
| 353 | iso_pu_bacteria | 2922151315 | 2922153482 | 538 |
| 354 | iso_pu_bacteria | 2922158528 | 2922159393 | 538 |
| 355 | iso_pu_bacteria | 2922172374 | 2922178143 | 538 |
| 356 | iso_pu_bacteria | 2922185730 | 2922192370 | 538 |
| 357 | iso_pu_bacteria | 2924144063 | 2924148817 | 538 |
| 358 | iso_pu_bacteria | 2924150972 | 2924152140 | 538 |
| 359 | iso_pu_bacteria | 2924158325 | 2924164076 | 538 |
| 360 | iso_pu_bacteria | 2924165586 | 2924172650 | 538 |
| 361 | iso_pu_bacteria | 2924172951 | 2924174456 | 538 |
| 362 | iso_pu_bacteria | 2924186466 | 2924191918 | 538 |
| 363 | iso_pu_bacteria | 2924193448 | 2924193776 | 538 |
| 364 | iso_pu_bacteria | 2924200457 | 2924206697 | 538 |
| 365 | iso_pu_bacteria | 2924207177 | 2924213129 | 538 |
| 366 | iso_pu_bacteria | 2924214083 | 2924214783 | 538 |
| 367 | iso_pu_bacteria | 2924221636 | 2924223982 | 538 |
| 368 | iso_pu_bacteria | 2924228884 | 2924232080 | 538 |
| 369 | iso_pu_bacteria | 2924726620 | 2924733144 | 538 |
| 370 | iso_pu_bacteria | 2924733363 | 2924736036 | 538 |
| 371 | iso_pu_bacteria | 2924741084 | 2924741299 | 538 |
| 372 | iso_pu_bacteria | 2924748358 | 2924751410 | 538 |
| 373 | iso_pu_bacteria | 2924754689 | 2924758618 | 538 |
| 374 | iso_pu_bacteria | 2924762789 | 2924764406 | 538 |
| 375 | iso_pu_bacteria | 2924776078 | 2924776996 | 538 |
| 376 | iso_pu_bacteria | 2924784321 | 2924788297 | 538 |
| 377 | iso_pu_bacteria | 2926754445 | 2926758186 | 538 |
| 378 | iso_pu_bacteria | 2926760298 | 2926764248 | 538 |
| 379 | iso_pu_bacteria | 2928521798 | 2928522304 | 538 |
| 380 | iso_pu_bacteria | 2929138655 | 2929141372 | 538 |
| 381 | iso_pu_bacteria | 2933006813 | 2933011176 | 538 |
| 382 | iso_pu_bacteria | 2933011516 | 2933016286 | 538 |
| 383 | iso_pu_bacteria | 2933594066 | 2933598997 | 538 |
| 384 | iso_pu_bacteria | 2936996657 | 2937000052 | 538 |
| 385 | iso_pu_bacteria | 2937002841 | 2937006987 | 538 |
| 386 | iso_pu_bacteria | 2937009748 | 2937015457 | 538 |
| 387 | iso_pu_bacteria | 2937016420 | 2937018176 | 538 |
| 388 | iso_pu_bacteria | 2937023124 | 2937024380 | 538 |
| 389 | iso_pu_bacteria | 2937029754 | 2937032992 | 538 |
| 390 | iso_pu_bacteria | 2937036028 | 2937042226 | 538 |
| 391 | iso_pu_bacteria | 2937042894 | 2937046727 | 538 |
| 392 | iso_pu_bacteria | 2937049772 | 2937052343 | 538 |
| 393 | iso_pu_bacteria | 2937056579 | 2937063152 | 538 |
| 394 | iso_pu_bacteria | 2937063883 | 2937067587 | 538 |
| 395 | iso_pu_bacteria | 2937071275 | 2937071401 | 538 |
| 396 | iso_pu_bacteria | 2937078374 | 2937078632 | 538 |
| 397 | iso_pu_bacteria | 2937084907 | 2937087309 | 538 |
| 398 | iso_pu_bacteria | 2937091812 | 2937093395 | 538 |
| 399 | iso_pu_bacteria | 2937098957 | 2937104714 | 538 |
| 400 | iso_pu_bacteria | 2937106411 | 2937106694 | 538 |
| 401 | iso_pu_bacteria | 2937113482 | 2937114575 | 538 |
| 402 | iso_pu_bacteria | 2937119839 | 2937123698 | 538 |
| 403 | iso_pu_bacteria | 2937126314 | 2937129324 | 538 |
| 404 | iso_pu_bacteria | 2937813078 | 2937818203 | 538 |
| 405 | iso_pu_bacteria | 2937822353 | 2937828407 | 538 |
| 406 | iso_pu_bacteria | 2937836603 | 2937838564 | 538 |
| 407 | iso_pu_bacteria | 2937848649 | 2937850650 | 538 |
| 408 | iso_pu_bacteria | 2937868953 | 2937872247 | 538 |
| 409 | iso_pu_bacteria | 2937877337 | 2937880301 | 538 |
| 410 | iso_pu_bacteria | 2937891427 | 2937896424 | 538 |
| 411 | iso_pu_bacteria | 2937972304 | 2937976166 | 538 |
| 412 | iso_pu_bacteria | 2937994558 | 2937997646 | 538 |
| 413 | iso_pu_bacteria | 2938014810 | 2938017994 | 538 |
| 414 | iso_pu_bacteria | 2941499720 | 2941501693 | 538 |
| 415 | iso_pu_bacteria | 2954011201 | 2954014274 | 538 |
| 416 | iso_pu_bacteria | 2957375807 | 2957376930 | 538 |
| 417 | iso_pu_bacteria | 2957382221 | 2957386085 | 538 |
| 418 | iso_pu_bacteria | 2957388812 | 2957390169 | 538 |
| 419 | iso_pu_bacteria | 2957395598 | 2957396767 | 538 |
| 420 | iso_pu_bacteria | 2957402308 | 2957406266 | 538 |
| 421 | iso_pu_bacteria | 2957408893 | 2957409019 | 538 |
| 422 | iso_pu_bacteria | 2957415311 | 2957422203 | 538 |
| 423 | iso_pu_bacteria | 2957422303 | 2957429556 | 538 |
| 424 | iso_pu_bacteria | 2957430029 | 2957436700 | 538 |
| 425 | iso_pu_bacteria | 2957437181 | 2957437390 | 538 |
| 426 | iso_pu_bacteria | 2957443900 | 2957449551 | 538 |
| 427 | iso_pu_bacteria | 2957450854 | 2957452780 | 538 |
| 428 | iso_pu_bacteria | 2957457609 | 2957459103 | 538 |
| 429 | iso_pu_bacteria | 2957464669 | 2957468195 | 538 |
| 430 | iso_pu_bacteria | 2957471148 | 2957471959 | 538 |
| 431 | iso_pu_bacteria | 2957478035 | 2957481020 | 538 |
| 432 | iso_pu_bacteria | 2957484790 | 2957488449 | 538 |
| 433 | iso_pu_bacteria | 2957491536 | 2957495273 | 538 |
| 434 | iso_pu_bacteria | 2957498199 | 2957501877 | 538 |
| 435 | iso_pu_bacteria | 2957505466 | 2957511425 | 538 |
| 436 | iso_pu_bacteria | 2958034702 | 2958037758 | 538 |
| 437 | iso_pu_bacteria | 2958041894 | 2958047470 | 538 |
| 438 | iso_pu_bacteria | 2958064165 | 2958066140 | 538 |
| 439 | iso_pu_bacteria | 2958071322 | 2958074608 | 538 |
| 440 | iso_pu_bacteria | 2958084443 | 2958087437 | 538 |
| 441 | iso_pu_bacteria | 2958100919 | 2958104024 | 538 |
| 442 | iso_pu_bacteria | 2958108152 | 2958112661 | 538 |
| 443 | iso_pu_bacteria | 2958115193 | 2958116707 | 538 |
| 444 | iso_pu_bacteria | 2958122699 | 2958128836 | 538 |
| 445 | iso_pu_bacteria | 2958130278 | 2958134058 | 538 |
| 446 | iso_pu_bacteria | 2958137437 | 2958143185 | 538 |
| 447 | iso_pu_bacteria | 2958144490 | 2958149067 | 538 |
| 448 | iso_pu_bacteria | 2958158011 | 2958160764 | 538 |
| 449 | iso_pu_bacteria | 2958165035 | 2958168120 | 538 |
| 450 | iso_pu_bacteria | 2958172287 | 2958175324 | 538 |
| 451 | iso_pu_bacteria | 2958179912 | 2958183704 | 538 |
| 452 | iso_pu_bacteria | 2960584000 | 2960584368 | 538 |
| 453 | iso_pu_bacteria | 2960591022 | 2960591280 | 538 |
| 454 | iso_pu_bacteria | 2960597568 | 2960598778 | 538 |
| 455 | iso_pu_bacteria | 2960603979 | 2960610216 | 538 |
| 456 | iso_pu_bacteria | 2960610863 | 2960617249 | 538 |
| 457 | iso_pu_bacteria | 2960617483 | 2960618759 | 538 |
| 458 | iso_pu_bacteria | 2960624210 | 2960629523 | 538 |
| 459 | iso_pu_bacteria | 2960631154 | 2960632532 | 538 |
| 460 | iso_pu_bacteria | 2960637947 | 2960639548 | 538 |
| 461 | iso_pu_bacteria | 2960645483 | 2960649391 | 538 |
| 462 | iso_pu_bacteria | 2960652885 | 2960653025 | 538 |
| 463 | iso_pu_bacteria | 2960660292 | 2960665272 | 538 |
| 464 | iso_pu_bacteria | 2960667422 | 2960671498 | 538 |
| 465 | iso_pu_bacteria | 2960674078 | 2960677374 | 538 |
| 466 | iso_pu_bacteria | 2960680706 | 2960681362 | 538 |
| 467 | iso_pu_bacteria | 2960687367 | 2960687934 | 538 |
| 468 | iso_pu_bacteria | 2960693952 | 2960697135 | 538 |
| 469 | iso_pu_bacteria | 2961077736 | 2961081670 | 538 |
| 470 | iso_pu_bacteria | 2961114664 | 2961120344 | 538 |
| 471 | iso_pu_bacteria | 2961127735 | 2961134131 | 538 |
| 472 | iso_pu_bacteria | 2961136820 | 2961143792 | 538 |
| 473 | iso_pu_bacteria | 2961163497 | 2961166585 | 538 |
| 474 | iso_pu_bacteria | 2961170736 | 2961172998 | 538 |
| 475 | iso_pu_bacteria | 2961183825 | 2961190661 | 538 |
| 476 | iso_pu_bacteria | 2963644680 | 2963649631 | 538 |
| 477 | iso_pu_bacteria | 2964607997 | 2964610855 | 538 |
| 478 | iso_pu_bacteria | 2964615318 | 2964620404 | 538 |
| 479 | iso_pu_bacteria | 2964621998 | 2964622784 | 538 |
| 480 | iso_pu_bacteria | 2964628898 | 2964632463 | 538 |
| 481 | iso_pu_bacteria | 2964636051 | 2964642640 | 538 |
| 482 | iso_pu_bacteria | 2964643177 | 2964647243 | 538 |
| 483 | iso_pu_bacteria | 2964649959 | 2964652267 | 538 |
| 484 | iso_pu_bacteria | 2964656573 | 2964658972 | 538 |
| 485 | iso_pu_bacteria | 2964663802 | 2964668859 | 538 |
| 486 | iso_pu_bacteria | 2964670856 | 2964677550 | 538 |
| 487 | iso_pu_bacteria | 2964678106 | 2964681793 | 538 |
| 488 | iso_pu_bacteria | 2964685014 | 2964690928 | 538 |
| 489 | iso_pu_bacteria | 2964691889 | 2964693198 | 538 |
| 490 | iso_pu_bacteria | 2964698721 | 2964705194 | 538 |
| 491 | iso_pu_bacteria | 2964705432 | 2964706192 | 538 |
| 492 | iso_pu_bacteria | 2964712639 | 2964719117 | 538 |
| 493 | iso_pu_bacteria | 2964719344 | 2964724783 | 538 |
| 494 | iso_pu_bacteria | 2965018300 | 2965021408 | 538 |
| 495 | iso_pu_bacteria | 2965025482 | 2965026254 | 538 |
| 496 | iso_pu_bacteria | 2965040258 | 2965046571 | 538 |
| 497 | iso_pu_bacteria | 2965047637 | 2965048134 | 538 |
| 498 | iso_pu_bacteria | 2965062239 | 2965070160 | 538 |
| 499 | iso_pu_bacteria | 2965089291 | 2965094975 | 538 |
| 500 | iso_pu_bacteria | 2965102966 | 2965106513 | 538 |
| 501 | iso_pu_bacteria | 2965119406 | 2965125059 | 538 |
| 502 | iso_pu_bacteria | 2967664464 | 2967666712 | 538 |
| 503 | iso_pu_bacteria | 2967671571 | 2967674346 | 538 |
| 504 | iso_pu_bacteria | 2967678726 | 2967685630 | 538 |
| 505 | iso_pu_bacteria | 2967686174 | 2967686511 | 538 |
| 506 | iso_pu_bacteria | 2967693043 | 2967696161 | 538 |
| 507 | iso_pu_bacteria | 2967699805 | 2967705622 | 538 |
| 508 | iso_pu_bacteria | 2967706974 | 2967708381 | 538 |
| 509 | iso_pu_bacteria | 2967714385 | 2967715779 | 538 |
| 510 | iso_pu_bacteria | 2967721400 | 2967721968 | 538 |
| 511 | iso_pu_bacteria | 2967728569 | 2967732484 | 538 |
| 512 | iso_pu_bacteria | 2967735183 | 2967735385 | 538 |
| 513 | iso_pu_bacteria | 2967742019 | 2967746872 | 538 |
| 514 | iso_pu_bacteria | 2967748971 | 2967755026 | 538 |
| 515 | iso_pu_bacteria | 2967755722 | 2967759045 | 538 |
| 516 | iso_pu_bacteria | 2967762386 | 2967768815 | 538 |
| 517 | iso_pu_bacteria | 2967769361 | 2967774589 | 538 |
| 518 | iso_pu_bacteria | 2967775926 | 2967781366 | 538 |
| 519 | iso_pu_bacteria | 2967996073 | 2967998209 | 538 |
| 520 | iso_pu_bacteria | 2968003550 | 2968008861 | 538 |
| 521 | iso_pu_bacteria | 2968016561 | 2968019394 | 538 |
| 522 | iso_pu_bacteria | 2968083720 | 2968087059 | 538 |
| 523 | iso_pu_bacteria | 2968091066 | 2968095703 | 538 |
| 524 | iso_pu_bacteria | 2968097103 | 2968099623 | 538 |
| 525 | iso_pu_bacteria | 2968110612 | 2968116811 | 538 |
| 526 | iso_pu_bacteria | 2968117919 | 2968118537 | 538 |
| 527 | iso_pu_bacteria | 2968128360 | 2968131869 | 538 |
| 528 | iso_pu_bacteria | 2968138860 | 2968145478 | 538 |
| 529 | iso_pu_bacteria | 2968171901 | 2968174990 | 538 |
| 530 | iso_pu_bacteria | 2970019648 | 2970022180 | 538 |
| 531 | iso_pu_bacteria | 2970026789 | 2970030226 | 538 |
| 532 | iso_pu_bacteria | 2970033650 | 2970040615 | 538 |
| 533 | iso_pu_bacteria | 2970040964 | 2970044329 | 538 |
| 534 | iso_pu_bacteria | 2970047711 | 2970050543 | 538 |
| 535 | iso_pu_bacteria | 2970054988 | 2970061094 | 538 |
| 536 | iso_pu_bacteria | 2970061556 | 2970067017 | 538 |
| 537 | iso_pu_bacteria | 2970068827 | 2970069483 | 538 |
| 538 | iso_pu_bacteria | 2970076120 | 2970079118 | 538 |
| 539 | iso_pu_bacteria | 2970082768 | 2970083426 | 538 |
| 540 | iso_pu_bacteria | 2970088815 | 2970090036 | 538 |
| 541 | iso_pu_bacteria | 2970095765 | 2970099122 | 538 |
| 542 | iso_pu_bacteria | 2970102677 | 2970108867 | 538 |
| 543 | iso_pu_bacteria | 2970109326 | 2970115294 | 538 |
| 544 | iso_pu_bacteria | 2970116247 | 2970121601 | 538 |
| 545 | iso_pu_bacteria | 2970122695 | 2970126462 | 538 |
| 546 | iso_pu_bacteria | 2970129317 | 2970134336 | 538 |
| 547 | iso_pu_bacteria | 2970136068 | 2970140712 | 538 |
| 548 | iso_pu_bacteria | 2970143518 | 2970144545 | 538 |
| 549 | iso_pu_bacteria | 2970149975 | 2970155609 | 538 |
| 550 | iso_pu_bacteria | 2970156795 | 2970160265 | 538 |
| 551 | iso_pu_bacteria | 2970164137 | 2970166725 | 538 |
| 552 | iso_pu_bacteria | 2970170962 | 2970173384 | 538 |
| 553 | iso_pu_bacteria | 2970177841 | 2970183306 | 538 |
| 554 | iso_pu_bacteria | 2970184632 | 2970191299 | 538 |
| 555 | iso_pu_bacteria | 2970191845 | 2970195642 | 538 |
| 556 | iso_pu_bacteria | 2970469710 | 2970472715 | 538 |
| 557 | iso_pu_bacteria | 2970489779 | 2970494722 | 538 |
| 558 | iso_pu_bacteria | 2970503327 | 2970505592 | 538 |
| 559 | iso_pu_bacteria | 2970510686 | 2970515893 | 538 |
| 560 | iso_pu_bacteria | 2970524798 | 2970529212 | 538 |
| 561 | iso_pu_bacteria | 2970540015 | 2970544105 | 538 |
| 562 | iso_pu_bacteria | 2970547951 | 2970550662 | 538 |
| 563 | iso_pu_bacteria | 2970554993 | 2970558049 | 538 |
| 564 | iso_pu_bacteria | 2970593180 | 2970596401 | 538 |
| 565 | iso_pu_bacteria | 2970627176 | 2970627440 | 538 |
| 566 | iso_pu_bacteria | 2977516862 | 2977522106 | 538 |
| 567 | iso_pu_bacteria | 2977523885 | 2977530046 | 538 |
| 568 | iso_pu_bacteria | 2977530762 | 2977532474 | 538 |
| 569 | iso_pu_bacteria | 2977537788 | 2977541006 | 538 |
| 570 | iso_pu_bacteria | 2977544691 | 2977551087 | 538 |
| 571 | iso_pu_bacteria | 2977551784 | 2977556886 | 538 |
| 572 | iso_pu_bacteria | 2977558990 | 2977564105 | 538 |
| 573 | iso_pu_bacteria | 2977565890 | 2977569148 | 538 |
| 574 | iso_pu_bacteria | 2977572785 | 2977577973 | 538 |
| 575 | iso_pu_bacteria | 2977579622 | 2977579749 | 538 |
| 576 | iso_pu_bacteria | 2977821940 | 2977825888 | 538 |
| 577 | iso_pu_bacteria | 2977843712 | 2977851299 | 538 |
| 578 | iso_pu_bacteria | 2977851361 | 2977854973 | 538 |
| 579 | iso_pu_bacteria | 2977864932 | 2977869118 | 538 |
| 580 | iso_pu_bacteria | 2977872689 | 2977874979 | 538 |
| 581 | iso_pu_bacteria | 2977898635 | 2977906753 | 538 |
| 582 | iso_pu_bacteria | 2977907340 | 2977909601 | 538 |
| 583 | iso_pu_bacteria | 2977915119 | 2977915806 | 538 |
| 584 | iso_pu_bacteria | 2977922695 | 2977927661 | 538 |
| 585 | iso_pu_bacteria | 2977935797 | 2977938614 | 538 |
| 586 | iso_pu_bacteria | 2977942078 | 2977946661 | 538 |
| 587 | iso_pu_bacteria | 2977950692 | 2977955364 | 538 |
| 588 | iso_pu_bacteria | 2977957713 | 2977960418 | 538 |
| 589 | iso_pu_bacteria | 2977986579 | 2977988407 | 538 |
| 590 | iso_pu_bacteria | 2979089926 | 2979090651 | 538 |
| 591 | iso_pu_bacteria | 2979100975 | 2979101702 | 538 |
| 592 | iso_pu_bacteria | 2979710463 | 2979711941 | 538 |
| 593 | iso_pu_bacteria | 2979764755 | 2979766495 | 538 |
| 594 | iso_pu_bacteria | 2979772303 | 2979776260 | 538 |
| 595 | iso_pu_bacteria | 2979779861 | 2979781254 | 538 |
| 596 | iso_pu_bacteria | 2979793036 | 2979799060 | 538 |
| 597 | iso_pu_bacteria | 2979808191 | 2979810313 | 538 |
| 598 | iso_pu_bacteria | 2984509177 | 2984510345 | 538 |
| 599 | iso_pu_bacteria | 2984518228 | 2984518950 | 538 |
| 600 | iso_pu_bacteria | 2984537506 | 2984538693 | 538 |
| 601 | iso_pu_bacteria | 2984601300 | 2984605401 | 538 |
| 602 | iso_pu_bacteria | 2987636660 | 2987643480 | 538 |
| 603 | iso_pu_bacteria | 2987645492 | 2987646271 | 538 |
| 604 | iso_pu_bacteria | 2987652177 | 2987654961 | 538 |
| 605 | iso_pu_bacteria | 2987659509 | 2987662596 | 538 |
| 606 | iso_pu_bacteria | 2987666974 | 2987672748 | 538 |
| 607 | iso_pu_bacteria | 2987673487 | 2987679207 | 538 |
| 608 | iso_pu_bacteria | 2989771324 | 2989773534 | 538 |
| 609 | iso_pu_bacteria | 2989776772 | 2989780341 | 538 |
| 610 | iso_pu_bacteria | 2996336353 | 2996340114 | 538 |
| 611 | iso_pu_bacteria | 2996341866 | 2996347103 | 538 |
| 612 | iso_pu_bacteria | 2996348954 | 2996352152 | 538 |
| 613 | iso_pu_bacteria | 2996386984 | 2996391957 | 538 |
| 614 | iso_pu_bacteria | 3000135777 | 3000142066 | 538 |
| 615 | iso_pu_bacteria | 3003930520 | 3003934934 | 538 |
| 616 | iso_pu_bacteria | 3004167301 | 3004171130 | 538 |
| 617 | iso_pu_bacteria | 3004188549 | 3004191647 | 538 |
| 618 | iso_pu_bacteria | 3004195979 | 3004196161 | 538 |
| 619 | iso_pu_bacteria | 3004203850 | 3004207025 | 538 |
| 620 | iso_pu_bacteria | 3004211236 | 3004213945 | 538 |
| 621 | iso_pu_bacteria | 3004218560 | 3004223536 | 538 |
| 622 | iso_pu_bacteria | 3004232784 | 3004234148 | 538 |
| 623 | iso_pu_bacteria | 3004239961 | 3004245161 | 538 |
| 624 | iso_pu_bacteria | 3004248173 | 3004252682 | 538 |
| 625 | iso_pu_bacteria | 3004268573 | 3004273277 | 538 |
| 626 | iso_pu_bacteria | 3004275668 | 3004278850 | 538 |
| 627 | iso_pu_bacteria | 3004334049 | 3004339182 | 538 |
| 628 | iso_pu_bacteria | 3005416602 | 3005418493 | 538 |
| 629 | iso_pu_bacteria | 637000159 | 637079347 | 538 |
| 630 | iso_pu_bacteria | 648276728 | 648735844 | 538 |
| 631 | iso_pu_bacteria | 649633066 | 649874801 | 538 |
| 632 | iso_pu_bacteria | 650716007 | 650843709 | 538 |
| 633 | iso_pu_bacteria | 8002285264 | 8002288006 | 538 |
| 634 | iso_pu_bacteria | 8003570095 | 8003574029 | 538 |
| 635 | iso_pu_bacteria | 8003992118 | 8003994970 | 538 |
| 636 | iso_pu_bacteria | 8003999396 | 8004002733 | 538 |
| 637 | iso_pu_bacteria | 8004300914 | 8004306068 | 538 |
| 638 | iso_pu_bacteria | 8004312739 | 8004313995 | 538 |
| 639 | iso_pu_bacteria | 8004361976 | 8004367360 | 538 |
| 640 | iso_pu_bacteria | 8004374579 | 8004378296 | 538 |
| 641 | iso_pu_bacteria | 8004387939 | 8004391563 | 538 |
| 642 | iso_pu_bacteria | 8004445564 | 8004448520 | 538 |
| 643 | iso_pu_bacteria | 8004633249 | 8004634615 | 538 |
| 644 | iso_pu_bacteria | 8004640170 | 8004646152 | 538 |
| 645 | iso_pu_bacteria | 8004703790 | 8004705034 | 538 |
| 646 | iso_pu_bacteria | 8004714634 | 8004716932 | 538 |
| 647 | iso_pu_bacteria | 8004727605 | 8004733486 | 538 |
| 648 | iso_pu_bacteria | 8005246636 | 8005249572 | 538 |
| 649 | iso_pu_bacteria | 8005314921 | 8005318615 | 538 |
| 650 | iso_pu_bacteria | 8005484373 | 8005488500 | 538 |
| 651 | iso_pu_bacteria | 8005645114 | 8005648967 | 538 |
| 652 | iso_pu_bacteria | 8005658619 | 8005662459 | 538 |
| 653 | iso_pu_bacteria | 8005682033 | 8005682207 | 538 |
| 654 | iso_pu_bacteria | 8024486573 | 8024487014 | 538 |
| 655 | iso_pu_bacteria | 8046767195 | 8046773227 | 538 |
| 656 | iso_pu_bacteria | 8049293176 | 8049295940 | 538 |
| 657 | iso_pu_bacteria | 8054558443 | 8054563398 | 538 |
| 658 | iso_pu_bacteria | 8055431914 | 8055432039 | 538 |
| 659 | iso_pu_bacteria | 8055617313 | 8055623275 | 538 |
| 660 | iso_pu_bacteria | 8056875544 | 8056876154 | 538 |
| 661 | iso_pu_bacteria | 8057575449 | 8057581037 | 538 |
| 662 | iso_pu_bacteria | 2534681786 | 2535485677 | 539 |
| 663 | iso_pu_bacteria | 2643221541 | 2643727653 | 539 |
| 664 | iso_pu_bacteria | 2643221568 | 2643858138 | 539 |
| 665 | iso_pu_bacteria | 2643221580 | 2643913070 | 539 |
| 666 | iso_pu_bacteria | 2643221591 | 2643962873 | 539 |
| 667 | iso_pu_bacteria | 2643221605 | 2644037273 | 539 |
| 668 | iso_pu_bacteria | 2643221606 | 2644041187 | 539 |
| 669 | iso_pu_bacteria | 2643221629 | 2644166973 | 539 |
| 670 | iso_pu_bacteria | 2643221637 | 2644209872 | 539 |
| 671 | iso_pu_bacteria | 2643221662 | 2644349486 | 539 |
| 672 | iso_pu_bacteria | 2643221671 | 2644394726 | 539 |
| 673 | iso_pu_bacteria | 2643221674 | 2644411476 | 539 |
| 674 | iso_pu_bacteria | 2643221718 | 2644653423 | 539 |
| 675 | iso_pu_bacteria | 2751185800 | 2753358401 | 539 |
| 676 | iso_pu_bacteria | 2757320392 | 2757570207 | 539 |
| 677 | iso_pu_bacteria | 2854911287 | 2854913918 | 539 |
| 678 | iso_pu_bacteria | 2891373044 | 2891377518 | 539 |
| 679 | iso_pu_bacteria | 2915650412 | 2915650787 | 539 |
| 680 | iso_pu_bacteria | 2919166419 | 2919169885 | 539 |
| 681 | iso_pu_bacteria | 2932401849 | 2932402605 | 539 |
| 682 | iso_pu_bacteria | 2978969890 | 2978972348 | 539 |
| 683 | iso_pu_bacteria | 2984587000 | 2984590579 | 539 |
| 684 | iso_pu_bacteria | 2989349275 | 2989354643 | 539 |
| 685 | iso_pu_bacteria | 8054460903 | 8054463451 | 539 |
| 686 | 3300005518 | Ga0070699_100080177 | Ga0070699_1000801772 | 540 |
| 687 | iso_pu_bacteria | 2837651117 | 2837654216 | 540 |
| 688 | iso_pu_bacteria | 2838736955 | 2838737373 | 540 |
| 689 | iso_pu_bacteria | 2842140634 | 2842142037 | 540 |
| 690 | iso_pu_bacteria | 2854896431 | 2854900240 | 540 |
| 691 | iso_pu_bacteria | 2854916844 | 2854919158 | 540 |
| 692 | 3300006847 | Ga0075431_100004625 | Ga0075431_1000046255 | 541 |
| 693 | 3300009147 | Ga0114129_10009933 | Ga0114129_100099337 | 541 |
| 694 | 3300029957 | Ga0265324_10001826 | Ga0265324_1000182614 | 541 |
| 695 | 3300031250 | Ga0265331_10000377 | Ga0265331_1000037747 | 541 |
| 696 | 3300031251 | Ga0265327_10000100 | Ga0265327_10000100149 | 541 |
| 697 | 3300044712 | Ga0453684_0008423 | Ga0453684_0008423_7569_9197 | 541 |
| 698 | 3300053153 | Ga0500616_0035918 | Ga0500616_0035918_791_2428 | 541 |
| 699 | iso_pu_bacteria | 2791355253 | 2793281626 | 541 |
| 700 | 3300001915 | JGI24741J21665_1001749 | JGI24741J21665_10017495 | 542 |
| 701 | 3300001979 | JGI24740J21852_10016205 | JGI24740J21852_100162052 | 542 |
| 702 | 3300001989 | JGI24739J22299_10001947 | JGI24739J22299_100019474 | 542 |
| 703 | 3300002067 | JGI24735J21928_10003491 | JGI24735J21928_100034916 | 542 |
| 704 | 3300002704 | JGI25155J39150_1000007 | JGI25155J39150_100000710 | 542 |
| 705 | 3300002704 | JGI25155J39150_1000012 | JGI25155J39150_1000012163 | 542 |
| 706 | 3300002705 | JGI25156J39149_1000036 | JGI25156J39149_100003617 | 542 |
| 707 | 3300002737 | JGI25162J39368_1000719 | JGI25162J39368_10007192 | 542 |
| 708 | 3300002737 | JGI25162J39368_1002558 | JGI25162J39368_10025585 | 542 |
| 709 | 3300002738 | JGI25154J39366_1000033 | JGI25154J39366_10000339 | 542 |
| 710 | 3300002739 | JGI25158J39367_1001179 | JGI25158J39367_10011793 | 542 |
| 711 | 3300002741 | JGI25157J39369_1000124 | JGI25157J39369_100012432 | 542 |
| 712 | 3300002987 | JGI25159J45721_1000032 | JGI25159J45721_100003229 | 542 |
| 713 | 3300002987 | JGI25159J45721_1000471 | JGI25159J45721_10004714 | 542 |
| 714 | 3300003214 | JGI25165J46597_1000016 | JGI25165J46597_1000016123 | 542 |
| 715 | 3300003214 | JGI25165J46597_1000598 | JGI25165J46597_10005988 | 542 |
| 716 | 3300003214 | JGI25165J46597_1001390 | JGI25165J46597_10013903 | 542 |
| 717 | 3300003354 | JGI25160J50197_1000006 | JGI25160J50197_100000673 | 542 |
| 718 | 3300003354 | JGI25160J50197_1000009 | JGI25160J50197_100000956 | 542 |
| 719 | 3300003374 | JGI25161J50226_1000004 | JGI25161J50226_100000473 | 542 |
| 720 | 3300003374 | JGI25161J50226_1000240 | JGI25161J50226_100024023 | 542 |
| 721 | 3300003762 | Ga0055542_1000452 | Ga0055542_100045235 | 542 |
| 722 | 3300003775 | Ga0055524_1001608 | Ga0055524_10016087 | 542 |
| 723 | 3300003781 | Ga0055536_1000808 | Ga0055536_100080820 | 542 |
| 724 | 3300003781 | Ga0055536_1000890 | Ga0055536_10008902 | 542 |
| 725 | 3300003781 | Ga0055536_1007545 | Ga0055536_10075452 | 542 |
| 726 | 3300003791 | Ga0055530_10010289 | Ga0055530_100102892 | 542 |
| 727 | 3300003792 | Ga0055540_1000988 | Ga0055540_100098819 | 542 |
| 728 | 3300003794 | Ga0055531_10010623 | Ga0055531_100106233 | 542 |
| 729 | 3300003856 | Ga0058692_1001375 | Ga0058692_10013757 | 542 |
| 730 | 3300003856 | Ga0058692_1001590 | Ga0058692_10015902 | 542 |
| 731 | 3300004625 | Ga0055543_1000002 | Ga0055543_1000002261 | 542 |
| 732 | 3300004625 | Ga0055543_1000055 | Ga0055543_100005557 | 542 |
| 733 | 3300005262 | Ga0065165_1000020 | Ga0065165_1000020213 | 542 |
| 734 | 3300005262 | Ga0065165_1000391 | Ga0065165_100039149 | 542 |
| 735 | 3300005327 | Ga0070658_10043203 | Ga0070658_100432033 | 542 |
| 736 | 3300005539 | Ga0068853_100010670 | Ga0068853_1000106705 | 542 |
| 737 | 3300005548 | Ga0070665_100004575 | Ga0070665_10000457514 | 542 |
| 738 | 3300005548 | Ga0070665_100037169 | Ga0070665_1000371692 | 542 |
| 739 | 3300005563 | Ga0068855_100169901 | Ga0068855_1001699012 | 542 |
| 740 | 3300005614 | Ga0068856_100033227 | Ga0068856_1000332273 | 542 |
| 741 | 3300005834 | Ga0068851_10007577 | Ga0068851_100075774 | 542 |
| 742 | 3300005834 | Ga0068851_10014685 | Ga0068851_100146852 | 542 |
| 743 | 3300005844 | Ga0068862_100000208 | Ga0068862_10000020840 | 542 |
| 744 | 3300005983 | Ga0081540_1004499 | Ga0081540_10044997 | 542 |
| 745 | 3300006038 | Ga0075365_10014528 | Ga0075365_100145282 | 542 |
| 746 | 3300006042 | Ga0075368_10000169 | Ga0075368_100001695 | 542 |
| 747 | 3300006048 | Ga0075363_100003056 | Ga0075363_1000030562 | 542 |
| 748 | 3300006048 | Ga0075363_100017379 | Ga0075363_1000173792 | 542 |
| 749 | 3300006051 | Ga0075364_10000197 | Ga0075364_100001978 | 542 |
| 750 | 3300006177 | Ga0075362_10001832 | Ga0075362_100018322 | 542 |
| 751 | 3300006177 | Ga0075362_10022538 | Ga0075362_100225382 | 542 |
| 752 | 3300006177 | Ga0075362_10035910 | Ga0075362_100359101 | 542 |
| 753 | 3300006178 | Ga0075367_10002319 | Ga0075367_100023193 | 542 |
| 754 | 3300006186 | Ga0075369_10011135 | Ga0075369_100111352 | 542 |
| 755 | 3300006186 | Ga0075369_10014425 | Ga0075369_100144252 | 542 |
| 756 | 3300006946 | Ga0079104_1000042 | Ga0079104_100004299 | 542 |
| 757 | 3300006946 | Ga0079104_1001097 | Ga0079104_10010974 | 542 |
| 758 | 3300006946 | Ga0079104_1007902 | Ga0079104_10079023 | 542 |
| 759 | 3300006948 | Ga0099826_10001501 | Ga0099826_100015013 | 542 |
| 760 | 3300006948 | Ga0099826_10012183 | Ga0099826_100121832 | 542 |
| 761 | 3300009093 | Ga0105240_10000019 | Ga0105240_10000019165 | 542 |
| 762 | 3300009101 | Ga0105247_10023880 | Ga0105247_100238802 | 542 |
| 763 | 3300009174 | Ga0105241_10159830 | Ga0105241_101598301 | 542 |
| 764 | 3300009545 | Ga0105237_10001085 | Ga0105237_100010858 | 542 |
| 765 | 3300009551 | Ga0105238_10040925 | Ga0105238_100409253 | 542 |
| 766 | 3300009553 | Ga0105249_10000184 | Ga0105249_1000018433 | 542 |
| 767 | 3300010375 | Ga0105239_10028356 | Ga0105239_100283562 | 542 |
| 768 | 3300010375 | Ga0105239_10095033 | Ga0105239_100950332 | 542 |
| 769 | 3300013100 | Ga0157373_10001083 | Ga0157373_1000108318 | 542 |
| 770 | 3300013100 | Ga0157373_10013052 | Ga0157373_100130523 | 542 |
| 771 | 3300013102 | Ga0157371_10000219 | Ga0157371_1000021932 | 542 |
| 772 | 3300013104 | Ga0157370_10000037 | Ga0157370_100000375 | 542 |
| 773 | 3300013104 | Ga0157370_10000824 | Ga0157370_1000082410 | 542 |
| 774 | 3300013105 | Ga0157369_10185724 | Ga0157369_101857241 | 542 |
| 775 | 3300013249 | Ga0171463_1006 | Ga0171463_1006266 | 542 |
| 776 | 3300015262 | Ga0182007_10000679 | Ga0182007_1000067910 | 542 |
| 777 | 3300015690 | Ga0183363_1195 | Ga0183363_119511 | 542 |
| 778 | 3300017792 | Ga0163161_10025315 | Ga0163161_100253152 | 542 |
| 779 | 3300021320 | Ga0214544_1000063 | Ga0214544_100006330 | 542 |
| 780 | 3300021321 | Ga0214542_1000095 | Ga0214542_100009520 | 542 |
| 781 | 3300021327 | Ga0214543_1000008 | Ga0214543_1000008221 | 542 |
| 782 | 3300021327 | Ga0214543_1000026 | Ga0214543_100002620 | 542 |
| 783 | 3300022739 | Ga0228711_1000003 | Ga0228711_1000003149 | 542 |
| 784 | 3300022740 | Ga0228710_1000003 | Ga0228710_1000003155 | 542 |
| 785 | 3300025206 | Ga0209435_100005 | Ga0209435_100005163 | 542 |
| 786 | 3300025233 | Ga0209437_100078 | Ga0209437_100078186 | 542 |
| 787 | 3300025233 | Ga0209437_100291 | Ga0209437_10029149 | 542 |
| 788 | 3300025246 | Ga0209646_1000011 | Ga0209646_1000011163 | 542 |
| 789 | 3300025246 | Ga0209646_1003337 | Ga0209646_10033372 | 542 |
| 790 | 3300025250 | Ga0209026_1000008 | Ga0209026_1000008163 | 542 |
| 791 | 3300025253 | Ga0209677_103659 | Ga0209677_1036593 | 542 |
| 792 | 3300025254 | Ga0209148_1000056 | Ga0209148_100005628 | 542 |
| 793 | 3300025256 | Ga0209759_1000004 | Ga0209759_1000004163 | 542 |
| 794 | 3300025261 | Ga0209233_1000068 | Ga0209233_1000068124 | 542 |
| 795 | 3300025261 | Ga0209233_1000157 | Ga0209233_100015710 | 542 |
| 796 | 3300025261 | Ga0209233_1000192 | Ga0209233_100019229 | 542 |
| 797 | 3300025261 | Ga0209233_1000194 | Ga0209233_100019425 | 542 |
| 798 | 3300025272 | Ga0209455_1000285 | Ga0209455_100028529 | 542 |
| 799 | 3300025284 | Ga0209130_1000032 | Ga0209130_100003269 | 542 |
| 800 | 3300025284 | Ga0209130_1000037 | Ga0209130_1000037213 | 542 |
| 801 | 3300025292 | Ga0209676_1001584 | Ga0209676_100158410 | 542 |
| 802 | 3300025294 | Ga0209025_1000196 | Ga0209025_100019695 | 542 |
| 803 | 3300025295 | Ga0209564_1000086 | Ga0209564_100008657 | 542 |
| 804 | 3300025297 | Ga0209758_1000576 | Ga0209758_10005768 | 542 |
| 805 | 3300025297 | Ga0209758_1007656 | Ga0209758_10076563 | 542 |
| 806 | 3300025298 | Ga0209050_1002937 | Ga0209050_10029377 | 542 |
| 807 | 3300025299 | Ga0209256_1000321 | Ga0209256_100032128 | 542 |
| 808 | 3300025299 | Ga0209256_1001676 | Ga0209256_10016765 | 542 |
| 809 | 3300025302 | Ga0207426_1000048 | Ga0207426_1000048253 | 542 |
| 810 | 3300025302 | Ga0207426_1000077 | Ga0207426_100007769 | 542 |
| 811 | 3300025303 | Ga0209051_1001367 | Ga0209051_10013679 | 542 |
| 812 | 3300025303 | Ga0209051_1007845 | Ga0209051_10078452 | 542 |
| 813 | 3300025304 | Ga0209257_1001330 | Ga0209257_10013309 | 542 |
| 814 | 3300025304 | Ga0209257_1005220 | Ga0209257_10052205 | 542 |
| 815 | 3300025904 | Ga0207647_10015537 | Ga0207647_100155372 | 542 |
| 816 | 3300025909 | Ga0207705_10055854 | Ga0207705_100558542 | 542 |
| 817 | 3300025911 | Ga0207654_10012470 | Ga0207654_100124702 | 542 |
| 818 | 3300025913 | Ga0207695_10000049 | Ga0207695_10000049167 | 542 |
| 819 | 3300025914 | Ga0207671_10000107 | Ga0207671_100001072 | 542 |
| 820 | 3300025924 | Ga0207694_10036721 | Ga0207694_100367212 | 542 |
| 821 | 3300025961 | Ga0207712_10000059 | Ga0207712_1000005933 | 542 |
| 822 | 3300026041 | Ga0207639_10003348 | Ga0207639_100033485 | 542 |
| 823 | 3300026041 | Ga0207639_10136590 | Ga0207639_101365902 | 542 |
| 824 | 3300026067 | Ga0207678_10002692 | Ga0207678_100026927 | 542 |
| 825 | 3300026078 | Ga0207702_10086723 | Ga0207702_100867232 | 542 |
| 826 | 3300026116 | Ga0207674_10010673 | Ga0207674_100106731 | 542 |
| 827 | 3300026142 | Ga0207698_10014125 | Ga0207698_100141251 | 542 |
| 828 | 3300027111 | Ga0209281_1000081 | Ga0209281_1000081149 | 542 |
| 829 | 3300027111 | Ga0209281_1000141 | Ga0209281_100014136 | 542 |
| 830 | 3300027111 | Ga0209281_1000194 | Ga0209281_100019499 | 542 |
| 831 | 3300027312 | Ga0209371_1001388 | Ga0209371_10013888 | 542 |
| 832 | 3300027666 | Ga0209282_1000036 | Ga0209282_100003689 | 542 |
| 833 | 3300027666 | Ga0209282_1000230 | Ga0209282_100023012 | 542 |
| 834 | 3300027666 | Ga0209282_1009311 | Ga0209282_10093112 | 542 |
| 835 | 3300027866 | Ga0209813_10000024 | Ga0209813_1000002424 | 542 |
| 836 | 3300028379 | Ga0268266_10003563 | Ga0268266_100035632 | 542 |
| 837 | 3300028380 | Ga0268265_10000225 | Ga0268265_1000022517 | 542 |
| 838 | 3300028381 | Ga0268264_10000691 | Ga0268264_100006915 | 542 |
| 839 | 3300028794 | Ga0307515_10000263 | Ga0307515_1000026378 | 542 |
| 840 | 3300028794 | Ga0307515_10008205 | Ga0307515_1000820510 | 542 |
| 841 | 3300030500 | Ga0268256_1001900 | Ga0268256_10019008 | 542 |
| 842 | 3300031235 | Ga0265330_10018642 | Ga0265330_100186421 | 542 |
| 843 | 3300031249 | Ga0265339_10023092 | Ga0265339_100230923 | 542 |
| 844 | 3300031456 | Ga0307513_10001607 | Ga0307513_1000160731 | 542 |
| 845 | 3300031456 | Ga0307513_10078170 | Ga0307513_100781702 | 542 |
| 846 | 3300031548 | Ga0307408_100010969 | Ga0307408_1000109692 | 542 |
| 847 | 3300031731 | Ga0307405_10068784 | Ga0307405_100687842 | 542 |
| 848 | 3300031911 | Ga0307412_10033535 | Ga0307412_100335352 | 542 |
| 849 | 3300031967 | Ga0315914_1000002 | Ga0315914_1000002255 | 542 |
| 850 | 3300033430 | Ga0315913_1000009 | Ga0315913_100000989 | 542 |
| 851 | 3300033464 | Ga0315915_1000005 | Ga0315915_1000005255 | 542 |
| 852 | 3300035695 | Ga0373927_0000822 | Ga0373927_0000822_19438_21066 | 542 |
| 853 | 3300037068 | Ga0373925_0007056 | Ga0373925_0007056_3441_5069 | 542 |
| 854 | 3300037312 | Ga0395899_0000090 | Ga0395899_0000090_127526_129154 | 542 |
| 855 | 3300037418 | Ga0395900_0000017 | Ga0395900_0000017_340500_342128 | 542 |
| 856 | 3300037418 | Ga0395900_0157016 | Ga0395900_0157016_95_1723 | 542 |
| 857 | 3300037466 | Ga0395898_0000030 | Ga0395898_0000030_340475_342103 | 542 |
| 858 | 3300037471 | Ga0395905_0000081 | Ga0395905_0000081_131307_132935 | 542 |
| 859 | 3300037471 | Ga0395905_0003702 | Ga0395905_0003702_11016_12644 | 542 |
| 860 | 3300037471 | Ga0395905_0006130 | Ga0395905_0006130_8090_9718 | 542 |
| 861 | 3300038443 | Ga0395901_0000015 | Ga0395901_0000015_27475_29103 | 542 |
| 862 | 3300038443 | Ga0395901_0113368 | Ga0395901_0113368_445_2073 | 542 |
| 863 | 3300039438 | Ga0436360_1160663 | Ga0436360_1160663_35_1663 | 542 |
| 864 | 3300042007 | Ga0439449_0000555 | Ga0439449_0000555_2402_4030 | 542 |
| 865 | 3300046453 | Ga0495627_000800 | Ga0495627_000800_19776_21404 | 542 |
| 866 | 3300046460 | Ga0495638_0012855 | Ga0495638_0012855_863_2491 | 542 |
| 867 | 3300046506 | Ga0495583_0000625 | Ga0495583_0000625_34152_35780 | 542 |
| 868 | 3300046512 | Ga0495610_0000095 | Ga0495610_0000095_80630_82258 | 542 |
| 869 | 3300046519 | Ga0495632_0001666 | Ga0495632_0001666_11390_13018 | 542 |
| 870 | 3300046520 | Ga0495637_0020445 | Ga0495637_0020445_666_2294 | 542 |
| 871 | 3300046522 | Ga0495643_0071276 | Ga0495643_0071276_169_1797 | 542 |
| 872 | 3300046524 | Ga0495648_0000308 | Ga0495648_0000308_52617_54245 | 542 |
| 873 | 3300046524 | Ga0495648_0002254 | Ga0495648_0002254_90_1718 | 542 |
| 874 | 3300046530 | Ga0495654_0002299 | Ga0495654_0002299_3360_4988 | 542 |
| 875 | 3300046558 | Ga0495633_0005773 | Ga0495633_0005773_1691_3319 | 542 |
| 876 | 3300046692 | Ga0495671_0000034 | Ga0495671_0000034_179604_181232 | 542 |
| 877 | 3300047317 | Ga0495604_0005557 | Ga0495604_0005557_2728_4356 | 542 |
| 878 | 3300047469 | Ga0495673_0000013 | Ga0495673_0000013_252305_253933 | 542 |
| 879 | 3300047470 | Ga0495681_0000008 | Ga0495681_0000008_112282_113910 | 542 |
| 880 | 3300048913 | Ga0496110_0001911 | Ga0496110_0001911_7036_8664 | 542 |
| 881 | 3300048915 | Ga0496112_0007768 | Ga0496112_0007768_2038_3666 | 542 |
| 882 | 3300048920 | Ga0496117_0074251 | Ga0496117_0074251_626_2254 | 542 |
| 883 | 3300048921 | Ga0496118_0007823 | Ga0496118_0007823_7296_8924 | 542 |
| 884 | 3300048922 | Ga0496119_0090993 | Ga0496119_0090993_62_1690 | 542 |
| 885 | 3300048924 | Ga0496121_0000003 | Ga0496121_0000003_996538_998166 | 542 |
| 886 | 3300048924 | Ga0496121_0055972 | Ga0496121_0055972_1127_2755 | 542 |
| 887 | 3300048924 | Ga0496121_0057655 | Ga0496121_0057655_946_2574 | 542 |
| 888 | 3300048924 | Ga0496121_0098706 | Ga0496121_0098706_101_1729 | 542 |
| 889 | 3300048925 | Ga0496122_0005520 | Ga0496122_0005520_6378_8006 | 542 |
| 890 | 3300048926 | Ga0496123_0006646 | Ga0496123_0006646_2030_3658 | 542 |
| 891 | 3300048926 | Ga0496123_0038991 | Ga0496123_0038991_1655_3283 | 542 |
| 892 | 3300048927 | Ga0496124_0000413 | Ga0496124_0000413_30940_32568 | 542 |
| 893 | 3300048927 | Ga0496124_0036929 | Ga0496124_0036929_2388_4016 | 542 |
| 894 | 3300048927 | Ga0496124_0083363 | Ga0496124_0083363_32_1660 | 542 |
| 895 | 3300048927 | Ga0496124_0110200 | Ga0496124_0110200_414_2042 | 542 |
| 896 | 3300048928 | Ga0496125_0000345 | Ga0496125_0000345_66035_67663 | 542 |
| 897 | 3300048928 | Ga0496125_0000898 | Ga0496125_0000898_7984_9612 | 542 |
| 898 | 3300048929 | Ga0496126_0064254 | Ga0496126_0064254_398_2026 | 542 |
| 899 | 3300048929 | Ga0496126_0152560 | Ga0496126_0152560_269_1897 | 542 |
| 900 | 3300049568 | Ga0501031_0008271 | Ga0501031_0008271_3958_5586 | 542 |
| 901 | 3300049569 | Ga0501032_0000008 | Ga0501032_0000008_48502_50130 | 542 |
| 902 | 3300049569 | Ga0501032_0000156 | Ga0501032_0000156_33159_34787 | 542 |
| 903 | 3300049569 | Ga0501032_0018295 | Ga0501032_0018295_2349_3977 | 542 |
| 904 | 3300049570 | Ga0501033_0000012 | Ga0501033_0000012_191494_193122 | 542 |
| 905 | 3300049570 | Ga0501033_0000423 | Ga0501033_0000423_5631_7259 | 542 |
| 906 | 3300049570 | Ga0501033_0000967 | Ga0501033_0000967_17135_18763 | 542 |
| 907 | 3300049570 | Ga0501033_0017829 | Ga0501033_0017829_2113_3741 | 542 |
| 908 | 3300049570 | Ga0501033_0040138 | Ga0501033_0040138_934_2562 | 542 |
| 909 | 3300049571 | Ga0501034_0000035 | Ga0501034_0000035_191494_193122 | 542 |
| 910 | 3300049571 | Ga0501034_0000087 | Ga0501034_0000087_20630_22258 | 542 |
| 911 | 3300049571 | Ga0501034_0005300 | Ga0501034_0005300_10352_11980 | 542 |
| 912 | 3300049571 | Ga0501034_0072305 | Ga0501034_0072305_1815_3443 | 542 |
| 913 | 3300049572 | Ga0501036_0000006 | Ga0501036_0000006_191494_193122 | 542 |
| 914 | 3300049572 | Ga0501036_0000885 | Ga0501036_0000885_2475_4103 | 542 |
| 915 | 3300049573 | Ga0501037_0000014 | Ga0501037_0000014_148777_150405 | 542 |
| 916 | 3300049573 | Ga0501037_0000072 | Ga0501037_0000072_48502_50130 | 542 |
| 917 | 3300049573 | Ga0501037_0000386 | Ga0501037_0000386_27171_28799 | 542 |
| 918 | 3300049574 | Ga0501038_0000007 | Ga0501038_0000007_48502_50130 | 542 |
| 919 | 3300049574 | Ga0501038_0000023 | Ga0501038_0000023_129219_130847 | 542 |
| 920 | 3300049575 | Ga0501039_0000012 | Ga0501039_0000012_191494_193122 | 542 |
| 921 | 3300049575 | Ga0501039_0000101 | Ga0501039_0000101_20614_22242 | 542 |
| 922 | 3300049579 | Ga0501043_0000022 | Ga0501043_0000022_67047_68675 | 542 |
| 923 | 3300049579 | Ga0501043_0000194 | Ga0501043_0000194_20614_22242 | 542 |
| 924 | 3300049579 | Ga0501043_0000211 | Ga0501043_0000211_48502_50130 | 542 |
| 925 | 3300049579 | Ga0501043_0025797 | Ga0501043_0025797_1938_3566 | 542 |
| 926 | 3300049580 | Ga0501046_0006281 | Ga0501046_0006281_6724_8352 | 542 |
| 927 | 3300049581 | Ga0501047_0012399 | Ga0501047_0012399_3533_5161 | 542 |
| 928 | 3300049581 | Ga0501047_0013458 | Ga0501047_0013458_5958_7586 | 542 |
| 929 | 3300049581 | Ga0501047_0108091 | Ga0501047_0108091_998_2626 | 542 |
| 930 | 3300049583 | Ga0501067_0001395 | Ga0501067_0001395_1705_3333 | 542 |
| 931 | 3300049584 | Ga0501068_0029719 | Ga0501068_0029719_1494_3122 | 542 |
| 932 | 3300049585 | Ga0501069_0000035 | Ga0501069_0000035_67029_68657 | 542 |
| 933 | 3300049585 | Ga0501069_0007570 | Ga0501069_0007570_217_1845 | 542 |
| 934 | 3300049585 | Ga0501069_0019293 | Ga0501069_0019293_64_1692 | 542 |
| 935 | 3300049586 | Ga0501070_0000103 | Ga0501070_0000103_13803_15431 | 542 |
| 936 | 3300049586 | Ga0501070_0004303 | Ga0501070_0004303_7661_9289 | 542 |
| 937 | 3300049586 | Ga0501070_0019274 | Ga0501070_0019274_1608_3236 | 542 |
| 938 | 3300049586 | Ga0501070_0021642 | Ga0501070_0021642_1598_3226 | 542 |
| 939 | 3300049586 | Ga0501070_0028028 | Ga0501070_0028028_2259_3887 | 542 |
| 940 | 3300049586 | Ga0501070_0097608 | Ga0501070_0097608_462_2090 | 542 |
| 941 | 3300049587 | Ga0501071_0007568 | Ga0501071_0007568_2513_4141 | 542 |
| 942 | 3300049589 | Ga0501073_0087934 | Ga0501073_0087934_48_1676 | 542 |
| 943 | 3300049590 | Ga0501074_0000530 | Ga0501074_0000530_19531_21159 | 542 |
| 944 | 3300049705 | Ga0501225_0000041 | Ga0501225_0000041_5565_7193 | 542 |
| 945 | 3300049742 | Ga0501080_0002529 | Ga0501080_0002529_12946_14574 | 542 |
| 946 | 3300049742 | Ga0501080_0059072 | Ga0501080_0059072_1904_3532 | 542 |
| 947 | 3300049742 | Ga0501080_0110528 | Ga0501080_0110528_764_2392 | 542 |
| 948 | 3300049744 | Ga0501083_0001316 | Ga0501083_0001316_9871_11499 | 542 |
| 949 | 3300049822 | Ga0501035_0000035 | Ga0501035_0000035_116787_118415 | 542 |
| 950 | 3300049822 | Ga0501035_0000139 | Ga0501035_0000139_19648_21276 | 542 |
| 951 | 3300049822 | Ga0501035_0003975 | Ga0501035_0003975_8298_9926 | 542 |
| 952 | 3300049822 | Ga0501035_0005080 | Ga0501035_0005080_8302_9930 | 542 |
| 953 | 3300049822 | Ga0501035_0007697 | Ga0501035_0007697_5001_6629 | 542 |
| 954 | 3300049822 | Ga0501035_0020763 | Ga0501035_0020763_2882_4510 | 542 |
| 955 | 3300049822 | Ga0501035_0021403 | Ga0501035_0021403_933_2561 | 542 |
| 956 | 3300049822 | Ga0501035_0098783 | Ga0501035_0098783_693_2321 | 542 |
| 957 | 3300049823 | Ga0501044_0000015 | Ga0501044_0000015_48502_50130 | 542 |
| 958 | 3300049823 | Ga0501044_0000578 | Ga0501044_0000578_15639_17267 | 542 |
| 959 | 3300049823 | Ga0501044_0025845 | Ga0501044_0025845_2423_4051 | 542 |
| 960 | 3300049823 | Ga0501044_0054117 | Ga0501044_0054117_350_1978 | 542 |
| 961 | 3300050489 | nmdc:mga03683_17874_c1 | nmdc:mga03683_17874_c1_162_1790 | 542 |
| 962 | 3300050492 | nmdc:mga0yw44_215_c1 | nmdc:mga0yw44_215_c1_17383_19011 | 542 |
| 963 | 3300050494 | nmdc:mga06z11_50_c1 | nmdc:mga06z11_50_c1_23593_25221 | 542 |
| 964 | 3300050495 | nmdc:mga04h51_64_c1 | nmdc:mga04h51_64_c1_8152_9780 | 542 |
| 965 | 3300050516 | nmdc:mga0sz30_2883_c1 | nmdc:mga0sz30_2883_c1_789_2417 | 542 |
| 966 | 3300053091 | Ga0500647_0048447 | Ga0500647_0048447_126_1754 | 542 |
| 967 | 3300053140 | Ga0500573_0001779 | Ga0500573_0001779_6745_8373 | 542 |
| 968 | 3300053156 | Ga0500622_0000286 | Ga0500622_0000286_36415_38043 | 542 |
| 969 | 3300053157 | Ga0500624_000052 | Ga0500624_000052_56699_58327 | 542 |
| 970 | 3300053161 | Ga0500634_0008242 | Ga0500634_0008242_1668_3296 | 542 |
| 971 | 3300053729 | Ga0500625_000002 | Ga0500625_000002_327232_328860 | 542 |
| 972 | 3300054114 | Ga0501084_0105017 | Ga0501084_0105017_292_1920 | 542 |
| 973 | 3300059505 | Ga0587083_0000805 | Ga0587083_0000805_553_2181 | 542 |
| 974 | 3300059605 | Ga0587106_001679 | Ga0587106_001679_25_1653 | 542 |
| 975 | 3300059652 | Ga0587107_001384 | Ga0587107_001384_61_1689 | 542 |
| 976 | 3300060344 | Ga0587071_004023 | Ga0587071_004023_222_1850 | 542 |
| 977 | 3300060353 | Ga0501082_0027147 | Ga0501082_0027147_1516_3144 | 542 |
| 978 | 3300002076 | JGI24749J21850_1000140 | JGI24749J21850_10001402 | 543 |
| 979 | 3300002459 | JGI24751J29686_10000002 | JGI24751J29686_10000002114 | 543 |
| 980 | 3300003187 | JGI25151J46595_10002604 | JGI25151J46595_100026042 | 543 |
| 981 | 3300005289 | Ga0065704_10072336 | Ga0065704_100723364 | 543 |
| 982 | 3300005295 | Ga0065707_10082484 | Ga0065707_100824843 | 543 |
| 983 | 3300005327 | Ga0070658_10049911 | Ga0070658_100499112 | 543 |
| 984 | 3300005327 | Ga0070658_10053212 | Ga0070658_100532122 | 543 |
| 985 | 3300005331 | Ga0070670_100000012 | Ga0070670_10000001286 | 543 |
| 986 | 3300005339 | Ga0070660_100005401 | Ga0070660_1000054015 | 543 |
| 987 | 3300005344 | Ga0070661_100015071 | Ga0070661_1000150712 | 543 |
| 988 | 3300005344 | Ga0070661_100021909 | Ga0070661_1000219093 | 543 |
| 989 | 3300005344 | Ga0070661_100077814 | Ga0070661_1000778142 | 543 |
| 990 | 3300005347 | Ga0070668_100000004 | Ga0070668_10000000418 | 543 |
| 991 | 3300005347 | Ga0070668_100061855 | Ga0070668_1000618551 | 543 |
| 992 | 3300005353 | Ga0070669_100000041 | Ga0070669_10000004122 | 543 |
| 993 | 3300005355 | Ga0070671_100000441 | Ga0070671_10000044119 | 543 |
| 994 | 3300005356 | Ga0070674_100004462 | Ga0070674_1000044625 | 543 |
| 995 | 3300005364 | Ga0070673_100056587 | Ga0070673_1000565872 | 543 |
| 996 | 3300005367 | Ga0070667_100000037 | Ga0070667_10000003716 | 543 |
| 997 | 3300005367 | Ga0070667_100000045 | Ga0070667_10000004571 | 543 |
| 998 | 3300005455 | Ga0070663_100044009 | Ga0070663_1000440092 | 543 |
| 999 | 3300005539 | Ga0068853_100001387 | Ga0068853_1000013875 | 543 |
| 1000 | 3300005548 | Ga0070665_100007021 | Ga0070665_1000070219 | 543 |
| 1001 | 3300005563 | Ga0068855_100141062 | Ga0068855_1001410622 | 543 |
| 1002 | 3300005578 | Ga0068854_100008328 | Ga0068854_1000083284 | 543 |
| 1003 | 3300005614 | Ga0068856_100002980 | Ga0068856_10000298012 | 543 |
| 1004 | 3300005616 | Ga0068852_100000578 | Ga0068852_1000005787 | 543 |
| 1005 | 3300005618 | Ga0068864_100000010 | Ga0068864_100000010182 | 543 |
| 1006 | 3300005618 | Ga0068864_100014044 | Ga0068864_1000140443 | 543 |
| 1007 | 3300005834 | Ga0068851_10012961 | Ga0068851_100129613 | 543 |
| 1008 | 3300005841 | Ga0068863_100004471 | Ga0068863_1000044718 | 543 |
| 1009 | 3300005841 | Ga0068863_100019178 | Ga0068863_1000191784 | 543 |
| 1010 | 3300005842 | Ga0068858_100000466 | Ga0068858_10000046617 | 543 |
| 1011 | 3300005843 | Ga0068860_100000002 | Ga0068860_100000002590 | 543 |
| 1012 | 3300005843 | Ga0068860_100000073 | Ga0068860_10000007370 | 543 |
| 1013 | 3300005843 | Ga0068860_100052296 | Ga0068860_1000522962 | 543 |
| 1014 | 3300005844 | Ga0068862_100000016 | Ga0068862_10000001676 | 543 |
| 1015 | 3300005844 | Ga0068862_100001423 | Ga0068862_10000142319 | 543 |
| 1016 | 3300006051 | Ga0075364_10042907 | Ga0075364_100429072 | 543 |
| 1017 | 3300006051 | Ga0075364_10110367 | Ga0075364_101103671 | 543 |
| 1018 | 3300009093 | Ga0105240_10002579 | Ga0105240_100025798 | 543 |
| 1019 | 3300009093 | Ga0105240_10003889 | Ga0105240_100038893 | 543 |
| 1020 | 3300009093 | Ga0105240_10202318 | Ga0105240_102023182 | 543 |
| 1021 | 3300009177 | Ga0105248_10000053 | Ga0105248_1000005328 | 543 |
| 1022 | 3300009545 | Ga0105237_10000333 | Ga0105237_1000033363 | 543 |
| 1023 | 3300009545 | Ga0105237_10027612 | Ga0105237_100276121 | 543 |
| 1024 | 3300009551 | Ga0105238_10015775 | Ga0105238_100157756 | 543 |
| 1025 | 3300009553 | Ga0105249_10116183 | Ga0105249_101161832 | 543 |
| 1026 | 3300010375 | Ga0105239_10000366 | Ga0105239_1000036641 | 543 |
| 1027 | 3300010375 | Ga0105239_10047006 | Ga0105239_100470063 | 543 |
| 1028 | 3300013102 | Ga0157371_10014027 | Ga0157371_100140274 | 543 |
| 1029 | 3300013104 | Ga0157370_10007830 | Ga0157370_100078303 | 543 |
| 1030 | 3300013104 | Ga0157370_10024754 | Ga0157370_100247542 | 543 |
| 1031 | 3300013105 | Ga0157369_10002685 | Ga0157369_100026858 | 543 |
| 1032 | 3300014326 | Ga0157380_10000134 | Ga0157380_100001345 | 543 |
| 1033 | 3300014968 | Ga0157379_10043295 | Ga0157379_100432953 | 543 |
| 1034 | 3300025231 | Ga0207427_102362 | Ga0207427_1023622 | 543 |
| 1035 | 3300025261 | Ga0209233_1000480 | Ga0209233_10004805 | 543 |
| 1036 | 3300025294 | Ga0209025_1000052 | Ga0209025_1000052159 | 543 |
| 1037 | 3300025909 | Ga0207705_10000004 | Ga0207705_1000000413 | 543 |
| 1038 | 3300025909 | Ga0207705_10001504 | Ga0207705_100015042 | 543 |
| 1039 | 3300025913 | Ga0207695_10016374 | Ga0207695_100163746 | 543 |
| 1040 | 3300025913 | Ga0207695_10026378 | Ga0207695_100263782 | 543 |
| 1041 | 3300025913 | Ga0207695_10044625 | Ga0207695_100446252 | 543 |
| 1042 | 3300025914 | Ga0207671_10000361 | Ga0207671_1000036134 | 543 |
| 1043 | 3300025914 | Ga0207671_10010693 | Ga0207671_100106933 | 543 |
| 1044 | 3300025919 | Ga0207657_10011321 | Ga0207657_100113215 | 543 |
| 1045 | 3300025919 | Ga0207657_10015965 | Ga0207657_100159653 | 543 |
| 1046 | 3300025920 | Ga0207649_10067406 | Ga0207649_100674062 | 543 |
| 1047 | 3300025923 | Ga0207681_10000013 | Ga0207681_10000013168 | 543 |
| 1048 | 3300025924 | Ga0207694_10016708 | Ga0207694_100167084 | 543 |
| 1049 | 3300025925 | Ga0207650_10000008 | Ga0207650_10000008249 | 543 |
| 1050 | 3300025925 | Ga0207650_10001003 | Ga0207650_1000100314 | 543 |
| 1051 | 3300025931 | Ga0207644_10000424 | Ga0207644_1000042419 | 543 |
| 1052 | 3300025941 | Ga0207711_10006215 | Ga0207711_100062154 | 543 |
| 1053 | 3300025949 | Ga0207667_10003331 | Ga0207667_1000333112 | 543 |
| 1054 | 3300025949 | Ga0207667_10012071 | Ga0207667_100120715 | 543 |
| 1055 | 3300025949 | Ga0207667_10116595 | Ga0207667_101165952 | 543 |
| 1056 | 3300025972 | Ga0207668_10000122 | Ga0207668_1000012219 | 543 |
| 1057 | 3300025981 | Ga0207640_10004035 | Ga0207640_100040355 | 543 |
| 1058 | 3300025981 | Ga0207640_10005794 | Ga0207640_100057943 | 543 |
| 1059 | 3300025981 | Ga0207640_10031937 | Ga0207640_100319372 | 543 |
| 1060 | 3300025986 | Ga0207658_10000002 | Ga0207658_10000002873 | 543 |
| 1061 | 3300025986 | Ga0207658_10000025 | Ga0207658_1000002590 | 543 |
| 1062 | 3300025986 | Ga0207658_10008204 | Ga0207658_100082042 | 543 |
| 1063 | 3300026035 | Ga0207703_10002501 | Ga0207703_1000250117 | 543 |
| 1064 | 3300026035 | Ga0207703_10009799 | Ga0207703_100097992 | 543 |
| 1065 | 3300026041 | Ga0207639_10000752 | Ga0207639_100007525 | 543 |
| 1066 | 3300026067 | Ga0207678_10112879 | Ga0207678_101128792 | 543 |
| 1067 | 3300026078 | Ga0207702_10000774 | Ga0207702_1000077411 | 543 |
| 1068 | 3300026078 | Ga0207702_10001580 | Ga0207702_1000158014 | 543 |
| 1069 | 3300026088 | Ga0207641_10000557 | Ga0207641_1000055717 | 543 |
| 1070 | 3300026088 | Ga0207641_10010897 | Ga0207641_100108974 | 543 |
| 1071 | 3300026095 | Ga0207676_10000012 | Ga0207676_10000012148 | 543 |
| 1072 | 3300026095 | Ga0207676_10010193 | Ga0207676_100101933 | 543 |
| 1073 | 3300026116 | Ga0207674_10105739 | Ga0207674_101057394 | 543 |
| 1074 | 3300026116 | Ga0207674_10140549 | Ga0207674_101405492 | 543 |
| 1075 | 3300026121 | Ga0207683_10059378 | Ga0207683_100593782 | 543 |
| 1076 | 3300026142 | Ga0207698_10000431 | Ga0207698_100004317 | 543 |
| 1077 | 3300028379 | Ga0268266_10000086 | Ga0268266_1000008668 | 543 |
| 1078 | 3300028379 | Ga0268266_10037051 | Ga0268266_100370512 | 543 |
| 1079 | 3300028380 | Ga0268265_10000006 | Ga0268265_10000006276 | 543 |
| 1080 | 3300028380 | Ga0268265_10000849 | Ga0268265_1000084914 | 543 |
| 1081 | 3300028381 | Ga0268264_10000001 | Ga0268264_100000011198 | 543 |
| 1082 | 3300028381 | Ga0268264_10000120 | Ga0268264_1000012085 | 543 |
| 1083 | 3300031239 | Ga0265328_10000449 | Ga0265328_100004499 | 543 |
| 1084 | 3300031250 | Ga0265331_10000109 | Ga0265331_1000010913 | 543 |
| 1085 | 3300031251 | Ga0265327_10000243 | Ga0265327_1000024384 | 543 |
| 1086 | 3300031251 | Ga0265327_10003763 | Ga0265327_1000376311 | 543 |
| 1087 | 3300031507 | Ga0307509_10043922 | Ga0307509_100439222 | 543 |
| 1088 | 3300031911 | Ga0307412_10001365 | Ga0307412_100013656 | 543 |
| 1089 | 3300037312 | Ga0395899_0114177 | Ga0395899_0114177_103_1734 | 543 |
| 1090 | 3300037418 | Ga0395900_0021967 | Ga0395900_0021967_4560_6191 | 543 |
| 1091 | 3300042876 | Ga0451577_0037775 | Ga0451577_0037775_2528_4177 | 543 |
| 1092 | 3300044659 | Ga0466973_0080647 | Ga0466973_0080647_1118_2749 | 543 |
| 1093 | 3300044712 | Ga0453684_0000006 | Ga0453684_0000006_1248009_1249658 | 543 |
| 1094 | 3300044712 | Ga0453684_0000048 | Ga0453684_0000048_204210_205859 | 543 |
| 1095 | 3300044901 | Ga0466960_0034799 | Ga0466960_0034799_135_1766 | 543 |
| 1096 | 3300045051 | Ga0451576_0000227 | Ga0451576_0000227_76872_78515 | 543 |
| 1097 | 3300046455 | Ga0495603_0007661 | Ga0495603_0007661_2330_3961 | 543 |
| 1098 | 3300046459 | Ga0495629_0002307 | Ga0495629_0002307_3959_5590 | 543 |
| 1099 | 3300046471 | Ga0495650_0003413 | Ga0495650_0003413_6301_7932 | 543 |
| 1100 | 3300046471 | Ga0495650_0003566 | Ga0495650_0003566_1666_3297 | 543 |
| 1101 | 3300046472 | Ga0495580_0033496 | Ga0495580_0033496_1320_2951 | 543 |
| 1102 | 3300046473 | Ga0495582_0004524 | Ga0495582_0004524_1132_2763 | 543 |
| 1103 | 3300046475 | Ga0495639_0009534 | Ga0495639_0009534_227_1858 | 543 |
| 1104 | 3300046506 | Ga0495583_0019645 | Ga0495583_0019645_315_1946 | 543 |
| 1105 | 3300046517 | Ga0495630_0056174 | Ga0495630_0056174_659_2290 | 543 |
| 1106 | 3300046528 | Ga0495642_0001260 | Ga0495642_0001260_1726_3357 | 543 |
| 1107 | 3300046535 | Ga0495586_0014478 | Ga0495586_0014478_1053_2684 | 543 |
| 1108 | 3300046543 | Ga0495645_0001395 | Ga0495645_0001395_6275_7906 | 543 |
| 1109 | 3300046689 | Ga0495613_0015634 | Ga0495613_0015634_1554_3185 | 543 |
| 1110 | 3300046794 | Ga0495589_0003359 | Ga0495589_0003359_749_2380 | 543 |
| 1111 | 3300047318 | Ga0495636_0026358 | Ga0495636_0026358_650_2281 | 543 |
| 1112 | 3300047444 | Ga0495675_0038110 | Ga0495675_0038110_1358_2989 | 543 |
| 1113 | 3300047470 | Ga0495681_0000057 | Ga0495681_0000057_36830_38461 | 543 |
| 1114 | 3300047673 | Ga0495593_0012920 | Ga0495593_0012920_420_2051 | 543 |
| 1115 | 3300048904 | Ga0496101_0027661 | Ga0496101_0027661_371_2002 | 543 |
| 1116 | 3300048905 | Ga0496102_0000088 | Ga0496102_0000088_93840_95471 | 543 |
| 1117 | 3300048905 | Ga0496102_0114742 | Ga0496102_0114742_629_2260 | 543 |
| 1118 | 3300048915 | Ga0496112_0181812 | Ga0496112_0181812_154_1785 | 543 |
| 1119 | 3300048916 | Ga0496113_0000241 | Ga0496113_0000241_2450_4081 | 543 |
| 1120 | 3300048917 | Ga0496114_0015662 | Ga0496114_0015662_2142_3773 | 543 |
| 1121 | 3300048919 | Ga0496116_0000097 | Ga0496116_0000097_78127_79758 | 543 |
| 1122 | 3300048920 | Ga0496117_0002381 | Ga0496117_0002381_2652_4283 | 543 |
| 1123 | 3300048921 | Ga0496118_0062082 | Ga0496118_0062082_1115_2746 | 543 |
| 1124 | 3300048925 | Ga0496122_0000024 | Ga0496122_0000024_201900_203531 | 543 |
| 1125 | 3300048925 | Ga0496122_0003171 | Ga0496122_0003171_2081_3712 | 543 |
| 1126 | 3300048926 | Ga0496123_0000086 | Ga0496123_0000086_125499_127130 | 543 |
| 1127 | 3300048927 | Ga0496124_0021788 | Ga0496124_0021788_2875_4506 | 543 |
| 1128 | 3300048928 | Ga0496125_0000651 | Ga0496125_0000651_48555_50186 | 543 |
| 1129 | 3300048929 | Ga0496126_0000119 | Ga0496126_0000119_103339_104970 | 543 |
| 1130 | 3300048929 | Ga0496126_0001430 | Ga0496126_0001430_5554_7185 | 543 |
| 1131 | 3300049569 | Ga0501032_0025815 | Ga0501032_0025815_1373_3004 | 543 |
| 1132 | 3300049571 | Ga0501034_0001581 | Ga0501034_0001581_4891_6525 | 543 |
| 1133 | 3300049571 | Ga0501034_0084264 | Ga0501034_0084264_1089_2720 | 543 |
| 1134 | 3300049571 | Ga0501034_0162278 | Ga0501034_0162278_68_1699 | 543 |
| 1135 | 3300049572 | Ga0501036_0119520 | Ga0501036_0119520_336_1967 | 543 |
| 1136 | 3300049581 | Ga0501047_0001346 | Ga0501047_0001346_25_1656 | 543 |
| 1137 | 3300049586 | Ga0501070_0017416 | Ga0501070_0017416_1919_3550 | 543 |
| 1138 | 3300053111 | Ga0500572_001775 | Ga0500572_001775_3332_4963 | 543 |
| 1139 | 3300053151 | Ga0500604_0000133 | Ga0500604_0000133_3880_5514 | 543 |
| 1140 | 3300053153 | Ga0500616_0022258 | Ga0500616_0022258_1573_3204 | 543 |
| 1141 | 3300053161 | Ga0500634_0000053 | Ga0500634_0000053_43944_45578 | 543 |
| 1142 | 3300053161 | Ga0500634_0047382 | Ga0500634_0047382_66_1700 | 543 |
| 1143 | 3300053177 | Ga0500636_0000005 | Ga0500636_0000005_101049_102680 | 543 |
| 1144 | 2162886007 | SwRhRL2b_contig_3683601 | SwRhRL2b_0247.00001430 | 544 |
| 1145 | 3300005262 | Ga0065165_1002742 | Ga0065165_10027423 | 544 |
| 1146 | 3300005289 | Ga0065704_10079957 | Ga0065704_100799573 | 544 |
| 1147 | 3300005353 | Ga0070669_100030363 | Ga0070669_1000303632 | 544 |
| 1148 | 3300005466 | Ga0070685_10021466 | Ga0070685_100214663 | 544 |
| 1149 | 3300005548 | Ga0070665_100047835 | Ga0070665_1000478353 | 544 |
| 1150 | 3300009978 | Ga0105148_100007 | Ga0105148_1000076 | 544 |
| 1151 | 3300010375 | Ga0105239_10000846 | Ga0105239_1000084644 | 544 |
| 1152 | 3300014326 | Ga0157380_10033757 | Ga0157380_100337574 | 544 |
| 1153 | 3300025229 | Ga0209147_100518 | Ga0209147_10051817 | 544 |
| 1154 | 3300028379 | Ga0268266_10104148 | Ga0268266_101041482 | 544 |
| 1155 | 3300028577 | Ga0265318_10004967 | Ga0265318_100049674 | 544 |
| 1156 | 3300031241 | Ga0265325_10021265 | Ga0265325_100212653 | 544 |
| 1157 | 3300031247 | Ga0265340_10011383 | Ga0265340_100113832 | 544 |
| 1158 | 3300031249 | Ga0265339_10026323 | Ga0265339_100263232 | 544 |
| 1159 | 3300031344 | Ga0265316_10060140 | Ga0265316_100601402 | 544 |
| 1160 | 3300031595 | Ga0265313_10013224 | Ga0265313_100132243 | 544 |
| 1161 | 3300031712 | Ga0265342_10015557 | Ga0265342_100155572 | 544 |
| 1162 | 3300037418 | Ga0395900_0062551 | Ga0395900_0062551_1634_3304 | 544 |
| 1163 | 3300037466 | Ga0395898_0022622 | Ga0395898_0022622_2712_4382 | 544 |
| 1164 | 3300046519 | Ga0495632_0000328 | Ga0495632_0000328_24133_25812 | 544 |
| 1165 | 3300046520 | Ga0495637_0006095 | Ga0495637_0006095_2137_3816 | 544 |
| 1166 | 3300046522 | Ga0495643_0000014 | Ga0495643_0000014_292590_294269 | 544 |
| 1167 | 3300046525 | Ga0495663_0000007 | Ga0495663_0000007_240948_242627 | 544 |
| 1168 | 3300046558 | Ga0495633_0000112 | Ga0495633_0000112_58190_59884 | 544 |
| 1169 | 3300046558 | Ga0495633_0000398 | Ga0495633_0000398_19812_21491 | 544 |
| 1170 | 3300046558 | Ga0495633_0047331 | Ga0495633_0047331_78_1781 | 544 |
| 1171 | 3300046674 | Ga0495588_0001064 | Ga0495588_0001064_1906_3609 | 544 |
| 1172 | 3300046692 | Ga0495671_0000032 | Ga0495671_0000032_179143_180822 | 544 |
| 1173 | 3300047323 | Ga0495683_0019282 | Ga0495683_0019282_684_2333 | 544 |
| 1174 | 3300047470 | Ga0495681_0049280 | Ga0495681_0049280_115_1794 | 544 |
| 1175 | 3300047472 | Ga0495686_0001495 | Ga0495686_0001495_23555_25225 | 544 |
| 1176 | 3300048907 | Ga0496104_0099974 | Ga0496104_0099974_952_2601 | 544 |
| 1177 | 3300048911 | Ga0496108_0019437 | Ga0496108_0019437_2056_3690 | 544 |
| 1178 | 3300048913 | Ga0496110_0090111 | Ga0496110_0090111_383_2017 | 544 |
| 1179 | 3300048920 | Ga0496117_0000066 | Ga0496117_0000066_109927_111630 | 544 |
| 1180 | 3300048921 | Ga0496118_0003408 | Ga0496118_0003408_9556_11259 | 544 |
| 1181 | 3300048922 | Ga0496119_0005553 | Ga0496119_0005553_4502_6190 | 544 |
| 1182 | 3300048924 | Ga0496121_0000682 | Ga0496121_0000682_50105_51739 | 544 |
| 1183 | 3300048924 | Ga0496121_0008021 | Ga0496121_0008021_1906_3540 | 544 |
| 1184 | 3300048925 | Ga0496122_0000057 | Ga0496122_0000057_141820_143523 | 544 |
| 1185 | 3300048925 | Ga0496122_0000107 | Ga0496122_0000107_37328_38962 | 544 |
| 1186 | 3300048926 | Ga0496123_0000063 | Ga0496123_0000063_154147_155781 | 544 |
| 1187 | 3300048926 | Ga0496123_0000096 | Ga0496123_0000096_30392_32095 | 544 |
| 1188 | 3300048927 | Ga0496124_0006506 | Ga0496124_0006506_6541_8244 | 544 |
| 1189 | 3300048927 | Ga0496124_0095267 | Ga0496124_0095267_765_2399 | 544 |
| 1190 | 3300049705 | Ga0501225_0002520 | Ga0501225_0002520_1127_2761 | 544 |
| 1191 | 3300050491 | nmdc:mga00v17_186_c2 | nmdc:mga00v17_186_c2_22394_24028 | 544 |
| 1192 | 3300050491 | nmdc:mga00v17_59_c2 | nmdc:mga00v17_59_c2_12899_14602 | 544 |
| 1193 | 3300050493 | nmdc:mga0k408_53436_c1 | nmdc:mga0k408_53436_c1_65_1768 | 544 |
| 1194 | 3300053137 | Ga0500561_0000021 | Ga0500561_0000021_29399_31102 | 544 |
| 1195 | 3300053153 | Ga0500616_0000709 | Ga0500616_0000709_3446_5080 | 544 |
| 1196 | 3300053157 | Ga0500624_000444 | Ga0500624_000444_1851_3554 | 544 |
| 1197 | iso_pu_bacteria | 2512564014 | 2512643596 | 544 |
| 1198 | iso_pu_bacteria | 2600254933 | 2600373650 | 544 |
| 1199 | iso_pu_bacteria | 2758568016 | 2758640629 | 544 |
| 1200 | iso_pu_bacteria | 3002141150 | 3002142224 | 544 |
| 1201 | iso_pu_bacteria | 643692032 | 643827088 | 544 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5vg7-assembly1.cif.gz_A | crystal structure of the r503q missense variant of human pgm1 | 0.9771 | 4 | 544 |
| 5vg7-assembly2.cif.gz_B | crystal structure of the r503q missense variant of human pgm1 | 0.9771 | 2 | 544 |
| 1c47-assembly1.cif.gz_B | binding driven structural changes in crystaline phosphoglucomutase associated with chemical reaction | 0.9761 | 4 | 544 |
| 5vbi-assembly2.cif.gz_B | crystal structure of the r515w missense variant of human pgm1 | 0.9751 | 1 | 544 |
| 5vec-assembly2.cif.gz_B | crystal structure of the r515l missense variant of human pgm1 | 0.9747 | 4 | 544 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5vinB03 | Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 | 0.9845 | 292 | 388 | 3.40.120.10 |
| af_A0A1D6GJ73_72_271_3.40.120.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 | 0.9586 | 3 | 188 | 3.40.120.10 |
| 1kfqA01 | Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 | 0.9583 | 4 | 188 | 3.40.120.10 |
| af_P33401_4_197_3.40.120.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 | 0.9546 | 4 | 188 | 3.40.120.10 |
| 4qg5B03 | Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 | 0.9523 | 295 | 406 | 3.40.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q3JFL8-F1-model_v4 | deleted | 0.9983 | 4 | 178 |
|
| AF-A0A529LXX2-F1-model_v4 | Alpha-D-glucose phosphate-specific phosphoglucomutase | 0.998 | 260 | 405 |
GO:0004614
GO:0005829 GO:0005975 |
| AF-A0A6P0XT78-F1-model_v4 | Alpha-D-glucose phosphate-specific phosphoglucomutase | 0.9973 | 5 | 129 |
GO:0000287
GO:0004614 GO:0005829 GO:0005975 |
| AF-A0A531AJ32-F1-model_v4 | phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent) (EC 5.4.2.2) | 0.9966 | 4 | 286 |
GO:0000287
GO:0004614 GO:0005829 GO:0005975 |
| AF-A0A4Q3HT85-F1-model_v4 | phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent) (EC 5.4.2.2) | 0.9959 | 4 | 379 |
GO:0000287
GO:0004614 GO:0005829 GO:0005975 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar