F491597

General Info

Members Datasets Scaffolds Average Seq Length
1201 608 1029 265

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_10163134|Ga0207702_101631343
Length 298
Sequence MSTRDLFTFRNGHFKIGVGITAVMLVVTAIAGFIVLPFAQPWVQFANVWDAICSAAGVPRRAASVTAPEQSKRLSEVVLTSHTLSRPSQEAIGRGATLAQRCAICHGPTGISRADSPNLAGQYAAVIYKELHDFRSGARTNAVMSPFAVNLTDQEIADLSNYYAYLPRLPAYHPTPLLPKPNIVIYGAPIRGIAPCGACHGSLDNKTGSPWLEGQSEAYMKAQLQAFASGERRNDISQQMRNIARAMTPQEIEQAAACSISCGEGGGLSPTVIASAAKQSRIPPRNDSGLLRRKGSSQ

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
3 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
4 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
5 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
6 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
7 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
8 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
9 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
10 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
11 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
12 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
15 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
16 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
17 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
18 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
19 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
20 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
21 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
22 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
23 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
24 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
25 2643221599 Rhizobium sp. Root708 Isolate Unclassified
26 2643221607 Rhizobium sp. Root73 Isolate Unclassified
27 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
28 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
29 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
30 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
31 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
32 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
33 2802429634 Rhizobium anhuiense S10 Isolate Nodule
34 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
35 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
36 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
37 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
38 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
39 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
40 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
41 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
42 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
43 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
44 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
45 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
46 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
47 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
48 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
49 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
50 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
51 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
52 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
53 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
54 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
55 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
56 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
57 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
58 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
59 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
60 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
61 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
62 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
63 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
64 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
65 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
66 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
67 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
68 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
69 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
70 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
71 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
72 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
73 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
74 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
75 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
76 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
77 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
78 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
79 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
80 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
81 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
82 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
83 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
84 2904699407
85 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
86 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
87 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
88 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
89 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
90 2922368715
91 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
92 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
93 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
94 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
95 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
96 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
97 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
98 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
99 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
100 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
101 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
102 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
103 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
104 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
105 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
106 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
107 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
108 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
109 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
110 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
111 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
112 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
113 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
114 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
115 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
116 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
117 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
118 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
119 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
120 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
121 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
122 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
123 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
124 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
125 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
126 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
127 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
128 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
129 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
130 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
131 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
132 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
133 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
134 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
135 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
136 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
137 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
138 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
139 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
140 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
141 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
142 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
143 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
144 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
145 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
146 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
147 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
148 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
149 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
150 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
151 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
152 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
153 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
154 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
155 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
156 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
157 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
158 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
159 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
160 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
161 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
162 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
163 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
164 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
165 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
166 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
167 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
168 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
169 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
170 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
171 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
172 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
173 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
174 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
175 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
176 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
177 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
178 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
179 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
180 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
181 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
182 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
183 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
184 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
185 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
186 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
187 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
188 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
189 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
190 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
191 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
192 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
193 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
194 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
195 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
196 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
197 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
198 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
199 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
200 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
201 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
202 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
203 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
204 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
205 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
206 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
207 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
208 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
209 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
210 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
211 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
212 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
213 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
214 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
215 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
216 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
217 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
218 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
219 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
220 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
221 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
222 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
223 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
224 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
225 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
226 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
227 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
228 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
229 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
230 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
231 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
232 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
233 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
234 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
235 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
236 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
237 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
238 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
239 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
240 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
241 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
242 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
243 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
244 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
245 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
246 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
247 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
248 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
249 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
250 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
251 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
252 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
253 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
254 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
255 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
256 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
257 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
258 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
259 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
260 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
261 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
262 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
263 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
264 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
265 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
266 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
267 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
268 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
269 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
272 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
275 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
276 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
277 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
278 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
279 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
280 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
281 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
282 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
283 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
284 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
285 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
340 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
344 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
345 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
346 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
347 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
348 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
349 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
350 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
351 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
352 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
353 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
354 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
355 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
356 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
357 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
358 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
359 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
360 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
361 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
362 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
363 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
364 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
365 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
366 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
367 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
368 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
369 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
370 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
371 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
372 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
373 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
374 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
375 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
376 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
377 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
378 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
379 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
380 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
381 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
382 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
383 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
384 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
385 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
386 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
387 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
388 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
389 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
390 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
391 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
392 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
393 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
394 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
395 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
396 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
397 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
398 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
399 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
400 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
401 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
402 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
403 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
404 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
405 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
406 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
407 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
408 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
409 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
410 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
411 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
412 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
413 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
414 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
415 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
416 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
417 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
418 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
419 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
420 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
421 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
422 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
423 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
424 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
425 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
426 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
427 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
428 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
429 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
430 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
431 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
432 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
433 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
434 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
435 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
436 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
437 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
438 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
439 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
440 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
441 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
442 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
443 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
444 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
445 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
446 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
447 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
448 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
449 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
450 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
451 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
452 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
453 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
454 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
455 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
456 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
457 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
458 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
459 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
460 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
461 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
462 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
463 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
464 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
465 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
466 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
467 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
468 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
469 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
470 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
471 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
472 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
473 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
474 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
475 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
476 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
477 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
478 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
479 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
480 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
481 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
482 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
483 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
484 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
485 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
486 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
487 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
488 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
489 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
490 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
491 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
492 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
493 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
494 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
495 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
496 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
497 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
498 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
499 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
500 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
501 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
502 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
503 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
504 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
505 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
506 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
507 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
508 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
509 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
510 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
511 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
512 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
513 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
514 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
515 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
516 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
517 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
518 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
519 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
520 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
521 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
522 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
523 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
524 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
525 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
526 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
527 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
528 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
529 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
530 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
531 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
532 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
533 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
534 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
535 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
536 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
537 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
538 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
539 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
540 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
541 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
542 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
543 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
544 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
545 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
546 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
547 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
548 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
549 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
550 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
551 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
552 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
553 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
554 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
555 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
556 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
557 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
558 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
559 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
560 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
561 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
562 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
563 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
564 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
565 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
566 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
567 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
568 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
569 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
570 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
571 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
572 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
573 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
574 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
575 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
576 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
577 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
578 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
579 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
580 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
581 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
582 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
583 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
584 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
585 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
586 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
587 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
588 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
589 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
590 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
591 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
592 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
593 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
594 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
595 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
596 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
597 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
598 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
599 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
600 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
601 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
602 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
603 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
604 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
605 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
606 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
607 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
608 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.82
Metatranscriptomes 0
Isolates 14.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.07
Nodule 9.91
Rhizoplane 6.49
Rhizosphere 54.95
Stem 0
Stem Tuber 0
Unclassified 12.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000016 3300002739 Bacteria 45462
2 JGI25152J39213_1000083 3300002773 Bacteria 64754
3 JGI25152J39213_1000150 3300002773 Bacteria 47719
4 JGI25152J39213_1000619 3300002773 Bacteria 19007
5 JGI25150J39212_1000060 3300002774 Bacteria 64750
6 JGI25150J39212_1000115 3300002774 Bacteria 45489
7 JGI25159J45721_1000637 3300002987 Bacteria 15563
8 JGI25151J46595_10000239 3300003187 Bacteria 64754
9 JGI25151J46595_10000391 3300003187 Bacteria 45489
10 JGI25151J46595_10000799 3300003187 Bacteria 25219
11 JGI25165J46597_1000006 3300003214 Bacteria 529784
12 JGI25153J46596_10000578 3300003215 Bacteria 22597
13 JGI25153J46596_10001193 3300003215 Bacteria 15708
14 JGI25153J46596_10001417 3300003215 Bacteria 14361
15 JGI25153J46596_10004733 3300003215 Bacteria 7252
16 JGI25153J46596_10007157 3300003215 Bacteria 5534
17 JGI25153J46596_10007225 3300003215 Bacteria 5499
18 JGI25153J46596_10015144 3300003215 Bacteria 3161
19 rootH1_10026922 3300003316 Bacteria 16069
20 rootH2_10112393 3300003320 Bacteria 1510
21 rootL2_10217006 3300003322 Bacteria 1340
22 rootL2_10313393 3300003322 Bacteria 1316
23 rootH1_10296570 3300003323 Bacteria 1643
24 JGI25160J50197_1002213 3300003354 Bacteria 9127
25 JGI25160J50197_1003037 3300003354 Bacteria 7654
26 JGI25161J50226_1000096 3300003374 Bacteria 72203
27 JGI25404J52841_10000254 3300003659 Bacteria 6695
28 JGI25404J52841_10038037 3300003659 Bacteria 1021
29 Ga0055527_1009821 3300003760 Bacteria 1114
30 Ga0055542_1006307 3300003762 Bacteria 2552
31 Ga0055526_1003664 3300003771 Bacteria 9612
32 Ga0055524_1005122 3300003775 Bacteria 5924
33 Ga0055528_1002007 3300003790 Bacteria 11416
34 Ga0055528_1004016 3300003790 Bacteria 7199
35 Ga0055540_1003592 3300003792 Bacteria 7406
36 Ga0055531_10004774 3300003794 Bacteria 8101
37 Ga0055543_1000183 3300004625 Bacteria 51527
38 Ga0065165_1001490 3300005262 Bacteria 24866
39 Ga0065165_1002488 3300005262 Bacteria 15477
40 Ga0065165_1003977 3300005262 Bacteria 9675
41 Ga0065165_1012513 3300005262 Bacteria 3451
42 Ga0065704_10144922 3300005289 Bacteria 1481
43 Ga0065707_10082478 3300005295 Bacteria 14636
44 Ga0070658_10002866 3300005327 Bacteria 14324
45 Ga0070658_10071500 3300005327 Bacteria 2842
46 Ga0070683_100020118 3300005329 Bacteria 5936
47 Ga0070690_100112567 3300005330 Bacteria 1818
48 Ga0070690_100266135 3300005330 Bacteria 1218
49 Ga0070690_100516215 3300005330 Bacteria 896
50 Ga0070670_100048365 3300005331 Bacteria 3660
51 Ga0070670_100261034 3300005331 Bacteria 1510
52 Ga0070666_10243503 3300005335 Bacteria 1272
53 Ga0070666_10263828 3300005335 Bacteria 1221
54 Ga0070680_100340170 3300005336 Bacteria 1275
55 Ga0070682_100337387 3300005337 Bacteria 1119
56 Ga0070682_100340538 3300005337 Bacteria 1114
57 Ga0068868_100006547 3300005338 Bacteria 8248
58 Ga0068868_100140150 3300005338 Bacteria 1984
59 Ga0068868_100203979 3300005338 Bacteria 1650
60 Ga0070660_100014686 3300005339 Bacteria 5650
61 Ga0070687_100375586 3300005343 Bacteria 925
62 Ga0070668_100069351 3300005347 Bacteria 2742
63 Ga0070668_100749356 3300005347 Bacteria 864
64 Ga0070669_100103043 3300005353 Bacteria 2155
65 Ga0070669_100194774 3300005353 Bacteria 1591
66 Ga0070675_100784501 3300005354 Bacteria 870
67 Ga0070671_100035469 3300005355 Bacteria 4132
68 Ga0070671_100077398 3300005355 Bacteria 2780
69 Ga0070671_100301395 3300005355 Bacteria 1364
70 Ga0070674_100063047 3300005356 Bacteria 2593
71 Ga0070673_100058510 3300005364 Bacteria 3047
72 Ga0070659_100051286 3300005366 Bacteria 3244
73 Ga0070659_100090102 3300005366 Bacteria 2458
74 Ga0070709_10003856 3300005434 Bacteria 8076
75 Ga0070714_100250700 3300005435 Bacteria 1637
76 Ga0070713_100210757 3300005436 Bacteria 1759
77 Ga0070710_10015620 3300005437 Bacteria 3846
78 Ga0070701_10123893 3300005438 Bacteria 1460
79 Ga0070711_100076039 3300005439 Bacteria 2379
80 Ga0070663_100016240 3300005455 Bacteria 4829
81 Ga0070663_100020229 3300005455 Bacteria 4403
82 Ga0070663_100064231 3300005455 Bacteria 2653
83 Ga0070663_100359046 3300005455 Bacteria 1181
84 Ga0070663_100428270 3300005455 Bacteria 1086
85 Ga0070663_100505219 3300005455 Bacteria 1004
86 Ga0070678_100017610 3300005456 Bacteria 4607
87 Ga0070678_100145554 3300005456 Bacteria 1901
88 Ga0070678_100284076 3300005456 Bacteria 1400
89 Ga0070662_100268053 3300005457 Bacteria 1378
90 Ga0070662_100268977 3300005457 Bacteria 1376
91 Ga0070685_10321644 3300005466 Bacteria 1049
92 Ga0070699_100571212 3300005518 Bacteria 1030
93 Ga0070679_100017548 3300005530 Bacteria 6927
94 Ga0070679_100728112 3300005530 Bacteria 935
95 Ga0070684_100032764 3300005535 Bacteria 4432
96 Ga0068853_100014537 3300005539 Bacteria 6451
97 Ga0068853_100498747 3300005539 Bacteria 1149
98 Ga0070672_100433070 3300005543 Bacteria 1131
99 Ga0070686_100165764 3300005544 Bacteria 1559
100 Ga0070695_100481201 3300005545 Bacteria 957
101 Ga0070665_100003933 3300005548 Bacteria 15678
102 Ga0070665_100027988 3300005548 Bacteria 5677
103 Ga0070665_100043093 3300005548 Bacteria 4536
104 Ga0070665_100075092 3300005548 Bacteria 3387
105 Ga0070665_100330698 3300005548 Bacteria 1528
106 Ga0070665_100418637 3300005548 Bacteria 1348
107 Ga0070665_100503395 3300005548 Bacteria 1222
108 Ga0068855_100014574 3300005563 Bacteria 9470
109 Ga0068855_100036502 3300005563 Bacteria 5849
110 Ga0068855_100037055 3300005563 Bacteria 5802
111 Ga0068855_100048758 3300005563 Bacteria 4997
112 Ga0068855_100167276 3300005563 Bacteria 2492
113 Ga0068855_100585626 3300005563 Bacteria 1204
114 Ga0070664_100010213 3300005564 Bacteria 7614
115 Ga0070664_100180166 3300005564 Bacteria 1878
116 Ga0068857_100204464 3300005577 Bacteria 1801
117 Ga0068857_100409039 3300005577 Bacteria 1263
118 Ga0068854_100548609 3300005578 Bacteria 980
119 Ga0068856_100070384 3300005614 Bacteria 3460
120 Ga0068856_100160476 3300005614 Bacteria 2258
121 Ga0068856_100243192 3300005614 Bacteria 1815
122 Ga0068856_100262968 3300005614 Bacteria 1741
123 Ga0070702_100096290 3300005615 Bacteria 1806
124 Ga0070702_100254722 3300005615 Bacteria 1192
125 Ga0068852_100012928 3300005616 Bacteria 6366
126 Ga0068852_100048001 3300005616 Bacteria 3646
127 Ga0068852_100231216 3300005616 Bacteria 1762
128 Ga0068852_100277526 3300005616 Bacteria 1614
129 Ga0068852_100457107 3300005616 Bacteria 1265
130 Ga0068852_100501362 3300005616 Bacteria 1209
131 Ga0068859_100094400 3300005617 Bacteria 3043
132 Ga0068859_100520451 3300005617 Bacteria 1284
133 Ga0068859_100821143 3300005617 Bacteria 1016
134 Ga0068864_100029384 3300005618 Bacteria 4655
135 Ga0068864_100186573 3300005618 Bacteria 1899
136 Ga0068870_10188569 3300005840 Bacteria 1243
137 Ga0068863_100077859 3300005841 Bacteria 3139
138 Ga0068858_100023425 3300005842 Bacteria 5752
139 Ga0068858_100090581 3300005842 Bacteria 2846
140 Ga0068860_100111996 3300005843 Bacteria 2610
141 Ga0068860_100716998 3300005843 Bacteria 1010
142 Ga0068862_100509108 3300005844 Bacteria 1144
143 Ga0068862_100544576 3300005844 Bacteria 1107
144 Ga0081540_1002053 3300005983 Bacteria 16798
145 Ga0081540_1002582 3300005983 Bacteria 14701
146 Ga0081540_1003838 3300005983 Bacteria 11758
147 Ga0081540_1005208 3300005983 Bacteria 9729
148 Ga0081540_1072054 3300005983 Bacteria 1593
149 Ga0075365_10074629 3300006038 Bacteria 2287
150 Ga0075365_10103860 3300006038 Bacteria 1948
151 Ga0075365_10105251 3300006038 Bacteria 1935
152 Ga0075365_10133070 3300006038 Bacteria 1722
153 Ga0075365_10183211 3300006038 Bacteria 1464
154 Ga0075368_10002535 3300006042 Bacteria 5974
155 Ga0075368_10063030 3300006042 Bacteria 1487
156 Ga0075363_100040213 3300006048 Bacteria 2464
157 Ga0075363_100042632 3300006048 Bacteria 2398
158 Ga0075363_100060540 3300006048 Bacteria 2039
159 Ga0075363_100220522 3300006048 Bacteria 1087
160 Ga0075364_10037703 3300006051 Bacteria 3131
161 Ga0075364_10135769 3300006051 Bacteria 1652
162 Ga0070716_100091085 3300006173 Bacteria 1846
163 Ga0075367_10053799 3300006178 Bacteria 2386
164 Ga0075367_10180409 3300006178 Bacteria 1316
165 Ga0075367_10265229 3300006178 Bacteria 1078
166 Ga0075367_10357592 3300006178 Bacteria 922
167 Ga0075369_10070150 3300006186 Bacteria 1541
168 Ga0075366_10046435 3300006195 Bacteria 2573
169 Ga0075366_10148409 3300006195 Bacteria 1419
170 Ga0097621_100080313 3300006237 Bacteria 2713
171 Ga0097621_100266519 3300006237 Bacteria 1504
172 Ga0075370_10008627 3300006353 Bacteria 5253
173 Ga0075370_10066372 3300006353 Bacteria 2058
174 Ga0068871_100095172 3300006358 Bacteria 2487
175 Ga0068871_100145790 3300006358 Bacteria 2015
176 Ga0075431_100661998 3300006847 Bacteria 1024
177 Ga0068865_100041409 3300006881 Bacteria 3134
178 Ga0075436_100410776 3300006914 Bacteria 982
179 Ga0097620_100094399 3300006931 Bacteria 3043
180 Ga0097620_100520466 3300006931 Bacteria 1284
181 Ga0097620_100821154 3300006931 Bacteria 1016
182 Ga0099794_10190411 3300007265 Bacteria 1049
183 Ga0099795_10017175 3300007788 Bacteria 2303
184 Ga0105250_10079294 3300009092 Bacteria 1330
185 Ga0105240_10010226 3300009093 Bacteria 13205
186 Ga0105240_10010947 3300009093 Bacteria 12708
187 Ga0105240_10074563 3300009093 Bacteria 4188
188 Ga0105240_10108885 3300009093 Bacteria 3356
189 Ga0105240_10175405 3300009093 Bacteria 2534
190 Ga0105240_10233374 3300009093 Bacteria 2137
191 Ga0105240_10271484 3300009093 Bacteria 1952
192 Ga0105240_10354484 3300009093 Bacteria 1664
193 Ga0105240_10686223 3300009093 Bacteria 1119
194 Ga0111539_10545712 3300009094 Bacteria 1350
195 Ga0105245_10051925 3300009098 Bacteria 3676
196 Ga0105245_10079955 3300009098 Bacteria 2986
197 Ga0105245_10266042 3300009098 Bacteria 1670
198 Ga0105247_10341169 3300009101 Bacteria 1051
199 Ga0105243_10011026 3300009148 Bacteria 6835
200 Ga0105243_10239921 3300009148 Bacteria 1612
201 Ga0105241_10014111 3300009174 Bacteria 5854
202 Ga0105241_10113348 3300009174 Bacteria 2173
203 Ga0105241_10119390 3300009174 Bacteria 2121
204 Ga0105241_10135040 3300009174 Bacteria 2002
205 Ga0105241_10277228 3300009174 Bacteria 1431
206 Ga0105241_10281298 3300009174 Bacteria 1421
207 Ga0105241_10293804 3300009174 Bacteria 1392
208 Ga0105242_10048398 3300009176 Bacteria 3455
209 Ga0105242_10273475 3300009176 Bacteria 1531
210 Ga0105242_10409824 3300009176 Bacteria 1267
211 Ga0105248_10034971 3300009177 Bacteria 5622
212 Ga0105248_10046037 3300009177 Bacteria 4890
213 Ga0105248_10107619 3300009177 Bacteria 3144
214 Ga0105248_10523315 3300009177 Bacteria 1337
215 Ga0105237_10003658 3300009545 Bacteria 18135
216 Ga0105237_10005418 3300009545 Bacteria 14405
217 Ga0105237_10042573 3300009545 Bacteria 4579
218 Ga0105237_10077266 3300009545 Bacteria 3319
219 Ga0105237_10100512 3300009545 Bacteria 2884
220 Ga0105237_10126179 3300009545 Bacteria 2553
221 Ga0105237_10323492 3300009545 Bacteria 1546
222 Ga0105237_10444566 3300009545 Bacteria 1302
223 Ga0105238_10135833 3300009551 Bacteria 2437
224 Ga0105238_10332376 3300009551 Bacteria 1507
225 Ga0105238_10458082 3300009551 Bacteria 1273
226 Ga0105238_10784392 3300009551 Bacteria 968
227 Ga0105249_10036927 3300009553 Bacteria 4433
228 Ga0105249_10238250 3300009553 Bacteria 1798
229 Ga0105239_10002717 3300010375 Bacteria 22262
230 Ga0105239_10010954 3300010375 Bacteria 10129
231 Ga0105239_10039418 3300010375 Bacteria 5176
232 Ga0105239_10048515 3300010375 Bacteria 4656
233 Ga0105239_10082916 3300010375 Bacteria 3531
234 Ga0105239_10174867 3300010375 Bacteria 2401
235 Ga0105239_10183118 3300010375 Bacteria 2344
236 Ga0105239_10386009 3300010375 Bacteria 1584
237 Ga0105239_10446995 3300010375 Bacteria 1466
238 Ga0105239_10606846 3300010375 Bacteria 1248
239 Ga0105239_10681093 3300010375 Bacteria 1175
240 Ga0105246_10020290 3300011119 Bacteria 4261
241 Ga0105246_10055406 3300011119 Bacteria 2736
242 Ga0157373_10002345 3300013100 Bacteria 14371
243 Ga0157370_10004573 3300013104 Bacteria 15841
244 Ga0157370_10016923 3300013104 Bacteria 7371
245 Ga0157370_10173706 3300013104 Bacteria 2003
246 Ga0157370_10242888 3300013104 Bacteria 1666
247 Ga0157369_10000362 3300013105 Bacteria 60506
248 Ga0157369_10004644 3300013105 Bacteria 16137
249 Ga0157369_10016093 3300013105 Bacteria 8416
250 Ga0157369_10144914 3300013105 Bacteria 2511
251 Ga0157374_10002490 3300013296 Bacteria 15563
252 Ga0157378_10075165 3300013297 Bacteria 3041
253 Ga0157378_10179724 3300013297 Bacteria 1990
254 Ga0157378_10597807 3300013297 Bacteria 1114
255 Ga0163162_10015168 3300013306 Bacteria 7526
256 Ga0163162_10101008 3300013306 Bacteria 2976
257 Ga0157372_10002285 3300013307 Bacteria 20771
258 Ga0157372_10743048 3300013307 Bacteria 1141
259 Ga0157375_10091403 3300013308 Bacteria 3105
260 Ga0157375_10139188 3300013308 Bacteria 2553
261 Ga0157375_10216272 3300013308 Bacteria 2074
262 Ga0163163_10003792 3300014325 Bacteria 12874
263 Ga0163163_10007553 3300014325 Bacteria 9597
264 Ga0163163_10061180 3300014325 Bacteria 3730
265 Ga0163163_10576374 3300014325 Bacteria 1188
266 Ga0163163_10787736 3300014325 Bacteria 1014
267 Ga0157380_10019544 3300014326 Bacteria 5050
268 Ga0157380_10551717 3300014326 Bacteria 1130
269 Ga0182008_10030237 3300014497 Bacteria 2731
270 Ga0182008_10197176 3300014497 Bacteria 1023
271 Ga0157377_10084318 3300014745 Bacteria 1864
272 Ga0157379_10088052 3300014968 Bacteria 2784
273 Ga0157379_10093085 3300014968 Bacteria 2704
274 Ga0157379_10263569 3300014968 Bacteria 1566
275 Ga0157379_10450242 3300014968 Bacteria 1188
276 Ga0157376_10013448 3300014969 Bacteria 6107
277 Ga0182006_1022019 3300015261 Bacteria 2653
278 Ga0182007_10032118 3300015262 Bacteria 1784
279 Ga0163161_10021099 3300017792 Bacteria 4578
280 Ga0163161_10573995 3300017792 Bacteria 927
281 Ga0213874_10013586 3300021377 Bacteria 2113
282 Ga0213874_10013739 3300021377 Bacteria 2105
283 Ga0209436_100004 3300025208 Bacteria 196698
284 Ga0209672_100948 3300025228 Bacteria 12951
285 Ga0209563_100449 3300025230 Bacteria 14243
286 Ga0207425_1000137 3300025245 Bacteria 65554
287 Ga0207425_1000217 3300025245 Bacteria 45693
288 Ga0207425_1011182 3300025245 Bacteria 2150
289 Ga0209677_100210 3300025253 Bacteria 44738
290 Ga0209148_1000929 3300025254 Bacteria 19375
291 Ga0209148_1002656 3300025254 Bacteria 5766
292 Ga0209759_1001867 3300025256 Bacteria 10461
293 Ga0209129_1000082 3300025258 Bacteria 183436
294 Ga0209129_1000098 3300025258 Bacteria 163406
295 Ga0209129_1000165 3300025258 Bacteria 98917
296 Ga0209129_1001930 3300025258 Bacteria 10867
297 Ga0209129_1005362 3300025258 Bacteria 4573
298 Ga0209233_1000010 3300025261 Bacteria 1194329
299 Ga0209233_1003142 3300025261 Bacteria 5859
300 Ga0209233_1006358 3300025261 Bacteria 3815
301 Ga0209233_1021026 3300025261 Bacteria 1699
302 Ga0209455_1000620 3300025272 Bacteria 22265
303 Ga0209673_1003625 3300025273 Bacteria 8930
304 Ga0209673_1027984 3300025273 Bacteria 1824
305 Ga0209673_1030369 3300025273 Bacteria 1703
306 Ga0209130_1000001 3300025284 Bacteria 831557
307 Ga0209025_1000142 3300025294 Bacteria 183903
308 Ga0209025_1000172 3300025294 Bacteria 160407
309 Ga0209025_1000362 3300025294 Bacteria 96826
310 Ga0209564_1001805 3300025295 Bacteria 19744
311 Ga0209564_1004735 3300025295 Bacteria 8146
312 Ga0209564_1011661 3300025295 Bacteria 3913
313 Ga0209564_1044776 3300025295 Bacteria 1145
314 Ga0209758_1000021 3300025297 Bacteria 697691
315 Ga0209758_1000388 3300025297 Bacteria 76021
316 Ga0209758_1000488 3300025297 Bacteria 64778
317 Ga0209758_1000738 3300025297 Bacteria 47745
318 Ga0209758_1001532 3300025297 Bacteria 26653
319 Ga0209758_1023778 3300025297 Bacteria 2756
320 Ga0209758_1025905 3300025297 Bacteria 2558
321 Ga0209758_1031377 3300025297 Bacteria 2180
322 Ga0209256_1001343 3300025299 Bacteria 26083
323 Ga0209256_1013699 3300025299 Bacteria 2989
324 Ga0209256_1018762 3300025299 Bacteria 2231
325 Ga0207426_1000005 3300025302 Bacteria 1037188
326 Ga0207426_1000143 3300025302 Bacteria 192948
327 Ga0207426_1000687 3300025302 Bacteria 40682
328 Ga0207426_1004068 3300025302 Bacteria 7380
329 Ga0207426_1026400 3300025302 Bacteria 1946
330 Ga0207426_1071450 3300025302 Bacteria 967
331 Ga0209051_1007389 3300025303 Bacteria 6012
332 Ga0209051_1014372 3300025303 Bacteria 3700
333 Ga0209257_1000455 3300025304 Bacteria 75945
334 Ga0209257_1012178 3300025304 Bacteria 4019
335 Ga0209257_1042696 3300025304 Bacteria 1336
336 Ga0207697_10081335 3300025315 Bacteria 1365
337 Ga0207692_10022140 3300025898 Bacteria 2920
338 Ga0207642_10073329 3300025899 Bacteria 1637
339 Ga0207710_10137027 3300025900 Bacteria 1179
340 Ga0207688_10024216 3300025901 Bacteria 3328
341 Ga0207688_10031251 3300025901 Bacteria 2939
342 Ga0207688_10131669 3300025901 Bacteria 1466
343 Ga0207680_10461651 3300025903 Bacteria 902
344 Ga0207647_10000340 3300025904 Bacteria 38070
345 Ga0207647_10006430 3300025904 Bacteria 8541
346 Ga0207699_10033697 3300025906 Bacteria 2897
347 Ga0207643_10115699 3300025908 Bacteria 1584
348 Ga0207705_10000352 3300025909 Bacteria 41499
349 Ga0207705_10131740 3300025909 Bacteria 1861
350 Ga0207705_10599324 3300025909 Bacteria 857
351 Ga0207654_10019392 3300025911 Bacteria 3589
352 Ga0207654_10111618 3300025911 Bacteria 1702
353 Ga0207707_10031913 3300025912 Bacteria 4611
354 Ga0207695_10000015 3300025913 Bacteria 803205
355 Ga0207695_10047671 3300025913 Bacteria 4531
356 Ga0207695_10118597 3300025913 Bacteria 2617
357 Ga0207695_10156665 3300025913 Bacteria 2212
358 Ga0207695_10765357 3300025913 Bacteria 846
359 Ga0207671_10006016 3300025914 Bacteria 10965
360 Ga0207671_10007700 3300025914 Bacteria 9296
361 Ga0207671_10146469 3300025914 Bacteria 1822
362 Ga0207671_10204779 3300025914 Bacteria 1542
363 Ga0207671_10227943 3300025914 Bacteria 1461
364 Ga0207671_10381049 3300025914 Bacteria 1120
365 Ga0207671_10391325 3300025914 Bacteria 1105
366 Ga0207693_10068993 3300025915 Bacteria 2767
367 Ga0207693_10144997 3300025915 Bacteria 1867
368 Ga0207660_10147020 3300025917 Bacteria 1807
369 Ga0207662_10073290 3300025918 Bacteria 2077
370 Ga0207657_10002294 3300025919 Bacteria 20726
371 Ga0207657_10063817 3300025919 Bacteria 3147
372 Ga0207649_10084274 3300025920 Bacteria 2066
373 Ga0207649_10431590 3300025920 Bacteria 991
374 Ga0207652_10271870 3300025921 Bacteria 1529
375 Ga0207694_10649961 3300025924 Bacteria 888
376 Ga0207650_10164340 3300025925 Bacteria 1760
377 Ga0207659_10438468 3300025926 Bacteria 1098
378 Ga0207687_10047348 3300025927 Bacteria 2981
379 Ga0207687_10159535 3300025927 Bacteria 1729
380 Ga0207687_10171682 3300025927 Bacteria 1673
381 Ga0207700_10287430 3300025928 Bacteria 1416
382 Ga0207644_10035292 3300025931 Bacteria 3503
383 Ga0207644_10094809 3300025931 Bacteria 2231
384 Ga0207644_10269258 3300025931 Bacteria 1364
385 Ga0207706_10128442 3300025933 Bacteria 2229
386 Ga0207706_10258745 3300025933 Bacteria 1520
387 Ga0207706_10276911 3300025933 Bacteria 1464
388 Ga0207709_10023852 3300025935 Bacteria 3487
389 Ga0207670_10442199 3300025936 Bacteria 1047
390 Ga0207669_10038831 3300025937 Bacteria 2745
391 Ga0207704_10023352 3300025938 Bacteria 3331
392 Ga0207704_10568185 3300025938 Bacteria 924
393 Ga0207691_10499021 3300025940 Bacteria 1034
394 Ga0207691_10731170 3300025940 Bacteria 834
395 Ga0207711_10066437 3300025941 Bacteria 3119
396 Ga0207711_10083775 3300025941 Bacteria 2790
397 Ga0207711_10116854 3300025941 Bacteria 2379
398 Ga0207689_10087777 3300025942 Bacteria 2555
399 Ga0207689_10194134 3300025942 Bacteria 1675
400 Ga0207661_10038687 3300025944 Bacteria 3740
401 Ga0207679_10047242 3300025945 Bacteria 3126
402 Ga0207679_10381243 3300025945 Bacteria 1236
403 Ga0207679_10412657 3300025945 Bacteria 1190
404 Ga0207667_10002243 3300025949 Bacteria 24288
405 Ga0207667_10010756 3300025949 Bacteria 10672
406 Ga0207667_10011404 3300025949 Bacteria 10330
407 Ga0207667_10015015 3300025949 Bacteria 8810
408 Ga0207667_10359872 3300025949 Bacteria 1484
409 Ga0207651_10071143 3300025960 Bacteria 2464
410 Ga0207651_10205779 3300025960 Bacteria 1581
411 Ga0207712_10055817 3300025961 Bacteria 2780
412 Ga0207668_10027869 3300025972 Bacteria 3685
413 Ga0207668_10053221 3300025972 Bacteria 2804
414 Ga0207668_10291585 3300025972 Bacteria 1343
415 Ga0207640_10154765 3300025981 Bacteria 1688
416 Ga0207658_10200605 3300025986 Bacteria 1665
417 Ga0207677_10335565 3300026023 Bacteria 1261
418 Ga0207639_10460884 3300026041 Bacteria 1155
419 Ga0207678_10022770 3300026067 Bacteria 5486
420 Ga0207678_10047370 3300026067 Bacteria 3718
421 Ga0207678_10049880 3300026067 Bacteria 3617
422 Ga0207678_10060449 3300026067 Bacteria 3259
423 Ga0207678_10151597 3300026067 Bacteria 1979
424 Ga0207678_10188016 3300026067 Bacteria 1764
425 Ga0207678_10192087 3300026067 Bacteria 1745
426 Ga0207678_10203469 3300026067 Bacteria 1693
427 Ga0207678_10263661 3300026067 Bacteria 1477
428 Ga0207708_10032013 3300026075 Bacteria 3993
429 Ga0207708_10096030 3300026075 Bacteria 2290
430 Ga0207702_10063047 3300026078 Bacteria 3169
431 Ga0207702_10141780 3300026078 Bacteria 2176
432 Ga0207702_10163134 3300026078 Bacteria 2037
433 Ga0207641_10159592 3300026088 Bacteria 2049
434 Ga0207641_10483056 3300026088 Bacteria 1201
435 Ga0207676_10073727 3300026095 Bacteria 2748
436 Ga0207676_10083040 3300026095 Bacteria 2608
437 Ga0207675_100053975 3300026118 Bacteria 3749
438 Ga0207683_10014660 3300026121 Bacteria 6675
439 Ga0207683_10055468 3300026121 Bacteria 3474
440 Ga0207683_10263975 3300026121 Bacteria 1572
441 Ga0207683_10338332 3300026121 Bacteria 1380
442 Ga0207698_10021492 3300026142 Bacteria 4464
443 Ga0207698_10102945 3300026142 Bacteria 2372
444 Ga0207698_10187883 3300026142 Bacteria 1837
445 Ga0207698_10914398 3300026142 Bacteria 885
446 Ga0209813_10037485 3300027866 Bacteria 1461
447 Ga0268266_10016992 3300028379 Bacteria 6215
448 Ga0268266_10029091 3300028379 Bacteria 4696
449 Ga0268266_10046425 3300028379 Bacteria 3718
450 Ga0268266_10131123 3300028379 Bacteria 2242
451 Ga0268265_10217115 3300028380 Bacteria 1670
452 Ga0268265_10315490 3300028380 Bacteria 1413
453 Ga0268264_10706744 3300028381 Bacteria 1001
454 Ga0307517_10231816 3300028786 Bacteria 1107
455 Ga0265338_10000159 3300028800 Bacteria 123495
456 Ga0265338_10000677 3300028800 Bacteria 58906
457 Ga0265332_10061935 3300031238 Bacteria 1599
458 Ga0265340_10009852 3300031247 Bacteria 5121
459 Ga0265340_10098838 3300031247 Bacteria 1358
460 Ga0265339_10005005 3300031249 Bacteria 8917
461 Ga0265339_10058585 3300031249 Bacteria 2079
462 Ga0265331_10057168 3300031250 Bacteria 1851
463 Ga0307509_10000779 3300031507 Bacteria 54577
464 Ga0307509_10031638 3300031507 Bacteria 5842
465 Ga0307408_100054083 3300031548 Bacteria 2902
466 Ga0307508_10005559 3300031616 Bacteria 11972
467 Ga0265314_10011012 3300031711 Bacteria 7501
468 Ga0265314_10088576 3300031711 Bacteria 2021
469 Ga0265314_10169495 3300031711 Bacteria 1319
470 Ga0265342_10010007 3300031712 Bacteria 6621
471 Ga0307405_10018547 3300031731 Bacteria 3841
472 Ga0307405_10477000 3300031731 Bacteria 995
473 Ga0307410_10105966 3300031852 Bacteria 2025
474 Ga0307406_10367633 3300031901 Bacteria 1130
475 Ga0307412_10028755 3300031911 Bacteria 3482
476 Ga0307409_100487100 3300031995 Bacteria 1198
477 Ga0307416_100700310 3300032002 Bacteria 1102
478 Ga0307411_10048502 3300032005 Bacteria 2753
479 Ga0307411_10152289 3300032005 Bacteria 1720
480 Ga0307510_10000008 3300033180 Bacteria 433990
481 Ga0307510_10009746 3300033180 Bacteria 11432
482 Ga0307510_10056799 3300033180 Bacteria 4070
483 Ga0307510_10080532 3300033180 Bacteria 3166
484 Ga0307510_10128261 3300033180 Bacteria 2219
485 Ga0307510_10160954 3300033180 Bacteria 1842
486 Ga0307510_10327937 3300033180 Bacteria 986
487 Ga0307510_10356147 3300033180 Bacteria 913
488 Ga0315911_1000009 3300033442 Bacteria 379354
489 Ga0373930_0009869 3300034816 Bacteria 1697
490 Ga0373934_0042189 3300035086 Bacteria 1801
491 Ga0373934_0118110 3300035086 Bacteria 1078
492 Ga0373923_0000827 3300035111 Bacteria 8121
493 Ga0373923_0254690 3300035111 Bacteria 822
494 Ga0373936_0023778 3300035113 Bacteria 2389
495 Ga0373939_0057352 3300035114 Bacteria 1229
496 Ga0373945_0030903 3300035116 Bacteria 1889
497 Ga0373953_0003595 3300035117 Bacteria 4850
498 Ga0373954_0000634 3300035118 Bacteria 13429
499 Ga0373956_0018011 3300035119 Bacteria 2987
500 Ga0373957_0000200 3300035120 Bacteria 15408
501 Ga0373943_0002648 3300035170 Bacteria 8148
502 Ga0373943_0051944 3300035170 Bacteria 2020
503 Ga0373946_0008219 3300035171 Bacteria 3829
504 Ga0373955_0008103 3300035172 Bacteria 4861
505 Ga0373924_0004394 3300035410 Bacteria 4920
506 Ga0373924_0080229 3300035410 Bacteria 1387
507 Ga0373931_0042085 3300035691 Bacteria 2401
508 Ga0373931_0092591 3300035691 Bacteria 1686
509 Ga0373935_0006106 3300035692 Bacteria 7164
510 Ga0373935_0125065 3300035692 Bacteria 1722
511 Ga0373935_0261912 3300035692 Unclassified 1213
512 Ga0373927_0001513 3300035695 Bacteria 17491
513 Ga0373927_0139323 3300035695 Bacteria 1586
514 Ga0373927_0213932 3300035695 Bacteria 1266
515 Ga0373933_0002159 3300035724 Bacteria 11266
516 Ga0373947_0084456 3300035725 Bacteria 1970
517 Ga0373947_0244381 3300035725 Unclassified 1185
518 Ga0373947_0450488 3300035725 Bacteria 872
519 Ga0373925_0006671 3300037068 Bacteria 8469
520 Ga0373925_0252084 3300037068 Bacteria 1416
521 Ga0373925_0269292 3300037068 Bacteria 1370
522 Ga0395899_0000007 3300037312 Bacteria 629129
523 Ga0395899_0029757 3300037312 Bacteria 4108
524 Ga0395899_0160377 3300037312 Bacteria 1589
525 Ga0395900_0004826 3300037418 Bacteria 14204
526 Ga0395900_0061053 3300037418 Bacteria 3877
527 Ga0395900_0353364 3300037418 Bacteria 1443
528 Ga0395900_0406146 3300037418 Bacteria 1325
529 Ga0395898_0000276 3300037466 Bacteria 124774
530 Ga0395898_0012584 3300037466 Bacteria 8748
531 Ga0395898_0081232 3300037466 Bacteria 3126
532 Ga0395898_0102696 3300037466 Bacteria 2744
533 Ga0395905_0022102 3300037471 Bacteria 6017
534 Ga0395905_0119904 3300037471 Bacteria 2472
535 Ga0395905_0279868 3300037471 Bacteria 1554
536 Ga0436364_0804269 3300037853 Bacteria 3901
537 Ga0395901_0000017 3300038443 Bacteria 345003
538 Ga0395901_0002433 3300038443 Bacteria 18893
539 Ga0395901_0007409 3300038443 Bacteria 11070
540 Ga0395901_0010567 3300038443 Bacteria 9353
541 Ga0395901_0086648 3300038443 Bacteria 3274
542 Ga0395901_0121988 3300038443 Bacteria 2739
543 Ga0395901_0185005 3300038443 Bacteria 2185
544 Ga0436365_0096880 3300039437 Bacteria 1895
545 Ga0436365_0116034 3300039437 Bacteria 3825
546 Ga0436365_0410894 3300039437 Bacteria 972
547 Ga0436365_1476096 3300039437 Bacteria 3897
548 Ga0436360_0795597 3300039438 Bacteria 1869
549 Ga0436361_0260510 3300039447 Bacteria 1762
550 Ga0436361_0901521 3300039447 Bacteria 4403
551 Ga0436361_0918647 3300039447 Bacteria 7525
552 Ga0436363_0090351 3300039450 Bacteria 4290
553 Ga0436363_1223179 3300039450 Bacteria 2390
554 Ga0436363_1511490 3300039450 Bacteria 2452
555 Ga0436362_0224975 3300039453 Bacteria 3350
556 Ga0439465_0006693 3300041413 Bacteria 3659
557 Ga0451837_0376583 3300041494 Bacteria 1113
558 Ga0451855_0177954 3300041511 Bacteria 4441
559 Ga0451853_0910860 3300041512 Bacteria 25581
560 Ga0439448_0000098 3300042005 Bacteria 15629
561 Ga0466969_0000523 3300044656 Bacteria 21109
562 Ga0466969_0070745 3300044656 Bacteria 1678
563 Ga0466973_0019878 3300044659 Bacteria 6407
564 Ga0466966_0001170 3300044684 Bacteria 16864
565 Ga0466961_0000375 3300044693 Bacteria 28794
566 Ga0466961_0015547 3300044693 Bacteria 4883
567 Ga0466963_0001202 3300044694 Bacteria 13621
568 Ga0466963_0121949 3300044694 Bacteria 1795
569 Ga0466964_0066669 3300044706 Bacteria 1511
570 Ga0466970_0000982 3300044765 Bacteria 13717
571 Ga0466957_0003670 3300044842 Bacteria 8471
572 Ga0466957_0263324 3300044842 Bacteria 1149
573 Ga0466957_0586456 3300044842 Bacteria 779
574 Ga0466960_0203387 3300044901 Bacteria 1083
575 Ga0466959_0006481 3300045049 Bacteria 8112
576 Ga0466959_0014159 3300045049 Bacteria 5789
577 Ga0466958_0007577 3300045836 Bacteria 5977
578 Ga0466958_0092199 3300045836 Bacteria 1875
579 Ga0466967_0036461 3300045976 Bacteria 4198
580 Ga0466967_0208302 3300045976 Bacteria 1854
581 Ga0495592_0002897 3300046454 Bacteria 12205
582 Ga0495592_0119351 3300046454 Bacteria 1857
583 Ga0495592_0191388 3300046454 Bacteria 1386
584 Ga0495592_0225893 3300046454 Bacteria 1249
585 Ga0495603_0001638 3300046455 Bacteria 13151
586 Ga0495603_0013589 3300046455 Bacteria 4925
587 Ga0495603_0019422 3300046455 Bacteria 4112
588 Ga0495603_0022020 3300046455 Bacteria 3859
589 Ga0495603_0186121 3300046455 Bacteria 1201
590 Ga0495629_0000215 3300046459 Bacteria 52018
591 Ga0495629_0002158 3300046459 Bacteria 15190
592 Ga0495629_0004330 3300046459 Bacteria 10642
593 Ga0495629_0019046 3300046459 Bacteria 4908
594 Ga0495638_0008267 3300046460 Bacteria 7390
595 Ga0495638_0232269 3300046460 Bacteria 1025
596 Ga0495641_0035031 3300046461 Bacteria 2369
597 Ga0495641_0061969 3300046461 Bacteria 1688
598 Ga0495651_0014331 3300046462 Bacteria 6128
599 Ga0495651_0023237 3300046462 Bacteria 4821
600 Ga0495651_0023242 3300046462 Bacteria 4821
601 Ga0495651_0065402 3300046462 Bacteria 2777
602 Ga0495651_0298257 3300046462 Bacteria 1082
603 Ga0495653_0017446 3300046463 Bacteria 5838
604 Ga0495653_0115439 3300046463 Bacteria 1922
605 Ga0495653_0155372 3300046463 Bacteria 1594
606 Ga0495650_0001730 3300046471 Bacteria 19964
607 Ga0495650_0023114 3300046471 Bacteria 2966
608 Ga0495580_0003083 3300046472 Bacteria 14276
609 Ga0495580_0006344 3300046472 Bacteria 9647
610 Ga0495582_0006681 3300046473 Bacteria 6406
611 Ga0495582_0115614 3300046473 Bacteria 1508
612 Ga0495605_0020982 3300046474 Bacteria 3465
613 Ga0495639_0000750 3300046475 Bacteria 14821
614 Ga0495639_0117968 3300046475 Unclassified 1264
615 Ga0495662_0002275 3300046476 Bacteria 9684
616 Ga0495662_0178581 3300046476 Bacteria 1046
617 Ga0495664_0014584 3300046477 Bacteria 4458
618 Ga0495664_0023152 3300046477 Bacteria 3603
619 Ga0495664_0051948 3300046477 Bacteria 2434
620 Ga0495585_0100879 3300046492 Bacteria 1544
621 Ga0495594_0054320 3300046499 Bacteria 2207
622 Ga0495594_0137048 3300046499 Bacteria 1387
623 Ga0495596_0108613 3300046500 Bacteria 1077
624 Ga0495583_0001126 3300046506 Bacteria 29374
625 Ga0495583_0057578 3300046506 Bacteria 1747
626 Ga0495606_0002134 3300046507 Bacteria 23878
627 Ga0495606_0043458 3300046507 Bacteria 2997
628 Ga0495606_0067765 3300046507 Bacteria 2259
629 Ga0495606_0182494 3300046507 Bacteria 1209
630 Ga0495606_0249450 3300046507 Bacteria 985
631 Ga0495608_0002218 3300046511 Bacteria 14020
632 Ga0495608_0022549 3300046511 Bacteria 4317
633 Ga0495608_0467078 3300046511 Bacteria 766
634 Ga0495616_0048906 3300046513 Bacteria 2122
635 Ga0495618_0222532 3300046514 Bacteria 1190
636 Ga0495628_0038487 3300046516 Bacteria 3828
637 Ga0495628_0517182 3300046516 Bacteria 860
638 Ga0495630_0025991 3300046517 Bacteria 4332
639 Ga0495631_0003452 3300046518 Bacteria 8649
640 Ga0495631_0033577 3300046518 Bacteria 2304
641 Ga0495632_0013949 3300046519 Bacteria 4564
642 Ga0495643_0047143 3300046522 Bacteria 2334
643 Ga0495643_0125108 3300046522 Bacteria 1295
644 Ga0495644_0055108 3300046523 Bacteria 1494
645 Ga0495648_0056234 3300046524 Bacteria 2368
646 Ga0495648_0130506 3300046524 Unclassified 1337
647 Ga0495652_0034244 3300046529 Bacteria 4428
648 Ga0495652_0038809 3300046529 Bacteria 4122
649 Ga0495652_0126467 3300046529 Bacteria 2030
650 Ga0495652_0126502 3300046529 Bacteria 2029
651 Ga0495652_0157078 3300046529 Bacteria 1770
652 Ga0495665_0007507 3300046531 Bacteria 5902
653 Ga0495640_0005616 3300046533 Bacteria 9978
654 Ga0495640_0007861 3300046533 Bacteria 8385
655 Ga0495640_0020015 3300046533 Bacteria 4933
656 Ga0495640_0112121 3300046533 Bacteria 1781
657 Ga0495640_0143738 3300046533 Unclassified 1536
658 Ga0495586_0013054 3300046535 Bacteria 4402
659 Ga0495586_0106141 3300046535 Bacteria 1562
660 Ga0495587_0032169 3300046536 Bacteria 3172
661 Ga0495597_0066410 3300046542 Bacteria 1563
662 Ga0495645_0001582 3300046543 Bacteria 15411
663 Ga0495645_0023405 3300046543 Bacteria 4472
664 Ga0495645_0045991 3300046543 Bacteria 3183
665 Ga0495645_0063352 3300046543 Bacteria 2677
666 Ga0495622_0005946 3300046557 Bacteria 5670
667 Ga0495622_0006189 3300046557 Bacteria 5559
668 Ga0495622_0007815 3300046557 Bacteria 4966
669 Ga0495667_0019371 3300046559 Bacteria 4592
670 Ga0495667_0037821 3300046559 Bacteria 3215
671 Ga0495667_0095980 3300046559 Bacteria 1919
672 Ga0495667_0130304 3300046559 Bacteria 1622
673 Ga0495656_0141873 3300046615 Bacteria 1153
674 Ga0495668_0003217 3300046616 Bacteria 12461
675 Ga0495668_0187067 3300046616 Bacteria 1134
676 Ga0495634_0001188 3300046642 Bacteria 24100
677 Ga0495634_0012328 3300046642 Bacteria 6195
678 Ga0495634_0147156 3300046642 Bacteria 1492
679 Ga0495611_0087234 3300046648 Bacteria 1440
680 Ga0495625_0001420 3300046660 Bacteria 29255
681 Ga0495625_0270253 3300046660 Bacteria 1097
682 Ga0495635_0001058 3300046663 Bacteria 18230
683 Ga0495635_0031655 3300046663 Bacteria 3671
684 Ga0495635_0082311 3300046663 Bacteria 2202
685 Ga0495635_0156827 3300046663 Bacteria 1549
686 Ga0495588_0026364 3300046674 Bacteria 2901
687 Ga0495588_0063205 3300046674 Bacteria 1919
688 Ga0495588_0279413 3300046674 Bacteria 880
689 Ga0495657_0004962 3300046675 Bacteria 10578
690 Ga0495657_0009569 3300046675 Bacteria 7342
691 Ga0495657_0021303 3300046675 Bacteria 4651
692 Ga0495599_0003523 3300046678 Bacteria 9167
693 Ga0495599_0059991 3300046678 Bacteria 2379
694 Ga0495623_0006259 3300046679 Bacteria 7742
695 Ga0495623_0023756 3300046679 Bacteria 3955
696 Ga0495623_0049549 3300046679 Bacteria 2661
697 Ga0495646_0000934 3300046680 Bacteria 16609
698 Ga0495646_0026112 3300046680 Bacteria 3669
699 Ga0495646_0052471 3300046680 Bacteria 2463
700 Ga0495646_0109119 3300046680 Bacteria 1577
701 Ga0495647_0018833 3300046681 Bacteria 2463
702 Ga0495658_0061062 3300046683 Bacteria 2163
703 Ga0495658_0183251 3300046683 Bacteria 1300
704 Ga0495669_0003832 3300046684 Bacteria 6181
705 Ga0495613_0009382 3300046689 Bacteria 7261
706 Ga0495613_0019532 3300046689 Bacteria 5050
707 Ga0495613_0048777 3300046689 Bacteria 3127
708 Ga0495613_0139728 3300046689 Bacteria 1731
709 Ga0495624_0007459 3300046690 Bacteria 7676
710 Ga0495624_0051204 3300046690 Bacteria 2614
711 Ga0495624_0193788 3300046690 Unclassified 1236
712 Ga0495670_0068778 3300046691 Bacteria 1790
713 Ga0495649_0003657 3300046694 Bacteria 10260
714 Ga0495649_0180508 3300046694 Bacteria 1101
715 Ga0495589_0008061 3300046794 Bacteria 5508
716 Ga0495589_0032881 3300046794 Bacteria 2606
717 Ga0495600_0001795 3300046809 Bacteria 11997
718 Ga0495600_0004023 3300046809 Bacteria 8738
719 Ga0495600_0060700 3300046809 Bacteria 2469
720 Ga0495600_0103023 3300046809 Bacteria 1860
721 Ga0495600_0170027 3300046809 Bacteria 1407
722 Ga0495660_0038341 3300046810 Bacteria 2664
723 Ga0495581_0000567 3300047315 Bacteria 19221
724 Ga0495581_0007237 3300047315 Bacteria 6419
725 Ga0495581_0065992 3300047315 Bacteria 2093
726 Ga0495604_0004281 3300047317 Bacteria 11303
727 Ga0495604_0005607 3300047317 Bacteria 9956
728 Ga0495604_0006726 3300047317 Bacteria 9113
729 Ga0495604_0014661 3300047317 Bacteria 6247
730 Ga0495604_0015049 3300047317 Bacteria 6171
731 Ga0495604_0172956 3300047317 Bacteria 1517
732 Ga0495604_0211484 3300047317 Bacteria 1340
733 Ga0495604_0396353 3300047317 Bacteria 910
734 Ga0495604_0409167 3300047317 Bacteria 892
735 Ga0495636_0041465 3300047318 Bacteria 1911
736 Ga0495674_0007182 3300047319 Bacteria 10654
737 Ga0495674_0013705 3300047319 Bacteria 7616
738 Ga0495674_0015961 3300047319 Bacteria 7010
739 Ga0495674_0020569 3300047319 Bacteria 6108
740 Ga0495674_0166386 3300047319 Bacteria 1842
741 Ga0495672_0001907 3300047320 Bacteria 19826
742 Ga0495672_0056827 3300047320 Bacteria 2275
743 Ga0495676_0051305 3300047321 Bacteria 3302
744 Ga0495676_0275953 3300047321 Bacteria 1139
745 Ga0495680_0009178 3300047322 Bacteria 8921
746 Ga0495680_0050126 3300047322 Bacteria 3266
747 Ga0495680_0133851 3300047322 Bacteria 1819
748 Ga0495683_0099101 3300047323 Bacteria 1403
749 Ga0495687_006263 3300047443 Bacteria 7340
750 Ga0495687_039374 3300047443 Bacteria 2091
751 Ga0495675_0002644 3300047444 Bacteria 10732
752 Ga0495675_0017427 3300047444 Bacteria 4552
753 Ga0495675_0176218 3300047444 Bacteria 1311
754 Ga0495679_027443 3300047446 Bacteria 1878
755 Ga0495684_0003538 3300047471 Bacteria 12221
756 Ga0495684_0073429 3300047471 Bacteria 2599
757 Ga0495684_0183581 3300047471 Bacteria 1550
758 Ga0495686_0000002 3300047472 Bacteria 1050777
759 Ga0495686_0000075 3300047472 Bacteria 208031
760 Ga0495686_0122584 3300047472 Bacteria 1548
761 Ga0495686_0137614 3300047472 Bacteria 1443
762 Ga0495593_0002295 3300047673 Bacteria 11465
763 Ga0495593_0003406 3300047673 Bacteria 9525
764 Ga0495602_0057070 3300048088 Bacteria 3429
765 Ga0495602_0081463 3300048088 Bacteria 2721
766 Ga0495602_0272327 3300048088 Bacteria 1251
767 Ga0495602_0317786 3300048088 Bacteria 1134
768 Ga0495614_0025417 3300048089 Bacteria 2554
769 Ga0496100_0065578 3300048903 Bacteria 2406
770 Ga0496100_0168826 3300048903 Bacteria 1574
771 Ga0496100_0447978 3300048903 Bacteria 989
772 Ga0496101_0000875 3300048904 Bacteria 17763
773 Ga0496101_0058755 3300048904 Bacteria 2786
774 Ga0496101_0073003 3300048904 Bacteria 2520
775 Ga0496101_0180199 3300048904 Bacteria 1627
776 Ga0496102_0009695 3300048905 Bacteria 8280
777 Ga0496102_0021478 3300048905 Bacteria 5708
778 Ga0496102_0356779 3300048905 Bacteria 1376
779 Ga0496102_0715375 3300048905 Bacteria 924
780 Ga0496103_0006163 3300048906 Bacteria 7164
781 Ga0496103_0015179 3300048906 Bacteria 4579
782 Ga0496103_0059635 3300048906 Bacteria 2371
783 Ga0496104_0006272 3300048907 Bacteria 10452
784 Ga0496104_0009754 3300048907 Bacteria 8561
785 Ga0496104_0016857 3300048907 Bacteria 6642
786 Ga0496104_0027410 3300048907 Bacteria 5272
787 Ga0496104_0049962 3300048907 Bacteria 3945
788 Ga0496104_0148417 3300048907 Bacteria 2251
789 Ga0496104_0416258 3300048907 Bacteria 1256
790 Ga0496104_0553105 3300048907 Bacteria 1062
791 Ga0496105_0008791 3300048908 Bacteria 7863
792 Ga0496105_0013347 3300048908 Bacteria 6519
793 Ga0496105_0013653 3300048908 Bacteria 6449
794 Ga0496105_0015561 3300048908 Bacteria 6065
795 Ga0496105_0017743 3300048908 Bacteria 5710
796 Ga0496105_0019982 3300048908 Bacteria 5406
797 Ga0496105_0124523 3300048908 Bacteria 2125
798 Ga0496105_0174614 3300048908 Bacteria 1760
799 Ga0496105_0267473 3300048908 Bacteria 1381
800 Ga0496106_0000340 3300048909 Bacteria 32856
801 Ga0496106_0000980 3300048909 Bacteria 20817
802 Ga0496106_0054530 3300048909 Bacteria 3020
803 Ga0496106_0088453 3300048909 Bacteria 2388
804 Ga0496106_0284363 3300048909 Bacteria 1325
805 Ga0496106_0338085 3300048909 Bacteria 1209
806 Ga0496106_0548041 3300048909 Bacteria 928
807 Ga0496107_0018903 3300048910 Bacteria 4857
808 Ga0496107_0020915 3300048910 Bacteria 4625
809 Ga0496107_0104295 3300048910 Bacteria 2081
810 Ga0496108_0002192 3300048911 Bacteria 15654
811 Ga0496108_0024933 3300048911 Bacteria 4926
812 Ga0496108_0191933 3300048911 Bacteria 1770
813 Ga0496109_0008485 3300048912 Bacteria 8735
814 Ga0496109_0010462 3300048912 Bacteria 7926
815 Ga0496109_0016756 3300048912 Bacteria 6412
816 Ga0496109_0101853 3300048912 Bacteria 2665
817 Ga0496109_0224669 3300048912 Bacteria 1766
818 Ga0496110_0005199 3300048913 Bacteria 10182
819 Ga0496110_0052601 3300048913 Bacteria 3578
820 Ga0496110_0095144 3300048913 Bacteria 2667
821 Ga0496110_0187839 3300048913 Bacteria 1876
822 Ga0496111_0008455 3300048914 Bacteria 6815
823 Ga0496111_0094015 3300048914 Bacteria 2198
824 Ga0496111_0123312 3300048914 Bacteria 1915
825 Ga0496111_0198771 3300048914 Bacteria 1490
826 Ga0496111_0234380 3300048914 Bacteria 1363
827 Ga0496111_0318632 3300048914 Bacteria 1152
828 Ga0496112_0000046 3300048915 Bacteria 85631
829 Ga0496112_0011755 3300048915 Bacteria 8015
830 Ga0496112_0016391 3300048915 Bacteria 6941
831 Ga0496112_0045182 3300048915 Bacteria 4317
832 Ga0496112_0058027 3300048915 Bacteria 3811
833 Ga0496112_0694900 3300048915 Unclassified 945
834 Ga0496112_0839479 3300048915 Bacteria 842
835 Ga0496113_0001312 3300048916 Bacteria 13745
836 Ga0496113_0004620 3300048916 Bacteria 8486
837 Ga0496114_0004461 3300048917 Bacteria 10865
838 Ga0496114_0068014 3300048917 Bacteria 2990
839 Ga0496114_0228009 3300048917 Bacteria 1636
840 Ga0496114_0284169 3300048917 Bacteria 1459
841 Ga0496115_0002553 3300048918 Bacteria 13088
842 Ga0496115_0026735 3300048918 Bacteria 4507
843 Ga0496115_0070017 3300048918 Bacteria 2843
844 Ga0496115_0083471 3300048918 Bacteria 2604
845 Ga0496115_0218197 3300048918 Bacteria 1574
846 Ga0496115_0406274 3300048918 Bacteria 1104
847 Ga0496116_0000554 3300048919 Bacteria 50097
848 Ga0496116_0000555 3300048919 Bacteria 50050
849 Ga0496116_0007216 3300048919 Bacteria 9916
850 Ga0496116_0062552 3300048919 Bacteria 2403
851 Ga0496117_0040145 3300048920 Bacteria 3447
852 Ga0496117_0068342 3300048920 Bacteria 2399
853 Ga0496117_0073771 3300048920 Bacteria 2275
854 Ga0496117_0104448 3300048920 Bacteria 1783
855 Ga0496117_0116626 3300048920 Bacteria 1650
856 Ga0496117_0160292 3300048920 Bacteria 1319
857 Ga0496118_0014101 3300048921 Bacteria 7499
858 Ga0496118_0024568 3300048921 Bacteria 5196
859 Ga0496118_0126344 3300048921 Bacteria 1654
860 Ga0496118_0130139 3300048921 Bacteria 1618
861 Ga0496118_0158501 3300048921 Unclassified 1404
862 Ga0496118_0189864 3300048921 Bacteria 1230
863 Ga0496119_0015903 3300048922 Bacteria 5760
864 Ga0496119_0082578 3300048922 Bacteria 1848
865 Ga0496119_0152820 3300048922 Bacteria 1235
866 Ga0496120_0079787 3300048923 Bacteria 1775
867 Ga0496120_0135629 3300048923 Bacteria 1255
868 Ga0496121_0000330 3300048924 Bacteria 98687
869 Ga0496121_0000516 3300048924 Bacteria 73572
870 Ga0496121_0002350 3300048924 Bacteria 29161
871 Ga0496121_0005737 3300048924 Bacteria 15768
872 Ga0496121_0047898 3300048924 Bacteria 3641
873 Ga0496121_0083183 3300048924 Bacteria 2527
874 Ga0496121_0088668 3300048924 Bacteria 2424
875 Ga0496121_0096160 3300048924 Bacteria 2299
876 Ga0496121_0117918 3300048924 Bacteria 2010
877 Ga0496121_0122978 3300048924 Bacteria 1956
878 Ga0496121_0152296 3300048924 Bacteria 1700
879 Ga0496121_0215148 3300048924 Bacteria 1358
880 Ga0496121_0215158 3300048924 Bacteria 1358
881 Ga0496121_0356939 3300048924 Bacteria 972
882 Ga0496122_0003971 3300048925 Bacteria 18885
883 Ga0496122_0007384 3300048925 Bacteria 12243
884 Ga0496122_0011018 3300048925 Bacteria 9238
885 Ga0496122_0209944 3300048925 Bacteria 1129
886 Ga0496122_0219257 3300048925 Bacteria 1093
887 Ga0496123_0003013 3300048926 Bacteria 19460
888 Ga0496123_0064214 3300048926 Unclassified 2341
889 Ga0496124_0001503 3300048927 Bacteria 34105
890 Ga0496124_0001892 3300048927 Bacteria 28784
891 Ga0496124_0007566 3300048927 Bacteria 11521
892 Ga0496124_0100937 3300048927 Bacteria 2338
893 Ga0496124_0137125 3300048927 Bacteria 1936
894 Ga0496124_0163019 3300048927 Bacteria 1736
895 Ga0496124_0173368 3300048927 Bacteria 1668
896 Ga0496124_0183784 3300048927 Bacteria 1606
897 Ga0496125_0012824 3300048928 Bacteria 8283
898 Ga0496125_0028905 3300048928 Bacteria 4993
899 Ga0496125_0034333 3300048928 Bacteria 4473
900 Ga0496125_0038831 3300048928 Bacteria 4111
901 Ga0496125_0110409 3300048928 Bacteria 1994
902 Ga0496125_0127047 3300048928 Bacteria 1804
903 Ga0496125_0161986 3300048928 Bacteria 1518
904 Ga0496125_0273739 3300048928 Bacteria 1050
905 Ga0496126_0003590 3300048929 Bacteria 19439
906 Ga0496126_0004961 3300048929 Bacteria 15521
907 Ga0496126_0008744 3300048929 Bacteria 10873
908 Ga0496126_0014351 3300048929 Bacteria 8012
909 Ga0496126_0021577 3300048929 Bacteria 6288
910 Ga0496126_0048825 3300048929 Bacteria 3865
911 Ga0496126_0073740 3300048929 Bacteria 3033
912 Ga0496126_0128019 3300048929 Bacteria 2196
913 Ga0496126_0136250 3300048929 Bacteria 2118
914 Ga0496126_0151272 3300048929 Bacteria 1989
915 Ga0496126_0189831 3300048929 Bacteria 1741
916 Ga0496126_0305040 3300048929 Bacteria 1312
917 Ga0496126_0431099 3300048929 Unclassified 1064
918 Ga0496126_0540897 3300048929 Bacteria 926
919 Ga0501032_0120620 3300049569 Bacteria 1733
920 Ga0501032_0127848 3300049569 Bacteria 1678
921 Ga0501034_0081269 3300049571 Bacteria 3243
922 Ga0501038_0162296 3300049574 Bacteria 1815
923 Ga0501043_0015152 3300049579 Bacteria 6035
924 Ga0501046_0276539 3300049580 Bacteria 1231
925 Ga0501047_0069695 3300049581 Bacteria 3386
926 Ga0501047_0187189 3300049581 Bacteria 1935
927 Ga0501070_0002569 3300049586 Bacteria 15889
928 Ga0501072_0592059 3300049588 Unclassified 875
929 Ga0501073_0099041 3300049589 Bacteria 2024
930 Ga0501079_0447739 3300049741 Bacteria 1014
931 Ga0501080_0051457 3300049742 Bacteria 3832
932 Ga0501035_0241920 3300049822 Bacteria 1535
933 Ga0501044_0058692 3300049823 Bacteria 3945
934 Ga0501044_0099517 3300049823 Bacteria 2926
935 nmdc:mga03n38_12701_c1 3300050490 Bacteria 3178
936 nmdc:mga03n38_233572_c1 3300050490 Bacteria 965
937 nmdc:mga0yw44_119137_c1 3300050492 Bacteria 1699
938 nmdc:mga0yw44_353071_c1 3300050492 Bacteria 990
939 nmdc:mga0yw44_53556_c1 3300050492 Bacteria 2451
940 nmdc:mga0k408_226252_c1 3300050493 Bacteria 1117
941 nmdc:mga0k408_56476_c1 3300050493 Bacteria 2278
942 nmdc:mga06z11_212317_c1 3300050494 Bacteria 1128
943 nmdc:mga06z11_372899_c1 3300050494 Bacteria 857
944 nmdc:mga04h51_43115_c1 3300050495 Bacteria 1483
945 nmdc:mga04h51_44777_c1 3300050495 Bacteria 1461
946 nmdc:mga07m45_11320_c1 3300050496 Bacteria 4684
947 nmdc:mga07m45_167480_c2 3300050496 Bacteria 920
948 nmdc:mga07m45_26783_c1 3300050496 Bacteria 3170
949 nmdc:mga0rr50_125135_c1 3300050513 Bacteria 2051
950 nmdc:mga0sz30_101728_c1 3300050516 Bacteria 1256
951 nmdc:mga0sz30_103299_c2 3300050516 Bacteria 892
952 nmdc:mga0sz30_7774_c1 3300050516 Bacteria 4029
953 Ga0495601_0007329 3300053077 Bacteria 6466
954 Ga0495601_0015690 3300053077 Bacteria 4580
955 Ga0495601_0151677 3300053077 Bacteria 1513
956 Ga0500610_0098594 3300053079 Bacteria 1514
957 Ga0500635_0003164 3300053080 Bacteria 4115
958 Ga0500635_0006838 3300053080 Bacteria 3064
959 Ga0495655_0070491 3300053083 Bacteria 976
960 Ga0495595_0000335 3300053084 Bacteria 18133
961 Ga0495619_0001292 3300053085 Bacteria 16456
962 Ga0495619_0086548 3300053085 Bacteria 2118
963 Ga0495619_0317149 3300053085 Bacteria 1079
964 Ga0500578_0296575 3300053086 Bacteria 960
965 Ga0500643_000085 3300053087 Bacteria 98026
966 Ga0500647_0048749 3300053091 Bacteria 2036
967 Ga0500583_0057464 3300053092 Bacteria 1827
968 Ga0500651_0000753 3300053093 Bacteria 15823
969 Ga0500651_0019704 3300053093 Bacteria 4195
970 Ga0500651_0092317 3300053093 Bacteria 1863
971 Ga0500651_0157314 3300053093 Bacteria 1361
972 Ga0500566_0040638 3300053094 Bacteria 2688
973 Ga0500566_0104821 3300053094 Bacteria 1545
974 Ga0500566_0152408 3300053094 Bacteria 1214
975 Ga0500641_0006151 3300053096 Bacteria 4255
976 Ga0500641_0026829 3300053096 Bacteria 2239
977 Ga0500650_0052623 3300053098 Bacteria 1893
978 Ga0500554_036547 3300053102 Bacteria 1484
979 Ga0500555_001913 3300053103 Bacteria 6179
980 Ga0500557_000002 3300053105 Bacteria 234207
981 Ga0500557_000352 3300053105 Bacteria 6021
982 Ga0500562_013305 3300053108 Bacteria 2100
983 Ga0500569_001325 3300053109 Bacteria 4633
984 Ga0500569_080513 3300053109 Bacteria 1041
985 Ga0500572_000025 3300053111 Bacteria 45953
986 Ga0500572_005987 3300053111 Bacteria 2772
987 Ga0500594_0000727 3300053118 Bacteria 7004
988 Ga0500595_000468 3300053119 Bacteria 24982
989 Ga0500595_003984 3300053119 Bacteria 6749
990 Ga0500595_011510 3300053119 Bacteria 3460
991 Ga0500595_031540 3300053119 Bacteria 1777
992 Ga0500595_055296 3300053119 Bacteria 1216
993 Ga0500621_113381 3300053126 Bacteria 1057
994 Ga0500642_0000144 3300053130 Bacteria 31539
995 Ga0500642_0018643 3300053130 Bacteria 2689
996 Ga0500642_0051893 3300053130 Bacteria 1814
997 Ga0500658_0004773 3300053134 Bacteria 5050
998 Ga0500658_0051682 3300053134 Bacteria 1681
999 Ga0500559_0000289 3300053136 Bacteria 38837
1000 Ga0500559_0005421 3300053136 Bacteria 5871
1001 Ga0500559_0083158 3300053136 Bacteria 1458
1002 Ga0500568_0001209 3300053139 Bacteria 17208
1003 Ga0500568_0003017 3300053139 Bacteria 9628
1004 Ga0500577_0080777 3300053142 Bacteria 1296
1005 Ga0500590_031643 3300053148 Bacteria 2743
1006 Ga0500604_0007881 3300053151 Bacteria 2824
1007 Ga0500616_0073262 3300053153 Bacteria 1739
1008 Ga0500620_001333 3300053155 Bacteria 4489
1009 Ga0500622_0016487 3300053156 Bacteria 3947
1010 Ga0500622_0161119 3300053156 Bacteria 1052
1011 Ga0500633_0000136 3300053160 Bacteria 9700
1012 Ga0500638_002107 3300053162 Bacteria 6750
1013 Ga0500638_048019 3300053162 Bacteria 2065
1014 Ga0500639_113107 3300053163 Bacteria 1317
1015 Ga0500636_0000356 3300053177 Bacteria 25066
1016 Ga0500636_0029443 3300053177 Bacteria 3244
1017 Ga0500637_0000546 3300053178 Bacteria 14728
1018 Ga0500576_066515 3300053725 Bacteria 1561
1019 Ga0500625_005076 3300053729 Bacteria 5460
1020 Ga0500645_025229 3300053730 Bacteria 1814
1021 Ga0500609_001507 3300053731 Bacteria 3407
1022 Ga0500609_015690 3300053731 Bacteria 1027
1023 Ga0500596_001272 3300053735 Bacteria 5098
1024 Ga0500601_000107 3300053737 Bacteria 17235
1025 Ga0500601_009479 3300053737 Bacteria 1086
1026 Ga0500661_000782 3300055283 Bacteria 5933
1027 Ga0500661_004482 3300055283 Bacteria 2613
1028 Ga0501082_0215851 3300060353 Bacteria 1669
1029 Ga0466962_0021100 3300061719 Bacteria 3128

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046524 Ga0495648_0056234 Ga0495648_0056234_1625_2356 207
2 3300033180 Ga0307510_10000008 Ga0307510_10000008248 209
3 3300048929 Ga0496126_0540897 Ga0496126_0540897_194_910 228
4 3300044842 Ga0466957_0586456 Ga0466957_0586456_21_746 232
5 3300046511 Ga0495608_0467078 Ga0495608_0467078_27_743 233
6 3300047320 Ga0495672_0001907 Ga0495672_0001907_6922_7728 241
7 3300035086 Ga0373934_0118110 Ga0373934_0118110_25_759 244
8 3300046674 Ga0495588_0279413 Ga0495588_0279413_14_748 244
9 3300003320 rootH2_10112393 rootH2_101123932 245
10 3300003322 rootL2_10313393 rootL2_103133932 245
11 3300005289 Ga0065704_10144922 Ga0065704_101449221 245
12 3300005295 Ga0065707_10082478 Ga0065707_1008247813 245
13 3300025253 Ga0209677_100210 Ga0209677_10021027 245
14 3300039447 Ga0436361_0260510 Ga0436361_0260510_220_996 247
15 iso_pu_bacteria 2876377896 2876382896 247
16 iso_pu_bacteria 2938014810 2938021114 247
17 3300026075 Ga0207708_10096030 Ga0207708_100960302 250
18 3300026118 Ga0207675_100053975 Ga0207675_1000539752 250
19 3300037853 Ga0436364_0804269 Ga0436364_0804269_1901_2686 250
20 3300039450 Ga0436363_0090351 Ga0436363_0090351_2092_2877 250
21 3300039453 Ga0436362_0224975 Ga0436362_0224975_110_895 250
22 3300053096 Ga0500641_0006151 Ga0500641_0006151_2366_3157 250
23 3300014968 Ga0157379_10450242 Ga0157379_104502421 251
24 3300046660 Ga0495625_0270253 Ga0495625_0270253_47_838 251
25 3300053086 Ga0500578_0296575 Ga0500578_0296575_62_853 251
26 3300053109 Ga0500569_080513 Ga0500569_080513_60_851 251
27 3300053119 Ga0500595_011510 Ga0500595_011510_678_1469 251
28 3300048915 Ga0496112_0839479 Ga0496112_0839479_56_826 253
29 3300025981 Ga0207640_10154765 Ga0207640_101547652 254
30 3300005327 Ga0070658_10071500 Ga0070658_100715003 255
31 3300005329 Ga0070683_100020118 Ga0070683_1000201183 255
32 3300005330 Ga0070690_100266135 Ga0070690_1002661352 255
33 3300005335 Ga0070666_10263828 Ga0070666_102638282 255
34 3300005338 Ga0068868_100140150 Ga0068868_1001401502 255
35 3300005343 Ga0070687_100375586 Ga0070687_1003755861 255
36 3300005353 Ga0070669_100103043 Ga0070669_1001030432 255
37 3300005366 Ga0070659_100090102 Ga0070659_1000901022 255
38 3300005455 Ga0070663_100020229 Ga0070663_1000202292 255
39 3300005455 Ga0070663_100428270 Ga0070663_1004282701 255
40 3300005456 Ga0070678_100145554 Ga0070678_1001455541 255
41 3300005457 Ga0070662_100268977 Ga0070662_1002689771 255
42 3300005535 Ga0070684_100032764 Ga0070684_1000327645 255
43 3300005543 Ga0070672_100433070 Ga0070672_1004330701 255
44 3300005544 Ga0070686_100165764 Ga0070686_1001657642 255
45 3300005548 Ga0070665_100003933 Ga0070665_10000393312 255
46 3300005548 Ga0070665_100043093 Ga0070665_1000430932 255
47 3300005563 Ga0068855_100048758 Ga0068855_1000487585 255
48 3300005564 Ga0070664_100010213 Ga0070664_1000102137 255
49 3300005564 Ga0070664_100180166 Ga0070664_1001801661 255
50 3300005577 Ga0068857_100409039 Ga0068857_1004090392 255
51 3300005614 Ga0068856_100070384 Ga0068856_1000703843 255
52 3300005614 Ga0068856_100243192 Ga0068856_1002431922 255
53 3300005615 Ga0070702_100254722 Ga0070702_1002547222 255
54 3300005616 Ga0068852_100048001 Ga0068852_1000480012 255
55 3300005616 Ga0068852_100231216 Ga0068852_1002312162 255
56 3300005617 Ga0068859_100094400 Ga0068859_1000944002 255
57 3300005840 Ga0068870_10188569 Ga0068870_101885692 255
58 3300005841 Ga0068863_100077859 Ga0068863_1000778592 255
59 3300005842 Ga0068858_100023425 Ga0068858_1000234251 255
60 3300005843 Ga0068860_100111996 Ga0068860_1001119962 255
61 3300006038 Ga0075365_10103860 Ga0075365_101038602 255
62 3300006038 Ga0075365_10133070 Ga0075365_101330701 255
63 3300006042 Ga0075368_10002535 Ga0075368_100025356 255
64 3300006048 Ga0075363_100040213 Ga0075363_1000402132 255
65 3300006048 Ga0075363_100042632 Ga0075363_1000426322 255
66 3300006051 Ga0075364_10135769 Ga0075364_101357692 255
67 3300006178 Ga0075367_10053799 Ga0075367_100537992 255
68 3300006178 Ga0075367_10265229 Ga0075367_102652292 255
69 3300006186 Ga0075369_10070150 Ga0075369_100701502 255
70 3300006237 Ga0097621_100080313 Ga0097621_1000803132 255
71 3300006353 Ga0075370_10008627 Ga0075370_100086276 255
72 3300006358 Ga0068871_100095172 Ga0068871_1000951722 255
73 3300006931 Ga0097620_100094399 Ga0097620_1000943992 255
74 3300009093 Ga0105240_10686223 Ga0105240_106862232 255
75 3300009094 Ga0111539_10545712 Ga0111539_105457122 255
76 3300009098 Ga0105245_10079955 Ga0105245_100799552 255
77 3300009174 Ga0105241_10113348 Ga0105241_101133482 255
78 3300009174 Ga0105241_10281298 Ga0105241_102812982 255
79 3300009177 Ga0105248_10046037 Ga0105248_100460373 255
80 3300009545 Ga0105237_10100512 Ga0105237_101005122 255
81 3300009545 Ga0105237_10444566 Ga0105237_104445662 255
82 3300009551 Ga0105238_10135833 Ga0105238_101358332 255
83 3300010375 Ga0105239_10183118 Ga0105239_101831182 255
84 3300010375 Ga0105239_10446995 Ga0105239_104469952 255
85 3300011119 Ga0105246_10055406 Ga0105246_100554062 255
86 3300013105 Ga0157369_10016093 Ga0157369_100160932 255
87 3300013297 Ga0157378_10075165 Ga0157378_100751653 255
88 3300013307 Ga0157372_10743048 Ga0157372_107430481 255
89 3300013308 Ga0157375_10216272 Ga0157375_102162722 255
90 3300014325 Ga0163163_10576374 Ga0163163_105763742 255
91 3300014968 Ga0157379_10263569 Ga0157379_102635692 255
92 3300025900 Ga0207710_10137027 Ga0207710_101370272 255
93 3300025901 Ga0207688_10024216 Ga0207688_100242162 255
94 3300025908 Ga0207643_10115699 Ga0207643_101156992 255
95 3300025909 Ga0207705_10599324 Ga0207705_105993241 255
96 3300025913 Ga0207695_10765357 Ga0207695_107653571 255
97 3300025914 Ga0207671_10146469 Ga0207671_101464692 255
98 3300025918 Ga0207662_10073290 Ga0207662_100732902 255
99 3300025920 Ga0207649_10431590 Ga0207649_104315901 255
100 3300025924 Ga0207694_10649961 Ga0207694_106499611 255
101 3300025927 Ga0207687_10047348 Ga0207687_100473481 255
102 3300025933 Ga0207706_10258745 Ga0207706_102587452 255
103 3300025940 Ga0207691_10499021 Ga0207691_104990211 255
104 3300025941 Ga0207711_10116854 Ga0207711_101168542 255
105 3300025944 Ga0207661_10038687 Ga0207661_100386874 255
106 3300025945 Ga0207679_10047242 Ga0207679_100472423 255
107 3300025949 Ga0207667_10015015 Ga0207667_100150153 255
108 3300026067 Ga0207678_10060449 Ga0207678_100604492 255
109 3300026067 Ga0207678_10263661 Ga0207678_102636612 255
110 3300026078 Ga0207702_10063047 Ga0207702_100630472 255
111 3300026088 Ga0207641_10159592 Ga0207641_101595921 255
112 3300026121 Ga0207683_10055468 Ga0207683_100554684 255
113 3300026121 Ga0207683_10263975 Ga0207683_102639752 255
114 3300026142 Ga0207698_10021492 Ga0207698_100214925 255
115 3300028379 Ga0268266_10016992 Ga0268266_100169928 255
116 3300031507 Ga0307509_10031638 Ga0307509_100316383 255
117 3300033180 Ga0307510_10009746 Ga0307510_100097466 255
118 3300046455 Ga0495603_0022020 Ga0495603_0022020_1571_2362 255
119 3300046460 Ga0495638_0232269 Ga0495638_0232269_83_874 255
120 3300046461 Ga0495641_0061969 Ga0495641_0061969_875_1666 255
121 3300046473 Ga0495582_0115614 Ga0495582_0115614_500_1291 255
122 3300046499 Ga0495594_0137048 Ga0495594_0137048_141_932 255
123 3300046557 Ga0495622_0005946 Ga0495622_0005946_3356_4147 255
124 3300046615 Ga0495656_0141873 Ga0495656_0141873_151_942 255
125 3300048903 Ga0496100_0447978 Ga0496100_0447978_156_947 255
126 3300048909 Ga0496106_0284363 Ga0496106_0284363_373_1164 255
127 3300048911 Ga0496108_0191933 Ga0496108_0191933_521_1312 255
128 3300048912 Ga0496109_0101853 Ga0496109_0101853_74_865 255
129 3300048914 Ga0496111_0123312 Ga0496111_0123312_481_1272 255
130 3300048915 Ga0496112_0016391 Ga0496112_0016391_3442_4233 255
131 3300048918 Ga0496115_0406274 Ga0496115_0406274_181_972 255
132 3300048921 Ga0496118_0130139 Ga0496118_0130139_338_1129 255
133 3300048924 Ga0496121_0122978 Ga0496121_0122978_571_1362 255
134 3300048927 Ga0496124_0173368 Ga0496124_0173368_473_1264 255
135 3300048929 Ga0496126_0305040 Ga0496126_0305040_14_805 255
136 3300050490 nmdc:mga03n38_12701_c1 nmdc:mga03n38_12701_c1_2202_2993 255
137 3300050492 nmdc:mga0yw44_53556_c1 nmdc:mga0yw44_53556_c1_752_1543 255
138 3300050494 nmdc:mga06z11_372899_c1 nmdc:mga06z11_372899_c1_39_830 255
139 3300050496 nmdc:mga07m45_11320_c1 nmdc:mga07m45_11320_c1_3846_4637 255
140 3300050513 nmdc:mga0rr50_125135_c1 nmdc:mga0rr50_125135_c1_1235_2026 255
141 3300050516 nmdc:mga0sz30_103299_c2 nmdc:mga0sz30_103299_c2_32_823 255
142 iso_pu_bacteria 8016539877 8016548407 255
143 3300005616 Ga0068852_100501362 Ga0068852_1005013622 256
144 3300006914 Ga0075436_100410776 Ga0075436_1004107761 256
145 3300025914 Ga0207671_10391325 Ga0207671_103913251 256
146 3300037312 Ga0395899_0029757 Ga0395899_0029757_2037_2828 256
147 3300037418 Ga0395900_0061053 Ga0395900_0061053_2641_3432 256
148 3300038443 Ga0395901_0086648 Ga0395901_0086648_1749_2540 256
149 3300038443 Ga0395901_0121988 Ga0395901_0121988_1548_2339 256
150 3300044694 Ga0466963_0121949 Ga0466963_0121949_593_1390 256
151 3300046523 Ga0495644_0055108 Ga0495644_0055108_404_1195 256
152 3300053731 Ga0500609_015690 Ga0500609_015690_146_937 256
153 iso_pu_bacteria 2856287931 2856289083 256
154 iso_pu_bacteria 2857357740 2857358631 256
155 3300025261 Ga0209233_1021026 Ga0209233_10210262 258
156 3300031711 Ga0265314_10169495 Ga0265314_101694951 258
157 3300046794 Ga0495589_0008061 Ga0495589_0008061_1179_1985 258
158 3300047472 Ga0495686_0000002 Ga0495686_0000002_82311_83117 258
159 3300047472 Ga0495686_0000075 Ga0495686_0000075_115581_116387 258
160 iso_pu_bacteria 2582581299 2585233597 258
161 iso_pu_bacteria 2643221599 2644006933 258
162 iso_pu_bacteria 2904699407 2904701401 258
163 iso_pu_bacteria 8024486573 8024487170 258
164 iso_pu_bacteria 2513237096 2513659356 259
165 iso_pu_bacteria 2513237098 2513672838 259
166 iso_pu_bacteria 2513237137 2513861723 259
167 iso_pu_bacteria 2513237145 2513921382 259
168 iso_pu_bacteria 2517572143 2517893700 259
169 iso_pu_bacteria 2524023210 2524469937 259
170 iso_pu_bacteria 2524023228 2524535899 259
171 iso_pu_bacteria 2728368998 2728752842 259
172 iso_pu_bacteria 2885383462 2885389616 259
173 iso_pu_bacteria 2903768456 2903774321 259
174 iso_pu_bacteria 2906635258 2906641896 259
175 iso_pu_bacteria 2906660503 2906666087 259
176 iso_pu_bacteria 3005474847 3005478884 259
177 iso_pu_bacteria 8056681323 8056687757 259
178 3300025315 Ga0207697_10081335 Ga0207697_100813352 260
179 3300028800 Ga0265338_10000159 Ga0265338_1000015934 260
180 3300031238 Ga0265332_10061935 Ga0265332_100619352 260
181 3300031247 Ga0265340_10098838 Ga0265340_100988382 260
182 3300039437 Ga0436365_0116034 Ga0436365_0116034_2881_3666 260
183 3300002773 JGI25152J39213_1000083 JGI25152J39213_100008326 261
184 3300002774 JGI25150J39212_1000060 JGI25150J39212_100006026 261
185 3300003187 JGI25151J46595_10000239 JGI25151J46595_1000023938 261
186 3300003215 JGI25153J46596_10000578 JGI25153J46596_100005789 261
187 3300025245 Ga0207425_1000137 Ga0207425_100013741 261
188 3300025258 Ga0209129_1000098 Ga0209129_100009841 261
189 3300025273 Ga0209673_1030369 Ga0209673_10303692 261
190 3300025294 Ga0209025_1000142 Ga0209025_100014236 261
191 3300025297 Ga0209758_1000488 Ga0209758_100048841 261
192 3300037466 Ga0395898_0012584 Ga0395898_0012584_7744_8529 261
193 3300038443 Ga0395901_0007409 Ga0395901_0007409_4841_5626 261
194 3300039447 Ga0436361_0901521 Ga0436361_0901521_3241_4044 261
195 3300048919 Ga0496116_0000554 Ga0496116_0000554_13294_14085 261
196 3300048919 Ga0496116_0007216 Ga0496116_0007216_996_1787 261
197 3300048919 Ga0496116_0062552 Ga0496116_0062552_814_1602 261
198 3300048920 Ga0496117_0160292 Ga0496117_0160292_211_1002 261
199 3300048921 Ga0496118_0024568 Ga0496118_0024568_1940_2731 261
200 3300048924 Ga0496121_0000516 Ga0496121_0000516_47048_47839 261
201 3300048924 Ga0496121_0005737 Ga0496121_0005737_4063_4851 261
202 3300048924 Ga0496121_0152296 Ga0496121_0152296_487_1275 261
203 3300048924 Ga0496121_0215158 Ga0496121_0215158_338_1129 261
204 3300048925 Ga0496122_0003971 Ga0496122_0003971_16766_17557 261
205 3300048925 Ga0496122_0007384 Ga0496122_0007384_10905_11693 261
206 3300048926 Ga0496123_0003013 Ga0496123_0003013_5901_6692 261
207 3300048927 Ga0496124_0001503 Ga0496124_0001503_8366_9157 261
208 3300048927 Ga0496124_0001892 Ga0496124_0001892_22592_23383 261
209 3300048927 Ga0496124_0007566 Ga0496124_0007566_8010_8798 261
210 3300048928 Ga0496125_0012824 Ga0496125_0012824_567_1358 261
211 3300048929 Ga0496126_0431099 Ga0496126_0431099_194_985 261
212 iso_pu_bacteria 8005484373 8005486874 261
213 3300003316 rootH1_10026922 rootH1_100269228 262
214 3300005327 Ga0070658_10002866 Ga0070658_100028666 262
215 3300005366 Ga0070659_100051286 Ga0070659_1000512862 262
216 3300005548 Ga0070665_100418637 Ga0070665_1004186372 262
217 3300005563 Ga0068855_100037055 Ga0068855_1000370552 262
218 3300009093 Ga0105240_10074563 Ga0105240_100745634 262
219 3300009093 Ga0105240_10175405 Ga0105240_101754052 262
220 3300009174 Ga0105241_10135040 Ga0105241_101350402 262
221 3300009545 Ga0105237_10077266 Ga0105237_100772662 262
222 3300013104 Ga0157370_10016923 Ga0157370_100169238 262
223 3300013104 Ga0157370_10242888 Ga0157370_102428882 262
224 3300013105 Ga0157369_10000362 Ga0157369_1000036210 262
225 3300021377 Ga0213874_10013739 Ga0213874_100137391 262
226 3300025909 Ga0207705_10000352 Ga0207705_1000035230 262
227 3300025911 Ga0207654_10111618 Ga0207654_101116182 262
228 3300025913 Ga0207695_10118597 Ga0207695_101185971 262
229 3300025914 Ga0207671_10227943 Ga0207671_102279432 262
230 3300025949 Ga0207667_10002243 Ga0207667_100022436 262
231 3300028379 Ga0268266_10131123 Ga0268266_101311232 262
232 3300031712 Ga0265342_10010007 Ga0265342_100100076 262
233 3300037312 Ga0395899_0160377 Ga0395899_0160377_594_1382 262
234 3300038443 Ga0395901_0000017 Ga0395901_0000017_136313_137101 262
235 3300038443 Ga0395901_0002433 Ga0395901_0002433_940_1731 262
236 3300039450 Ga0436363_1223179 Ga0436363_1223179_1423_2241 262
237 3300044656 Ga0466969_0000523 Ga0466969_0000523_4778_5566 262
238 3300044659 Ga0466973_0019878 Ga0466973_0019878_118_906 262
239 3300044693 Ga0466961_0015547 Ga0466961_0015547_1325_2113 262
240 3300044694 Ga0466963_0001202 Ga0466963_0001202_111_899 262
241 3300044706 Ga0466964_0066669 Ga0466964_0066669_245_1078 262
242 3300044765 Ga0466970_0000982 Ga0466970_0000982_6719_7507 262
243 3300044842 Ga0466957_0003670 Ga0466957_0003670_5453_6241 262
244 3300045049 Ga0466959_0014159 Ga0466959_0014159_4280_5068 262
245 3300045836 Ga0466958_0007577 Ga0466958_0007577_2556_3344 262
246 3300045836 Ga0466958_0092199 Ga0466958_0092199_469_1257 262
247 3300046474 Ga0495605_0020982 Ga0495605_0020982_1075_1866 262
248 3300046506 Ga0495583_0001126 Ga0495583_0001126_13443_14234 262
249 3300046513 Ga0495616_0048906 Ga0495616_0048906_1116_1907 262
250 3300046518 Ga0495631_0003452 Ga0495631_0003452_7508_8299 262
251 3300046519 Ga0495632_0013949 Ga0495632_0013949_2898_3689 262
252 3300046522 Ga0495643_0125108 Ga0495643_0125108_45_836 262
253 3300046524 Ga0495648_0130506 Ga0495648_0130506_94_885 262
254 3300046533 Ga0495640_0143738 Ga0495640_0143738_481_1272 262
255 3300046616 Ga0495668_0003217 Ga0495668_0003217_1480_2271 262
256 3300046660 Ga0495625_0001420 Ga0495625_0001420_20944_21735 262
257 3300046810 Ga0495660_0038341 Ga0495660_0038341_436_1227 262
258 3300047317 Ga0495604_0015049 Ga0495604_0015049_330_1121 262
259 3300047318 Ga0495636_0041465 Ga0495636_0041465_1110_1901 262
260 3300048915 Ga0496112_0000046 Ga0496112_0000046_65082_65870 262
261 3300053105 Ga0500557_000352 Ga0500557_000352_4820_5611 262
262 3300053109 Ga0500569_001325 Ga0500569_001325_1222_2013 262
263 3300053118 Ga0500594_0000727 Ga0500594_0000727_5820_6611 262
264 3300053136 Ga0500559_0005421 Ga0500559_0005421_698_1489 262
265 3300061719 Ga0466962_0021100 Ga0466962_0021100_250_1038 262
266 3300002773 JGI25152J39213_1000150 JGI25152J39213_100015011 263
267 3300002774 JGI25150J39212_1000115 JGI25150J39212_100011537 263
268 3300003187 JGI25151J46595_10000391 JGI25151J46595_1000039111 263
269 3300003215 JGI25153J46596_10004733 JGI25153J46596_100047335 263
270 3300003215 JGI25153J46596_10007225 JGI25153J46596_100072254 263
271 3300003323 rootH1_10296570 rootH1_102965702 263
272 3300003659 JGI25404J52841_10000254 JGI25404J52841_100002548 263
273 3300003659 JGI25404J52841_10038037 JGI25404J52841_100380371 263
274 3300003760 Ga0055527_1009821 Ga0055527_10098212 263
275 3300005330 Ga0070690_100112567 Ga0070690_1001125672 263
276 3300005330 Ga0070690_100516215 Ga0070690_1005162151 263
277 3300005331 Ga0070670_100261034 Ga0070670_1002610342 263
278 3300005335 Ga0070666_10243503 Ga0070666_102435032 263
279 3300005336 Ga0070680_100340170 Ga0070680_1003401701 263
280 3300005337 Ga0070682_100337387 Ga0070682_1003373871 263
281 3300005337 Ga0070682_100340538 Ga0070682_1003405381 263
282 3300005338 Ga0068868_100006547 Ga0068868_1000065476 263
283 3300005338 Ga0068868_100203979 Ga0068868_1002039792 263
284 3300005339 Ga0070660_100014686 Ga0070660_1000146867 263
285 3300005347 Ga0070668_100069351 Ga0070668_1000693512 263
286 3300005347 Ga0070668_100749356 Ga0070668_1007493561 263
287 3300005354 Ga0070675_100784501 Ga0070675_1007845011 263
288 3300005355 Ga0070671_100077398 Ga0070671_1000773982 263
289 3300005355 Ga0070671_100301395 Ga0070671_1003013952 263
290 3300005356 Ga0070674_100063047 Ga0070674_1000630472 263
291 3300005364 Ga0070673_100058510 Ga0070673_1000585103 263
292 3300005438 Ga0070701_10123893 Ga0070701_101238931 263
293 3300005455 Ga0070663_100016240 Ga0070663_1000162405 263
294 3300005455 Ga0070663_100064231 Ga0070663_1000642312 263
295 3300005456 Ga0070678_100017610 Ga0070678_1000176102 263
296 3300005456 Ga0070678_100284076 Ga0070678_1002840762 263
297 3300005466 Ga0070685_10321644 Ga0070685_103216442 263
298 3300005530 Ga0070679_100017548 Ga0070679_1000175482 263
299 3300005539 Ga0068853_100014537 Ga0068853_1000145373 263
300 3300005539 Ga0068853_100498747 Ga0068853_1004987472 263
301 3300005545 Ga0070695_100481201 Ga0070695_1004812011 263
302 3300005548 Ga0070665_100075092 Ga0070665_1000750923 263
303 3300005548 Ga0070665_100503395 Ga0070665_1005033952 263
304 3300005563 Ga0068855_100014574 Ga0068855_1000145745 263
305 3300005563 Ga0068855_100036502 Ga0068855_1000365027 263
306 3300005578 Ga0068854_100548609 Ga0068854_1005486092 263
307 3300005615 Ga0070702_100096290 Ga0070702_1000962901 263
308 3300005616 Ga0068852_100457107 Ga0068852_1004571072 263
309 3300005617 Ga0068859_100520451 Ga0068859_1005204512 263
310 3300005617 Ga0068859_100821143 Ga0068859_1008211431 263
311 3300005618 Ga0068864_100029384 Ga0068864_1000293843 263
312 3300005842 Ga0068858_100090581 Ga0068858_1000905812 263
313 3300005843 Ga0068860_100716998 Ga0068860_1007169982 263
314 3300005844 Ga0068862_100509108 Ga0068862_1005091081 263
315 3300005844 Ga0068862_100544576 Ga0068862_1005445762 263
316 3300005983 Ga0081540_1002053 Ga0081540_100205314 263
317 3300005983 Ga0081540_1003838 Ga0081540_100383810 263
318 3300005983 Ga0081540_1005208 Ga0081540_10052083 263
319 3300006038 Ga0075365_10105251 Ga0075365_101052512 263
320 3300006042 Ga0075368_10063030 Ga0075368_100630301 263
321 3300006048 Ga0075363_100060540 Ga0075363_1000605402 263
322 3300006237 Ga0097621_100266519 Ga0097621_1002665192 263
323 3300006358 Ga0068871_100145790 Ga0068871_1001457902 263
324 3300006881 Ga0068865_100041409 Ga0068865_1000414093 263
325 3300006931 Ga0097620_100520466 Ga0097620_1005204662 263
326 3300006931 Ga0097620_100821154 Ga0097620_1008211541 263
327 3300007265 Ga0099794_10190411 Ga0099794_101904112 263
328 3300007788 Ga0099795_10017175 Ga0099795_100171752 263
329 3300009092 Ga0105250_10079294 Ga0105250_100792942 263
330 3300009093 Ga0105240_10010947 Ga0105240_100109479 263
331 3300009093 Ga0105240_10233374 Ga0105240_102333741 263
332 3300009098 Ga0105245_10051925 Ga0105245_100519252 263
333 3300009101 Ga0105247_10341169 Ga0105247_103411691 263
334 3300009148 Ga0105243_10011026 Ga0105243_100110266 263
335 3300009148 Ga0105243_10239921 Ga0105243_102399212 263
336 3300009174 Ga0105241_10014111 Ga0105241_100141114 263
337 3300009174 Ga0105241_10277228 Ga0105241_102772281 263
338 3300009176 Ga0105242_10048398 Ga0105242_100483982 263
339 3300009176 Ga0105242_10409824 Ga0105242_104098241 263
340 3300009177 Ga0105248_10034971 Ga0105248_100349712 263
341 3300009545 Ga0105237_10005418 Ga0105237_1000541820 263
342 3300009545 Ga0105237_10126179 Ga0105237_101261792 263
343 3300009551 Ga0105238_10332376 Ga0105238_103323761 263
344 3300009553 Ga0105249_10036927 Ga0105249_100369273 263
345 3300010375 Ga0105239_10002717 Ga0105239_100027179 263
346 3300010375 Ga0105239_10010954 Ga0105239_100109548 263
347 3300010375 Ga0105239_10039418 Ga0105239_100394185 263
348 3300011119 Ga0105246_10020290 Ga0105246_100202902 263
349 3300013100 Ga0157373_10002345 Ga0157373_1000234515 263
350 3300013104 Ga0157370_10004573 Ga0157370_100045739 263
351 3300013104 Ga0157370_10173706 Ga0157370_101737062 263
352 3300013105 Ga0157369_10004644 Ga0157369_100046448 263
353 3300013296 Ga0157374_10002490 Ga0157374_1000249024 263
354 3300013297 Ga0157378_10179724 Ga0157378_101797242 263
355 3300013306 Ga0163162_10015168 Ga0163162_100151685 263
356 3300013306 Ga0163162_10101008 Ga0163162_101010083 263
357 3300013307 Ga0157372_10002285 Ga0157372_100022859 263
358 3300013308 Ga0157375_10091403 Ga0157375_100914032 263
359 3300014325 Ga0163163_10007553 Ga0163163_100075531 263
360 3300014326 Ga0157380_10019544 Ga0157380_100195445 263
361 3300014745 Ga0157377_10084318 Ga0157377_100843181 263
362 3300014968 Ga0157379_10093085 Ga0157379_100930851 263
363 3300014969 Ga0157376_10013448 Ga0157376_100134485 263
364 3300017792 Ga0163161_10021099 Ga0163161_100210994 263
365 3300025228 Ga0209672_100948 Ga0209672_10094811 263
366 3300025245 Ga0207425_1000217 Ga0207425_100021738 263
367 3300025256 Ga0209759_1001867 Ga0209759_10018676 263
368 3300025258 Ga0209129_1000165 Ga0209129_100016561 263
369 3300025294 Ga0209025_1000362 Ga0209025_100036236 263
370 3300025297 Ga0209758_1000738 Ga0209758_100073810 263
371 3300025297 Ga0209758_1001532 Ga0209758_100153214 263
372 3300025899 Ga0207642_10073329 Ga0207642_100733292 263
373 3300025901 Ga0207688_10131669 Ga0207688_101316692 263
374 3300025903 Ga0207680_10461651 Ga0207680_104616511 263
375 3300025904 Ga0207647_10000340 Ga0207647_100003409 263
376 3300025912 Ga0207707_10031913 Ga0207707_100319133 263
377 3300025913 Ga0207695_10047671 Ga0207695_100476711 263
378 3300025914 Ga0207671_10006016 Ga0207671_1000601614 263
379 3300025915 Ga0207693_10068993 Ga0207693_100689932 263
380 3300025917 Ga0207660_10147020 Ga0207660_101470202 263
381 3300025919 Ga0207657_10002294 Ga0207657_100022943 263
382 3300025920 Ga0207649_10084274 Ga0207649_100842742 263
383 3300025921 Ga0207652_10271870 Ga0207652_102718702 263
384 3300025926 Ga0207659_10438468 Ga0207659_104384682 263
385 3300025927 Ga0207687_10171682 Ga0207687_101716822 263
386 3300025931 Ga0207644_10094809 Ga0207644_100948092 263
387 3300025931 Ga0207644_10269258 Ga0207644_102692581 263
388 3300025933 Ga0207706_10128442 Ga0207706_101284422 263
389 3300025935 Ga0207709_10023852 Ga0207709_100238522 263
390 3300025936 Ga0207670_10442199 Ga0207670_104421992 263
391 3300025937 Ga0207669_10038831 Ga0207669_100388312 263
392 3300025938 Ga0207704_10023352 Ga0207704_100233522 263
393 3300025940 Ga0207691_10731170 Ga0207691_107311701 263
394 3300025941 Ga0207711_10066437 Ga0207711_100664373 263
395 3300025942 Ga0207689_10087777 Ga0207689_100877772 263
396 3300025942 Ga0207689_10194134 Ga0207689_101941342 263
397 3300025945 Ga0207679_10381243 Ga0207679_103812431 263
398 3300025945 Ga0207679_10412657 Ga0207679_104126571 263
399 3300025949 Ga0207667_10010756 Ga0207667_100107567 263
400 3300025949 Ga0207667_10011404 Ga0207667_100114041 263
401 3300025960 Ga0207651_10071143 Ga0207651_100711432 263
402 3300025960 Ga0207651_10205779 Ga0207651_102057792 263
403 3300025961 Ga0207712_10055817 Ga0207712_100558172 263
404 3300025972 Ga0207668_10027869 Ga0207668_100278692 263
405 3300025986 Ga0207658_10200605 Ga0207658_102006051 263
406 3300026023 Ga0207677_10335565 Ga0207677_103355651 263
407 3300026041 Ga0207639_10460884 Ga0207639_104608842 263
408 3300026067 Ga0207678_10022770 Ga0207678_100227703 263
409 3300026067 Ga0207678_10047370 Ga0207678_100473702 263
410 3300026067 Ga0207678_10188016 Ga0207678_101880162 263
411 3300026075 Ga0207708_10032013 Ga0207708_100320134 263
412 3300026088 Ga0207641_10483056 Ga0207641_104830562 263
413 3300026095 Ga0207676_10073727 Ga0207676_100737272 263
414 3300026121 Ga0207683_10014660 Ga0207683_100146602 263
415 3300026121 Ga0207683_10338332 Ga0207683_103383322 263
416 3300026142 Ga0207698_10102945 Ga0207698_101029452 263
417 3300026142 Ga0207698_10187883 Ga0207698_101878832 263
418 3300027866 Ga0209813_10037485 Ga0209813_100374852 263
419 3300028379 Ga0268266_10046425 Ga0268266_100464252 263
420 3300028380 Ga0268265_10217115 Ga0268265_102171151 263
421 3300028380 Ga0268265_10315490 Ga0268265_103154901 263
422 3300028381 Ga0268264_10706744 Ga0268264_107067442 263
423 3300028786 Ga0307517_10231816 Ga0307517_102318161 263
424 3300028800 Ga0265338_10000677 Ga0265338_1000067736 263
425 3300031249 Ga0265339_10058585 Ga0265339_100585852 263
426 3300031250 Ga0265331_10057168 Ga0265331_100571682 263
427 3300031548 Ga0307408_100054083 Ga0307408_1000540832 263
428 3300031711 Ga0265314_10088576 Ga0265314_100885761 263
429 3300031731 Ga0307405_10018547 Ga0307405_100185471 263
430 3300031731 Ga0307405_10477000 Ga0307405_104770002 263
431 3300031852 Ga0307410_10105966 Ga0307410_101059662 263
432 3300031901 Ga0307406_10367633 Ga0307406_103676331 263
433 3300031911 Ga0307412_10028755 Ga0307412_100287551 263
434 3300031995 Ga0307409_100487100 Ga0307409_1004871001 263
435 3300032002 Ga0307416_100700310 Ga0307416_1007003101 263
436 3300032005 Ga0307411_10048502 Ga0307411_100485023 263
437 3300032005 Ga0307411_10152289 Ga0307411_101522892 263
438 3300033180 Ga0307510_10160954 Ga0307510_101609542 263
439 3300033180 Ga0307510_10356147 Ga0307510_103561471 263
440 3300033442 Ga0315911_1000009 Ga0315911_1000009282 263
441 3300034816 Ga0373930_0009869 Ga0373930_0009869_710_1501 263
442 3300035086 Ga0373934_0042189 Ga0373934_0042189_649_1440 263
443 3300035111 Ga0373923_0000827 Ga0373923_0000827_3995_4786 263
444 3300035111 Ga0373923_0254690 Ga0373923_0254690_21_812 263
445 3300035113 Ga0373936_0023778 Ga0373936_0023778_1088_1879 263
446 3300035114 Ga0373939_0057352 Ga0373939_0057352_157_948 263
447 3300035116 Ga0373945_0030903 Ga0373945_0030903_556_1347 263
448 3300035117 Ga0373953_0003595 Ga0373953_0003595_2024_2815 263
449 3300035118 Ga0373954_0000634 Ga0373954_0000634_2496_3287 263
450 3300035119 Ga0373956_0018011 Ga0373956_0018011_1982_2773 263
451 3300035120 Ga0373957_0000200 Ga0373957_0000200_5513_6304 263
452 3300035170 Ga0373943_0002648 Ga0373943_0002648_1059_1850 263
453 3300035171 Ga0373946_0008219 Ga0373946_0008219_2702_3493 263
454 3300035172 Ga0373955_0008103 Ga0373955_0008103_2750_3541 263
455 3300035410 Ga0373924_0004394 Ga0373924_0004394_1233_2024 263
456 3300035410 Ga0373924_0080229 Ga0373924_0080229_67_858 263
457 3300035691 Ga0373931_0042085 Ga0373931_0042085_1229_2029 263
458 3300035691 Ga0373931_0092591 Ga0373931_0092591_181_972 263
459 3300035692 Ga0373935_0006106 Ga0373935_0006106_194_985 263
460 3300035692 Ga0373935_0125065 Ga0373935_0125065_437_1228 263
461 3300035695 Ga0373927_0001513 Ga0373927_0001513_13014_13805 263
462 3300035695 Ga0373927_0139323 Ga0373927_0139323_284_1075 263
463 3300035695 Ga0373927_0213932 Ga0373927_0213932_404_1195 263
464 3300035724 Ga0373933_0002159 Ga0373933_0002159_2522_3313 263
465 3300035725 Ga0373947_0084456 Ga0373947_0084456_505_1296 263
466 3300035725 Ga0373947_0450488 Ga0373947_0450488_70_861 263
467 3300037068 Ga0373925_0006671 Ga0373925_0006671_6264_7055 263
468 3300037068 Ga0373925_0252084 Ga0373925_0252084_308_1099 263
469 3300037068 Ga0373925_0269292 Ga0373925_0269292_120_911 263
470 3300037312 Ga0395899_0000007 Ga0395899_0000007_296835_297629 263
471 3300037418 Ga0395900_0406146 Ga0395900_0406146_85_876 263
472 3300037466 Ga0395898_0000276 Ga0395898_0000276_111368_112162 263
473 3300039447 Ga0436361_0918647 Ga0436361_0918647_4602_5399 263
474 3300041494 Ga0451837_0376583 Ga0451837_0376583_79_870 263
475 3300042005 Ga0439448_0000098 Ga0439448_0000098_3257_4048 263
476 3300046454 Ga0495592_0002897 Ga0495592_0002897_4963_5754 263
477 3300046454 Ga0495592_0119351 Ga0495592_0119351_578_1369 263
478 3300046455 Ga0495603_0013589 Ga0495603_0013589_212_1003 263
479 3300046455 Ga0495603_0019422 Ga0495603_0019422_2054_2845 263
480 3300046455 Ga0495603_0186121 Ga0495603_0186121_397_1188 263
481 3300046459 Ga0495629_0002158 Ga0495629_0002158_4452_5243 263
482 3300046459 Ga0495629_0004330 Ga0495629_0004330_4070_4861 263
483 3300046461 Ga0495641_0035031 Ga0495641_0035031_272_1063 263
484 3300046462 Ga0495651_0023237 Ga0495651_0023237_2122_2913 263
485 3300046462 Ga0495651_0065402 Ga0495651_0065402_1264_2055 263
486 3300046463 Ga0495653_0017446 Ga0495653_0017446_3152_3943 263
487 3300046472 Ga0495580_0006344 Ga0495580_0006344_2894_3685 263
488 3300046473 Ga0495582_0006681 Ga0495582_0006681_5264_6055 263
489 3300046475 Ga0495639_0000750 Ga0495639_0000750_8546_9337 263
490 3300046476 Ga0495662_0002275 Ga0495662_0002275_6084_6875 263
491 3300046477 Ga0495664_0014584 Ga0495664_0014584_1596_2387 263
492 3300046499 Ga0495594_0054320 Ga0495594_0054320_1139_1930 263
493 3300046500 Ga0495596_0108613 Ga0495596_0108613_147_938 263
494 3300046511 Ga0495608_0002218 Ga0495608_0002218_10387_11178 263
495 3300046514 Ga0495618_0222532 Ga0495618_0222532_378_1169 263
496 3300046516 Ga0495628_0038487 Ga0495628_0038487_323_1114 263
497 3300046517 Ga0495630_0025991 Ga0495630_0025991_516_1307 263
498 3300046518 Ga0495631_0033577 Ga0495631_0033577_159_950 263
499 3300046529 Ga0495652_0034244 Ga0495652_0034244_41_832 263
500 3300046529 Ga0495652_0038809 Ga0495652_0038809_308_1099 263
501 3300046529 Ga0495652_0126467 Ga0495652_0126467_629_1435 263
502 3300046531 Ga0495665_0007507 Ga0495665_0007507_3430_4221 263
503 3300046533 Ga0495640_0005616 Ga0495640_0005616_360_1151 263
504 3300046533 Ga0495640_0007861 Ga0495640_0007861_5994_6785 263
505 3300046535 Ga0495586_0013054 Ga0495586_0013054_1318_2109 263
506 3300046536 Ga0495587_0032169 Ga0495587_0032169_2174_2965 263
507 3300046543 Ga0495645_0063352 Ga0495645_0063352_885_1676 263
508 3300046557 Ga0495622_0006189 Ga0495622_0006189_324_1115 263
509 3300046559 Ga0495667_0019371 Ga0495667_0019371_3514_4305 263
510 3300046642 Ga0495634_0001188 Ga0495634_0001188_13674_14465 263
511 3300046642 Ga0495634_0012328 Ga0495634_0012328_1837_2628 263
512 3300046663 Ga0495635_0001058 Ga0495635_0001058_7116_7907 263
513 3300046663 Ga0495635_0031655 Ga0495635_0031655_2143_2934 263
514 3300046674 Ga0495588_0026364 Ga0495588_0026364_580_1371 263
515 3300046675 Ga0495657_0021303 Ga0495657_0021303_638_1429 263
516 3300046678 Ga0495599_0003523 Ga0495599_0003523_3787_4578 263
517 3300046679 Ga0495623_0006259 Ga0495623_0006259_3024_3815 263
518 3300046680 Ga0495646_0000934 Ga0495646_0000934_5082_5873 263
519 3300046680 Ga0495646_0109119 Ga0495646_0109119_426_1217 263
520 3300046681 Ga0495647_0018833 Ga0495647_0018833_909_1700 263
521 3300046683 Ga0495658_0061062 Ga0495658_0061062_1307_2098 263
522 3300046683 Ga0495658_0183251 Ga0495658_0183251_196_987 263
523 3300046684 Ga0495669_0003832 Ga0495669_0003832_3967_4758 263
524 3300046689 Ga0495613_0009382 Ga0495613_0009382_333_1124 263
525 3300046689 Ga0495613_0048777 Ga0495613_0048777_2303_3094 263
526 3300046690 Ga0495624_0007459 Ga0495624_0007459_373_1164 263
527 3300046809 Ga0495600_0001795 Ga0495600_0001795_8055_8846 263
528 3300046809 Ga0495600_0103023 Ga0495600_0103023_701_1492 263
529 3300047315 Ga0495581_0000567 Ga0495581_0000567_2152_2943 263
530 3300047317 Ga0495604_0005607 Ga0495604_0005607_1663_2454 263
531 3300047317 Ga0495604_0172956 Ga0495604_0172956_73_864 263
532 3300047317 Ga0495604_0211484 Ga0495604_0211484_535_1326 263
533 3300047319 Ga0495674_0007182 Ga0495674_0007182_7279_8070 263
534 3300047319 Ga0495674_0013705 Ga0495674_0013705_3090_3884 263
535 3300047319 Ga0495674_0015961 Ga0495674_0015961_3568_4359 263
536 3300047319 Ga0495674_0020569 Ga0495674_0020569_281_1081 263
537 3300047320 Ga0495672_0056827 Ga0495672_0056827_573_1364 263
538 3300047322 Ga0495680_0133851 Ga0495680_0133851_932_1738 263
539 3300047444 Ga0495675_0002644 Ga0495675_0002644_2485_3276 263
540 3300047471 Ga0495684_0003538 Ga0495684_0003538_9254_10045 263
541 3300047471 Ga0495684_0073429 Ga0495684_0073429_1682_2473 263
542 3300047472 Ga0495686_0122584 Ga0495686_0122584_595_1386 263
543 3300047673 Ga0495593_0002295 Ga0495593_0002295_6470_7261 263
544 3300047673 Ga0495593_0003406 Ga0495593_0003406_76_867 263
545 3300048088 Ga0495602_0272327 Ga0495602_0272327_292_1086 263
546 3300048089 Ga0495614_0025417 Ga0495614_0025417_1018_1809 263
547 3300048903 Ga0496100_0065578 Ga0496100_0065578_319_1110 263
548 3300048904 Ga0496101_0000875 Ga0496101_0000875_6718_7509 263
549 3300048904 Ga0496101_0180199 Ga0496101_0180199_68_859 263
550 3300048905 Ga0496102_0009695 Ga0496102_0009695_7364_8155 263
551 3300048905 Ga0496102_0715375 Ga0496102_0715375_31_822 263
552 3300048906 Ga0496103_0006163 Ga0496103_0006163_577_1368 263
553 3300048906 Ga0496103_0059635 Ga0496103_0059635_740_1531 263
554 3300048907 Ga0496104_0027410 Ga0496104_0027410_281_1072 263
555 3300048907 Ga0496104_0148417 Ga0496104_0148417_142_933 263
556 3300048908 Ga0496105_0013653 Ga0496105_0013653_385_1176 263
557 3300048908 Ga0496105_0017743 Ga0496105_0017743_287_1078 263
558 3300048909 Ga0496106_0054530 Ga0496106_0054530_1261_2052 263
559 3300048909 Ga0496106_0088453 Ga0496106_0088453_1072_1863 263
560 3300048909 Ga0496106_0548041 Ga0496106_0548041_71_862 263
561 3300048910 Ga0496107_0018903 Ga0496107_0018903_385_1176 263
562 3300048910 Ga0496107_0020915 Ga0496107_0020915_1071_1862 263
563 3300048911 Ga0496108_0002192 Ga0496108_0002192_3015_3806 263
564 3300048912 Ga0496109_0010462 Ga0496109_0010462_1665_2456 263
565 3300048912 Ga0496109_0224669 Ga0496109_0224669_357_1148 263
566 3300048913 Ga0496110_0005199 Ga0496110_0005199_1119_1910 263
567 3300048913 Ga0496110_0095144 Ga0496110_0095144_172_963 263
568 3300048914 Ga0496111_0094015 Ga0496111_0094015_944_1735 263
569 3300048914 Ga0496111_0234380 Ga0496111_0234380_188_979 263
570 3300048915 Ga0496112_0058027 Ga0496112_0058027_1079_1870 263
571 3300048916 Ga0496113_0001312 Ga0496113_0001312_12791_13582 263
572 3300048917 Ga0496114_0004461 Ga0496114_0004461_3817_4608 263
573 3300048918 Ga0496115_0002553 Ga0496115_0002553_11719_12510 263
574 3300048919 Ga0496116_0000555 Ga0496116_0000555_23873_24673 263
575 3300048920 Ga0496117_0116626 Ga0496117_0116626_699_1490 263
576 3300048921 Ga0496118_0189864 Ga0496118_0189864_319_1110 263
577 3300048922 Ga0496119_0082578 Ga0496119_0082578_372_1163 263
578 3300048924 Ga0496121_0000330 Ga0496121_0000330_42749_43540 263
579 3300048925 Ga0496122_0219257 Ga0496122_0219257_100_891 263
580 3300048926 Ga0496123_0064214 Ga0496123_0064214_1033_1833 263
581 3300048927 Ga0496124_0163019 Ga0496124_0163019_429_1220 263
582 3300048929 Ga0496126_0003590 Ga0496126_0003590_4473_5264 263
583 3300048929 Ga0496126_0004961 Ga0496126_0004961_9381_10172 263
584 3300048929 Ga0496126_0014351 Ga0496126_0014351_4746_5540 263
585 3300048929 Ga0496126_0021577 Ga0496126_0021577_142_942 263
586 3300048929 Ga0496126_0048825 Ga0496126_0048825_503_1294 263
587 3300048929 Ga0496126_0128019 Ga0496126_0128019_833_1624 263
588 3300048929 Ga0496126_0151272 Ga0496126_0151272_244_1035 263
589 3300048929 Ga0496126_0189831 Ga0496126_0189831_203_994 263
590 3300050490 nmdc:mga03n38_233572_c1 nmdc:mga03n38_233572_c1_43_837 263
591 3300050492 nmdc:mga0yw44_119137_c1 nmdc:mga0yw44_119137_c1_85_876 263
592 3300050493 nmdc:mga0k408_226252_c1 nmdc:mga0k408_226252_c1_306_1097 263
593 3300050495 nmdc:mga04h51_44777_c1 nmdc:mga04h51_44777_c1_568_1359 263
594 3300053077 Ga0495601_0007329 Ga0495601_0007329_5643_6434 263
595 3300053077 Ga0495601_0015690 Ga0495601_0015690_440_1231 263
596 3300053077 Ga0495601_0151677 Ga0495601_0151677_22_813 263
597 3300053080 Ga0500635_0006838 Ga0500635_0006838_297_1088 263
598 3300053084 Ga0495595_0000335 Ga0495595_0000335_10125_10916 263
599 3300053085 Ga0495619_0001292 Ga0495619_0001292_6558_7349 263
600 3300053085 Ga0495619_0317149 Ga0495619_0317149_34_825 263
601 3300053093 Ga0500651_0000753 Ga0500651_0000753_14847_15638 263
602 3300053094 Ga0500566_0104821 Ga0500566_0104821_676_1467 263
603 3300053096 Ga0500641_0026829 Ga0500641_0026829_875_1666 263
604 3300053102 Ga0500554_036547 Ga0500554_036547_454_1245 263
605 3300053119 Ga0500595_000468 Ga0500595_000468_13224_14015 263
606 3300053119 Ga0500595_003984 Ga0500595_003984_1898_2689 263
607 3300053119 Ga0500595_055296 Ga0500595_055296_63_854 263
608 3300053130 Ga0500642_0051893 Ga0500642_0051893_802_1593 263
609 3300053136 Ga0500559_0083158 Ga0500559_0083158_352_1143 263
610 3300053139 Ga0500568_0003017 Ga0500568_0003017_6683_7474 263
611 3300053156 Ga0500622_0161119 Ga0500622_0161119_148_939 263
612 3300053162 Ga0500638_002107 Ga0500638_002107_5388_6179 263
613 3300053178 Ga0500637_0000546 Ga0500637_0000546_11200_11991 263
614 3300053730 Ga0500645_025229 Ga0500645_025229_930_1721 263
615 3300055283 Ga0500661_000782 Ga0500661_000782_4354_5145 263
616 iso_pu_bacteria 2643221607 2644048599 263
617 iso_pu_bacteria 2643221686 2644481400 263
618 iso_pu_bacteria 2876761206 2876767253 263
619 3300046454 Ga0495592_0191388 Ga0495592_0191388_449_1249 264
620 3300046455 Ga0495603_0001638 Ga0495603_0001638_2767_3567 264
621 3300046459 Ga0495629_0000215 Ga0495629_0000215_17053_17853 264
622 3300046462 Ga0495651_0298257 Ga0495651_0298257_239_1039 264
623 3300046463 Ga0495653_0115439 Ga0495653_0115439_1006_1806 264
624 3300046471 Ga0495650_0001730 Ga0495650_0001730_11821_12621 264
625 3300046471 Ga0495650_0023114 Ga0495650_0023114_1247_2047 264
626 3300046472 Ga0495580_0003083 Ga0495580_0003083_7027_7827 264
627 3300046477 Ga0495664_0023152 Ga0495664_0023152_2740_3540 264
628 3300046492 Ga0495585_0100879 Ga0495585_0100879_204_1004 264
629 3300046506 Ga0495583_0057578 Ga0495583_0057578_270_1070 264
630 3300046507 Ga0495606_0002134 Ga0495606_0002134_14844_15644 264
631 3300046507 Ga0495606_0067765 Ga0495606_0067765_1033_1833 264
632 3300046507 Ga0495606_0182494 Ga0495606_0182494_247_1047 264
633 3300046535 Ga0495586_0106141 Ga0495586_0106141_164_964 264
634 3300046542 Ga0495597_0066410 Ga0495597_0066410_697_1497 264
635 3300046543 Ga0495645_0001582 Ga0495645_0001582_11514_12314 264
636 3300046543 Ga0495645_0023405 Ga0495645_0023405_2717_3517 264
637 3300046559 Ga0495667_0095980 Ga0495667_0095980_996_1796 264
638 3300046674 Ga0495588_0063205 Ga0495588_0063205_646_1446 264
639 3300046680 Ga0495646_0052471 Ga0495646_0052471_1251_2051 264
640 3300046689 Ga0495613_0019532 Ga0495613_0019532_3240_4040 264
641 3300046691 Ga0495670_0068778 Ga0495670_0068778_22_822 264
642 3300046694 Ga0495649_0003657 Ga0495649_0003657_7316_8116 264
643 3300046794 Ga0495589_0032881 Ga0495589_0032881_202_1002 264
644 3300046809 Ga0495600_0170027 Ga0495600_0170027_299_1099 264
645 3300047315 Ga0495581_0007237 Ga0495581_0007237_1455_2255 264
646 3300047317 Ga0495604_0396353 Ga0495604_0396353_94_894 264
647 3300047317 Ga0495604_0409167 Ga0495604_0409167_81_881 264
648 3300047443 Ga0495687_006263 Ga0495687_006263_684_1484 264
649 3300047444 Ga0495675_0017427 Ga0495675_0017427_1779_2579 264
650 3300047446 Ga0495679_027443 Ga0495679_027443_837_1637 264
651 3300048088 Ga0495602_0317786 Ga0495602_0317786_179_979 264
652 3300048903 Ga0496100_0168826 Ga0496100_0168826_507_1307 264
653 3300048904 Ga0496101_0058755 Ga0496101_0058755_1962_2762 264
654 3300048907 Ga0496104_0016857 Ga0496104_0016857_3487_4287 264
655 3300048907 Ga0496104_0416258 Ga0496104_0416258_440_1240 264
656 3300048908 Ga0496105_0019982 Ga0496105_0019982_2618_3418 264
657 3300048908 Ga0496105_0267473 Ga0496105_0267473_13_813 264
658 3300048909 Ga0496106_0000340 Ga0496106_0000340_2478_3293 264
659 3300048918 Ga0496115_0026735 Ga0496115_0026735_1903_2703 264
660 3300048924 Ga0496121_0088668 Ga0496121_0088668_883_1698 264
661 iso_pu_bacteria 2508501009 2508543027 264
662 iso_pu_bacteria 2510917030 2511199825 264
663 iso_pu_bacteria 2511231028 2511401215 264
664 iso_pu_bacteria 2513237095 2513650241 264
665 iso_pu_bacteria 2513237102 2513702890 264
666 iso_pu_bacteria 2513237104 2513717919 264
667 iso_pu_bacteria 2513237139 2513872502 264
668 iso_pu_bacteria 2513237141 2513894330 264
669 iso_pu_bacteria 2513237161 2514015936 264
670 iso_pu_bacteria 2517093001 2517101522 264
671 iso_pu_bacteria 2524023205 2524442781 264
672 iso_pu_bacteria 2528768022 2528849763 264
673 iso_pu_bacteria 2534681796 2535519465 264
674 iso_pu_bacteria 2582581298 2585221557 264
675 iso_pu_bacteria 2585427529 2585544273 264
676 iso_pu_bacteria 2617270735 2617348725 264
677 iso_pu_bacteria 2671180139 2671693984 264
678 iso_pu_bacteria 2744054633 2745080082 264
679 iso_pu_bacteria 2791355196 2793064100 264
680 iso_pu_bacteria 2802429603 2805917911 264
681 iso_pu_bacteria 2802429634 2806056560 264
682 iso_pu_bacteria 2802429635 2806063684 264
683 iso_pu_bacteria 2816332527 2818241234 264
684 iso_pu_bacteria 2824600985 2824606499 264
685 iso_pu_bacteria 2824609381 2824614618 264
686 iso_pu_bacteria 2824617872 2824622675 264
687 iso_pu_bacteria 2824626560 2824631876 264
688 iso_pu_bacteria 2824635225 2824642766 264
689 iso_pu_bacteria 2824644064 2824650760 264
690 iso_pu_bacteria 2824653114 2824655898 264
691 iso_pu_bacteria 2824661429 2824669651 264
692 iso_pu_bacteria 2824671348 2824673857 264
693 iso_pu_bacteria 2824679649 2824686463 264
694 iso_pu_bacteria 2824687955 2824690508 264
695 iso_pu_bacteria 2824696289 2824698287 264
696 iso_pu_bacteria 2824704595 2824712144 264
697 iso_pu_bacteria 2824714736 2824720536 264
698 iso_pu_bacteria 2824723954 2824730808 264
699 iso_pu_bacteria 2824753945 2824762596 264
700 iso_pu_bacteria 2824763712 2824773018 264
701 iso_pu_bacteria 2824773399 2824776508 264
702 iso_pu_bacteria 2838122688 2838124047 264
703 iso_pu_bacteria 2841941048 2841943825 264
704 iso_pu_bacteria 2841949485 2841950148 264
705 iso_pu_bacteria 2841966195 2841966541 264
706 iso_pu_bacteria 2841974524 2841975281 264
707 iso_pu_bacteria 2841983080 2841983154 264
708 iso_pu_bacteria 2842038055 2842039352 264
709 iso_pu_bacteria 2842045827 2842047702 264
710 iso_pu_bacteria 2842509118 2842515383 264
711 iso_pu_bacteria 2844315083 2844318812 264
712 iso_pu_bacteria 2847939898 2847946271 264
713 iso_pu_bacteria 2849076700 2849079589 264
714 iso_pu_bacteria 2874612657 2874616099 264
715 iso_pu_bacteria 2874620515 2874627402 264
716 iso_pu_bacteria 2874628541 2874629848 264
717 iso_pu_bacteria 2879099564 2879101729 264
718 iso_pu_bacteria 2881364244 2881371700 264
719 iso_pu_bacteria 2885409591 2885418837 264
720 iso_pu_bacteria 2888378607 2888383770 264
721 iso_pu_bacteria 2888388044 2888394092 264
722 iso_pu_bacteria 2888388044 2888394190 264
723 iso_pu_bacteria 2888419890 2888424207 264
724 iso_pu_bacteria 2902405164 2902409272 264
725 iso_pu_bacteria 2903727486 2903732629 264
726 iso_pu_bacteria 2904666416 2904671080 264
727 iso_pu_bacteria 2904711408 2904720839 264
728 iso_pu_bacteria 2906602504 2906610306 264
729 iso_pu_bacteria 2906643746 2906646796 264
730 iso_pu_bacteria 2922368715 2922374018 264
731 iso_pu_bacteria 2922393267 2922397758 264
732 iso_pu_bacteria 2929615660 2929617724 264
733 iso_pu_bacteria 2929624759 2929627429 264
734 iso_pu_bacteria 2932784394 2932788477 264
735 iso_pu_bacteria 2932809354 2932816306 264
736 iso_pu_bacteria 2932818245 2932821476 264
737 iso_pu_bacteria 2932828146 2932831560 264
738 iso_pu_bacteria 2933577622 2933579680 264
739 iso_pu_bacteria 2935608549 2935612191 264
740 iso_pu_bacteria 2935616580 2935622393 264
741 iso_pu_bacteria 2935638405 2935645178 264
742 iso_pu_bacteria 2935665750 2935671793 264
743 iso_pu_bacteria 2935675223 2935678804 264
744 iso_pu_bacteria 2935684952 2935688875 264
745 iso_pu_bacteria 2935694250 2935696249 264
746 iso_pu_bacteria 2935703347 2935706995 264
747 iso_pu_bacteria 2935713505 2935715894 264
748 iso_pu_bacteria 2935722832 2935725542 264
749 iso_pu_bacteria 2935732158 2935738179 264
750 iso_pu_bacteria 2935741537 2935747554 264
751 iso_pu_bacteria 2935750917 2935753871 264
752 iso_pu_bacteria 2935760218 2935762877 264
753 iso_pu_bacteria 2935769743 2935775053 264
754 iso_pu_bacteria 2935777560 2935782686 264
755 iso_pu_bacteria 2935785616 2935791730 264
756 iso_pu_bacteria 2935793552 2935800038 264
757 iso_pu_bacteria 2935801545 2935807658 264
758 iso_pu_bacteria 2935810662 2935817074 264
759 iso_pu_bacteria 2935819856 2935821661 264
760 iso_pu_bacteria 2935827899 2935834645 264
761 iso_pu_bacteria 2935837841 2935840328 264
762 iso_pu_bacteria 2935847175 2935847262 264
763 iso_pu_bacteria 2935855204 2935860539 264
764 iso_pu_bacteria 2935864058 2935865423 264
765 iso_pu_bacteria 2935873716 2935878019 264
766 iso_pu_bacteria 2935908558 2935914635 264
767 iso_pu_bacteria 2935916978 2935924898 264
768 iso_pu_bacteria 2935926038 2935932287 264
769 iso_pu_bacteria 2935934488 2935940885 264
770 iso_pu_bacteria 2935942939 2935948958 264
771 iso_pu_bacteria 2935951376 2935957516 264
772 iso_pu_bacteria 2935959822 2935959959 264
773 iso_pu_bacteria 2935967501 2935973963 264
774 iso_pu_bacteria 2935992306 2935996032 264
775 iso_pu_bacteria 2936002035 2936009498 264
776 iso_pu_bacteria 2936037263 2936043453 264
777 iso_pu_bacteria 2940556831 2940560753 264
778 iso_pu_bacteria 2941531003 2941538345 264
779 iso_pu_bacteria 2941538514 2941541541 264
780 iso_pu_bacteria 3005452660 3005456984 264
781 iso_pu_bacteria 3005718088 3005724533 264
782 iso_pu_bacteria 643348564 643592636 264
783 iso_pu_bacteria 8005542996 8005547155 264
784 iso_pu_bacteria 8016511872 8016513638 264
785 iso_pu_bacteria 8016522445 8016529962 264
786 iso_pu_bacteria 8016530956 8016535199 264
787 iso_pu_bacteria 8016548790 8016553723 264
788 iso_pu_bacteria 8016557553 8016562100 264
789 iso_pu_bacteria 8016566248 8016573538 264
790 iso_pu_bacteria 8016575299 8016577665 264
791 iso_pu_bacteria 8016595262 8016599921 264
792 iso_pu_bacteria 8016603502 8016610888 264
793 iso_pu_bacteria 8016613128 8016614076 264
794 iso_pu_bacteria 8016622563 8016626980 264
795 iso_pu_bacteria 8019530166 8019534949 264
796 iso_pu_bacteria 8019538911 8019544516 264
797 iso_pu_bacteria 8019547302 8019554073 264
798 iso_pu_bacteria 8019576017 8019582245 264
799 iso_pu_bacteria 8019586578 8019589938 264
800 iso_pu_bacteria 8019597564 8019601333 264
801 iso_pu_bacteria 8019608314 8019617222 264
802 iso_pu_bacteria 8019687851 8019689673 264
803 iso_pu_bacteria 8055742211 8055746661 264
804 iso_pu_bacteria 8056967851 8056973195 264
805 iso_pu_bacteria 8057575449 8057578033 264
806 3300031247 Ga0265340_10009852 Ga0265340_100098522 266
807 3300031249 Ga0265339_10005005 Ga0265339_100050059 266
808 3300005530 Ga0070679_100728112 Ga0070679_1007281121 267
809 3300009093 Ga0105240_10108885 Ga0105240_101088854 267
810 3300013105 Ga0157369_10144914 Ga0157369_101449142 267
811 3300021377 Ga0213874_10013586 Ga0213874_100135862 267
812 3300025303 Ga0209051_1007389 Ga0209051_10073893 267
813 3300039437 Ga0436365_0096880 Ga0436365_0096880_850_1665 267
814 3300039437 Ga0436365_0410894 Ga0436365_0410894_99_914 267
815 3300039450 Ga0436363_1511490 Ga0436363_1511490_872_1684 267
816 3300044842 Ga0466957_0263324 Ga0466957_0263324_277_1092 267
817 3300045976 Ga0466967_0208302 Ga0466967_0208302_895_1710 267
818 3300048920 Ga0496117_0040145 Ga0496117_0040145_2562_3377 267
819 3300048924 Ga0496121_0096160 Ga0496121_0096160_1217_2032 267
820 3300048924 Ga0496121_0215148 Ga0496121_0215148_215_1027 267
821 3300049569 Ga0501032_0127848 Ga0501032_0127848_811_1623 267
822 3300049571 Ga0501034_0081269 Ga0501034_0081269_165_977 267
823 3300049574 Ga0501038_0162296 Ga0501038_0162296_307_1119 267
824 3300049588 Ga0501072_0592059 Ga0501072_0592059_50_862 267
825 3300049823 Ga0501044_0058692 Ga0501044_0058692_1999_2808 267
826 3300053177 Ga0500636_0029443 Ga0500636_0029443_132_944 267
827 3300053737 Ga0500601_009479 Ga0500601_009479_133_945 267
828 3300002739 JGI25158J39367_1000016 JGI25158J39367_10000166 268
829 3300002773 JGI25152J39213_1000619 JGI25152J39213_100061912 268
830 3300002987 JGI25159J45721_1000637 JGI25159J45721_100063713 268
831 3300003187 JGI25151J46595_10000799 JGI25151J46595_1000079917 268
832 3300003214 JGI25165J46597_1000006 JGI25165J46597_1000006466 268
833 3300003215 JGI25153J46596_10001193 JGI25153J46596_100011935 268
834 3300003215 JGI25153J46596_10001417 JGI25153J46596_100014175 268
835 3300003215 JGI25153J46596_10007157 JGI25153J46596_100071576 268
836 3300003215 JGI25153J46596_10015144 JGI25153J46596_100151442 268
837 3300003322 rootL2_10217006 rootL2_102170061 268
838 3300003354 JGI25160J50197_1002213 JGI25160J50197_100221311 268
839 3300003354 JGI25160J50197_1003037 JGI25160J50197_10030375 268
840 3300003374 JGI25161J50226_1000096 JGI25161J50226_10000966 268
841 3300003762 Ga0055542_1006307 Ga0055542_10063072 268
842 3300003771 Ga0055526_1003664 Ga0055526_10036645 268
843 3300003775 Ga0055524_1005122 Ga0055524_10051226 268
844 3300003790 Ga0055528_1002007 Ga0055528_100200710 268
845 3300003790 Ga0055528_1004016 Ga0055528_10040162 268
846 3300003792 Ga0055540_1003592 Ga0055540_10035926 268
847 3300003794 Ga0055531_10004774 Ga0055531_100047745 268
848 3300004625 Ga0055543_1000183 Ga0055543_100018352 268
849 3300005262 Ga0065165_1001490 Ga0065165_10014906 268
850 3300005262 Ga0065165_1002488 Ga0065165_10024886 268
851 3300005262 Ga0065165_1003977 Ga0065165_10039775 268
852 3300005262 Ga0065165_1012513 Ga0065165_10125132 268
853 3300005331 Ga0070670_100048365 Ga0070670_1000483653 268
854 3300005353 Ga0070669_100194774 Ga0070669_1001947742 268
855 3300005355 Ga0070671_100035469 Ga0070671_1000354695 268
856 3300005434 Ga0070709_10003856 Ga0070709_100038562 268
857 3300005435 Ga0070714_100250700 Ga0070714_1002507002 268
858 3300005436 Ga0070713_100210757 Ga0070713_1002107572 268
859 3300005437 Ga0070710_10015620 Ga0070710_100156202 268
860 3300005439 Ga0070711_100076039 Ga0070711_1000760392 268
861 3300005455 Ga0070663_100359046 Ga0070663_1003590461 268
862 3300005455 Ga0070663_100505219 Ga0070663_1005052191 268
863 3300005457 Ga0070662_100268053 Ga0070662_1002680532 268
864 3300005518 Ga0070699_100571212 Ga0070699_1005712121 268
865 3300005548 Ga0070665_100027988 Ga0070665_1000279883 268
866 3300005548 Ga0070665_100330698 Ga0070665_1003306982 268
867 3300005563 Ga0068855_100167276 Ga0068855_1001672762 268
868 3300005563 Ga0068855_100585626 Ga0068855_1005856261 268
869 3300005577 Ga0068857_100204464 Ga0068857_1002044642 268
870 3300005614 Ga0068856_100160476 Ga0068856_1001604763 268
871 3300005614 Ga0068856_100262968 Ga0068856_1002629682 268
872 3300005616 Ga0068852_100012928 Ga0068852_1000129285 268
873 3300005616 Ga0068852_100277526 Ga0068852_1002775262 268
874 3300005618 Ga0068864_100186573 Ga0068864_1001865733 268
875 3300005983 Ga0081540_1002582 Ga0081540_10025827 268
876 3300005983 Ga0081540_1072054 Ga0081540_10720542 268
877 3300006038 Ga0075365_10074629 Ga0075365_100746292 268
878 3300006038 Ga0075365_10183211 Ga0075365_101832111 268
879 3300006048 Ga0075363_100220522 Ga0075363_1002205221 268
880 3300006051 Ga0075364_10037703 Ga0075364_100377033 268
881 3300006173 Ga0070716_100091085 Ga0070716_1000910852 268
882 3300006178 Ga0075367_10180409 Ga0075367_101804092 268
883 3300006178 Ga0075367_10357592 Ga0075367_103575922 268
884 3300006195 Ga0075366_10046435 Ga0075366_100464353 268
885 3300006195 Ga0075366_10148409 Ga0075366_101484091 268
886 3300006353 Ga0075370_10066372 Ga0075370_100663723 268
887 3300006847 Ga0075431_100661998 Ga0075431_1006619981 268
888 3300009093 Ga0105240_10010226 Ga0105240_100102268 268
889 3300009093 Ga0105240_10271484 Ga0105240_102714841 268
890 3300009093 Ga0105240_10354484 Ga0105240_103544842 268
891 3300009098 Ga0105245_10266042 Ga0105245_102660422 268
892 3300009174 Ga0105241_10119390 Ga0105241_101193903 268
893 3300009174 Ga0105241_10293804 Ga0105241_102938042 268
894 3300009176 Ga0105242_10273475 Ga0105242_102734752 268
895 3300009177 Ga0105248_10107619 Ga0105248_101076192 268
896 3300009177 Ga0105248_10523315 Ga0105248_105233151 268
897 3300009545 Ga0105237_10003658 Ga0105237_1000365814 268
898 3300009545 Ga0105237_10042573 Ga0105237_100425735 268
899 3300009545 Ga0105237_10323492 Ga0105237_103234921 268
900 3300009551 Ga0105238_10458082 Ga0105238_104580822 268
901 3300009551 Ga0105238_10784392 Ga0105238_107843922 268
902 3300009553 Ga0105249_10238250 Ga0105249_102382503 268
903 3300010375 Ga0105239_10048515 Ga0105239_100485153 268
904 3300010375 Ga0105239_10082916 Ga0105239_100829165 268
905 3300010375 Ga0105239_10174867 Ga0105239_101748672 268
906 3300010375 Ga0105239_10386009 Ga0105239_103860092 268
907 3300010375 Ga0105239_10606846 Ga0105239_106068461 268
908 3300010375 Ga0105239_10681093 Ga0105239_106810931 268
909 3300013297 Ga0157378_10597807 Ga0157378_105978071 268
910 3300013308 Ga0157375_10139188 Ga0157375_101391882 268
911 3300014325 Ga0163163_10003792 Ga0163163_100037923 268
912 3300014325 Ga0163163_10061180 Ga0163163_100611802 268
913 3300014325 Ga0163163_10787736 Ga0163163_107877362 268
914 3300014326 Ga0157380_10551717 Ga0157380_105517171 268
915 3300014497 Ga0182008_10030237 Ga0182008_100302373 268
916 3300014497 Ga0182008_10197176 Ga0182008_101971761 268
917 3300014968 Ga0157379_10088052 Ga0157379_100880522 268
918 3300015261 Ga0182006_1022019 Ga0182006_10220193 268
919 3300015262 Ga0182007_10032118 Ga0182007_100321182 268
920 3300017792 Ga0163161_10573995 Ga0163161_105739952 268
921 3300025208 Ga0209436_100004 Ga0209436_100004153 268
922 3300025230 Ga0209563_100449 Ga0209563_10044911 268
923 3300025245 Ga0207425_1011182 Ga0207425_10111822 268
924 3300025254 Ga0209148_1000929 Ga0209148_10009295 268
925 3300025254 Ga0209148_1002656 Ga0209148_10026562 268
926 3300025258 Ga0209129_1000082 Ga0209129_100008224 268
927 3300025258 Ga0209129_1001930 Ga0209129_100193011 268
928 3300025258 Ga0209129_1005362 Ga0209129_10053624 268
929 3300025261 Ga0209233_1000010 Ga0209233_10000101045 268
930 3300025261 Ga0209233_1003142 Ga0209233_10031426 268
931 3300025261 Ga0209233_1006358 Ga0209233_10063583 268
932 3300025272 Ga0209455_1000620 Ga0209455_10006203 268
933 3300025273 Ga0209673_1003625 Ga0209673_10036252 268
934 3300025273 Ga0209673_1027984 Ga0209673_10279842 268
935 3300025284 Ga0209130_1000001 Ga0209130_1000001271 268
936 3300025294 Ga0209025_1000172 Ga0209025_100017283 268
937 3300025295 Ga0209564_1001805 Ga0209564_100180512 268
938 3300025295 Ga0209564_1004735 Ga0209564_10047356 268
939 3300025295 Ga0209564_1011661 Ga0209564_10116614 268
940 3300025295 Ga0209564_1044776 Ga0209564_10447762 268
941 3300025297 Ga0209758_1000021 Ga0209758_1000021405 268
942 3300025297 Ga0209758_1000388 Ga0209758_100038846 268
943 3300025297 Ga0209758_1023778 Ga0209758_10237782 268
944 3300025297 Ga0209758_1025905 Ga0209758_10259053 268
945 3300025297 Ga0209758_1031377 Ga0209758_10313772 268
946 3300025299 Ga0209256_1001343 Ga0209256_10013439 268
947 3300025299 Ga0209256_1013699 Ga0209256_10136992 268
948 3300025299 Ga0209256_1018762 Ga0209256_10187622 268
949 3300025302 Ga0207426_1000005 Ga0207426_1000005876 268
950 3300025302 Ga0207426_1000143 Ga0207426_100014383 268
951 3300025302 Ga0207426_1000687 Ga0207426_100068734 268
952 3300025302 Ga0207426_1004068 Ga0207426_10040685 268
953 3300025302 Ga0207426_1026400 Ga0207426_10264002 268
954 3300025302 Ga0207426_1071450 Ga0207426_10714502 268
955 3300025303 Ga0209051_1014372 Ga0209051_10143724 268
956 3300025304 Ga0209257_1000455 Ga0209257_100045515 268
957 3300025304 Ga0209257_1012178 Ga0209257_10121784 268
958 3300025304 Ga0209257_1042696 Ga0209257_10426961 268
959 3300025898 Ga0207692_10022140 Ga0207692_100221402 268
960 3300025901 Ga0207688_10031251 Ga0207688_100312512 268
961 3300025904 Ga0207647_10006430 Ga0207647_100064305 268
962 3300025906 Ga0207699_10033697 Ga0207699_100336972 268
963 3300025909 Ga0207705_10131740 Ga0207705_101317402 268
964 3300025911 Ga0207654_10019392 Ga0207654_100193924 268
965 3300025913 Ga0207695_10000015 Ga0207695_10000015399 268
966 3300025913 Ga0207695_10156665 Ga0207695_101566653 268
967 3300025914 Ga0207671_10007700 Ga0207671_100077009 268
968 3300025914 Ga0207671_10204779 Ga0207671_102047792 268
969 3300025914 Ga0207671_10381049 Ga0207671_103810491 268
970 3300025915 Ga0207693_10144997 Ga0207693_101449972 268
971 3300025919 Ga0207657_10063817 Ga0207657_100638173 268
972 3300025925 Ga0207650_10164340 Ga0207650_101643402 268
973 3300025927 Ga0207687_10159535 Ga0207687_101595352 268
974 3300025928 Ga0207700_10287430 Ga0207700_102874301 268
975 3300025931 Ga0207644_10035292 Ga0207644_100352924 268
976 3300025933 Ga0207706_10276911 Ga0207706_102769111 268
977 3300025938 Ga0207704_10568185 Ga0207704_105681851 268
978 3300025941 Ga0207711_10083775 Ga0207711_100837753 268
979 3300025949 Ga0207667_10359872 Ga0207667_103598722 268
980 3300025972 Ga0207668_10053221 Ga0207668_100532212 268
981 3300025972 Ga0207668_10291585 Ga0207668_102915851 268
982 3300026067 Ga0207678_10049880 Ga0207678_100498803 268
983 3300026067 Ga0207678_10151597 Ga0207678_101515972 268
984 3300026067 Ga0207678_10192087 Ga0207678_101920872 268
985 3300026067 Ga0207678_10203469 Ga0207678_102034692 268
986 3300026078 Ga0207702_10141780 Ga0207702_101417802 268
987 3300026078 Ga0207702_10163134 Ga0207702_101631343 268
988 3300026095 Ga0207676_10083040 Ga0207676_100830402 268
989 3300026142 Ga0207698_10914398 Ga0207698_109143981 268
990 3300028379 Ga0268266_10029091 Ga0268266_100290914 268
991 3300031507 Ga0307509_10000779 Ga0307509_1000077934 268
992 3300031616 Ga0307508_10005559 Ga0307508_100055598 268
993 3300031711 Ga0265314_10011012 Ga0265314_100110122 268
994 3300033180 Ga0307510_10056799 Ga0307510_100567995 268
995 3300033180 Ga0307510_10080532 Ga0307510_100805322 268
996 3300033180 Ga0307510_10128261 Ga0307510_101282612 268
997 3300033180 Ga0307510_10327937 Ga0307510_103279372 268
998 3300035170 Ga0373943_0051944 Ga0373943_0051944_802_1620 268
999 3300035692 Ga0373935_0261912 Ga0373935_0261912_25_843 268
1000 3300035725 Ga0373947_0244381 Ga0373947_0244381_103_921 268
1001 3300037418 Ga0395900_0004826 Ga0395900_0004826_7910_8725 268
1002 3300037418 Ga0395900_0353364 Ga0395900_0353364_134_949 268
1003 3300037466 Ga0395898_0081232 Ga0395898_0081232_2269_3081 268
1004 3300037466 Ga0395898_0102696 Ga0395898_0102696_959_1774 268
1005 3300037471 Ga0395905_0022102 Ga0395905_0022102_968_1783 268
1006 3300037471 Ga0395905_0119904 Ga0395905_0119904_1322_2137 268
1007 3300037471 Ga0395905_0279868 Ga0395905_0279868_47_865 268
1008 3300038443 Ga0395901_0010567 Ga0395901_0010567_1370_2185 268
1009 3300038443 Ga0395901_0185005 Ga0395901_0185005_715_1530 268
1010 3300039437 Ga0436365_1476096 Ga0436365_1476096_254_1072 268
1011 3300039438 Ga0436360_0795597 Ga0436360_0795597_374_1192 268
1012 3300041413 Ga0439465_0006693 Ga0439465_0006693_2732_3541 268
1013 3300041511 Ga0451855_0177954 Ga0451855_0177954_715_1530 268
1014 3300041512 Ga0451853_0910860 Ga0451853_0910860_6618_7433 268
1015 3300044656 Ga0466969_0070745 Ga0466969_0070745_149_964 268
1016 3300044684 Ga0466966_0001170 Ga0466966_0001170_13584_14399 268
1017 3300044693 Ga0466961_0000375 Ga0466961_0000375_16584_17399 268
1018 3300044901 Ga0466960_0203387 Ga0466960_0203387_149_964 268
1019 3300045049 Ga0466959_0006481 Ga0466959_0006481_3896_4711 268
1020 3300045976 Ga0466967_0036461 Ga0466967_0036461_2823_3638 268
1021 3300046454 Ga0495592_0225893 Ga0495592_0225893_416_1231 268
1022 3300046459 Ga0495629_0019046 Ga0495629_0019046_2798_3613 268
1023 3300046460 Ga0495638_0008267 Ga0495638_0008267_3186_4001 268
1024 3300046462 Ga0495651_0014331 Ga0495651_0014331_849_1664 268
1025 3300046462 Ga0495651_0023242 Ga0495651_0023242_2086_2904 268
1026 3300046463 Ga0495653_0155372 Ga0495653_0155372_84_899 268
1027 3300046475 Ga0495639_0117968 Ga0495639_0117968_202_1020 268
1028 3300046476 Ga0495662_0178581 Ga0495662_0178581_145_960 268
1029 3300046477 Ga0495664_0051948 Ga0495664_0051948_1011_1838 268
1030 3300046507 Ga0495606_0043458 Ga0495606_0043458_1548_2363 268
1031 3300046507 Ga0495606_0249450 Ga0495606_0249450_28_843 268
1032 3300046511 Ga0495608_0022549 Ga0495608_0022549_2810_3625 268
1033 3300046516 Ga0495628_0517182 Ga0495628_0517182_11_829 268
1034 3300046522 Ga0495643_0047143 Ga0495643_0047143_1249_2064 268
1035 3300046529 Ga0495652_0126502 Ga0495652_0126502_343_1158 268
1036 3300046529 Ga0495652_0157078 Ga0495652_0157078_807_1622 268
1037 3300046533 Ga0495640_0020015 Ga0495640_0020015_2200_3015 268
1038 3300046533 Ga0495640_0112121 Ga0495640_0112121_299_1114 268
1039 3300046543 Ga0495645_0045991 Ga0495645_0045991_2004_2819 268
1040 3300046557 Ga0495622_0007815 Ga0495622_0007815_3566_4381 268
1041 3300046559 Ga0495667_0037821 Ga0495667_0037821_825_1640 268
1042 3300046559 Ga0495667_0130304 Ga0495667_0130304_452_1270 268
1043 3300046616 Ga0495668_0187067 Ga0495668_0187067_24_839 268
1044 3300046642 Ga0495634_0147156 Ga0495634_0147156_402_1217 268
1045 3300046648 Ga0495611_0087234 Ga0495611_0087234_578_1393 268
1046 3300046663 Ga0495635_0082311 Ga0495635_0082311_867_1682 268
1047 3300046663 Ga0495635_0156827 Ga0495635_0156827_426_1241 268
1048 3300046675 Ga0495657_0004962 Ga0495657_0004962_1673_2488 268
1049 3300046675 Ga0495657_0009569 Ga0495657_0009569_4772_5587 268
1050 3300046678 Ga0495599_0059991 Ga0495599_0059991_773_1588 268
1051 3300046679 Ga0495623_0023756 Ga0495623_0023756_2745_3563 268
1052 3300046679 Ga0495623_0049549 Ga0495623_0049549_1173_1988 268
1053 3300046680 Ga0495646_0026112 Ga0495646_0026112_748_1563 268
1054 3300046689 Ga0495613_0139728 Ga0495613_0139728_662_1477 268
1055 3300046690 Ga0495624_0051204 Ga0495624_0051204_1187_2002 268
1056 3300046690 Ga0495624_0193788 Ga0495624_0193788_237_1055 268
1057 3300046694 Ga0495649_0180508 Ga0495649_0180508_266_1081 268
1058 3300046809 Ga0495600_0004023 Ga0495600_0004023_993_1808 268
1059 3300046809 Ga0495600_0060700 Ga0495600_0060700_708_1526 268
1060 3300047315 Ga0495581_0065992 Ga0495581_0065992_881_1699 268
1061 3300047317 Ga0495604_0004281 Ga0495604_0004281_10131_10946 268
1062 3300047317 Ga0495604_0006726 Ga0495604_0006726_1546_2361 268
1063 3300047317 Ga0495604_0014661 Ga0495604_0014661_4763_5581 268
1064 3300047319 Ga0495674_0166386 Ga0495674_0166386_674_1489 268
1065 3300047321 Ga0495676_0051305 Ga0495676_0051305_1578_2393 268
1066 3300047321 Ga0495676_0275953 Ga0495676_0275953_202_1020 268
1067 3300047322 Ga0495680_0009178 Ga0495680_0009178_3898_4713 268
1068 3300047322 Ga0495680_0050126 Ga0495680_0050126_64_882 268
1069 3300047323 Ga0495683_0099101 Ga0495683_0099101_486_1301 268
1070 3300047443 Ga0495687_039374 Ga0495687_039374_460_1275 268
1071 3300047444 Ga0495675_0176218 Ga0495675_0176218_197_1012 268
1072 3300047471 Ga0495684_0183581 Ga0495684_0183581_618_1433 268
1073 3300047472 Ga0495686_0137614 Ga0495686_0137614_332_1147 268
1074 3300048088 Ga0495602_0057070 Ga0495602_0057070_927_1742 268
1075 3300048088 Ga0495602_0081463 Ga0495602_0081463_1234_2049 268
1076 3300048904 Ga0496101_0073003 Ga0496101_0073003_1580_2398 268
1077 3300048905 Ga0496102_0021478 Ga0496102_0021478_2357_3172 268
1078 3300048905 Ga0496102_0356779 Ga0496102_0356779_130_945 268
1079 3300048906 Ga0496103_0015179 Ga0496103_0015179_741_1556 268
1080 3300048907 Ga0496104_0006272 Ga0496104_0006272_341_1153 268
1081 3300048907 Ga0496104_0009754 Ga0496104_0009754_5037_5852 268
1082 3300048907 Ga0496104_0049962 Ga0496104_0049962_2706_3521 268
1083 3300048907 Ga0496104_0553105 Ga0496104_0553105_79_894 268
1084 3300048908 Ga0496105_0008791 Ga0496105_0008791_5146_5958 268
1085 3300048908 Ga0496105_0013347 Ga0496105_0013347_5126_5941 268
1086 3300048908 Ga0496105_0015561 Ga0496105_0015561_3707_4525 268
1087 3300048908 Ga0496105_0124523 Ga0496105_0124523_280_1095 268
1088 3300048908 Ga0496105_0174614 Ga0496105_0174614_48_863 268
1089 3300048909 Ga0496106_0000980 Ga0496106_0000980_9017_9832 268
1090 3300048909 Ga0496106_0338085 Ga0496106_0338085_378_1193 268
1091 3300048910 Ga0496107_0104295 Ga0496107_0104295_281_1096 268
1092 3300048911 Ga0496108_0024933 Ga0496108_0024933_2822_3640 268
1093 3300048912 Ga0496109_0008485 Ga0496109_0008485_5040_5858 268
1094 3300048912 Ga0496109_0016756 Ga0496109_0016756_2959_3774 268
1095 3300048913 Ga0496110_0052601 Ga0496110_0052601_982_1800 268
1096 3300048913 Ga0496110_0187839 Ga0496110_0187839_889_1704 268
1097 3300048914 Ga0496111_0008455 Ga0496111_0008455_4275_5093 268
1098 3300048914 Ga0496111_0198771 Ga0496111_0198771_364_1176 268
1099 3300048914 Ga0496111_0318632 Ga0496111_0318632_323_1138 268
1100 3300048915 Ga0496112_0011755 Ga0496112_0011755_6216_7034 268
1101 3300048915 Ga0496112_0045182 Ga0496112_0045182_2274_3089 268
1102 3300048915 Ga0496112_0694900 Ga0496112_0694900_97_909 268
1103 3300048916 Ga0496113_0004620 Ga0496113_0004620_5168_5986 268
1104 3300048917 Ga0496114_0068014 Ga0496114_0068014_1591_2403 268
1105 3300048917 Ga0496114_0228009 Ga0496114_0228009_747_1562 268
1106 3300048917 Ga0496114_0284169 Ga0496114_0284169_471_1286 268
1107 3300048918 Ga0496115_0070017 Ga0496115_0070017_321_1139 268
1108 3300048918 Ga0496115_0083471 Ga0496115_0083471_782_1597 268
1109 3300048918 Ga0496115_0218197 Ga0496115_0218197_309_1124 268
1110 3300048920 Ga0496117_0068342 Ga0496117_0068342_1277_2092 268
1111 3300048920 Ga0496117_0073771 Ga0496117_0073771_386_1201 268
1112 3300048920 Ga0496117_0104448 Ga0496117_0104448_152_967 268
1113 3300048921 Ga0496118_0014101 Ga0496118_0014101_5918_6733 268
1114 3300048921 Ga0496118_0126344 Ga0496118_0126344_504_1319 268
1115 3300048921 Ga0496118_0158501 Ga0496118_0158501_326_1138 268
1116 3300048922 Ga0496119_0015903 Ga0496119_0015903_209_1024 268
1117 3300048922 Ga0496119_0152820 Ga0496119_0152820_143_958 268
1118 3300048923 Ga0496120_0079787 Ga0496120_0079787_872_1684 268
1119 3300048923 Ga0496120_0135629 Ga0496120_0135629_383_1198 268
1120 3300048924 Ga0496121_0002350 Ga0496121_0002350_16142_16954 268
1121 3300048924 Ga0496121_0047898 Ga0496121_0047898_1754_2569 268
1122 3300048924 Ga0496121_0083183 Ga0496121_0083183_194_1009 268
1123 3300048924 Ga0496121_0117918 Ga0496121_0117918_654_1469 268
1124 3300048924 Ga0496121_0356939 Ga0496121_0356939_135_950 268
1125 3300048925 Ga0496122_0011018 Ga0496122_0011018_6497_7312 268
1126 3300048925 Ga0496122_0209944 Ga0496122_0209944_122_937 268
1127 3300048927 Ga0496124_0100937 Ga0496124_0100937_1023_1835 268
1128 3300048927 Ga0496124_0137125 Ga0496124_0137125_316_1131 268
1129 3300048927 Ga0496124_0183784 Ga0496124_0183784_644_1459 268
1130 3300048928 Ga0496125_0028905 Ga0496125_0028905_1028_1843 268
1131 3300048928 Ga0496125_0034333 Ga0496125_0034333_261_1073 268
1132 3300048928 Ga0496125_0038831 Ga0496125_0038831_825_1640 268
1133 3300048928 Ga0496125_0110409 Ga0496125_0110409_357_1172 268
1134 3300048928 Ga0496125_0127047 Ga0496125_0127047_834_1649 268
1135 3300048928 Ga0496125_0161986 Ga0496125_0161986_125_940 268
1136 3300048928 Ga0496125_0273739 Ga0496125_0273739_205_1014 268
1137 3300048929 Ga0496126_0008744 Ga0496126_0008744_4389_5204 268
1138 3300048929 Ga0496126_0073740 Ga0496126_0073740_352_1164 268
1139 3300048929 Ga0496126_0136250 Ga0496126_0136250_1015_1830 268
1140 3300049569 Ga0501032_0120620 Ga0501032_0120620_682_1494 268
1141 3300049579 Ga0501043_0015152 Ga0501043_0015152_632_1444 268
1142 3300049580 Ga0501046_0276539 Ga0501046_0276539_266_1084 268
1143 3300049581 Ga0501047_0069695 Ga0501047_0069695_1965_2783 268
1144 3300049581 Ga0501047_0187189 Ga0501047_0187189_371_1189 268
1145 3300049586 Ga0501070_0002569 Ga0501070_0002569_3423_4241 268
1146 3300049589 Ga0501073_0099041 Ga0501073_0099041_520_1338 268
1147 3300049741 Ga0501079_0447739 Ga0501079_0447739_86_904 268
1148 3300049742 Ga0501080_0051457 Ga0501080_0051457_810_1628 268
1149 3300049822 Ga0501035_0241920 Ga0501035_0241920_166_984 268
1150 3300049823 Ga0501044_0099517 Ga0501044_0099517_1556_2374 268
1151 3300050492 nmdc:mga0yw44_353071_c1 nmdc:mga0yw44_353071_c1_129_944 268
1152 3300050493 nmdc:mga0k408_56476_c1 nmdc:mga0k408_56476_c1_189_1004 268
1153 3300050494 nmdc:mga06z11_212317_c1 nmdc:mga06z11_212317_c1_192_1007 268
1154 3300050495 nmdc:mga04h51_43115_c1 nmdc:mga04h51_43115_c1_235_1050 268
1155 3300050496 nmdc:mga07m45_167480_c2 nmdc:mga07m45_167480_c2_38_853 268
1156 3300050496 nmdc:mga07m45_26783_c1 nmdc:mga07m45_26783_c1_674_1489 268
1157 3300050516 nmdc:mga0sz30_101728_c1 nmdc:mga0sz30_101728_c1_333_1148 268
1158 3300050516 nmdc:mga0sz30_7774_c1 nmdc:mga0sz30_7774_c1_3090_3905 268
1159 3300053079 Ga0500610_0098594 Ga0500610_0098594_296_1111 268
1160 3300053080 Ga0500635_0003164 Ga0500635_0003164_35_850 268
1161 3300053083 Ga0495655_0070491 Ga0495655_0070491_94_909 268
1162 3300053085 Ga0495619_0086548 Ga0495619_0086548_1245_2060 268
1163 3300053087 Ga0500643_000085 Ga0500643_000085_82687_83502 268
1164 3300053091 Ga0500647_0048749 Ga0500647_0048749_783_1601 268
1165 3300053092 Ga0500583_0057464 Ga0500583_0057464_335_1150 268
1166 3300053093 Ga0500651_0019704 Ga0500651_0019704_1537_2352 268
1167 3300053093 Ga0500651_0092317 Ga0500651_0092317_992_1807 268
1168 3300053093 Ga0500651_0157314 Ga0500651_0157314_87_902 268
1169 3300053094 Ga0500566_0040638 Ga0500566_0040638_1436_2251 268
1170 3300053094 Ga0500566_0152408 Ga0500566_0152408_195_1010 268
1171 3300053098 Ga0500650_0052623 Ga0500650_0052623_782_1597 268
1172 3300053103 Ga0500555_001913 Ga0500555_001913_686_1501 268
1173 3300053105 Ga0500557_000002 Ga0500557_000002_90065_90883 268
1174 3300053108 Ga0500562_013305 Ga0500562_013305_724_1539 268
1175 3300053111 Ga0500572_000025 Ga0500572_000025_25247_26065 268
1176 3300053111 Ga0500572_005987 Ga0500572_005987_1178_1993 268
1177 3300053119 Ga0500595_031540 Ga0500595_031540_586_1401 268
1178 3300053126 Ga0500621_113381 Ga0500621_113381_133_948 268
1179 3300053130 Ga0500642_0000144 Ga0500642_0000144_10729_11547 268
1180 3300053130 Ga0500642_0018643 Ga0500642_0018643_502_1317 268
1181 3300053134 Ga0500658_0004773 Ga0500658_0004773_3152_3967 268
1182 3300053134 Ga0500658_0051682 Ga0500658_0051682_743_1558 268
1183 3300053136 Ga0500559_0000289 Ga0500559_0000289_19906_20724 268
1184 3300053139 Ga0500568_0001209 Ga0500568_0001209_7972_8787 268
1185 3300053142 Ga0500577_0080777 Ga0500577_0080777_257_1072 268
1186 3300053148 Ga0500590_031643 Ga0500590_031643_598_1413 268
1187 3300053151 Ga0500604_0007881 Ga0500604_0007881_560_1375 268
1188 3300053153 Ga0500616_0073262 Ga0500616_0073262_454_1269 268
1189 3300053155 Ga0500620_001333 Ga0500620_001333_3289_4104 268
1190 3300053156 Ga0500622_0016487 Ga0500622_0016487_2579_3394 268
1191 3300053160 Ga0500633_0000136 Ga0500633_0000136_952_1767 268
1192 3300053162 Ga0500638_048019 Ga0500638_048019_533_1348 268
1193 3300053163 Ga0500639_113107 Ga0500639_113107_299_1117 268
1194 3300053177 Ga0500636_0000356 Ga0500636_0000356_14137_14952 268
1195 3300053725 Ga0500576_066515 Ga0500576_066515_704_1522 268
1196 3300053729 Ga0500625_005076 Ga0500625_005076_1192_2010 268
1197 3300053731 Ga0500609_001507 Ga0500609_001507_2281_3096 268
1198 3300053735 Ga0500596_001272 Ga0500596_001272_895_1713 268
1199 3300053737 Ga0500601_000107 Ga0500601_000107_14972_15787 268
1200 3300055283 Ga0500661_004482 Ga0500661_004482_721_1536 268
1201 3300060353 Ga0501082_0215851 Ga0501082_0215851_760_1572 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

92

166

0.9

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

91

162

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4o1w-assembly2.cif.gz_B crystal structure of colwellia psychrerythraea cytochrome c 0.9649 92 166
2zzs-assembly1.cif.gz_A crystal structure of cytochrome c554 from vibrio parahaemolyticus strain rimd2210633 0.956 92 166
2zzs-assembly29.cif.gz_3 crystal structure of cytochrome c554 from vibrio parahaemolyticus strain rimd2210633 0.9334 92 166
4o1w-assembly2.cif.gz_B crystal structure of colwellia psychrerythraea cytochrome c 0.9174 92 166
5n1t-assembly1.cif.gz_B crystal structure of complex between flavocytochrome c and copper chaperone copc from t. paradoxus 0.9001 94 164
ID Description Score Start End Superfamily
4o1wD00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9633 92 166 1.10.760.10
2zzsS00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9435 92 166 1.10.760.10
3vrdA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9365 95 168 1.10.760.10
2zzs300 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9334 92 166 1.10.760.10
2zzsM00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9312 93 164 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A4Q5PH06-F1-model_v4 Cytochrome c 0.9725 92 169 GO:0009055
GO:0020037
GO:0046872
AF-A0A832E710-F1-model_v4 Cytochrome c 0.9686 90 166 GO:0009055
GO:0020037
GO:0046872
AF-A0A5C8M5W2-F1-model_v4 Cytochrome c 0.9646 92 173 GO:0009055
GO:0020037
GO:0046872
AF-A0A0N0JTD0-F1-model_v4 Cytochrome c domain-containing protein 0.9514 95 168 GO:0009055
GO:0020037
GO:0046872
AF-A0A6N6P183-F1-model_v4 C-type cytochrome 0.95 94 166 GO:0009055
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
84.97 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map