F491597
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1201 | 608 | 1029 | 265 |
Family's Representative Sequence
| Representative Sequence | 3300026078|Ga0207702_10163134|Ga0207702_101631343 |
| Length | 298 |
| Sequence | MSTRDLFTFRNGHFKIGVGITAVMLVVTAIAGFIVLPFAQPWVQFANVWDAICSAAGVPRRAASVTAPEQSKRLSEVVLTSHTLSRPSQEAIGRGATLAQRCAICHGPTGISRADSPNLAGQYAAVIYKELHDFRSGARTNAVMSPFAVNLTDQEIADLSNYYAYLPRLPAYHPTPLLPKPNIVIYGAPIRGIAPCGACHGSLDNKTGSPWLEGQSEAYMKAQLQAFASGERRNDISQQMRNIARAMTPQEIEQAAACSISCGEGGGLSPTVIASAAKQSRIPPRNDSGLLRRKGSSQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 2 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 3 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 4 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 5 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 6 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 7 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 8 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 9 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 10 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 11 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 12 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 15 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 16 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 17 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 18 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 19 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 20 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 21 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 22 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 23 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 24 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 25 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 26 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 27 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 28 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 29 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 30 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 31 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 32 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 33 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 34 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 35 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 36 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 37 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 38 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 39 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 40 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 41 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 42 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 43 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 44 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 45 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 46 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 47 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 48 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 49 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 50 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 51 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 52 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 53 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 54 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 55 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 56 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 57 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 58 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 59 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 60 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 61 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 62 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 63 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 64 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 65 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 66 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 67 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 68 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 69 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 70 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 71 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 72 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 73 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 74 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 75 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 76 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 77 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 78 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 79 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 80 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 81 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 82 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 83 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 84 | 2904699407 | |||
| 85 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 86 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 87 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 88 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 89 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 90 | 2922368715 | |||
| 91 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 92 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 93 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 94 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 95 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 96 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 97 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 98 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 99 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 100 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 101 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 102 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 103 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 104 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 105 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 106 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 107 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 108 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 109 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 110 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 111 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 112 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 113 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 114 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 115 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 116 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 117 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 118 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 119 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 120 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 121 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 122 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 123 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 124 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 125 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 126 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 127 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 128 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 129 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 130 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 131 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 132 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 133 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 134 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 135 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 136 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 137 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 138 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 139 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 140 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 141 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 142 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 143 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 144 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 145 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 146 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 147 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 148 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 149 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 150 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 151 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 152 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 153 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 154 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 155 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 156 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 157 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 158 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 159 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 160 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 161 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 162 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 163 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 164 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 165 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 166 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 167 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 168 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 169 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 171 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 172 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 175 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 176 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 177 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 179 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 187 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 189 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 190 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 191 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 196 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 198 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 199 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 200 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 202 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 203 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 205 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 207 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 208 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 209 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 211 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 212 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 213 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 214 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 215 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 216 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 217 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 218 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 219 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 220 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 221 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 222 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 223 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 224 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 225 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 226 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 227 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 229 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 230 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 231 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 232 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 233 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 235 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 236 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 244 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 245 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 246 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 248 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 249 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 256 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 259 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 261 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 262 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 264 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 265 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 266 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 267 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 268 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 272 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 275 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 276 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 279 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 281 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 282 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 284 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 285 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 286 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 287 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 340 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 344 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 345 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 346 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 347 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 348 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 349 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 350 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 351 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 352 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 353 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 354 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 355 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 356 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 357 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 358 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 359 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 360 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 361 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 362 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 363 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 364 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 365 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 366 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 367 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 368 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 369 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 370 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 371 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 372 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 373 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 374 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 375 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 376 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 377 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 378 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 379 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 380 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 381 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 382 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 383 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 384 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 385 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 386 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 387 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 388 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 389 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 390 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 391 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 392 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 393 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 394 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 395 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 396 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 397 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 398 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 399 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 400 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 401 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 402 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 403 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 404 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 405 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 406 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 407 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 408 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 409 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 410 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 411 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 487 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 488 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 489 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 490 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 491 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 492 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 493 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 494 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 495 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 496 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 497 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 498 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 499 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 500 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 501 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 502 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 503 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 504 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 505 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 506 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 507 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 508 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 509 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 510 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 511 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 512 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 513 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 514 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 515 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 516 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 517 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 519 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 520 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 521 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 522 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 523 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 524 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 525 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 526 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 527 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 528 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 529 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 530 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 531 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 532 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 533 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 534 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 536 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 537 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 541 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 542 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 543 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 544 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 545 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 546 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 547 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 548 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 549 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 550 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 551 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 552 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 553 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 554 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 555 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 556 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 557 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 558 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 559 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 560 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 561 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 562 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 563 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 564 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 565 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 566 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 567 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 568 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 569 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 570 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 571 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 572 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 573 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 574 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 575 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 576 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 577 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 578 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 579 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 580 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 581 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 582 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 583 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 584 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 585 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 586 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 587 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 588 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 589 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 590 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 591 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 592 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 593 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 594 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 595 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 596 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 597 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 598 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 599 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 600 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 601 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 602 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 603 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 604 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 605 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 606 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 607 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 608 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.82 |
| Metatranscriptomes | 0 |
| Isolates | 14.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.07 |
| Nodule | 9.91 |
| Rhizoplane | 6.49 |
| Rhizosphere | 54.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25158J39367_1000016 | 3300002739 | Bacteria | 45462 |
| 2 | JGI25152J39213_1000083 | 3300002773 | Bacteria | 64754 |
| 3 | JGI25152J39213_1000150 | 3300002773 | Bacteria | 47719 |
| 4 | JGI25152J39213_1000619 | 3300002773 | Bacteria | 19007 |
| 5 | JGI25150J39212_1000060 | 3300002774 | Bacteria | 64750 |
| 6 | JGI25150J39212_1000115 | 3300002774 | Bacteria | 45489 |
| 7 | JGI25159J45721_1000637 | 3300002987 | Bacteria | 15563 |
| 8 | JGI25151J46595_10000239 | 3300003187 | Bacteria | 64754 |
| 9 | JGI25151J46595_10000391 | 3300003187 | Bacteria | 45489 |
| 10 | JGI25151J46595_10000799 | 3300003187 | Bacteria | 25219 |
| 11 | JGI25165J46597_1000006 | 3300003214 | Bacteria | 529784 |
| 12 | JGI25153J46596_10000578 | 3300003215 | Bacteria | 22597 |
| 13 | JGI25153J46596_10001193 | 3300003215 | Bacteria | 15708 |
| 14 | JGI25153J46596_10001417 | 3300003215 | Bacteria | 14361 |
| 15 | JGI25153J46596_10004733 | 3300003215 | Bacteria | 7252 |
| 16 | JGI25153J46596_10007157 | 3300003215 | Bacteria | 5534 |
| 17 | JGI25153J46596_10007225 | 3300003215 | Bacteria | 5499 |
| 18 | JGI25153J46596_10015144 | 3300003215 | Bacteria | 3161 |
| 19 | rootH1_10026922 | 3300003316 | Bacteria | 16069 |
| 20 | rootH2_10112393 | 3300003320 | Bacteria | 1510 |
| 21 | rootL2_10217006 | 3300003322 | Bacteria | 1340 |
| 22 | rootL2_10313393 | 3300003322 | Bacteria | 1316 |
| 23 | rootH1_10296570 | 3300003323 | Bacteria | 1643 |
| 24 | JGI25160J50197_1002213 | 3300003354 | Bacteria | 9127 |
| 25 | JGI25160J50197_1003037 | 3300003354 | Bacteria | 7654 |
| 26 | JGI25161J50226_1000096 | 3300003374 | Bacteria | 72203 |
| 27 | JGI25404J52841_10000254 | 3300003659 | Bacteria | 6695 |
| 28 | JGI25404J52841_10038037 | 3300003659 | Bacteria | 1021 |
| 29 | Ga0055527_1009821 | 3300003760 | Bacteria | 1114 |
| 30 | Ga0055542_1006307 | 3300003762 | Bacteria | 2552 |
| 31 | Ga0055526_1003664 | 3300003771 | Bacteria | 9612 |
| 32 | Ga0055524_1005122 | 3300003775 | Bacteria | 5924 |
| 33 | Ga0055528_1002007 | 3300003790 | Bacteria | 11416 |
| 34 | Ga0055528_1004016 | 3300003790 | Bacteria | 7199 |
| 35 | Ga0055540_1003592 | 3300003792 | Bacteria | 7406 |
| 36 | Ga0055531_10004774 | 3300003794 | Bacteria | 8101 |
| 37 | Ga0055543_1000183 | 3300004625 | Bacteria | 51527 |
| 38 | Ga0065165_1001490 | 3300005262 | Bacteria | 24866 |
| 39 | Ga0065165_1002488 | 3300005262 | Bacteria | 15477 |
| 40 | Ga0065165_1003977 | 3300005262 | Bacteria | 9675 |
| 41 | Ga0065165_1012513 | 3300005262 | Bacteria | 3451 |
| 42 | Ga0065704_10144922 | 3300005289 | Bacteria | 1481 |
| 43 | Ga0065707_10082478 | 3300005295 | Bacteria | 14636 |
| 44 | Ga0070658_10002866 | 3300005327 | Bacteria | 14324 |
| 45 | Ga0070658_10071500 | 3300005327 | Bacteria | 2842 |
| 46 | Ga0070683_100020118 | 3300005329 | Bacteria | 5936 |
| 47 | Ga0070690_100112567 | 3300005330 | Bacteria | 1818 |
| 48 | Ga0070690_100266135 | 3300005330 | Bacteria | 1218 |
| 49 | Ga0070690_100516215 | 3300005330 | Bacteria | 896 |
| 50 | Ga0070670_100048365 | 3300005331 | Bacteria | 3660 |
| 51 | Ga0070670_100261034 | 3300005331 | Bacteria | 1510 |
| 52 | Ga0070666_10243503 | 3300005335 | Bacteria | 1272 |
| 53 | Ga0070666_10263828 | 3300005335 | Bacteria | 1221 |
| 54 | Ga0070680_100340170 | 3300005336 | Bacteria | 1275 |
| 55 | Ga0070682_100337387 | 3300005337 | Bacteria | 1119 |
| 56 | Ga0070682_100340538 | 3300005337 | Bacteria | 1114 |
| 57 | Ga0068868_100006547 | 3300005338 | Bacteria | 8248 |
| 58 | Ga0068868_100140150 | 3300005338 | Bacteria | 1984 |
| 59 | Ga0068868_100203979 | 3300005338 | Bacteria | 1650 |
| 60 | Ga0070660_100014686 | 3300005339 | Bacteria | 5650 |
| 61 | Ga0070687_100375586 | 3300005343 | Bacteria | 925 |
| 62 | Ga0070668_100069351 | 3300005347 | Bacteria | 2742 |
| 63 | Ga0070668_100749356 | 3300005347 | Bacteria | 864 |
| 64 | Ga0070669_100103043 | 3300005353 | Bacteria | 2155 |
| 65 | Ga0070669_100194774 | 3300005353 | Bacteria | 1591 |
| 66 | Ga0070675_100784501 | 3300005354 | Bacteria | 870 |
| 67 | Ga0070671_100035469 | 3300005355 | Bacteria | 4132 |
| 68 | Ga0070671_100077398 | 3300005355 | Bacteria | 2780 |
| 69 | Ga0070671_100301395 | 3300005355 | Bacteria | 1364 |
| 70 | Ga0070674_100063047 | 3300005356 | Bacteria | 2593 |
| 71 | Ga0070673_100058510 | 3300005364 | Bacteria | 3047 |
| 72 | Ga0070659_100051286 | 3300005366 | Bacteria | 3244 |
| 73 | Ga0070659_100090102 | 3300005366 | Bacteria | 2458 |
| 74 | Ga0070709_10003856 | 3300005434 | Bacteria | 8076 |
| 75 | Ga0070714_100250700 | 3300005435 | Bacteria | 1637 |
| 76 | Ga0070713_100210757 | 3300005436 | Bacteria | 1759 |
| 77 | Ga0070710_10015620 | 3300005437 | Bacteria | 3846 |
| 78 | Ga0070701_10123893 | 3300005438 | Bacteria | 1460 |
| 79 | Ga0070711_100076039 | 3300005439 | Bacteria | 2379 |
| 80 | Ga0070663_100016240 | 3300005455 | Bacteria | 4829 |
| 81 | Ga0070663_100020229 | 3300005455 | Bacteria | 4403 |
| 82 | Ga0070663_100064231 | 3300005455 | Bacteria | 2653 |
| 83 | Ga0070663_100359046 | 3300005455 | Bacteria | 1181 |
| 84 | Ga0070663_100428270 | 3300005455 | Bacteria | 1086 |
| 85 | Ga0070663_100505219 | 3300005455 | Bacteria | 1004 |
| 86 | Ga0070678_100017610 | 3300005456 | Bacteria | 4607 |
| 87 | Ga0070678_100145554 | 3300005456 | Bacteria | 1901 |
| 88 | Ga0070678_100284076 | 3300005456 | Bacteria | 1400 |
| 89 | Ga0070662_100268053 | 3300005457 | Bacteria | 1378 |
| 90 | Ga0070662_100268977 | 3300005457 | Bacteria | 1376 |
| 91 | Ga0070685_10321644 | 3300005466 | Bacteria | 1049 |
| 92 | Ga0070699_100571212 | 3300005518 | Bacteria | 1030 |
| 93 | Ga0070679_100017548 | 3300005530 | Bacteria | 6927 |
| 94 | Ga0070679_100728112 | 3300005530 | Bacteria | 935 |
| 95 | Ga0070684_100032764 | 3300005535 | Bacteria | 4432 |
| 96 | Ga0068853_100014537 | 3300005539 | Bacteria | 6451 |
| 97 | Ga0068853_100498747 | 3300005539 | Bacteria | 1149 |
| 98 | Ga0070672_100433070 | 3300005543 | Bacteria | 1131 |
| 99 | Ga0070686_100165764 | 3300005544 | Bacteria | 1559 |
| 100 | Ga0070695_100481201 | 3300005545 | Bacteria | 957 |
| 101 | Ga0070665_100003933 | 3300005548 | Bacteria | 15678 |
| 102 | Ga0070665_100027988 | 3300005548 | Bacteria | 5677 |
| 103 | Ga0070665_100043093 | 3300005548 | Bacteria | 4536 |
| 104 | Ga0070665_100075092 | 3300005548 | Bacteria | 3387 |
| 105 | Ga0070665_100330698 | 3300005548 | Bacteria | 1528 |
| 106 | Ga0070665_100418637 | 3300005548 | Bacteria | 1348 |
| 107 | Ga0070665_100503395 | 3300005548 | Bacteria | 1222 |
| 108 | Ga0068855_100014574 | 3300005563 | Bacteria | 9470 |
| 109 | Ga0068855_100036502 | 3300005563 | Bacteria | 5849 |
| 110 | Ga0068855_100037055 | 3300005563 | Bacteria | 5802 |
| 111 | Ga0068855_100048758 | 3300005563 | Bacteria | 4997 |
| 112 | Ga0068855_100167276 | 3300005563 | Bacteria | 2492 |
| 113 | Ga0068855_100585626 | 3300005563 | Bacteria | 1204 |
| 114 | Ga0070664_100010213 | 3300005564 | Bacteria | 7614 |
| 115 | Ga0070664_100180166 | 3300005564 | Bacteria | 1878 |
| 116 | Ga0068857_100204464 | 3300005577 | Bacteria | 1801 |
| 117 | Ga0068857_100409039 | 3300005577 | Bacteria | 1263 |
| 118 | Ga0068854_100548609 | 3300005578 | Bacteria | 980 |
| 119 | Ga0068856_100070384 | 3300005614 | Bacteria | 3460 |
| 120 | Ga0068856_100160476 | 3300005614 | Bacteria | 2258 |
| 121 | Ga0068856_100243192 | 3300005614 | Bacteria | 1815 |
| 122 | Ga0068856_100262968 | 3300005614 | Bacteria | 1741 |
| 123 | Ga0070702_100096290 | 3300005615 | Bacteria | 1806 |
| 124 | Ga0070702_100254722 | 3300005615 | Bacteria | 1192 |
| 125 | Ga0068852_100012928 | 3300005616 | Bacteria | 6366 |
| 126 | Ga0068852_100048001 | 3300005616 | Bacteria | 3646 |
| 127 | Ga0068852_100231216 | 3300005616 | Bacteria | 1762 |
| 128 | Ga0068852_100277526 | 3300005616 | Bacteria | 1614 |
| 129 | Ga0068852_100457107 | 3300005616 | Bacteria | 1265 |
| 130 | Ga0068852_100501362 | 3300005616 | Bacteria | 1209 |
| 131 | Ga0068859_100094400 | 3300005617 | Bacteria | 3043 |
| 132 | Ga0068859_100520451 | 3300005617 | Bacteria | 1284 |
| 133 | Ga0068859_100821143 | 3300005617 | Bacteria | 1016 |
| 134 | Ga0068864_100029384 | 3300005618 | Bacteria | 4655 |
| 135 | Ga0068864_100186573 | 3300005618 | Bacteria | 1899 |
| 136 | Ga0068870_10188569 | 3300005840 | Bacteria | 1243 |
| 137 | Ga0068863_100077859 | 3300005841 | Bacteria | 3139 |
| 138 | Ga0068858_100023425 | 3300005842 | Bacteria | 5752 |
| 139 | Ga0068858_100090581 | 3300005842 | Bacteria | 2846 |
| 140 | Ga0068860_100111996 | 3300005843 | Bacteria | 2610 |
| 141 | Ga0068860_100716998 | 3300005843 | Bacteria | 1010 |
| 142 | Ga0068862_100509108 | 3300005844 | Bacteria | 1144 |
| 143 | Ga0068862_100544576 | 3300005844 | Bacteria | 1107 |
| 144 | Ga0081540_1002053 | 3300005983 | Bacteria | 16798 |
| 145 | Ga0081540_1002582 | 3300005983 | Bacteria | 14701 |
| 146 | Ga0081540_1003838 | 3300005983 | Bacteria | 11758 |
| 147 | Ga0081540_1005208 | 3300005983 | Bacteria | 9729 |
| 148 | Ga0081540_1072054 | 3300005983 | Bacteria | 1593 |
| 149 | Ga0075365_10074629 | 3300006038 | Bacteria | 2287 |
| 150 | Ga0075365_10103860 | 3300006038 | Bacteria | 1948 |
| 151 | Ga0075365_10105251 | 3300006038 | Bacteria | 1935 |
| 152 | Ga0075365_10133070 | 3300006038 | Bacteria | 1722 |
| 153 | Ga0075365_10183211 | 3300006038 | Bacteria | 1464 |
| 154 | Ga0075368_10002535 | 3300006042 | Bacteria | 5974 |
| 155 | Ga0075368_10063030 | 3300006042 | Bacteria | 1487 |
| 156 | Ga0075363_100040213 | 3300006048 | Bacteria | 2464 |
| 157 | Ga0075363_100042632 | 3300006048 | Bacteria | 2398 |
| 158 | Ga0075363_100060540 | 3300006048 | Bacteria | 2039 |
| 159 | Ga0075363_100220522 | 3300006048 | Bacteria | 1087 |
| 160 | Ga0075364_10037703 | 3300006051 | Bacteria | 3131 |
| 161 | Ga0075364_10135769 | 3300006051 | Bacteria | 1652 |
| 162 | Ga0070716_100091085 | 3300006173 | Bacteria | 1846 |
| 163 | Ga0075367_10053799 | 3300006178 | Bacteria | 2386 |
| 164 | Ga0075367_10180409 | 3300006178 | Bacteria | 1316 |
| 165 | Ga0075367_10265229 | 3300006178 | Bacteria | 1078 |
| 166 | Ga0075367_10357592 | 3300006178 | Bacteria | 922 |
| 167 | Ga0075369_10070150 | 3300006186 | Bacteria | 1541 |
| 168 | Ga0075366_10046435 | 3300006195 | Bacteria | 2573 |
| 169 | Ga0075366_10148409 | 3300006195 | Bacteria | 1419 |
| 170 | Ga0097621_100080313 | 3300006237 | Bacteria | 2713 |
| 171 | Ga0097621_100266519 | 3300006237 | Bacteria | 1504 |
| 172 | Ga0075370_10008627 | 3300006353 | Bacteria | 5253 |
| 173 | Ga0075370_10066372 | 3300006353 | Bacteria | 2058 |
| 174 | Ga0068871_100095172 | 3300006358 | Bacteria | 2487 |
| 175 | Ga0068871_100145790 | 3300006358 | Bacteria | 2015 |
| 176 | Ga0075431_100661998 | 3300006847 | Bacteria | 1024 |
| 177 | Ga0068865_100041409 | 3300006881 | Bacteria | 3134 |
| 178 | Ga0075436_100410776 | 3300006914 | Bacteria | 982 |
| 179 | Ga0097620_100094399 | 3300006931 | Bacteria | 3043 |
| 180 | Ga0097620_100520466 | 3300006931 | Bacteria | 1284 |
| 181 | Ga0097620_100821154 | 3300006931 | Bacteria | 1016 |
| 182 | Ga0099794_10190411 | 3300007265 | Bacteria | 1049 |
| 183 | Ga0099795_10017175 | 3300007788 | Bacteria | 2303 |
| 184 | Ga0105250_10079294 | 3300009092 | Bacteria | 1330 |
| 185 | Ga0105240_10010226 | 3300009093 | Bacteria | 13205 |
| 186 | Ga0105240_10010947 | 3300009093 | Bacteria | 12708 |
| 187 | Ga0105240_10074563 | 3300009093 | Bacteria | 4188 |
| 188 | Ga0105240_10108885 | 3300009093 | Bacteria | 3356 |
| 189 | Ga0105240_10175405 | 3300009093 | Bacteria | 2534 |
| 190 | Ga0105240_10233374 | 3300009093 | Bacteria | 2137 |
| 191 | Ga0105240_10271484 | 3300009093 | Bacteria | 1952 |
| 192 | Ga0105240_10354484 | 3300009093 | Bacteria | 1664 |
| 193 | Ga0105240_10686223 | 3300009093 | Bacteria | 1119 |
| 194 | Ga0111539_10545712 | 3300009094 | Bacteria | 1350 |
| 195 | Ga0105245_10051925 | 3300009098 | Bacteria | 3676 |
| 196 | Ga0105245_10079955 | 3300009098 | Bacteria | 2986 |
| 197 | Ga0105245_10266042 | 3300009098 | Bacteria | 1670 |
| 198 | Ga0105247_10341169 | 3300009101 | Bacteria | 1051 |
| 199 | Ga0105243_10011026 | 3300009148 | Bacteria | 6835 |
| 200 | Ga0105243_10239921 | 3300009148 | Bacteria | 1612 |
| 201 | Ga0105241_10014111 | 3300009174 | Bacteria | 5854 |
| 202 | Ga0105241_10113348 | 3300009174 | Bacteria | 2173 |
| 203 | Ga0105241_10119390 | 3300009174 | Bacteria | 2121 |
| 204 | Ga0105241_10135040 | 3300009174 | Bacteria | 2002 |
| 205 | Ga0105241_10277228 | 3300009174 | Bacteria | 1431 |
| 206 | Ga0105241_10281298 | 3300009174 | Bacteria | 1421 |
| 207 | Ga0105241_10293804 | 3300009174 | Bacteria | 1392 |
| 208 | Ga0105242_10048398 | 3300009176 | Bacteria | 3455 |
| 209 | Ga0105242_10273475 | 3300009176 | Bacteria | 1531 |
| 210 | Ga0105242_10409824 | 3300009176 | Bacteria | 1267 |
| 211 | Ga0105248_10034971 | 3300009177 | Bacteria | 5622 |
| 212 | Ga0105248_10046037 | 3300009177 | Bacteria | 4890 |
| 213 | Ga0105248_10107619 | 3300009177 | Bacteria | 3144 |
| 214 | Ga0105248_10523315 | 3300009177 | Bacteria | 1337 |
| 215 | Ga0105237_10003658 | 3300009545 | Bacteria | 18135 |
| 216 | Ga0105237_10005418 | 3300009545 | Bacteria | 14405 |
| 217 | Ga0105237_10042573 | 3300009545 | Bacteria | 4579 |
| 218 | Ga0105237_10077266 | 3300009545 | Bacteria | 3319 |
| 219 | Ga0105237_10100512 | 3300009545 | Bacteria | 2884 |
| 220 | Ga0105237_10126179 | 3300009545 | Bacteria | 2553 |
| 221 | Ga0105237_10323492 | 3300009545 | Bacteria | 1546 |
| 222 | Ga0105237_10444566 | 3300009545 | Bacteria | 1302 |
| 223 | Ga0105238_10135833 | 3300009551 | Bacteria | 2437 |
| 224 | Ga0105238_10332376 | 3300009551 | Bacteria | 1507 |
| 225 | Ga0105238_10458082 | 3300009551 | Bacteria | 1273 |
| 226 | Ga0105238_10784392 | 3300009551 | Bacteria | 968 |
| 227 | Ga0105249_10036927 | 3300009553 | Bacteria | 4433 |
| 228 | Ga0105249_10238250 | 3300009553 | Bacteria | 1798 |
| 229 | Ga0105239_10002717 | 3300010375 | Bacteria | 22262 |
| 230 | Ga0105239_10010954 | 3300010375 | Bacteria | 10129 |
| 231 | Ga0105239_10039418 | 3300010375 | Bacteria | 5176 |
| 232 | Ga0105239_10048515 | 3300010375 | Bacteria | 4656 |
| 233 | Ga0105239_10082916 | 3300010375 | Bacteria | 3531 |
| 234 | Ga0105239_10174867 | 3300010375 | Bacteria | 2401 |
| 235 | Ga0105239_10183118 | 3300010375 | Bacteria | 2344 |
| 236 | Ga0105239_10386009 | 3300010375 | Bacteria | 1584 |
| 237 | Ga0105239_10446995 | 3300010375 | Bacteria | 1466 |
| 238 | Ga0105239_10606846 | 3300010375 | Bacteria | 1248 |
| 239 | Ga0105239_10681093 | 3300010375 | Bacteria | 1175 |
| 240 | Ga0105246_10020290 | 3300011119 | Bacteria | 4261 |
| 241 | Ga0105246_10055406 | 3300011119 | Bacteria | 2736 |
| 242 | Ga0157373_10002345 | 3300013100 | Bacteria | 14371 |
| 243 | Ga0157370_10004573 | 3300013104 | Bacteria | 15841 |
| 244 | Ga0157370_10016923 | 3300013104 | Bacteria | 7371 |
| 245 | Ga0157370_10173706 | 3300013104 | Bacteria | 2003 |
| 246 | Ga0157370_10242888 | 3300013104 | Bacteria | 1666 |
| 247 | Ga0157369_10000362 | 3300013105 | Bacteria | 60506 |
| 248 | Ga0157369_10004644 | 3300013105 | Bacteria | 16137 |
| 249 | Ga0157369_10016093 | 3300013105 | Bacteria | 8416 |
| 250 | Ga0157369_10144914 | 3300013105 | Bacteria | 2511 |
| 251 | Ga0157374_10002490 | 3300013296 | Bacteria | 15563 |
| 252 | Ga0157378_10075165 | 3300013297 | Bacteria | 3041 |
| 253 | Ga0157378_10179724 | 3300013297 | Bacteria | 1990 |
| 254 | Ga0157378_10597807 | 3300013297 | Bacteria | 1114 |
| 255 | Ga0163162_10015168 | 3300013306 | Bacteria | 7526 |
| 256 | Ga0163162_10101008 | 3300013306 | Bacteria | 2976 |
| 257 | Ga0157372_10002285 | 3300013307 | Bacteria | 20771 |
| 258 | Ga0157372_10743048 | 3300013307 | Bacteria | 1141 |
| 259 | Ga0157375_10091403 | 3300013308 | Bacteria | 3105 |
| 260 | Ga0157375_10139188 | 3300013308 | Bacteria | 2553 |
| 261 | Ga0157375_10216272 | 3300013308 | Bacteria | 2074 |
| 262 | Ga0163163_10003792 | 3300014325 | Bacteria | 12874 |
| 263 | Ga0163163_10007553 | 3300014325 | Bacteria | 9597 |
| 264 | Ga0163163_10061180 | 3300014325 | Bacteria | 3730 |
| 265 | Ga0163163_10576374 | 3300014325 | Bacteria | 1188 |
| 266 | Ga0163163_10787736 | 3300014325 | Bacteria | 1014 |
| 267 | Ga0157380_10019544 | 3300014326 | Bacteria | 5050 |
| 268 | Ga0157380_10551717 | 3300014326 | Bacteria | 1130 |
| 269 | Ga0182008_10030237 | 3300014497 | Bacteria | 2731 |
| 270 | Ga0182008_10197176 | 3300014497 | Bacteria | 1023 |
| 271 | Ga0157377_10084318 | 3300014745 | Bacteria | 1864 |
| 272 | Ga0157379_10088052 | 3300014968 | Bacteria | 2784 |
| 273 | Ga0157379_10093085 | 3300014968 | Bacteria | 2704 |
| 274 | Ga0157379_10263569 | 3300014968 | Bacteria | 1566 |
| 275 | Ga0157379_10450242 | 3300014968 | Bacteria | 1188 |
| 276 | Ga0157376_10013448 | 3300014969 | Bacteria | 6107 |
| 277 | Ga0182006_1022019 | 3300015261 | Bacteria | 2653 |
| 278 | Ga0182007_10032118 | 3300015262 | Bacteria | 1784 |
| 279 | Ga0163161_10021099 | 3300017792 | Bacteria | 4578 |
| 280 | Ga0163161_10573995 | 3300017792 | Bacteria | 927 |
| 281 | Ga0213874_10013586 | 3300021377 | Bacteria | 2113 |
| 282 | Ga0213874_10013739 | 3300021377 | Bacteria | 2105 |
| 283 | Ga0209436_100004 | 3300025208 | Bacteria | 196698 |
| 284 | Ga0209672_100948 | 3300025228 | Bacteria | 12951 |
| 285 | Ga0209563_100449 | 3300025230 | Bacteria | 14243 |
| 286 | Ga0207425_1000137 | 3300025245 | Bacteria | 65554 |
| 287 | Ga0207425_1000217 | 3300025245 | Bacteria | 45693 |
| 288 | Ga0207425_1011182 | 3300025245 | Bacteria | 2150 |
| 289 | Ga0209677_100210 | 3300025253 | Bacteria | 44738 |
| 290 | Ga0209148_1000929 | 3300025254 | Bacteria | 19375 |
| 291 | Ga0209148_1002656 | 3300025254 | Bacteria | 5766 |
| 292 | Ga0209759_1001867 | 3300025256 | Bacteria | 10461 |
| 293 | Ga0209129_1000082 | 3300025258 | Bacteria | 183436 |
| 294 | Ga0209129_1000098 | 3300025258 | Bacteria | 163406 |
| 295 | Ga0209129_1000165 | 3300025258 | Bacteria | 98917 |
| 296 | Ga0209129_1001930 | 3300025258 | Bacteria | 10867 |
| 297 | Ga0209129_1005362 | 3300025258 | Bacteria | 4573 |
| 298 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 299 | Ga0209233_1003142 | 3300025261 | Bacteria | 5859 |
| 300 | Ga0209233_1006358 | 3300025261 | Bacteria | 3815 |
| 301 | Ga0209233_1021026 | 3300025261 | Bacteria | 1699 |
| 302 | Ga0209455_1000620 | 3300025272 | Bacteria | 22265 |
| 303 | Ga0209673_1003625 | 3300025273 | Bacteria | 8930 |
| 304 | Ga0209673_1027984 | 3300025273 | Bacteria | 1824 |
| 305 | Ga0209673_1030369 | 3300025273 | Bacteria | 1703 |
| 306 | Ga0209130_1000001 | 3300025284 | Bacteria | 831557 |
| 307 | Ga0209025_1000142 | 3300025294 | Bacteria | 183903 |
| 308 | Ga0209025_1000172 | 3300025294 | Bacteria | 160407 |
| 309 | Ga0209025_1000362 | 3300025294 | Bacteria | 96826 |
| 310 | Ga0209564_1001805 | 3300025295 | Bacteria | 19744 |
| 311 | Ga0209564_1004735 | 3300025295 | Bacteria | 8146 |
| 312 | Ga0209564_1011661 | 3300025295 | Bacteria | 3913 |
| 313 | Ga0209564_1044776 | 3300025295 | Bacteria | 1145 |
| 314 | Ga0209758_1000021 | 3300025297 | Bacteria | 697691 |
| 315 | Ga0209758_1000388 | 3300025297 | Bacteria | 76021 |
| 316 | Ga0209758_1000488 | 3300025297 | Bacteria | 64778 |
| 317 | Ga0209758_1000738 | 3300025297 | Bacteria | 47745 |
| 318 | Ga0209758_1001532 | 3300025297 | Bacteria | 26653 |
| 319 | Ga0209758_1023778 | 3300025297 | Bacteria | 2756 |
| 320 | Ga0209758_1025905 | 3300025297 | Bacteria | 2558 |
| 321 | Ga0209758_1031377 | 3300025297 | Bacteria | 2180 |
| 322 | Ga0209256_1001343 | 3300025299 | Bacteria | 26083 |
| 323 | Ga0209256_1013699 | 3300025299 | Bacteria | 2989 |
| 324 | Ga0209256_1018762 | 3300025299 | Bacteria | 2231 |
| 325 | Ga0207426_1000005 | 3300025302 | Bacteria | 1037188 |
| 326 | Ga0207426_1000143 | 3300025302 | Bacteria | 192948 |
| 327 | Ga0207426_1000687 | 3300025302 | Bacteria | 40682 |
| 328 | Ga0207426_1004068 | 3300025302 | Bacteria | 7380 |
| 329 | Ga0207426_1026400 | 3300025302 | Bacteria | 1946 |
| 330 | Ga0207426_1071450 | 3300025302 | Bacteria | 967 |
| 331 | Ga0209051_1007389 | 3300025303 | Bacteria | 6012 |
| 332 | Ga0209051_1014372 | 3300025303 | Bacteria | 3700 |
| 333 | Ga0209257_1000455 | 3300025304 | Bacteria | 75945 |
| 334 | Ga0209257_1012178 | 3300025304 | Bacteria | 4019 |
| 335 | Ga0209257_1042696 | 3300025304 | Bacteria | 1336 |
| 336 | Ga0207697_10081335 | 3300025315 | Bacteria | 1365 |
| 337 | Ga0207692_10022140 | 3300025898 | Bacteria | 2920 |
| 338 | Ga0207642_10073329 | 3300025899 | Bacteria | 1637 |
| 339 | Ga0207710_10137027 | 3300025900 | Bacteria | 1179 |
| 340 | Ga0207688_10024216 | 3300025901 | Bacteria | 3328 |
| 341 | Ga0207688_10031251 | 3300025901 | Bacteria | 2939 |
| 342 | Ga0207688_10131669 | 3300025901 | Bacteria | 1466 |
| 343 | Ga0207680_10461651 | 3300025903 | Bacteria | 902 |
| 344 | Ga0207647_10000340 | 3300025904 | Bacteria | 38070 |
| 345 | Ga0207647_10006430 | 3300025904 | Bacteria | 8541 |
| 346 | Ga0207699_10033697 | 3300025906 | Bacteria | 2897 |
| 347 | Ga0207643_10115699 | 3300025908 | Bacteria | 1584 |
| 348 | Ga0207705_10000352 | 3300025909 | Bacteria | 41499 |
| 349 | Ga0207705_10131740 | 3300025909 | Bacteria | 1861 |
| 350 | Ga0207705_10599324 | 3300025909 | Bacteria | 857 |
| 351 | Ga0207654_10019392 | 3300025911 | Bacteria | 3589 |
| 352 | Ga0207654_10111618 | 3300025911 | Bacteria | 1702 |
| 353 | Ga0207707_10031913 | 3300025912 | Bacteria | 4611 |
| 354 | Ga0207695_10000015 | 3300025913 | Bacteria | 803205 |
| 355 | Ga0207695_10047671 | 3300025913 | Bacteria | 4531 |
| 356 | Ga0207695_10118597 | 3300025913 | Bacteria | 2617 |
| 357 | Ga0207695_10156665 | 3300025913 | Bacteria | 2212 |
| 358 | Ga0207695_10765357 | 3300025913 | Bacteria | 846 |
| 359 | Ga0207671_10006016 | 3300025914 | Bacteria | 10965 |
| 360 | Ga0207671_10007700 | 3300025914 | Bacteria | 9296 |
| 361 | Ga0207671_10146469 | 3300025914 | Bacteria | 1822 |
| 362 | Ga0207671_10204779 | 3300025914 | Bacteria | 1542 |
| 363 | Ga0207671_10227943 | 3300025914 | Bacteria | 1461 |
| 364 | Ga0207671_10381049 | 3300025914 | Bacteria | 1120 |
| 365 | Ga0207671_10391325 | 3300025914 | Bacteria | 1105 |
| 366 | Ga0207693_10068993 | 3300025915 | Bacteria | 2767 |
| 367 | Ga0207693_10144997 | 3300025915 | Bacteria | 1867 |
| 368 | Ga0207660_10147020 | 3300025917 | Bacteria | 1807 |
| 369 | Ga0207662_10073290 | 3300025918 | Bacteria | 2077 |
| 370 | Ga0207657_10002294 | 3300025919 | Bacteria | 20726 |
| 371 | Ga0207657_10063817 | 3300025919 | Bacteria | 3147 |
| 372 | Ga0207649_10084274 | 3300025920 | Bacteria | 2066 |
| 373 | Ga0207649_10431590 | 3300025920 | Bacteria | 991 |
| 374 | Ga0207652_10271870 | 3300025921 | Bacteria | 1529 |
| 375 | Ga0207694_10649961 | 3300025924 | Bacteria | 888 |
| 376 | Ga0207650_10164340 | 3300025925 | Bacteria | 1760 |
| 377 | Ga0207659_10438468 | 3300025926 | Bacteria | 1098 |
| 378 | Ga0207687_10047348 | 3300025927 | Bacteria | 2981 |
| 379 | Ga0207687_10159535 | 3300025927 | Bacteria | 1729 |
| 380 | Ga0207687_10171682 | 3300025927 | Bacteria | 1673 |
| 381 | Ga0207700_10287430 | 3300025928 | Bacteria | 1416 |
| 382 | Ga0207644_10035292 | 3300025931 | Bacteria | 3503 |
| 383 | Ga0207644_10094809 | 3300025931 | Bacteria | 2231 |
| 384 | Ga0207644_10269258 | 3300025931 | Bacteria | 1364 |
| 385 | Ga0207706_10128442 | 3300025933 | Bacteria | 2229 |
| 386 | Ga0207706_10258745 | 3300025933 | Bacteria | 1520 |
| 387 | Ga0207706_10276911 | 3300025933 | Bacteria | 1464 |
| 388 | Ga0207709_10023852 | 3300025935 | Bacteria | 3487 |
| 389 | Ga0207670_10442199 | 3300025936 | Bacteria | 1047 |
| 390 | Ga0207669_10038831 | 3300025937 | Bacteria | 2745 |
| 391 | Ga0207704_10023352 | 3300025938 | Bacteria | 3331 |
| 392 | Ga0207704_10568185 | 3300025938 | Bacteria | 924 |
| 393 | Ga0207691_10499021 | 3300025940 | Bacteria | 1034 |
| 394 | Ga0207691_10731170 | 3300025940 | Bacteria | 834 |
| 395 | Ga0207711_10066437 | 3300025941 | Bacteria | 3119 |
| 396 | Ga0207711_10083775 | 3300025941 | Bacteria | 2790 |
| 397 | Ga0207711_10116854 | 3300025941 | Bacteria | 2379 |
| 398 | Ga0207689_10087777 | 3300025942 | Bacteria | 2555 |
| 399 | Ga0207689_10194134 | 3300025942 | Bacteria | 1675 |
| 400 | Ga0207661_10038687 | 3300025944 | Bacteria | 3740 |
| 401 | Ga0207679_10047242 | 3300025945 | Bacteria | 3126 |
| 402 | Ga0207679_10381243 | 3300025945 | Bacteria | 1236 |
| 403 | Ga0207679_10412657 | 3300025945 | Bacteria | 1190 |
| 404 | Ga0207667_10002243 | 3300025949 | Bacteria | 24288 |
| 405 | Ga0207667_10010756 | 3300025949 | Bacteria | 10672 |
| 406 | Ga0207667_10011404 | 3300025949 | Bacteria | 10330 |
| 407 | Ga0207667_10015015 | 3300025949 | Bacteria | 8810 |
| 408 | Ga0207667_10359872 | 3300025949 | Bacteria | 1484 |
| 409 | Ga0207651_10071143 | 3300025960 | Bacteria | 2464 |
| 410 | Ga0207651_10205779 | 3300025960 | Bacteria | 1581 |
| 411 | Ga0207712_10055817 | 3300025961 | Bacteria | 2780 |
| 412 | Ga0207668_10027869 | 3300025972 | Bacteria | 3685 |
| 413 | Ga0207668_10053221 | 3300025972 | Bacteria | 2804 |
| 414 | Ga0207668_10291585 | 3300025972 | Bacteria | 1343 |
| 415 | Ga0207640_10154765 | 3300025981 | Bacteria | 1688 |
| 416 | Ga0207658_10200605 | 3300025986 | Bacteria | 1665 |
| 417 | Ga0207677_10335565 | 3300026023 | Bacteria | 1261 |
| 418 | Ga0207639_10460884 | 3300026041 | Bacteria | 1155 |
| 419 | Ga0207678_10022770 | 3300026067 | Bacteria | 5486 |
| 420 | Ga0207678_10047370 | 3300026067 | Bacteria | 3718 |
| 421 | Ga0207678_10049880 | 3300026067 | Bacteria | 3617 |
| 422 | Ga0207678_10060449 | 3300026067 | Bacteria | 3259 |
| 423 | Ga0207678_10151597 | 3300026067 | Bacteria | 1979 |
| 424 | Ga0207678_10188016 | 3300026067 | Bacteria | 1764 |
| 425 | Ga0207678_10192087 | 3300026067 | Bacteria | 1745 |
| 426 | Ga0207678_10203469 | 3300026067 | Bacteria | 1693 |
| 427 | Ga0207678_10263661 | 3300026067 | Bacteria | 1477 |
| 428 | Ga0207708_10032013 | 3300026075 | Bacteria | 3993 |
| 429 | Ga0207708_10096030 | 3300026075 | Bacteria | 2290 |
| 430 | Ga0207702_10063047 | 3300026078 | Bacteria | 3169 |
| 431 | Ga0207702_10141780 | 3300026078 | Bacteria | 2176 |
| 432 | Ga0207702_10163134 | 3300026078 | Bacteria | 2037 |
| 433 | Ga0207641_10159592 | 3300026088 | Bacteria | 2049 |
| 434 | Ga0207641_10483056 | 3300026088 | Bacteria | 1201 |
| 435 | Ga0207676_10073727 | 3300026095 | Bacteria | 2748 |
| 436 | Ga0207676_10083040 | 3300026095 | Bacteria | 2608 |
| 437 | Ga0207675_100053975 | 3300026118 | Bacteria | 3749 |
| 438 | Ga0207683_10014660 | 3300026121 | Bacteria | 6675 |
| 439 | Ga0207683_10055468 | 3300026121 | Bacteria | 3474 |
| 440 | Ga0207683_10263975 | 3300026121 | Bacteria | 1572 |
| 441 | Ga0207683_10338332 | 3300026121 | Bacteria | 1380 |
| 442 | Ga0207698_10021492 | 3300026142 | Bacteria | 4464 |
| 443 | Ga0207698_10102945 | 3300026142 | Bacteria | 2372 |
| 444 | Ga0207698_10187883 | 3300026142 | Bacteria | 1837 |
| 445 | Ga0207698_10914398 | 3300026142 | Bacteria | 885 |
| 446 | Ga0209813_10037485 | 3300027866 | Bacteria | 1461 |
| 447 | Ga0268266_10016992 | 3300028379 | Bacteria | 6215 |
| 448 | Ga0268266_10029091 | 3300028379 | Bacteria | 4696 |
| 449 | Ga0268266_10046425 | 3300028379 | Bacteria | 3718 |
| 450 | Ga0268266_10131123 | 3300028379 | Bacteria | 2242 |
| 451 | Ga0268265_10217115 | 3300028380 | Bacteria | 1670 |
| 452 | Ga0268265_10315490 | 3300028380 | Bacteria | 1413 |
| 453 | Ga0268264_10706744 | 3300028381 | Bacteria | 1001 |
| 454 | Ga0307517_10231816 | 3300028786 | Bacteria | 1107 |
| 455 | Ga0265338_10000159 | 3300028800 | Bacteria | 123495 |
| 456 | Ga0265338_10000677 | 3300028800 | Bacteria | 58906 |
| 457 | Ga0265332_10061935 | 3300031238 | Bacteria | 1599 |
| 458 | Ga0265340_10009852 | 3300031247 | Bacteria | 5121 |
| 459 | Ga0265340_10098838 | 3300031247 | Bacteria | 1358 |
| 460 | Ga0265339_10005005 | 3300031249 | Bacteria | 8917 |
| 461 | Ga0265339_10058585 | 3300031249 | Bacteria | 2079 |
| 462 | Ga0265331_10057168 | 3300031250 | Bacteria | 1851 |
| 463 | Ga0307509_10000779 | 3300031507 | Bacteria | 54577 |
| 464 | Ga0307509_10031638 | 3300031507 | Bacteria | 5842 |
| 465 | Ga0307408_100054083 | 3300031548 | Bacteria | 2902 |
| 466 | Ga0307508_10005559 | 3300031616 | Bacteria | 11972 |
| 467 | Ga0265314_10011012 | 3300031711 | Bacteria | 7501 |
| 468 | Ga0265314_10088576 | 3300031711 | Bacteria | 2021 |
| 469 | Ga0265314_10169495 | 3300031711 | Bacteria | 1319 |
| 470 | Ga0265342_10010007 | 3300031712 | Bacteria | 6621 |
| 471 | Ga0307405_10018547 | 3300031731 | Bacteria | 3841 |
| 472 | Ga0307405_10477000 | 3300031731 | Bacteria | 995 |
| 473 | Ga0307410_10105966 | 3300031852 | Bacteria | 2025 |
| 474 | Ga0307406_10367633 | 3300031901 | Bacteria | 1130 |
| 475 | Ga0307412_10028755 | 3300031911 | Bacteria | 3482 |
| 476 | Ga0307409_100487100 | 3300031995 | Bacteria | 1198 |
| 477 | Ga0307416_100700310 | 3300032002 | Bacteria | 1102 |
| 478 | Ga0307411_10048502 | 3300032005 | Bacteria | 2753 |
| 479 | Ga0307411_10152289 | 3300032005 | Bacteria | 1720 |
| 480 | Ga0307510_10000008 | 3300033180 | Bacteria | 433990 |
| 481 | Ga0307510_10009746 | 3300033180 | Bacteria | 11432 |
| 482 | Ga0307510_10056799 | 3300033180 | Bacteria | 4070 |
| 483 | Ga0307510_10080532 | 3300033180 | Bacteria | 3166 |
| 484 | Ga0307510_10128261 | 3300033180 | Bacteria | 2219 |
| 485 | Ga0307510_10160954 | 3300033180 | Bacteria | 1842 |
| 486 | Ga0307510_10327937 | 3300033180 | Bacteria | 986 |
| 487 | Ga0307510_10356147 | 3300033180 | Bacteria | 913 |
| 488 | Ga0315911_1000009 | 3300033442 | Bacteria | 379354 |
| 489 | Ga0373930_0009869 | 3300034816 | Bacteria | 1697 |
| 490 | Ga0373934_0042189 | 3300035086 | Bacteria | 1801 |
| 491 | Ga0373934_0118110 | 3300035086 | Bacteria | 1078 |
| 492 | Ga0373923_0000827 | 3300035111 | Bacteria | 8121 |
| 493 | Ga0373923_0254690 | 3300035111 | Bacteria | 822 |
| 494 | Ga0373936_0023778 | 3300035113 | Bacteria | 2389 |
| 495 | Ga0373939_0057352 | 3300035114 | Bacteria | 1229 |
| 496 | Ga0373945_0030903 | 3300035116 | Bacteria | 1889 |
| 497 | Ga0373953_0003595 | 3300035117 | Bacteria | 4850 |
| 498 | Ga0373954_0000634 | 3300035118 | Bacteria | 13429 |
| 499 | Ga0373956_0018011 | 3300035119 | Bacteria | 2987 |
| 500 | Ga0373957_0000200 | 3300035120 | Bacteria | 15408 |
| 501 | Ga0373943_0002648 | 3300035170 | Bacteria | 8148 |
| 502 | Ga0373943_0051944 | 3300035170 | Bacteria | 2020 |
| 503 | Ga0373946_0008219 | 3300035171 | Bacteria | 3829 |
| 504 | Ga0373955_0008103 | 3300035172 | Bacteria | 4861 |
| 505 | Ga0373924_0004394 | 3300035410 | Bacteria | 4920 |
| 506 | Ga0373924_0080229 | 3300035410 | Bacteria | 1387 |
| 507 | Ga0373931_0042085 | 3300035691 | Bacteria | 2401 |
| 508 | Ga0373931_0092591 | 3300035691 | Bacteria | 1686 |
| 509 | Ga0373935_0006106 | 3300035692 | Bacteria | 7164 |
| 510 | Ga0373935_0125065 | 3300035692 | Bacteria | 1722 |
| 511 | Ga0373935_0261912 | 3300035692 | Unclassified | 1213 |
| 512 | Ga0373927_0001513 | 3300035695 | Bacteria | 17491 |
| 513 | Ga0373927_0139323 | 3300035695 | Bacteria | 1586 |
| 514 | Ga0373927_0213932 | 3300035695 | Bacteria | 1266 |
| 515 | Ga0373933_0002159 | 3300035724 | Bacteria | 11266 |
| 516 | Ga0373947_0084456 | 3300035725 | Bacteria | 1970 |
| 517 | Ga0373947_0244381 | 3300035725 | Unclassified | 1185 |
| 518 | Ga0373947_0450488 | 3300035725 | Bacteria | 872 |
| 519 | Ga0373925_0006671 | 3300037068 | Bacteria | 8469 |
| 520 | Ga0373925_0252084 | 3300037068 | Bacteria | 1416 |
| 521 | Ga0373925_0269292 | 3300037068 | Bacteria | 1370 |
| 522 | Ga0395899_0000007 | 3300037312 | Bacteria | 629129 |
| 523 | Ga0395899_0029757 | 3300037312 | Bacteria | 4108 |
| 524 | Ga0395899_0160377 | 3300037312 | Bacteria | 1589 |
| 525 | Ga0395900_0004826 | 3300037418 | Bacteria | 14204 |
| 526 | Ga0395900_0061053 | 3300037418 | Bacteria | 3877 |
| 527 | Ga0395900_0353364 | 3300037418 | Bacteria | 1443 |
| 528 | Ga0395900_0406146 | 3300037418 | Bacteria | 1325 |
| 529 | Ga0395898_0000276 | 3300037466 | Bacteria | 124774 |
| 530 | Ga0395898_0012584 | 3300037466 | Bacteria | 8748 |
| 531 | Ga0395898_0081232 | 3300037466 | Bacteria | 3126 |
| 532 | Ga0395898_0102696 | 3300037466 | Bacteria | 2744 |
| 533 | Ga0395905_0022102 | 3300037471 | Bacteria | 6017 |
| 534 | Ga0395905_0119904 | 3300037471 | Bacteria | 2472 |
| 535 | Ga0395905_0279868 | 3300037471 | Bacteria | 1554 |
| 536 | Ga0436364_0804269 | 3300037853 | Bacteria | 3901 |
| 537 | Ga0395901_0000017 | 3300038443 | Bacteria | 345003 |
| 538 | Ga0395901_0002433 | 3300038443 | Bacteria | 18893 |
| 539 | Ga0395901_0007409 | 3300038443 | Bacteria | 11070 |
| 540 | Ga0395901_0010567 | 3300038443 | Bacteria | 9353 |
| 541 | Ga0395901_0086648 | 3300038443 | Bacteria | 3274 |
| 542 | Ga0395901_0121988 | 3300038443 | Bacteria | 2739 |
| 543 | Ga0395901_0185005 | 3300038443 | Bacteria | 2185 |
| 544 | Ga0436365_0096880 | 3300039437 | Bacteria | 1895 |
| 545 | Ga0436365_0116034 | 3300039437 | Bacteria | 3825 |
| 546 | Ga0436365_0410894 | 3300039437 | Bacteria | 972 |
| 547 | Ga0436365_1476096 | 3300039437 | Bacteria | 3897 |
| 548 | Ga0436360_0795597 | 3300039438 | Bacteria | 1869 |
| 549 | Ga0436361_0260510 | 3300039447 | Bacteria | 1762 |
| 550 | Ga0436361_0901521 | 3300039447 | Bacteria | 4403 |
| 551 | Ga0436361_0918647 | 3300039447 | Bacteria | 7525 |
| 552 | Ga0436363_0090351 | 3300039450 | Bacteria | 4290 |
| 553 | Ga0436363_1223179 | 3300039450 | Bacteria | 2390 |
| 554 | Ga0436363_1511490 | 3300039450 | Bacteria | 2452 |
| 555 | Ga0436362_0224975 | 3300039453 | Bacteria | 3350 |
| 556 | Ga0439465_0006693 | 3300041413 | Bacteria | 3659 |
| 557 | Ga0451837_0376583 | 3300041494 | Bacteria | 1113 |
| 558 | Ga0451855_0177954 | 3300041511 | Bacteria | 4441 |
| 559 | Ga0451853_0910860 | 3300041512 | Bacteria | 25581 |
| 560 | Ga0439448_0000098 | 3300042005 | Bacteria | 15629 |
| 561 | Ga0466969_0000523 | 3300044656 | Bacteria | 21109 |
| 562 | Ga0466969_0070745 | 3300044656 | Bacteria | 1678 |
| 563 | Ga0466973_0019878 | 3300044659 | Bacteria | 6407 |
| 564 | Ga0466966_0001170 | 3300044684 | Bacteria | 16864 |
| 565 | Ga0466961_0000375 | 3300044693 | Bacteria | 28794 |
| 566 | Ga0466961_0015547 | 3300044693 | Bacteria | 4883 |
| 567 | Ga0466963_0001202 | 3300044694 | Bacteria | 13621 |
| 568 | Ga0466963_0121949 | 3300044694 | Bacteria | 1795 |
| 569 | Ga0466964_0066669 | 3300044706 | Bacteria | 1511 |
| 570 | Ga0466970_0000982 | 3300044765 | Bacteria | 13717 |
| 571 | Ga0466957_0003670 | 3300044842 | Bacteria | 8471 |
| 572 | Ga0466957_0263324 | 3300044842 | Bacteria | 1149 |
| 573 | Ga0466957_0586456 | 3300044842 | Bacteria | 779 |
| 574 | Ga0466960_0203387 | 3300044901 | Bacteria | 1083 |
| 575 | Ga0466959_0006481 | 3300045049 | Bacteria | 8112 |
| 576 | Ga0466959_0014159 | 3300045049 | Bacteria | 5789 |
| 577 | Ga0466958_0007577 | 3300045836 | Bacteria | 5977 |
| 578 | Ga0466958_0092199 | 3300045836 | Bacteria | 1875 |
| 579 | Ga0466967_0036461 | 3300045976 | Bacteria | 4198 |
| 580 | Ga0466967_0208302 | 3300045976 | Bacteria | 1854 |
| 581 | Ga0495592_0002897 | 3300046454 | Bacteria | 12205 |
| 582 | Ga0495592_0119351 | 3300046454 | Bacteria | 1857 |
| 583 | Ga0495592_0191388 | 3300046454 | Bacteria | 1386 |
| 584 | Ga0495592_0225893 | 3300046454 | Bacteria | 1249 |
| 585 | Ga0495603_0001638 | 3300046455 | Bacteria | 13151 |
| 586 | Ga0495603_0013589 | 3300046455 | Bacteria | 4925 |
| 587 | Ga0495603_0019422 | 3300046455 | Bacteria | 4112 |
| 588 | Ga0495603_0022020 | 3300046455 | Bacteria | 3859 |
| 589 | Ga0495603_0186121 | 3300046455 | Bacteria | 1201 |
| 590 | Ga0495629_0000215 | 3300046459 | Bacteria | 52018 |
| 591 | Ga0495629_0002158 | 3300046459 | Bacteria | 15190 |
| 592 | Ga0495629_0004330 | 3300046459 | Bacteria | 10642 |
| 593 | Ga0495629_0019046 | 3300046459 | Bacteria | 4908 |
| 594 | Ga0495638_0008267 | 3300046460 | Bacteria | 7390 |
| 595 | Ga0495638_0232269 | 3300046460 | Bacteria | 1025 |
| 596 | Ga0495641_0035031 | 3300046461 | Bacteria | 2369 |
| 597 | Ga0495641_0061969 | 3300046461 | Bacteria | 1688 |
| 598 | Ga0495651_0014331 | 3300046462 | Bacteria | 6128 |
| 599 | Ga0495651_0023237 | 3300046462 | Bacteria | 4821 |
| 600 | Ga0495651_0023242 | 3300046462 | Bacteria | 4821 |
| 601 | Ga0495651_0065402 | 3300046462 | Bacteria | 2777 |
| 602 | Ga0495651_0298257 | 3300046462 | Bacteria | 1082 |
| 603 | Ga0495653_0017446 | 3300046463 | Bacteria | 5838 |
| 604 | Ga0495653_0115439 | 3300046463 | Bacteria | 1922 |
| 605 | Ga0495653_0155372 | 3300046463 | Bacteria | 1594 |
| 606 | Ga0495650_0001730 | 3300046471 | Bacteria | 19964 |
| 607 | Ga0495650_0023114 | 3300046471 | Bacteria | 2966 |
| 608 | Ga0495580_0003083 | 3300046472 | Bacteria | 14276 |
| 609 | Ga0495580_0006344 | 3300046472 | Bacteria | 9647 |
| 610 | Ga0495582_0006681 | 3300046473 | Bacteria | 6406 |
| 611 | Ga0495582_0115614 | 3300046473 | Bacteria | 1508 |
| 612 | Ga0495605_0020982 | 3300046474 | Bacteria | 3465 |
| 613 | Ga0495639_0000750 | 3300046475 | Bacteria | 14821 |
| 614 | Ga0495639_0117968 | 3300046475 | Unclassified | 1264 |
| 615 | Ga0495662_0002275 | 3300046476 | Bacteria | 9684 |
| 616 | Ga0495662_0178581 | 3300046476 | Bacteria | 1046 |
| 617 | Ga0495664_0014584 | 3300046477 | Bacteria | 4458 |
| 618 | Ga0495664_0023152 | 3300046477 | Bacteria | 3603 |
| 619 | Ga0495664_0051948 | 3300046477 | Bacteria | 2434 |
| 620 | Ga0495585_0100879 | 3300046492 | Bacteria | 1544 |
| 621 | Ga0495594_0054320 | 3300046499 | Bacteria | 2207 |
| 622 | Ga0495594_0137048 | 3300046499 | Bacteria | 1387 |
| 623 | Ga0495596_0108613 | 3300046500 | Bacteria | 1077 |
| 624 | Ga0495583_0001126 | 3300046506 | Bacteria | 29374 |
| 625 | Ga0495583_0057578 | 3300046506 | Bacteria | 1747 |
| 626 | Ga0495606_0002134 | 3300046507 | Bacteria | 23878 |
| 627 | Ga0495606_0043458 | 3300046507 | Bacteria | 2997 |
| 628 | Ga0495606_0067765 | 3300046507 | Bacteria | 2259 |
| 629 | Ga0495606_0182494 | 3300046507 | Bacteria | 1209 |
| 630 | Ga0495606_0249450 | 3300046507 | Bacteria | 985 |
| 631 | Ga0495608_0002218 | 3300046511 | Bacteria | 14020 |
| 632 | Ga0495608_0022549 | 3300046511 | Bacteria | 4317 |
| 633 | Ga0495608_0467078 | 3300046511 | Bacteria | 766 |
| 634 | Ga0495616_0048906 | 3300046513 | Bacteria | 2122 |
| 635 | Ga0495618_0222532 | 3300046514 | Bacteria | 1190 |
| 636 | Ga0495628_0038487 | 3300046516 | Bacteria | 3828 |
| 637 | Ga0495628_0517182 | 3300046516 | Bacteria | 860 |
| 638 | Ga0495630_0025991 | 3300046517 | Bacteria | 4332 |
| 639 | Ga0495631_0003452 | 3300046518 | Bacteria | 8649 |
| 640 | Ga0495631_0033577 | 3300046518 | Bacteria | 2304 |
| 641 | Ga0495632_0013949 | 3300046519 | Bacteria | 4564 |
| 642 | Ga0495643_0047143 | 3300046522 | Bacteria | 2334 |
| 643 | Ga0495643_0125108 | 3300046522 | Bacteria | 1295 |
| 644 | Ga0495644_0055108 | 3300046523 | Bacteria | 1494 |
| 645 | Ga0495648_0056234 | 3300046524 | Bacteria | 2368 |
| 646 | Ga0495648_0130506 | 3300046524 | Unclassified | 1337 |
| 647 | Ga0495652_0034244 | 3300046529 | Bacteria | 4428 |
| 648 | Ga0495652_0038809 | 3300046529 | Bacteria | 4122 |
| 649 | Ga0495652_0126467 | 3300046529 | Bacteria | 2030 |
| 650 | Ga0495652_0126502 | 3300046529 | Bacteria | 2029 |
| 651 | Ga0495652_0157078 | 3300046529 | Bacteria | 1770 |
| 652 | Ga0495665_0007507 | 3300046531 | Bacteria | 5902 |
| 653 | Ga0495640_0005616 | 3300046533 | Bacteria | 9978 |
| 654 | Ga0495640_0007861 | 3300046533 | Bacteria | 8385 |
| 655 | Ga0495640_0020015 | 3300046533 | Bacteria | 4933 |
| 656 | Ga0495640_0112121 | 3300046533 | Bacteria | 1781 |
| 657 | Ga0495640_0143738 | 3300046533 | Unclassified | 1536 |
| 658 | Ga0495586_0013054 | 3300046535 | Bacteria | 4402 |
| 659 | Ga0495586_0106141 | 3300046535 | Bacteria | 1562 |
| 660 | Ga0495587_0032169 | 3300046536 | Bacteria | 3172 |
| 661 | Ga0495597_0066410 | 3300046542 | Bacteria | 1563 |
| 662 | Ga0495645_0001582 | 3300046543 | Bacteria | 15411 |
| 663 | Ga0495645_0023405 | 3300046543 | Bacteria | 4472 |
| 664 | Ga0495645_0045991 | 3300046543 | Bacteria | 3183 |
| 665 | Ga0495645_0063352 | 3300046543 | Bacteria | 2677 |
| 666 | Ga0495622_0005946 | 3300046557 | Bacteria | 5670 |
| 667 | Ga0495622_0006189 | 3300046557 | Bacteria | 5559 |
| 668 | Ga0495622_0007815 | 3300046557 | Bacteria | 4966 |
| 669 | Ga0495667_0019371 | 3300046559 | Bacteria | 4592 |
| 670 | Ga0495667_0037821 | 3300046559 | Bacteria | 3215 |
| 671 | Ga0495667_0095980 | 3300046559 | Bacteria | 1919 |
| 672 | Ga0495667_0130304 | 3300046559 | Bacteria | 1622 |
| 673 | Ga0495656_0141873 | 3300046615 | Bacteria | 1153 |
| 674 | Ga0495668_0003217 | 3300046616 | Bacteria | 12461 |
| 675 | Ga0495668_0187067 | 3300046616 | Bacteria | 1134 |
| 676 | Ga0495634_0001188 | 3300046642 | Bacteria | 24100 |
| 677 | Ga0495634_0012328 | 3300046642 | Bacteria | 6195 |
| 678 | Ga0495634_0147156 | 3300046642 | Bacteria | 1492 |
| 679 | Ga0495611_0087234 | 3300046648 | Bacteria | 1440 |
| 680 | Ga0495625_0001420 | 3300046660 | Bacteria | 29255 |
| 681 | Ga0495625_0270253 | 3300046660 | Bacteria | 1097 |
| 682 | Ga0495635_0001058 | 3300046663 | Bacteria | 18230 |
| 683 | Ga0495635_0031655 | 3300046663 | Bacteria | 3671 |
| 684 | Ga0495635_0082311 | 3300046663 | Bacteria | 2202 |
| 685 | Ga0495635_0156827 | 3300046663 | Bacteria | 1549 |
| 686 | Ga0495588_0026364 | 3300046674 | Bacteria | 2901 |
| 687 | Ga0495588_0063205 | 3300046674 | Bacteria | 1919 |
| 688 | Ga0495588_0279413 | 3300046674 | Bacteria | 880 |
| 689 | Ga0495657_0004962 | 3300046675 | Bacteria | 10578 |
| 690 | Ga0495657_0009569 | 3300046675 | Bacteria | 7342 |
| 691 | Ga0495657_0021303 | 3300046675 | Bacteria | 4651 |
| 692 | Ga0495599_0003523 | 3300046678 | Bacteria | 9167 |
| 693 | Ga0495599_0059991 | 3300046678 | Bacteria | 2379 |
| 694 | Ga0495623_0006259 | 3300046679 | Bacteria | 7742 |
| 695 | Ga0495623_0023756 | 3300046679 | Bacteria | 3955 |
| 696 | Ga0495623_0049549 | 3300046679 | Bacteria | 2661 |
| 697 | Ga0495646_0000934 | 3300046680 | Bacteria | 16609 |
| 698 | Ga0495646_0026112 | 3300046680 | Bacteria | 3669 |
| 699 | Ga0495646_0052471 | 3300046680 | Bacteria | 2463 |
| 700 | Ga0495646_0109119 | 3300046680 | Bacteria | 1577 |
| 701 | Ga0495647_0018833 | 3300046681 | Bacteria | 2463 |
| 702 | Ga0495658_0061062 | 3300046683 | Bacteria | 2163 |
| 703 | Ga0495658_0183251 | 3300046683 | Bacteria | 1300 |
| 704 | Ga0495669_0003832 | 3300046684 | Bacteria | 6181 |
| 705 | Ga0495613_0009382 | 3300046689 | Bacteria | 7261 |
| 706 | Ga0495613_0019532 | 3300046689 | Bacteria | 5050 |
| 707 | Ga0495613_0048777 | 3300046689 | Bacteria | 3127 |
| 708 | Ga0495613_0139728 | 3300046689 | Bacteria | 1731 |
| 709 | Ga0495624_0007459 | 3300046690 | Bacteria | 7676 |
| 710 | Ga0495624_0051204 | 3300046690 | Bacteria | 2614 |
| 711 | Ga0495624_0193788 | 3300046690 | Unclassified | 1236 |
| 712 | Ga0495670_0068778 | 3300046691 | Bacteria | 1790 |
| 713 | Ga0495649_0003657 | 3300046694 | Bacteria | 10260 |
| 714 | Ga0495649_0180508 | 3300046694 | Bacteria | 1101 |
| 715 | Ga0495589_0008061 | 3300046794 | Bacteria | 5508 |
| 716 | Ga0495589_0032881 | 3300046794 | Bacteria | 2606 |
| 717 | Ga0495600_0001795 | 3300046809 | Bacteria | 11997 |
| 718 | Ga0495600_0004023 | 3300046809 | Bacteria | 8738 |
| 719 | Ga0495600_0060700 | 3300046809 | Bacteria | 2469 |
| 720 | Ga0495600_0103023 | 3300046809 | Bacteria | 1860 |
| 721 | Ga0495600_0170027 | 3300046809 | Bacteria | 1407 |
| 722 | Ga0495660_0038341 | 3300046810 | Bacteria | 2664 |
| 723 | Ga0495581_0000567 | 3300047315 | Bacteria | 19221 |
| 724 | Ga0495581_0007237 | 3300047315 | Bacteria | 6419 |
| 725 | Ga0495581_0065992 | 3300047315 | Bacteria | 2093 |
| 726 | Ga0495604_0004281 | 3300047317 | Bacteria | 11303 |
| 727 | Ga0495604_0005607 | 3300047317 | Bacteria | 9956 |
| 728 | Ga0495604_0006726 | 3300047317 | Bacteria | 9113 |
| 729 | Ga0495604_0014661 | 3300047317 | Bacteria | 6247 |
| 730 | Ga0495604_0015049 | 3300047317 | Bacteria | 6171 |
| 731 | Ga0495604_0172956 | 3300047317 | Bacteria | 1517 |
| 732 | Ga0495604_0211484 | 3300047317 | Bacteria | 1340 |
| 733 | Ga0495604_0396353 | 3300047317 | Bacteria | 910 |
| 734 | Ga0495604_0409167 | 3300047317 | Bacteria | 892 |
| 735 | Ga0495636_0041465 | 3300047318 | Bacteria | 1911 |
| 736 | Ga0495674_0007182 | 3300047319 | Bacteria | 10654 |
| 737 | Ga0495674_0013705 | 3300047319 | Bacteria | 7616 |
| 738 | Ga0495674_0015961 | 3300047319 | Bacteria | 7010 |
| 739 | Ga0495674_0020569 | 3300047319 | Bacteria | 6108 |
| 740 | Ga0495674_0166386 | 3300047319 | Bacteria | 1842 |
| 741 | Ga0495672_0001907 | 3300047320 | Bacteria | 19826 |
| 742 | Ga0495672_0056827 | 3300047320 | Bacteria | 2275 |
| 743 | Ga0495676_0051305 | 3300047321 | Bacteria | 3302 |
| 744 | Ga0495676_0275953 | 3300047321 | Bacteria | 1139 |
| 745 | Ga0495680_0009178 | 3300047322 | Bacteria | 8921 |
| 746 | Ga0495680_0050126 | 3300047322 | Bacteria | 3266 |
| 747 | Ga0495680_0133851 | 3300047322 | Bacteria | 1819 |
| 748 | Ga0495683_0099101 | 3300047323 | Bacteria | 1403 |
| 749 | Ga0495687_006263 | 3300047443 | Bacteria | 7340 |
| 750 | Ga0495687_039374 | 3300047443 | Bacteria | 2091 |
| 751 | Ga0495675_0002644 | 3300047444 | Bacteria | 10732 |
| 752 | Ga0495675_0017427 | 3300047444 | Bacteria | 4552 |
| 753 | Ga0495675_0176218 | 3300047444 | Bacteria | 1311 |
| 754 | Ga0495679_027443 | 3300047446 | Bacteria | 1878 |
| 755 | Ga0495684_0003538 | 3300047471 | Bacteria | 12221 |
| 756 | Ga0495684_0073429 | 3300047471 | Bacteria | 2599 |
| 757 | Ga0495684_0183581 | 3300047471 | Bacteria | 1550 |
| 758 | Ga0495686_0000002 | 3300047472 | Bacteria | 1050777 |
| 759 | Ga0495686_0000075 | 3300047472 | Bacteria | 208031 |
| 760 | Ga0495686_0122584 | 3300047472 | Bacteria | 1548 |
| 761 | Ga0495686_0137614 | 3300047472 | Bacteria | 1443 |
| 762 | Ga0495593_0002295 | 3300047673 | Bacteria | 11465 |
| 763 | Ga0495593_0003406 | 3300047673 | Bacteria | 9525 |
| 764 | Ga0495602_0057070 | 3300048088 | Bacteria | 3429 |
| 765 | Ga0495602_0081463 | 3300048088 | Bacteria | 2721 |
| 766 | Ga0495602_0272327 | 3300048088 | Bacteria | 1251 |
| 767 | Ga0495602_0317786 | 3300048088 | Bacteria | 1134 |
| 768 | Ga0495614_0025417 | 3300048089 | Bacteria | 2554 |
| 769 | Ga0496100_0065578 | 3300048903 | Bacteria | 2406 |
| 770 | Ga0496100_0168826 | 3300048903 | Bacteria | 1574 |
| 771 | Ga0496100_0447978 | 3300048903 | Bacteria | 989 |
| 772 | Ga0496101_0000875 | 3300048904 | Bacteria | 17763 |
| 773 | Ga0496101_0058755 | 3300048904 | Bacteria | 2786 |
| 774 | Ga0496101_0073003 | 3300048904 | Bacteria | 2520 |
| 775 | Ga0496101_0180199 | 3300048904 | Bacteria | 1627 |
| 776 | Ga0496102_0009695 | 3300048905 | Bacteria | 8280 |
| 777 | Ga0496102_0021478 | 3300048905 | Bacteria | 5708 |
| 778 | Ga0496102_0356779 | 3300048905 | Bacteria | 1376 |
| 779 | Ga0496102_0715375 | 3300048905 | Bacteria | 924 |
| 780 | Ga0496103_0006163 | 3300048906 | Bacteria | 7164 |
| 781 | Ga0496103_0015179 | 3300048906 | Bacteria | 4579 |
| 782 | Ga0496103_0059635 | 3300048906 | Bacteria | 2371 |
| 783 | Ga0496104_0006272 | 3300048907 | Bacteria | 10452 |
| 784 | Ga0496104_0009754 | 3300048907 | Bacteria | 8561 |
| 785 | Ga0496104_0016857 | 3300048907 | Bacteria | 6642 |
| 786 | Ga0496104_0027410 | 3300048907 | Bacteria | 5272 |
| 787 | Ga0496104_0049962 | 3300048907 | Bacteria | 3945 |
| 788 | Ga0496104_0148417 | 3300048907 | Bacteria | 2251 |
| 789 | Ga0496104_0416258 | 3300048907 | Bacteria | 1256 |
| 790 | Ga0496104_0553105 | 3300048907 | Bacteria | 1062 |
| 791 | Ga0496105_0008791 | 3300048908 | Bacteria | 7863 |
| 792 | Ga0496105_0013347 | 3300048908 | Bacteria | 6519 |
| 793 | Ga0496105_0013653 | 3300048908 | Bacteria | 6449 |
| 794 | Ga0496105_0015561 | 3300048908 | Bacteria | 6065 |
| 795 | Ga0496105_0017743 | 3300048908 | Bacteria | 5710 |
| 796 | Ga0496105_0019982 | 3300048908 | Bacteria | 5406 |
| 797 | Ga0496105_0124523 | 3300048908 | Bacteria | 2125 |
| 798 | Ga0496105_0174614 | 3300048908 | Bacteria | 1760 |
| 799 | Ga0496105_0267473 | 3300048908 | Bacteria | 1381 |
| 800 | Ga0496106_0000340 | 3300048909 | Bacteria | 32856 |
| 801 | Ga0496106_0000980 | 3300048909 | Bacteria | 20817 |
| 802 | Ga0496106_0054530 | 3300048909 | Bacteria | 3020 |
| 803 | Ga0496106_0088453 | 3300048909 | Bacteria | 2388 |
| 804 | Ga0496106_0284363 | 3300048909 | Bacteria | 1325 |
| 805 | Ga0496106_0338085 | 3300048909 | Bacteria | 1209 |
| 806 | Ga0496106_0548041 | 3300048909 | Bacteria | 928 |
| 807 | Ga0496107_0018903 | 3300048910 | Bacteria | 4857 |
| 808 | Ga0496107_0020915 | 3300048910 | Bacteria | 4625 |
| 809 | Ga0496107_0104295 | 3300048910 | Bacteria | 2081 |
| 810 | Ga0496108_0002192 | 3300048911 | Bacteria | 15654 |
| 811 | Ga0496108_0024933 | 3300048911 | Bacteria | 4926 |
| 812 | Ga0496108_0191933 | 3300048911 | Bacteria | 1770 |
| 813 | Ga0496109_0008485 | 3300048912 | Bacteria | 8735 |
| 814 | Ga0496109_0010462 | 3300048912 | Bacteria | 7926 |
| 815 | Ga0496109_0016756 | 3300048912 | Bacteria | 6412 |
| 816 | Ga0496109_0101853 | 3300048912 | Bacteria | 2665 |
| 817 | Ga0496109_0224669 | 3300048912 | Bacteria | 1766 |
| 818 | Ga0496110_0005199 | 3300048913 | Bacteria | 10182 |
| 819 | Ga0496110_0052601 | 3300048913 | Bacteria | 3578 |
| 820 | Ga0496110_0095144 | 3300048913 | Bacteria | 2667 |
| 821 | Ga0496110_0187839 | 3300048913 | Bacteria | 1876 |
| 822 | Ga0496111_0008455 | 3300048914 | Bacteria | 6815 |
| 823 | Ga0496111_0094015 | 3300048914 | Bacteria | 2198 |
| 824 | Ga0496111_0123312 | 3300048914 | Bacteria | 1915 |
| 825 | Ga0496111_0198771 | 3300048914 | Bacteria | 1490 |
| 826 | Ga0496111_0234380 | 3300048914 | Bacteria | 1363 |
| 827 | Ga0496111_0318632 | 3300048914 | Bacteria | 1152 |
| 828 | Ga0496112_0000046 | 3300048915 | Bacteria | 85631 |
| 829 | Ga0496112_0011755 | 3300048915 | Bacteria | 8015 |
| 830 | Ga0496112_0016391 | 3300048915 | Bacteria | 6941 |
| 831 | Ga0496112_0045182 | 3300048915 | Bacteria | 4317 |
| 832 | Ga0496112_0058027 | 3300048915 | Bacteria | 3811 |
| 833 | Ga0496112_0694900 | 3300048915 | Unclassified | 945 |
| 834 | Ga0496112_0839479 | 3300048915 | Bacteria | 842 |
| 835 | Ga0496113_0001312 | 3300048916 | Bacteria | 13745 |
| 836 | Ga0496113_0004620 | 3300048916 | Bacteria | 8486 |
| 837 | Ga0496114_0004461 | 3300048917 | Bacteria | 10865 |
| 838 | Ga0496114_0068014 | 3300048917 | Bacteria | 2990 |
| 839 | Ga0496114_0228009 | 3300048917 | Bacteria | 1636 |
| 840 | Ga0496114_0284169 | 3300048917 | Bacteria | 1459 |
| 841 | Ga0496115_0002553 | 3300048918 | Bacteria | 13088 |
| 842 | Ga0496115_0026735 | 3300048918 | Bacteria | 4507 |
| 843 | Ga0496115_0070017 | 3300048918 | Bacteria | 2843 |
| 844 | Ga0496115_0083471 | 3300048918 | Bacteria | 2604 |
| 845 | Ga0496115_0218197 | 3300048918 | Bacteria | 1574 |
| 846 | Ga0496115_0406274 | 3300048918 | Bacteria | 1104 |
| 847 | Ga0496116_0000554 | 3300048919 | Bacteria | 50097 |
| 848 | Ga0496116_0000555 | 3300048919 | Bacteria | 50050 |
| 849 | Ga0496116_0007216 | 3300048919 | Bacteria | 9916 |
| 850 | Ga0496116_0062552 | 3300048919 | Bacteria | 2403 |
| 851 | Ga0496117_0040145 | 3300048920 | Bacteria | 3447 |
| 852 | Ga0496117_0068342 | 3300048920 | Bacteria | 2399 |
| 853 | Ga0496117_0073771 | 3300048920 | Bacteria | 2275 |
| 854 | Ga0496117_0104448 | 3300048920 | Bacteria | 1783 |
| 855 | Ga0496117_0116626 | 3300048920 | Bacteria | 1650 |
| 856 | Ga0496117_0160292 | 3300048920 | Bacteria | 1319 |
| 857 | Ga0496118_0014101 | 3300048921 | Bacteria | 7499 |
| 858 | Ga0496118_0024568 | 3300048921 | Bacteria | 5196 |
| 859 | Ga0496118_0126344 | 3300048921 | Bacteria | 1654 |
| 860 | Ga0496118_0130139 | 3300048921 | Bacteria | 1618 |
| 861 | Ga0496118_0158501 | 3300048921 | Unclassified | 1404 |
| 862 | Ga0496118_0189864 | 3300048921 | Bacteria | 1230 |
| 863 | Ga0496119_0015903 | 3300048922 | Bacteria | 5760 |
| 864 | Ga0496119_0082578 | 3300048922 | Bacteria | 1848 |
| 865 | Ga0496119_0152820 | 3300048922 | Bacteria | 1235 |
| 866 | Ga0496120_0079787 | 3300048923 | Bacteria | 1775 |
| 867 | Ga0496120_0135629 | 3300048923 | Bacteria | 1255 |
| 868 | Ga0496121_0000330 | 3300048924 | Bacteria | 98687 |
| 869 | Ga0496121_0000516 | 3300048924 | Bacteria | 73572 |
| 870 | Ga0496121_0002350 | 3300048924 | Bacteria | 29161 |
| 871 | Ga0496121_0005737 | 3300048924 | Bacteria | 15768 |
| 872 | Ga0496121_0047898 | 3300048924 | Bacteria | 3641 |
| 873 | Ga0496121_0083183 | 3300048924 | Bacteria | 2527 |
| 874 | Ga0496121_0088668 | 3300048924 | Bacteria | 2424 |
| 875 | Ga0496121_0096160 | 3300048924 | Bacteria | 2299 |
| 876 | Ga0496121_0117918 | 3300048924 | Bacteria | 2010 |
| 877 | Ga0496121_0122978 | 3300048924 | Bacteria | 1956 |
| 878 | Ga0496121_0152296 | 3300048924 | Bacteria | 1700 |
| 879 | Ga0496121_0215148 | 3300048924 | Bacteria | 1358 |
| 880 | Ga0496121_0215158 | 3300048924 | Bacteria | 1358 |
| 881 | Ga0496121_0356939 | 3300048924 | Bacteria | 972 |
| 882 | Ga0496122_0003971 | 3300048925 | Bacteria | 18885 |
| 883 | Ga0496122_0007384 | 3300048925 | Bacteria | 12243 |
| 884 | Ga0496122_0011018 | 3300048925 | Bacteria | 9238 |
| 885 | Ga0496122_0209944 | 3300048925 | Bacteria | 1129 |
| 886 | Ga0496122_0219257 | 3300048925 | Bacteria | 1093 |
| 887 | Ga0496123_0003013 | 3300048926 | Bacteria | 19460 |
| 888 | Ga0496123_0064214 | 3300048926 | Unclassified | 2341 |
| 889 | Ga0496124_0001503 | 3300048927 | Bacteria | 34105 |
| 890 | Ga0496124_0001892 | 3300048927 | Bacteria | 28784 |
| 891 | Ga0496124_0007566 | 3300048927 | Bacteria | 11521 |
| 892 | Ga0496124_0100937 | 3300048927 | Bacteria | 2338 |
| 893 | Ga0496124_0137125 | 3300048927 | Bacteria | 1936 |
| 894 | Ga0496124_0163019 | 3300048927 | Bacteria | 1736 |
| 895 | Ga0496124_0173368 | 3300048927 | Bacteria | 1668 |
| 896 | Ga0496124_0183784 | 3300048927 | Bacteria | 1606 |
| 897 | Ga0496125_0012824 | 3300048928 | Bacteria | 8283 |
| 898 | Ga0496125_0028905 | 3300048928 | Bacteria | 4993 |
| 899 | Ga0496125_0034333 | 3300048928 | Bacteria | 4473 |
| 900 | Ga0496125_0038831 | 3300048928 | Bacteria | 4111 |
| 901 | Ga0496125_0110409 | 3300048928 | Bacteria | 1994 |
| 902 | Ga0496125_0127047 | 3300048928 | Bacteria | 1804 |
| 903 | Ga0496125_0161986 | 3300048928 | Bacteria | 1518 |
| 904 | Ga0496125_0273739 | 3300048928 | Bacteria | 1050 |
| 905 | Ga0496126_0003590 | 3300048929 | Bacteria | 19439 |
| 906 | Ga0496126_0004961 | 3300048929 | Bacteria | 15521 |
| 907 | Ga0496126_0008744 | 3300048929 | Bacteria | 10873 |
| 908 | Ga0496126_0014351 | 3300048929 | Bacteria | 8012 |
| 909 | Ga0496126_0021577 | 3300048929 | Bacteria | 6288 |
| 910 | Ga0496126_0048825 | 3300048929 | Bacteria | 3865 |
| 911 | Ga0496126_0073740 | 3300048929 | Bacteria | 3033 |
| 912 | Ga0496126_0128019 | 3300048929 | Bacteria | 2196 |
| 913 | Ga0496126_0136250 | 3300048929 | Bacteria | 2118 |
| 914 | Ga0496126_0151272 | 3300048929 | Bacteria | 1989 |
| 915 | Ga0496126_0189831 | 3300048929 | Bacteria | 1741 |
| 916 | Ga0496126_0305040 | 3300048929 | Bacteria | 1312 |
| 917 | Ga0496126_0431099 | 3300048929 | Unclassified | 1064 |
| 918 | Ga0496126_0540897 | 3300048929 | Bacteria | 926 |
| 919 | Ga0501032_0120620 | 3300049569 | Bacteria | 1733 |
| 920 | Ga0501032_0127848 | 3300049569 | Bacteria | 1678 |
| 921 | Ga0501034_0081269 | 3300049571 | Bacteria | 3243 |
| 922 | Ga0501038_0162296 | 3300049574 | Bacteria | 1815 |
| 923 | Ga0501043_0015152 | 3300049579 | Bacteria | 6035 |
| 924 | Ga0501046_0276539 | 3300049580 | Bacteria | 1231 |
| 925 | Ga0501047_0069695 | 3300049581 | Bacteria | 3386 |
| 926 | Ga0501047_0187189 | 3300049581 | Bacteria | 1935 |
| 927 | Ga0501070_0002569 | 3300049586 | Bacteria | 15889 |
| 928 | Ga0501072_0592059 | 3300049588 | Unclassified | 875 |
| 929 | Ga0501073_0099041 | 3300049589 | Bacteria | 2024 |
| 930 | Ga0501079_0447739 | 3300049741 | Bacteria | 1014 |
| 931 | Ga0501080_0051457 | 3300049742 | Bacteria | 3832 |
| 932 | Ga0501035_0241920 | 3300049822 | Bacteria | 1535 |
| 933 | Ga0501044_0058692 | 3300049823 | Bacteria | 3945 |
| 934 | Ga0501044_0099517 | 3300049823 | Bacteria | 2926 |
| 935 | nmdc:mga03n38_12701_c1 | 3300050490 | Bacteria | 3178 |
| 936 | nmdc:mga03n38_233572_c1 | 3300050490 | Bacteria | 965 |
| 937 | nmdc:mga0yw44_119137_c1 | 3300050492 | Bacteria | 1699 |
| 938 | nmdc:mga0yw44_353071_c1 | 3300050492 | Bacteria | 990 |
| 939 | nmdc:mga0yw44_53556_c1 | 3300050492 | Bacteria | 2451 |
| 940 | nmdc:mga0k408_226252_c1 | 3300050493 | Bacteria | 1117 |
| 941 | nmdc:mga0k408_56476_c1 | 3300050493 | Bacteria | 2278 |
| 942 | nmdc:mga06z11_212317_c1 | 3300050494 | Bacteria | 1128 |
| 943 | nmdc:mga06z11_372899_c1 | 3300050494 | Bacteria | 857 |
| 944 | nmdc:mga04h51_43115_c1 | 3300050495 | Bacteria | 1483 |
| 945 | nmdc:mga04h51_44777_c1 | 3300050495 | Bacteria | 1461 |
| 946 | nmdc:mga07m45_11320_c1 | 3300050496 | Bacteria | 4684 |
| 947 | nmdc:mga07m45_167480_c2 | 3300050496 | Bacteria | 920 |
| 948 | nmdc:mga07m45_26783_c1 | 3300050496 | Bacteria | 3170 |
| 949 | nmdc:mga0rr50_125135_c1 | 3300050513 | Bacteria | 2051 |
| 950 | nmdc:mga0sz30_101728_c1 | 3300050516 | Bacteria | 1256 |
| 951 | nmdc:mga0sz30_103299_c2 | 3300050516 | Bacteria | 892 |
| 952 | nmdc:mga0sz30_7774_c1 | 3300050516 | Bacteria | 4029 |
| 953 | Ga0495601_0007329 | 3300053077 | Bacteria | 6466 |
| 954 | Ga0495601_0015690 | 3300053077 | Bacteria | 4580 |
| 955 | Ga0495601_0151677 | 3300053077 | Bacteria | 1513 |
| 956 | Ga0500610_0098594 | 3300053079 | Bacteria | 1514 |
| 957 | Ga0500635_0003164 | 3300053080 | Bacteria | 4115 |
| 958 | Ga0500635_0006838 | 3300053080 | Bacteria | 3064 |
| 959 | Ga0495655_0070491 | 3300053083 | Bacteria | 976 |
| 960 | Ga0495595_0000335 | 3300053084 | Bacteria | 18133 |
| 961 | Ga0495619_0001292 | 3300053085 | Bacteria | 16456 |
| 962 | Ga0495619_0086548 | 3300053085 | Bacteria | 2118 |
| 963 | Ga0495619_0317149 | 3300053085 | Bacteria | 1079 |
| 964 | Ga0500578_0296575 | 3300053086 | Bacteria | 960 |
| 965 | Ga0500643_000085 | 3300053087 | Bacteria | 98026 |
| 966 | Ga0500647_0048749 | 3300053091 | Bacteria | 2036 |
| 967 | Ga0500583_0057464 | 3300053092 | Bacteria | 1827 |
| 968 | Ga0500651_0000753 | 3300053093 | Bacteria | 15823 |
| 969 | Ga0500651_0019704 | 3300053093 | Bacteria | 4195 |
| 970 | Ga0500651_0092317 | 3300053093 | Bacteria | 1863 |
| 971 | Ga0500651_0157314 | 3300053093 | Bacteria | 1361 |
| 972 | Ga0500566_0040638 | 3300053094 | Bacteria | 2688 |
| 973 | Ga0500566_0104821 | 3300053094 | Bacteria | 1545 |
| 974 | Ga0500566_0152408 | 3300053094 | Bacteria | 1214 |
| 975 | Ga0500641_0006151 | 3300053096 | Bacteria | 4255 |
| 976 | Ga0500641_0026829 | 3300053096 | Bacteria | 2239 |
| 977 | Ga0500650_0052623 | 3300053098 | Bacteria | 1893 |
| 978 | Ga0500554_036547 | 3300053102 | Bacteria | 1484 |
| 979 | Ga0500555_001913 | 3300053103 | Bacteria | 6179 |
| 980 | Ga0500557_000002 | 3300053105 | Bacteria | 234207 |
| 981 | Ga0500557_000352 | 3300053105 | Bacteria | 6021 |
| 982 | Ga0500562_013305 | 3300053108 | Bacteria | 2100 |
| 983 | Ga0500569_001325 | 3300053109 | Bacteria | 4633 |
| 984 | Ga0500569_080513 | 3300053109 | Bacteria | 1041 |
| 985 | Ga0500572_000025 | 3300053111 | Bacteria | 45953 |
| 986 | Ga0500572_005987 | 3300053111 | Bacteria | 2772 |
| 987 | Ga0500594_0000727 | 3300053118 | Bacteria | 7004 |
| 988 | Ga0500595_000468 | 3300053119 | Bacteria | 24982 |
| 989 | Ga0500595_003984 | 3300053119 | Bacteria | 6749 |
| 990 | Ga0500595_011510 | 3300053119 | Bacteria | 3460 |
| 991 | Ga0500595_031540 | 3300053119 | Bacteria | 1777 |
| 992 | Ga0500595_055296 | 3300053119 | Bacteria | 1216 |
| 993 | Ga0500621_113381 | 3300053126 | Bacteria | 1057 |
| 994 | Ga0500642_0000144 | 3300053130 | Bacteria | 31539 |
| 995 | Ga0500642_0018643 | 3300053130 | Bacteria | 2689 |
| 996 | Ga0500642_0051893 | 3300053130 | Bacteria | 1814 |
| 997 | Ga0500658_0004773 | 3300053134 | Bacteria | 5050 |
| 998 | Ga0500658_0051682 | 3300053134 | Bacteria | 1681 |
| 999 | Ga0500559_0000289 | 3300053136 | Bacteria | 38837 |
| 1000 | Ga0500559_0005421 | 3300053136 | Bacteria | 5871 |
| 1001 | Ga0500559_0083158 | 3300053136 | Bacteria | 1458 |
| 1002 | Ga0500568_0001209 | 3300053139 | Bacteria | 17208 |
| 1003 | Ga0500568_0003017 | 3300053139 | Bacteria | 9628 |
| 1004 | Ga0500577_0080777 | 3300053142 | Bacteria | 1296 |
| 1005 | Ga0500590_031643 | 3300053148 | Bacteria | 2743 |
| 1006 | Ga0500604_0007881 | 3300053151 | Bacteria | 2824 |
| 1007 | Ga0500616_0073262 | 3300053153 | Bacteria | 1739 |
| 1008 | Ga0500620_001333 | 3300053155 | Bacteria | 4489 |
| 1009 | Ga0500622_0016487 | 3300053156 | Bacteria | 3947 |
| 1010 | Ga0500622_0161119 | 3300053156 | Bacteria | 1052 |
| 1011 | Ga0500633_0000136 | 3300053160 | Bacteria | 9700 |
| 1012 | Ga0500638_002107 | 3300053162 | Bacteria | 6750 |
| 1013 | Ga0500638_048019 | 3300053162 | Bacteria | 2065 |
| 1014 | Ga0500639_113107 | 3300053163 | Bacteria | 1317 |
| 1015 | Ga0500636_0000356 | 3300053177 | Bacteria | 25066 |
| 1016 | Ga0500636_0029443 | 3300053177 | Bacteria | 3244 |
| 1017 | Ga0500637_0000546 | 3300053178 | Bacteria | 14728 |
| 1018 | Ga0500576_066515 | 3300053725 | Bacteria | 1561 |
| 1019 | Ga0500625_005076 | 3300053729 | Bacteria | 5460 |
| 1020 | Ga0500645_025229 | 3300053730 | Bacteria | 1814 |
| 1021 | Ga0500609_001507 | 3300053731 | Bacteria | 3407 |
| 1022 | Ga0500609_015690 | 3300053731 | Bacteria | 1027 |
| 1023 | Ga0500596_001272 | 3300053735 | Bacteria | 5098 |
| 1024 | Ga0500601_000107 | 3300053737 | Bacteria | 17235 |
| 1025 | Ga0500601_009479 | 3300053737 | Bacteria | 1086 |
| 1026 | Ga0500661_000782 | 3300055283 | Bacteria | 5933 |
| 1027 | Ga0500661_004482 | 3300055283 | Bacteria | 2613 |
| 1028 | Ga0501082_0215851 | 3300060353 | Bacteria | 1669 |
| 1029 | Ga0466962_0021100 | 3300061719 | Bacteria | 3128 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046524 | Ga0495648_0056234 | Ga0495648_0056234_1625_2356 | 207 |
| 2 | 3300033180 | Ga0307510_10000008 | Ga0307510_10000008248 | 209 |
| 3 | 3300048929 | Ga0496126_0540897 | Ga0496126_0540897_194_910 | 228 |
| 4 | 3300044842 | Ga0466957_0586456 | Ga0466957_0586456_21_746 | 232 |
| 5 | 3300046511 | Ga0495608_0467078 | Ga0495608_0467078_27_743 | 233 |
| 6 | 3300047320 | Ga0495672_0001907 | Ga0495672_0001907_6922_7728 | 241 |
| 7 | 3300035086 | Ga0373934_0118110 | Ga0373934_0118110_25_759 | 244 |
| 8 | 3300046674 | Ga0495588_0279413 | Ga0495588_0279413_14_748 | 244 |
| 9 | 3300003320 | rootH2_10112393 | rootH2_101123932 | 245 |
| 10 | 3300003322 | rootL2_10313393 | rootL2_103133932 | 245 |
| 11 | 3300005289 | Ga0065704_10144922 | Ga0065704_101449221 | 245 |
| 12 | 3300005295 | Ga0065707_10082478 | Ga0065707_1008247813 | 245 |
| 13 | 3300025253 | Ga0209677_100210 | Ga0209677_10021027 | 245 |
| 14 | 3300039447 | Ga0436361_0260510 | Ga0436361_0260510_220_996 | 247 |
| 15 | iso_pu_bacteria | 2876377896 | 2876382896 | 247 |
| 16 | iso_pu_bacteria | 2938014810 | 2938021114 | 247 |
| 17 | 3300026075 | Ga0207708_10096030 | Ga0207708_100960302 | 250 |
| 18 | 3300026118 | Ga0207675_100053975 | Ga0207675_1000539752 | 250 |
| 19 | 3300037853 | Ga0436364_0804269 | Ga0436364_0804269_1901_2686 | 250 |
| 20 | 3300039450 | Ga0436363_0090351 | Ga0436363_0090351_2092_2877 | 250 |
| 21 | 3300039453 | Ga0436362_0224975 | Ga0436362_0224975_110_895 | 250 |
| 22 | 3300053096 | Ga0500641_0006151 | Ga0500641_0006151_2366_3157 | 250 |
| 23 | 3300014968 | Ga0157379_10450242 | Ga0157379_104502421 | 251 |
| 24 | 3300046660 | Ga0495625_0270253 | Ga0495625_0270253_47_838 | 251 |
| 25 | 3300053086 | Ga0500578_0296575 | Ga0500578_0296575_62_853 | 251 |
| 26 | 3300053109 | Ga0500569_080513 | Ga0500569_080513_60_851 | 251 |
| 27 | 3300053119 | Ga0500595_011510 | Ga0500595_011510_678_1469 | 251 |
| 28 | 3300048915 | Ga0496112_0839479 | Ga0496112_0839479_56_826 | 253 |
| 29 | 3300025981 | Ga0207640_10154765 | Ga0207640_101547652 | 254 |
| 30 | 3300005327 | Ga0070658_10071500 | Ga0070658_100715003 | 255 |
| 31 | 3300005329 | Ga0070683_100020118 | Ga0070683_1000201183 | 255 |
| 32 | 3300005330 | Ga0070690_100266135 | Ga0070690_1002661352 | 255 |
| 33 | 3300005335 | Ga0070666_10263828 | Ga0070666_102638282 | 255 |
| 34 | 3300005338 | Ga0068868_100140150 | Ga0068868_1001401502 | 255 |
| 35 | 3300005343 | Ga0070687_100375586 | Ga0070687_1003755861 | 255 |
| 36 | 3300005353 | Ga0070669_100103043 | Ga0070669_1001030432 | 255 |
| 37 | 3300005366 | Ga0070659_100090102 | Ga0070659_1000901022 | 255 |
| 38 | 3300005455 | Ga0070663_100020229 | Ga0070663_1000202292 | 255 |
| 39 | 3300005455 | Ga0070663_100428270 | Ga0070663_1004282701 | 255 |
| 40 | 3300005456 | Ga0070678_100145554 | Ga0070678_1001455541 | 255 |
| 41 | 3300005457 | Ga0070662_100268977 | Ga0070662_1002689771 | 255 |
| 42 | 3300005535 | Ga0070684_100032764 | Ga0070684_1000327645 | 255 |
| 43 | 3300005543 | Ga0070672_100433070 | Ga0070672_1004330701 | 255 |
| 44 | 3300005544 | Ga0070686_100165764 | Ga0070686_1001657642 | 255 |
| 45 | 3300005548 | Ga0070665_100003933 | Ga0070665_10000393312 | 255 |
| 46 | 3300005548 | Ga0070665_100043093 | Ga0070665_1000430932 | 255 |
| 47 | 3300005563 | Ga0068855_100048758 | Ga0068855_1000487585 | 255 |
| 48 | 3300005564 | Ga0070664_100010213 | Ga0070664_1000102137 | 255 |
| 49 | 3300005564 | Ga0070664_100180166 | Ga0070664_1001801661 | 255 |
| 50 | 3300005577 | Ga0068857_100409039 | Ga0068857_1004090392 | 255 |
| 51 | 3300005614 | Ga0068856_100070384 | Ga0068856_1000703843 | 255 |
| 52 | 3300005614 | Ga0068856_100243192 | Ga0068856_1002431922 | 255 |
| 53 | 3300005615 | Ga0070702_100254722 | Ga0070702_1002547222 | 255 |
| 54 | 3300005616 | Ga0068852_100048001 | Ga0068852_1000480012 | 255 |
| 55 | 3300005616 | Ga0068852_100231216 | Ga0068852_1002312162 | 255 |
| 56 | 3300005617 | Ga0068859_100094400 | Ga0068859_1000944002 | 255 |
| 57 | 3300005840 | Ga0068870_10188569 | Ga0068870_101885692 | 255 |
| 58 | 3300005841 | Ga0068863_100077859 | Ga0068863_1000778592 | 255 |
| 59 | 3300005842 | Ga0068858_100023425 | Ga0068858_1000234251 | 255 |
| 60 | 3300005843 | Ga0068860_100111996 | Ga0068860_1001119962 | 255 |
| 61 | 3300006038 | Ga0075365_10103860 | Ga0075365_101038602 | 255 |
| 62 | 3300006038 | Ga0075365_10133070 | Ga0075365_101330701 | 255 |
| 63 | 3300006042 | Ga0075368_10002535 | Ga0075368_100025356 | 255 |
| 64 | 3300006048 | Ga0075363_100040213 | Ga0075363_1000402132 | 255 |
| 65 | 3300006048 | Ga0075363_100042632 | Ga0075363_1000426322 | 255 |
| 66 | 3300006051 | Ga0075364_10135769 | Ga0075364_101357692 | 255 |
| 67 | 3300006178 | Ga0075367_10053799 | Ga0075367_100537992 | 255 |
| 68 | 3300006178 | Ga0075367_10265229 | Ga0075367_102652292 | 255 |
| 69 | 3300006186 | Ga0075369_10070150 | Ga0075369_100701502 | 255 |
| 70 | 3300006237 | Ga0097621_100080313 | Ga0097621_1000803132 | 255 |
| 71 | 3300006353 | Ga0075370_10008627 | Ga0075370_100086276 | 255 |
| 72 | 3300006358 | Ga0068871_100095172 | Ga0068871_1000951722 | 255 |
| 73 | 3300006931 | Ga0097620_100094399 | Ga0097620_1000943992 | 255 |
| 74 | 3300009093 | Ga0105240_10686223 | Ga0105240_106862232 | 255 |
| 75 | 3300009094 | Ga0111539_10545712 | Ga0111539_105457122 | 255 |
| 76 | 3300009098 | Ga0105245_10079955 | Ga0105245_100799552 | 255 |
| 77 | 3300009174 | Ga0105241_10113348 | Ga0105241_101133482 | 255 |
| 78 | 3300009174 | Ga0105241_10281298 | Ga0105241_102812982 | 255 |
| 79 | 3300009177 | Ga0105248_10046037 | Ga0105248_100460373 | 255 |
| 80 | 3300009545 | Ga0105237_10100512 | Ga0105237_101005122 | 255 |
| 81 | 3300009545 | Ga0105237_10444566 | Ga0105237_104445662 | 255 |
| 82 | 3300009551 | Ga0105238_10135833 | Ga0105238_101358332 | 255 |
| 83 | 3300010375 | Ga0105239_10183118 | Ga0105239_101831182 | 255 |
| 84 | 3300010375 | Ga0105239_10446995 | Ga0105239_104469952 | 255 |
| 85 | 3300011119 | Ga0105246_10055406 | Ga0105246_100554062 | 255 |
| 86 | 3300013105 | Ga0157369_10016093 | Ga0157369_100160932 | 255 |
| 87 | 3300013297 | Ga0157378_10075165 | Ga0157378_100751653 | 255 |
| 88 | 3300013307 | Ga0157372_10743048 | Ga0157372_107430481 | 255 |
| 89 | 3300013308 | Ga0157375_10216272 | Ga0157375_102162722 | 255 |
| 90 | 3300014325 | Ga0163163_10576374 | Ga0163163_105763742 | 255 |
| 91 | 3300014968 | Ga0157379_10263569 | Ga0157379_102635692 | 255 |
| 92 | 3300025900 | Ga0207710_10137027 | Ga0207710_101370272 | 255 |
| 93 | 3300025901 | Ga0207688_10024216 | Ga0207688_100242162 | 255 |
| 94 | 3300025908 | Ga0207643_10115699 | Ga0207643_101156992 | 255 |
| 95 | 3300025909 | Ga0207705_10599324 | Ga0207705_105993241 | 255 |
| 96 | 3300025913 | Ga0207695_10765357 | Ga0207695_107653571 | 255 |
| 97 | 3300025914 | Ga0207671_10146469 | Ga0207671_101464692 | 255 |
| 98 | 3300025918 | Ga0207662_10073290 | Ga0207662_100732902 | 255 |
| 99 | 3300025920 | Ga0207649_10431590 | Ga0207649_104315901 | 255 |
| 100 | 3300025924 | Ga0207694_10649961 | Ga0207694_106499611 | 255 |
| 101 | 3300025927 | Ga0207687_10047348 | Ga0207687_100473481 | 255 |
| 102 | 3300025933 | Ga0207706_10258745 | Ga0207706_102587452 | 255 |
| 103 | 3300025940 | Ga0207691_10499021 | Ga0207691_104990211 | 255 |
| 104 | 3300025941 | Ga0207711_10116854 | Ga0207711_101168542 | 255 |
| 105 | 3300025944 | Ga0207661_10038687 | Ga0207661_100386874 | 255 |
| 106 | 3300025945 | Ga0207679_10047242 | Ga0207679_100472423 | 255 |
| 107 | 3300025949 | Ga0207667_10015015 | Ga0207667_100150153 | 255 |
| 108 | 3300026067 | Ga0207678_10060449 | Ga0207678_100604492 | 255 |
| 109 | 3300026067 | Ga0207678_10263661 | Ga0207678_102636612 | 255 |
| 110 | 3300026078 | Ga0207702_10063047 | Ga0207702_100630472 | 255 |
| 111 | 3300026088 | Ga0207641_10159592 | Ga0207641_101595921 | 255 |
| 112 | 3300026121 | Ga0207683_10055468 | Ga0207683_100554684 | 255 |
| 113 | 3300026121 | Ga0207683_10263975 | Ga0207683_102639752 | 255 |
| 114 | 3300026142 | Ga0207698_10021492 | Ga0207698_100214925 | 255 |
| 115 | 3300028379 | Ga0268266_10016992 | Ga0268266_100169928 | 255 |
| 116 | 3300031507 | Ga0307509_10031638 | Ga0307509_100316383 | 255 |
| 117 | 3300033180 | Ga0307510_10009746 | Ga0307510_100097466 | 255 |
| 118 | 3300046455 | Ga0495603_0022020 | Ga0495603_0022020_1571_2362 | 255 |
| 119 | 3300046460 | Ga0495638_0232269 | Ga0495638_0232269_83_874 | 255 |
| 120 | 3300046461 | Ga0495641_0061969 | Ga0495641_0061969_875_1666 | 255 |
| 121 | 3300046473 | Ga0495582_0115614 | Ga0495582_0115614_500_1291 | 255 |
| 122 | 3300046499 | Ga0495594_0137048 | Ga0495594_0137048_141_932 | 255 |
| 123 | 3300046557 | Ga0495622_0005946 | Ga0495622_0005946_3356_4147 | 255 |
| 124 | 3300046615 | Ga0495656_0141873 | Ga0495656_0141873_151_942 | 255 |
| 125 | 3300048903 | Ga0496100_0447978 | Ga0496100_0447978_156_947 | 255 |
| 126 | 3300048909 | Ga0496106_0284363 | Ga0496106_0284363_373_1164 | 255 |
| 127 | 3300048911 | Ga0496108_0191933 | Ga0496108_0191933_521_1312 | 255 |
| 128 | 3300048912 | Ga0496109_0101853 | Ga0496109_0101853_74_865 | 255 |
| 129 | 3300048914 | Ga0496111_0123312 | Ga0496111_0123312_481_1272 | 255 |
| 130 | 3300048915 | Ga0496112_0016391 | Ga0496112_0016391_3442_4233 | 255 |
| 131 | 3300048918 | Ga0496115_0406274 | Ga0496115_0406274_181_972 | 255 |
| 132 | 3300048921 | Ga0496118_0130139 | Ga0496118_0130139_338_1129 | 255 |
| 133 | 3300048924 | Ga0496121_0122978 | Ga0496121_0122978_571_1362 | 255 |
| 134 | 3300048927 | Ga0496124_0173368 | Ga0496124_0173368_473_1264 | 255 |
| 135 | 3300048929 | Ga0496126_0305040 | Ga0496126_0305040_14_805 | 255 |
| 136 | 3300050490 | nmdc:mga03n38_12701_c1 | nmdc:mga03n38_12701_c1_2202_2993 | 255 |
| 137 | 3300050492 | nmdc:mga0yw44_53556_c1 | nmdc:mga0yw44_53556_c1_752_1543 | 255 |
| 138 | 3300050494 | nmdc:mga06z11_372899_c1 | nmdc:mga06z11_372899_c1_39_830 | 255 |
| 139 | 3300050496 | nmdc:mga07m45_11320_c1 | nmdc:mga07m45_11320_c1_3846_4637 | 255 |
| 140 | 3300050513 | nmdc:mga0rr50_125135_c1 | nmdc:mga0rr50_125135_c1_1235_2026 | 255 |
| 141 | 3300050516 | nmdc:mga0sz30_103299_c2 | nmdc:mga0sz30_103299_c2_32_823 | 255 |
| 142 | iso_pu_bacteria | 8016539877 | 8016548407 | 255 |
| 143 | 3300005616 | Ga0068852_100501362 | Ga0068852_1005013622 | 256 |
| 144 | 3300006914 | Ga0075436_100410776 | Ga0075436_1004107761 | 256 |
| 145 | 3300025914 | Ga0207671_10391325 | Ga0207671_103913251 | 256 |
| 146 | 3300037312 | Ga0395899_0029757 | Ga0395899_0029757_2037_2828 | 256 |
| 147 | 3300037418 | Ga0395900_0061053 | Ga0395900_0061053_2641_3432 | 256 |
| 148 | 3300038443 | Ga0395901_0086648 | Ga0395901_0086648_1749_2540 | 256 |
| 149 | 3300038443 | Ga0395901_0121988 | Ga0395901_0121988_1548_2339 | 256 |
| 150 | 3300044694 | Ga0466963_0121949 | Ga0466963_0121949_593_1390 | 256 |
| 151 | 3300046523 | Ga0495644_0055108 | Ga0495644_0055108_404_1195 | 256 |
| 152 | 3300053731 | Ga0500609_015690 | Ga0500609_015690_146_937 | 256 |
| 153 | iso_pu_bacteria | 2856287931 | 2856289083 | 256 |
| 154 | iso_pu_bacteria | 2857357740 | 2857358631 | 256 |
| 155 | 3300025261 | Ga0209233_1021026 | Ga0209233_10210262 | 258 |
| 156 | 3300031711 | Ga0265314_10169495 | Ga0265314_101694951 | 258 |
| 157 | 3300046794 | Ga0495589_0008061 | Ga0495589_0008061_1179_1985 | 258 |
| 158 | 3300047472 | Ga0495686_0000002 | Ga0495686_0000002_82311_83117 | 258 |
| 159 | 3300047472 | Ga0495686_0000075 | Ga0495686_0000075_115581_116387 | 258 |
| 160 | iso_pu_bacteria | 2582581299 | 2585233597 | 258 |
| 161 | iso_pu_bacteria | 2643221599 | 2644006933 | 258 |
| 162 | iso_pu_bacteria | 2904699407 | 2904701401 | 258 |
| 163 | iso_pu_bacteria | 8024486573 | 8024487170 | 258 |
| 164 | iso_pu_bacteria | 2513237096 | 2513659356 | 259 |
| 165 | iso_pu_bacteria | 2513237098 | 2513672838 | 259 |
| 166 | iso_pu_bacteria | 2513237137 | 2513861723 | 259 |
| 167 | iso_pu_bacteria | 2513237145 | 2513921382 | 259 |
| 168 | iso_pu_bacteria | 2517572143 | 2517893700 | 259 |
| 169 | iso_pu_bacteria | 2524023210 | 2524469937 | 259 |
| 170 | iso_pu_bacteria | 2524023228 | 2524535899 | 259 |
| 171 | iso_pu_bacteria | 2728368998 | 2728752842 | 259 |
| 172 | iso_pu_bacteria | 2885383462 | 2885389616 | 259 |
| 173 | iso_pu_bacteria | 2903768456 | 2903774321 | 259 |
| 174 | iso_pu_bacteria | 2906635258 | 2906641896 | 259 |
| 175 | iso_pu_bacteria | 2906660503 | 2906666087 | 259 |
| 176 | iso_pu_bacteria | 3005474847 | 3005478884 | 259 |
| 177 | iso_pu_bacteria | 8056681323 | 8056687757 | 259 |
| 178 | 3300025315 | Ga0207697_10081335 | Ga0207697_100813352 | 260 |
| 179 | 3300028800 | Ga0265338_10000159 | Ga0265338_1000015934 | 260 |
| 180 | 3300031238 | Ga0265332_10061935 | Ga0265332_100619352 | 260 |
| 181 | 3300031247 | Ga0265340_10098838 | Ga0265340_100988382 | 260 |
| 182 | 3300039437 | Ga0436365_0116034 | Ga0436365_0116034_2881_3666 | 260 |
| 183 | 3300002773 | JGI25152J39213_1000083 | JGI25152J39213_100008326 | 261 |
| 184 | 3300002774 | JGI25150J39212_1000060 | JGI25150J39212_100006026 | 261 |
| 185 | 3300003187 | JGI25151J46595_10000239 | JGI25151J46595_1000023938 | 261 |
| 186 | 3300003215 | JGI25153J46596_10000578 | JGI25153J46596_100005789 | 261 |
| 187 | 3300025245 | Ga0207425_1000137 | Ga0207425_100013741 | 261 |
| 188 | 3300025258 | Ga0209129_1000098 | Ga0209129_100009841 | 261 |
| 189 | 3300025273 | Ga0209673_1030369 | Ga0209673_10303692 | 261 |
| 190 | 3300025294 | Ga0209025_1000142 | Ga0209025_100014236 | 261 |
| 191 | 3300025297 | Ga0209758_1000488 | Ga0209758_100048841 | 261 |
| 192 | 3300037466 | Ga0395898_0012584 | Ga0395898_0012584_7744_8529 | 261 |
| 193 | 3300038443 | Ga0395901_0007409 | Ga0395901_0007409_4841_5626 | 261 |
| 194 | 3300039447 | Ga0436361_0901521 | Ga0436361_0901521_3241_4044 | 261 |
| 195 | 3300048919 | Ga0496116_0000554 | Ga0496116_0000554_13294_14085 | 261 |
| 196 | 3300048919 | Ga0496116_0007216 | Ga0496116_0007216_996_1787 | 261 |
| 197 | 3300048919 | Ga0496116_0062552 | Ga0496116_0062552_814_1602 | 261 |
| 198 | 3300048920 | Ga0496117_0160292 | Ga0496117_0160292_211_1002 | 261 |
| 199 | 3300048921 | Ga0496118_0024568 | Ga0496118_0024568_1940_2731 | 261 |
| 200 | 3300048924 | Ga0496121_0000516 | Ga0496121_0000516_47048_47839 | 261 |
| 201 | 3300048924 | Ga0496121_0005737 | Ga0496121_0005737_4063_4851 | 261 |
| 202 | 3300048924 | Ga0496121_0152296 | Ga0496121_0152296_487_1275 | 261 |
| 203 | 3300048924 | Ga0496121_0215158 | Ga0496121_0215158_338_1129 | 261 |
| 204 | 3300048925 | Ga0496122_0003971 | Ga0496122_0003971_16766_17557 | 261 |
| 205 | 3300048925 | Ga0496122_0007384 | Ga0496122_0007384_10905_11693 | 261 |
| 206 | 3300048926 | Ga0496123_0003013 | Ga0496123_0003013_5901_6692 | 261 |
| 207 | 3300048927 | Ga0496124_0001503 | Ga0496124_0001503_8366_9157 | 261 |
| 208 | 3300048927 | Ga0496124_0001892 | Ga0496124_0001892_22592_23383 | 261 |
| 209 | 3300048927 | Ga0496124_0007566 | Ga0496124_0007566_8010_8798 | 261 |
| 210 | 3300048928 | Ga0496125_0012824 | Ga0496125_0012824_567_1358 | 261 |
| 211 | 3300048929 | Ga0496126_0431099 | Ga0496126_0431099_194_985 | 261 |
| 212 | iso_pu_bacteria | 8005484373 | 8005486874 | 261 |
| 213 | 3300003316 | rootH1_10026922 | rootH1_100269228 | 262 |
| 214 | 3300005327 | Ga0070658_10002866 | Ga0070658_100028666 | 262 |
| 215 | 3300005366 | Ga0070659_100051286 | Ga0070659_1000512862 | 262 |
| 216 | 3300005548 | Ga0070665_100418637 | Ga0070665_1004186372 | 262 |
| 217 | 3300005563 | Ga0068855_100037055 | Ga0068855_1000370552 | 262 |
| 218 | 3300009093 | Ga0105240_10074563 | Ga0105240_100745634 | 262 |
| 219 | 3300009093 | Ga0105240_10175405 | Ga0105240_101754052 | 262 |
| 220 | 3300009174 | Ga0105241_10135040 | Ga0105241_101350402 | 262 |
| 221 | 3300009545 | Ga0105237_10077266 | Ga0105237_100772662 | 262 |
| 222 | 3300013104 | Ga0157370_10016923 | Ga0157370_100169238 | 262 |
| 223 | 3300013104 | Ga0157370_10242888 | Ga0157370_102428882 | 262 |
| 224 | 3300013105 | Ga0157369_10000362 | Ga0157369_1000036210 | 262 |
| 225 | 3300021377 | Ga0213874_10013739 | Ga0213874_100137391 | 262 |
| 226 | 3300025909 | Ga0207705_10000352 | Ga0207705_1000035230 | 262 |
| 227 | 3300025911 | Ga0207654_10111618 | Ga0207654_101116182 | 262 |
| 228 | 3300025913 | Ga0207695_10118597 | Ga0207695_101185971 | 262 |
| 229 | 3300025914 | Ga0207671_10227943 | Ga0207671_102279432 | 262 |
| 230 | 3300025949 | Ga0207667_10002243 | Ga0207667_100022436 | 262 |
| 231 | 3300028379 | Ga0268266_10131123 | Ga0268266_101311232 | 262 |
| 232 | 3300031712 | Ga0265342_10010007 | Ga0265342_100100076 | 262 |
| 233 | 3300037312 | Ga0395899_0160377 | Ga0395899_0160377_594_1382 | 262 |
| 234 | 3300038443 | Ga0395901_0000017 | Ga0395901_0000017_136313_137101 | 262 |
| 235 | 3300038443 | Ga0395901_0002433 | Ga0395901_0002433_940_1731 | 262 |
| 236 | 3300039450 | Ga0436363_1223179 | Ga0436363_1223179_1423_2241 | 262 |
| 237 | 3300044656 | Ga0466969_0000523 | Ga0466969_0000523_4778_5566 | 262 |
| 238 | 3300044659 | Ga0466973_0019878 | Ga0466973_0019878_118_906 | 262 |
| 239 | 3300044693 | Ga0466961_0015547 | Ga0466961_0015547_1325_2113 | 262 |
| 240 | 3300044694 | Ga0466963_0001202 | Ga0466963_0001202_111_899 | 262 |
| 241 | 3300044706 | Ga0466964_0066669 | Ga0466964_0066669_245_1078 | 262 |
| 242 | 3300044765 | Ga0466970_0000982 | Ga0466970_0000982_6719_7507 | 262 |
| 243 | 3300044842 | Ga0466957_0003670 | Ga0466957_0003670_5453_6241 | 262 |
| 244 | 3300045049 | Ga0466959_0014159 | Ga0466959_0014159_4280_5068 | 262 |
| 245 | 3300045836 | Ga0466958_0007577 | Ga0466958_0007577_2556_3344 | 262 |
| 246 | 3300045836 | Ga0466958_0092199 | Ga0466958_0092199_469_1257 | 262 |
| 247 | 3300046474 | Ga0495605_0020982 | Ga0495605_0020982_1075_1866 | 262 |
| 248 | 3300046506 | Ga0495583_0001126 | Ga0495583_0001126_13443_14234 | 262 |
| 249 | 3300046513 | Ga0495616_0048906 | Ga0495616_0048906_1116_1907 | 262 |
| 250 | 3300046518 | Ga0495631_0003452 | Ga0495631_0003452_7508_8299 | 262 |
| 251 | 3300046519 | Ga0495632_0013949 | Ga0495632_0013949_2898_3689 | 262 |
| 252 | 3300046522 | Ga0495643_0125108 | Ga0495643_0125108_45_836 | 262 |
| 253 | 3300046524 | Ga0495648_0130506 | Ga0495648_0130506_94_885 | 262 |
| 254 | 3300046533 | Ga0495640_0143738 | Ga0495640_0143738_481_1272 | 262 |
| 255 | 3300046616 | Ga0495668_0003217 | Ga0495668_0003217_1480_2271 | 262 |
| 256 | 3300046660 | Ga0495625_0001420 | Ga0495625_0001420_20944_21735 | 262 |
| 257 | 3300046810 | Ga0495660_0038341 | Ga0495660_0038341_436_1227 | 262 |
| 258 | 3300047317 | Ga0495604_0015049 | Ga0495604_0015049_330_1121 | 262 |
| 259 | 3300047318 | Ga0495636_0041465 | Ga0495636_0041465_1110_1901 | 262 |
| 260 | 3300048915 | Ga0496112_0000046 | Ga0496112_0000046_65082_65870 | 262 |
| 261 | 3300053105 | Ga0500557_000352 | Ga0500557_000352_4820_5611 | 262 |
| 262 | 3300053109 | Ga0500569_001325 | Ga0500569_001325_1222_2013 | 262 |
| 263 | 3300053118 | Ga0500594_0000727 | Ga0500594_0000727_5820_6611 | 262 |
| 264 | 3300053136 | Ga0500559_0005421 | Ga0500559_0005421_698_1489 | 262 |
| 265 | 3300061719 | Ga0466962_0021100 | Ga0466962_0021100_250_1038 | 262 |
| 266 | 3300002773 | JGI25152J39213_1000150 | JGI25152J39213_100015011 | 263 |
| 267 | 3300002774 | JGI25150J39212_1000115 | JGI25150J39212_100011537 | 263 |
| 268 | 3300003187 | JGI25151J46595_10000391 | JGI25151J46595_1000039111 | 263 |
| 269 | 3300003215 | JGI25153J46596_10004733 | JGI25153J46596_100047335 | 263 |
| 270 | 3300003215 | JGI25153J46596_10007225 | JGI25153J46596_100072254 | 263 |
| 271 | 3300003323 | rootH1_10296570 | rootH1_102965702 | 263 |
| 272 | 3300003659 | JGI25404J52841_10000254 | JGI25404J52841_100002548 | 263 |
| 273 | 3300003659 | JGI25404J52841_10038037 | JGI25404J52841_100380371 | 263 |
| 274 | 3300003760 | Ga0055527_1009821 | Ga0055527_10098212 | 263 |
| 275 | 3300005330 | Ga0070690_100112567 | Ga0070690_1001125672 | 263 |
| 276 | 3300005330 | Ga0070690_100516215 | Ga0070690_1005162151 | 263 |
| 277 | 3300005331 | Ga0070670_100261034 | Ga0070670_1002610342 | 263 |
| 278 | 3300005335 | Ga0070666_10243503 | Ga0070666_102435032 | 263 |
| 279 | 3300005336 | Ga0070680_100340170 | Ga0070680_1003401701 | 263 |
| 280 | 3300005337 | Ga0070682_100337387 | Ga0070682_1003373871 | 263 |
| 281 | 3300005337 | Ga0070682_100340538 | Ga0070682_1003405381 | 263 |
| 282 | 3300005338 | Ga0068868_100006547 | Ga0068868_1000065476 | 263 |
| 283 | 3300005338 | Ga0068868_100203979 | Ga0068868_1002039792 | 263 |
| 284 | 3300005339 | Ga0070660_100014686 | Ga0070660_1000146867 | 263 |
| 285 | 3300005347 | Ga0070668_100069351 | Ga0070668_1000693512 | 263 |
| 286 | 3300005347 | Ga0070668_100749356 | Ga0070668_1007493561 | 263 |
| 287 | 3300005354 | Ga0070675_100784501 | Ga0070675_1007845011 | 263 |
| 288 | 3300005355 | Ga0070671_100077398 | Ga0070671_1000773982 | 263 |
| 289 | 3300005355 | Ga0070671_100301395 | Ga0070671_1003013952 | 263 |
| 290 | 3300005356 | Ga0070674_100063047 | Ga0070674_1000630472 | 263 |
| 291 | 3300005364 | Ga0070673_100058510 | Ga0070673_1000585103 | 263 |
| 292 | 3300005438 | Ga0070701_10123893 | Ga0070701_101238931 | 263 |
| 293 | 3300005455 | Ga0070663_100016240 | Ga0070663_1000162405 | 263 |
| 294 | 3300005455 | Ga0070663_100064231 | Ga0070663_1000642312 | 263 |
| 295 | 3300005456 | Ga0070678_100017610 | Ga0070678_1000176102 | 263 |
| 296 | 3300005456 | Ga0070678_100284076 | Ga0070678_1002840762 | 263 |
| 297 | 3300005466 | Ga0070685_10321644 | Ga0070685_103216442 | 263 |
| 298 | 3300005530 | Ga0070679_100017548 | Ga0070679_1000175482 | 263 |
| 299 | 3300005539 | Ga0068853_100014537 | Ga0068853_1000145373 | 263 |
| 300 | 3300005539 | Ga0068853_100498747 | Ga0068853_1004987472 | 263 |
| 301 | 3300005545 | Ga0070695_100481201 | Ga0070695_1004812011 | 263 |
| 302 | 3300005548 | Ga0070665_100075092 | Ga0070665_1000750923 | 263 |
| 303 | 3300005548 | Ga0070665_100503395 | Ga0070665_1005033952 | 263 |
| 304 | 3300005563 | Ga0068855_100014574 | Ga0068855_1000145745 | 263 |
| 305 | 3300005563 | Ga0068855_100036502 | Ga0068855_1000365027 | 263 |
| 306 | 3300005578 | Ga0068854_100548609 | Ga0068854_1005486092 | 263 |
| 307 | 3300005615 | Ga0070702_100096290 | Ga0070702_1000962901 | 263 |
| 308 | 3300005616 | Ga0068852_100457107 | Ga0068852_1004571072 | 263 |
| 309 | 3300005617 | Ga0068859_100520451 | Ga0068859_1005204512 | 263 |
| 310 | 3300005617 | Ga0068859_100821143 | Ga0068859_1008211431 | 263 |
| 311 | 3300005618 | Ga0068864_100029384 | Ga0068864_1000293843 | 263 |
| 312 | 3300005842 | Ga0068858_100090581 | Ga0068858_1000905812 | 263 |
| 313 | 3300005843 | Ga0068860_100716998 | Ga0068860_1007169982 | 263 |
| 314 | 3300005844 | Ga0068862_100509108 | Ga0068862_1005091081 | 263 |
| 315 | 3300005844 | Ga0068862_100544576 | Ga0068862_1005445762 | 263 |
| 316 | 3300005983 | Ga0081540_1002053 | Ga0081540_100205314 | 263 |
| 317 | 3300005983 | Ga0081540_1003838 | Ga0081540_100383810 | 263 |
| 318 | 3300005983 | Ga0081540_1005208 | Ga0081540_10052083 | 263 |
| 319 | 3300006038 | Ga0075365_10105251 | Ga0075365_101052512 | 263 |
| 320 | 3300006042 | Ga0075368_10063030 | Ga0075368_100630301 | 263 |
| 321 | 3300006048 | Ga0075363_100060540 | Ga0075363_1000605402 | 263 |
| 322 | 3300006237 | Ga0097621_100266519 | Ga0097621_1002665192 | 263 |
| 323 | 3300006358 | Ga0068871_100145790 | Ga0068871_1001457902 | 263 |
| 324 | 3300006881 | Ga0068865_100041409 | Ga0068865_1000414093 | 263 |
| 325 | 3300006931 | Ga0097620_100520466 | Ga0097620_1005204662 | 263 |
| 326 | 3300006931 | Ga0097620_100821154 | Ga0097620_1008211541 | 263 |
| 327 | 3300007265 | Ga0099794_10190411 | Ga0099794_101904112 | 263 |
| 328 | 3300007788 | Ga0099795_10017175 | Ga0099795_100171752 | 263 |
| 329 | 3300009092 | Ga0105250_10079294 | Ga0105250_100792942 | 263 |
| 330 | 3300009093 | Ga0105240_10010947 | Ga0105240_100109479 | 263 |
| 331 | 3300009093 | Ga0105240_10233374 | Ga0105240_102333741 | 263 |
| 332 | 3300009098 | Ga0105245_10051925 | Ga0105245_100519252 | 263 |
| 333 | 3300009101 | Ga0105247_10341169 | Ga0105247_103411691 | 263 |
| 334 | 3300009148 | Ga0105243_10011026 | Ga0105243_100110266 | 263 |
| 335 | 3300009148 | Ga0105243_10239921 | Ga0105243_102399212 | 263 |
| 336 | 3300009174 | Ga0105241_10014111 | Ga0105241_100141114 | 263 |
| 337 | 3300009174 | Ga0105241_10277228 | Ga0105241_102772281 | 263 |
| 338 | 3300009176 | Ga0105242_10048398 | Ga0105242_100483982 | 263 |
| 339 | 3300009176 | Ga0105242_10409824 | Ga0105242_104098241 | 263 |
| 340 | 3300009177 | Ga0105248_10034971 | Ga0105248_100349712 | 263 |
| 341 | 3300009545 | Ga0105237_10005418 | Ga0105237_1000541820 | 263 |
| 342 | 3300009545 | Ga0105237_10126179 | Ga0105237_101261792 | 263 |
| 343 | 3300009551 | Ga0105238_10332376 | Ga0105238_103323761 | 263 |
| 344 | 3300009553 | Ga0105249_10036927 | Ga0105249_100369273 | 263 |
| 345 | 3300010375 | Ga0105239_10002717 | Ga0105239_100027179 | 263 |
| 346 | 3300010375 | Ga0105239_10010954 | Ga0105239_100109548 | 263 |
| 347 | 3300010375 | Ga0105239_10039418 | Ga0105239_100394185 | 263 |
| 348 | 3300011119 | Ga0105246_10020290 | Ga0105246_100202902 | 263 |
| 349 | 3300013100 | Ga0157373_10002345 | Ga0157373_1000234515 | 263 |
| 350 | 3300013104 | Ga0157370_10004573 | Ga0157370_100045739 | 263 |
| 351 | 3300013104 | Ga0157370_10173706 | Ga0157370_101737062 | 263 |
| 352 | 3300013105 | Ga0157369_10004644 | Ga0157369_100046448 | 263 |
| 353 | 3300013296 | Ga0157374_10002490 | Ga0157374_1000249024 | 263 |
| 354 | 3300013297 | Ga0157378_10179724 | Ga0157378_101797242 | 263 |
| 355 | 3300013306 | Ga0163162_10015168 | Ga0163162_100151685 | 263 |
| 356 | 3300013306 | Ga0163162_10101008 | Ga0163162_101010083 | 263 |
| 357 | 3300013307 | Ga0157372_10002285 | Ga0157372_100022859 | 263 |
| 358 | 3300013308 | Ga0157375_10091403 | Ga0157375_100914032 | 263 |
| 359 | 3300014325 | Ga0163163_10007553 | Ga0163163_100075531 | 263 |
| 360 | 3300014326 | Ga0157380_10019544 | Ga0157380_100195445 | 263 |
| 361 | 3300014745 | Ga0157377_10084318 | Ga0157377_100843181 | 263 |
| 362 | 3300014968 | Ga0157379_10093085 | Ga0157379_100930851 | 263 |
| 363 | 3300014969 | Ga0157376_10013448 | Ga0157376_100134485 | 263 |
| 364 | 3300017792 | Ga0163161_10021099 | Ga0163161_100210994 | 263 |
| 365 | 3300025228 | Ga0209672_100948 | Ga0209672_10094811 | 263 |
| 366 | 3300025245 | Ga0207425_1000217 | Ga0207425_100021738 | 263 |
| 367 | 3300025256 | Ga0209759_1001867 | Ga0209759_10018676 | 263 |
| 368 | 3300025258 | Ga0209129_1000165 | Ga0209129_100016561 | 263 |
| 369 | 3300025294 | Ga0209025_1000362 | Ga0209025_100036236 | 263 |
| 370 | 3300025297 | Ga0209758_1000738 | Ga0209758_100073810 | 263 |
| 371 | 3300025297 | Ga0209758_1001532 | Ga0209758_100153214 | 263 |
| 372 | 3300025899 | Ga0207642_10073329 | Ga0207642_100733292 | 263 |
| 373 | 3300025901 | Ga0207688_10131669 | Ga0207688_101316692 | 263 |
| 374 | 3300025903 | Ga0207680_10461651 | Ga0207680_104616511 | 263 |
| 375 | 3300025904 | Ga0207647_10000340 | Ga0207647_100003409 | 263 |
| 376 | 3300025912 | Ga0207707_10031913 | Ga0207707_100319133 | 263 |
| 377 | 3300025913 | Ga0207695_10047671 | Ga0207695_100476711 | 263 |
| 378 | 3300025914 | Ga0207671_10006016 | Ga0207671_1000601614 | 263 |
| 379 | 3300025915 | Ga0207693_10068993 | Ga0207693_100689932 | 263 |
| 380 | 3300025917 | Ga0207660_10147020 | Ga0207660_101470202 | 263 |
| 381 | 3300025919 | Ga0207657_10002294 | Ga0207657_100022943 | 263 |
| 382 | 3300025920 | Ga0207649_10084274 | Ga0207649_100842742 | 263 |
| 383 | 3300025921 | Ga0207652_10271870 | Ga0207652_102718702 | 263 |
| 384 | 3300025926 | Ga0207659_10438468 | Ga0207659_104384682 | 263 |
| 385 | 3300025927 | Ga0207687_10171682 | Ga0207687_101716822 | 263 |
| 386 | 3300025931 | Ga0207644_10094809 | Ga0207644_100948092 | 263 |
| 387 | 3300025931 | Ga0207644_10269258 | Ga0207644_102692581 | 263 |
| 388 | 3300025933 | Ga0207706_10128442 | Ga0207706_101284422 | 263 |
| 389 | 3300025935 | Ga0207709_10023852 | Ga0207709_100238522 | 263 |
| 390 | 3300025936 | Ga0207670_10442199 | Ga0207670_104421992 | 263 |
| 391 | 3300025937 | Ga0207669_10038831 | Ga0207669_100388312 | 263 |
| 392 | 3300025938 | Ga0207704_10023352 | Ga0207704_100233522 | 263 |
| 393 | 3300025940 | Ga0207691_10731170 | Ga0207691_107311701 | 263 |
| 394 | 3300025941 | Ga0207711_10066437 | Ga0207711_100664373 | 263 |
| 395 | 3300025942 | Ga0207689_10087777 | Ga0207689_100877772 | 263 |
| 396 | 3300025942 | Ga0207689_10194134 | Ga0207689_101941342 | 263 |
| 397 | 3300025945 | Ga0207679_10381243 | Ga0207679_103812431 | 263 |
| 398 | 3300025945 | Ga0207679_10412657 | Ga0207679_104126571 | 263 |
| 399 | 3300025949 | Ga0207667_10010756 | Ga0207667_100107567 | 263 |
| 400 | 3300025949 | Ga0207667_10011404 | Ga0207667_100114041 | 263 |
| 401 | 3300025960 | Ga0207651_10071143 | Ga0207651_100711432 | 263 |
| 402 | 3300025960 | Ga0207651_10205779 | Ga0207651_102057792 | 263 |
| 403 | 3300025961 | Ga0207712_10055817 | Ga0207712_100558172 | 263 |
| 404 | 3300025972 | Ga0207668_10027869 | Ga0207668_100278692 | 263 |
| 405 | 3300025986 | Ga0207658_10200605 | Ga0207658_102006051 | 263 |
| 406 | 3300026023 | Ga0207677_10335565 | Ga0207677_103355651 | 263 |
| 407 | 3300026041 | Ga0207639_10460884 | Ga0207639_104608842 | 263 |
| 408 | 3300026067 | Ga0207678_10022770 | Ga0207678_100227703 | 263 |
| 409 | 3300026067 | Ga0207678_10047370 | Ga0207678_100473702 | 263 |
| 410 | 3300026067 | Ga0207678_10188016 | Ga0207678_101880162 | 263 |
| 411 | 3300026075 | Ga0207708_10032013 | Ga0207708_100320134 | 263 |
| 412 | 3300026088 | Ga0207641_10483056 | Ga0207641_104830562 | 263 |
| 413 | 3300026095 | Ga0207676_10073727 | Ga0207676_100737272 | 263 |
| 414 | 3300026121 | Ga0207683_10014660 | Ga0207683_100146602 | 263 |
| 415 | 3300026121 | Ga0207683_10338332 | Ga0207683_103383322 | 263 |
| 416 | 3300026142 | Ga0207698_10102945 | Ga0207698_101029452 | 263 |
| 417 | 3300026142 | Ga0207698_10187883 | Ga0207698_101878832 | 263 |
| 418 | 3300027866 | Ga0209813_10037485 | Ga0209813_100374852 | 263 |
| 419 | 3300028379 | Ga0268266_10046425 | Ga0268266_100464252 | 263 |
| 420 | 3300028380 | Ga0268265_10217115 | Ga0268265_102171151 | 263 |
| 421 | 3300028380 | Ga0268265_10315490 | Ga0268265_103154901 | 263 |
| 422 | 3300028381 | Ga0268264_10706744 | Ga0268264_107067442 | 263 |
| 423 | 3300028786 | Ga0307517_10231816 | Ga0307517_102318161 | 263 |
| 424 | 3300028800 | Ga0265338_10000677 | Ga0265338_1000067736 | 263 |
| 425 | 3300031249 | Ga0265339_10058585 | Ga0265339_100585852 | 263 |
| 426 | 3300031250 | Ga0265331_10057168 | Ga0265331_100571682 | 263 |
| 427 | 3300031548 | Ga0307408_100054083 | Ga0307408_1000540832 | 263 |
| 428 | 3300031711 | Ga0265314_10088576 | Ga0265314_100885761 | 263 |
| 429 | 3300031731 | Ga0307405_10018547 | Ga0307405_100185471 | 263 |
| 430 | 3300031731 | Ga0307405_10477000 | Ga0307405_104770002 | 263 |
| 431 | 3300031852 | Ga0307410_10105966 | Ga0307410_101059662 | 263 |
| 432 | 3300031901 | Ga0307406_10367633 | Ga0307406_103676331 | 263 |
| 433 | 3300031911 | Ga0307412_10028755 | Ga0307412_100287551 | 263 |
| 434 | 3300031995 | Ga0307409_100487100 | Ga0307409_1004871001 | 263 |
| 435 | 3300032002 | Ga0307416_100700310 | Ga0307416_1007003101 | 263 |
| 436 | 3300032005 | Ga0307411_10048502 | Ga0307411_100485023 | 263 |
| 437 | 3300032005 | Ga0307411_10152289 | Ga0307411_101522892 | 263 |
| 438 | 3300033180 | Ga0307510_10160954 | Ga0307510_101609542 | 263 |
| 439 | 3300033180 | Ga0307510_10356147 | Ga0307510_103561471 | 263 |
| 440 | 3300033442 | Ga0315911_1000009 | Ga0315911_1000009282 | 263 |
| 441 | 3300034816 | Ga0373930_0009869 | Ga0373930_0009869_710_1501 | 263 |
| 442 | 3300035086 | Ga0373934_0042189 | Ga0373934_0042189_649_1440 | 263 |
| 443 | 3300035111 | Ga0373923_0000827 | Ga0373923_0000827_3995_4786 | 263 |
| 444 | 3300035111 | Ga0373923_0254690 | Ga0373923_0254690_21_812 | 263 |
| 445 | 3300035113 | Ga0373936_0023778 | Ga0373936_0023778_1088_1879 | 263 |
| 446 | 3300035114 | Ga0373939_0057352 | Ga0373939_0057352_157_948 | 263 |
| 447 | 3300035116 | Ga0373945_0030903 | Ga0373945_0030903_556_1347 | 263 |
| 448 | 3300035117 | Ga0373953_0003595 | Ga0373953_0003595_2024_2815 | 263 |
| 449 | 3300035118 | Ga0373954_0000634 | Ga0373954_0000634_2496_3287 | 263 |
| 450 | 3300035119 | Ga0373956_0018011 | Ga0373956_0018011_1982_2773 | 263 |
| 451 | 3300035120 | Ga0373957_0000200 | Ga0373957_0000200_5513_6304 | 263 |
| 452 | 3300035170 | Ga0373943_0002648 | Ga0373943_0002648_1059_1850 | 263 |
| 453 | 3300035171 | Ga0373946_0008219 | Ga0373946_0008219_2702_3493 | 263 |
| 454 | 3300035172 | Ga0373955_0008103 | Ga0373955_0008103_2750_3541 | 263 |
| 455 | 3300035410 | Ga0373924_0004394 | Ga0373924_0004394_1233_2024 | 263 |
| 456 | 3300035410 | Ga0373924_0080229 | Ga0373924_0080229_67_858 | 263 |
| 457 | 3300035691 | Ga0373931_0042085 | Ga0373931_0042085_1229_2029 | 263 |
| 458 | 3300035691 | Ga0373931_0092591 | Ga0373931_0092591_181_972 | 263 |
| 459 | 3300035692 | Ga0373935_0006106 | Ga0373935_0006106_194_985 | 263 |
| 460 | 3300035692 | Ga0373935_0125065 | Ga0373935_0125065_437_1228 | 263 |
| 461 | 3300035695 | Ga0373927_0001513 | Ga0373927_0001513_13014_13805 | 263 |
| 462 | 3300035695 | Ga0373927_0139323 | Ga0373927_0139323_284_1075 | 263 |
| 463 | 3300035695 | Ga0373927_0213932 | Ga0373927_0213932_404_1195 | 263 |
| 464 | 3300035724 | Ga0373933_0002159 | Ga0373933_0002159_2522_3313 | 263 |
| 465 | 3300035725 | Ga0373947_0084456 | Ga0373947_0084456_505_1296 | 263 |
| 466 | 3300035725 | Ga0373947_0450488 | Ga0373947_0450488_70_861 | 263 |
| 467 | 3300037068 | Ga0373925_0006671 | Ga0373925_0006671_6264_7055 | 263 |
| 468 | 3300037068 | Ga0373925_0252084 | Ga0373925_0252084_308_1099 | 263 |
| 469 | 3300037068 | Ga0373925_0269292 | Ga0373925_0269292_120_911 | 263 |
| 470 | 3300037312 | Ga0395899_0000007 | Ga0395899_0000007_296835_297629 | 263 |
| 471 | 3300037418 | Ga0395900_0406146 | Ga0395900_0406146_85_876 | 263 |
| 472 | 3300037466 | Ga0395898_0000276 | Ga0395898_0000276_111368_112162 | 263 |
| 473 | 3300039447 | Ga0436361_0918647 | Ga0436361_0918647_4602_5399 | 263 |
| 474 | 3300041494 | Ga0451837_0376583 | Ga0451837_0376583_79_870 | 263 |
| 475 | 3300042005 | Ga0439448_0000098 | Ga0439448_0000098_3257_4048 | 263 |
| 476 | 3300046454 | Ga0495592_0002897 | Ga0495592_0002897_4963_5754 | 263 |
| 477 | 3300046454 | Ga0495592_0119351 | Ga0495592_0119351_578_1369 | 263 |
| 478 | 3300046455 | Ga0495603_0013589 | Ga0495603_0013589_212_1003 | 263 |
| 479 | 3300046455 | Ga0495603_0019422 | Ga0495603_0019422_2054_2845 | 263 |
| 480 | 3300046455 | Ga0495603_0186121 | Ga0495603_0186121_397_1188 | 263 |
| 481 | 3300046459 | Ga0495629_0002158 | Ga0495629_0002158_4452_5243 | 263 |
| 482 | 3300046459 | Ga0495629_0004330 | Ga0495629_0004330_4070_4861 | 263 |
| 483 | 3300046461 | Ga0495641_0035031 | Ga0495641_0035031_272_1063 | 263 |
| 484 | 3300046462 | Ga0495651_0023237 | Ga0495651_0023237_2122_2913 | 263 |
| 485 | 3300046462 | Ga0495651_0065402 | Ga0495651_0065402_1264_2055 | 263 |
| 486 | 3300046463 | Ga0495653_0017446 | Ga0495653_0017446_3152_3943 | 263 |
| 487 | 3300046472 | Ga0495580_0006344 | Ga0495580_0006344_2894_3685 | 263 |
| 488 | 3300046473 | Ga0495582_0006681 | Ga0495582_0006681_5264_6055 | 263 |
| 489 | 3300046475 | Ga0495639_0000750 | Ga0495639_0000750_8546_9337 | 263 |
| 490 | 3300046476 | Ga0495662_0002275 | Ga0495662_0002275_6084_6875 | 263 |
| 491 | 3300046477 | Ga0495664_0014584 | Ga0495664_0014584_1596_2387 | 263 |
| 492 | 3300046499 | Ga0495594_0054320 | Ga0495594_0054320_1139_1930 | 263 |
| 493 | 3300046500 | Ga0495596_0108613 | Ga0495596_0108613_147_938 | 263 |
| 494 | 3300046511 | Ga0495608_0002218 | Ga0495608_0002218_10387_11178 | 263 |
| 495 | 3300046514 | Ga0495618_0222532 | Ga0495618_0222532_378_1169 | 263 |
| 496 | 3300046516 | Ga0495628_0038487 | Ga0495628_0038487_323_1114 | 263 |
| 497 | 3300046517 | Ga0495630_0025991 | Ga0495630_0025991_516_1307 | 263 |
| 498 | 3300046518 | Ga0495631_0033577 | Ga0495631_0033577_159_950 | 263 |
| 499 | 3300046529 | Ga0495652_0034244 | Ga0495652_0034244_41_832 | 263 |
| 500 | 3300046529 | Ga0495652_0038809 | Ga0495652_0038809_308_1099 | 263 |
| 501 | 3300046529 | Ga0495652_0126467 | Ga0495652_0126467_629_1435 | 263 |
| 502 | 3300046531 | Ga0495665_0007507 | Ga0495665_0007507_3430_4221 | 263 |
| 503 | 3300046533 | Ga0495640_0005616 | Ga0495640_0005616_360_1151 | 263 |
| 504 | 3300046533 | Ga0495640_0007861 | Ga0495640_0007861_5994_6785 | 263 |
| 505 | 3300046535 | Ga0495586_0013054 | Ga0495586_0013054_1318_2109 | 263 |
| 506 | 3300046536 | Ga0495587_0032169 | Ga0495587_0032169_2174_2965 | 263 |
| 507 | 3300046543 | Ga0495645_0063352 | Ga0495645_0063352_885_1676 | 263 |
| 508 | 3300046557 | Ga0495622_0006189 | Ga0495622_0006189_324_1115 | 263 |
| 509 | 3300046559 | Ga0495667_0019371 | Ga0495667_0019371_3514_4305 | 263 |
| 510 | 3300046642 | Ga0495634_0001188 | Ga0495634_0001188_13674_14465 | 263 |
| 511 | 3300046642 | Ga0495634_0012328 | Ga0495634_0012328_1837_2628 | 263 |
| 512 | 3300046663 | Ga0495635_0001058 | Ga0495635_0001058_7116_7907 | 263 |
| 513 | 3300046663 | Ga0495635_0031655 | Ga0495635_0031655_2143_2934 | 263 |
| 514 | 3300046674 | Ga0495588_0026364 | Ga0495588_0026364_580_1371 | 263 |
| 515 | 3300046675 | Ga0495657_0021303 | Ga0495657_0021303_638_1429 | 263 |
| 516 | 3300046678 | Ga0495599_0003523 | Ga0495599_0003523_3787_4578 | 263 |
| 517 | 3300046679 | Ga0495623_0006259 | Ga0495623_0006259_3024_3815 | 263 |
| 518 | 3300046680 | Ga0495646_0000934 | Ga0495646_0000934_5082_5873 | 263 |
| 519 | 3300046680 | Ga0495646_0109119 | Ga0495646_0109119_426_1217 | 263 |
| 520 | 3300046681 | Ga0495647_0018833 | Ga0495647_0018833_909_1700 | 263 |
| 521 | 3300046683 | Ga0495658_0061062 | Ga0495658_0061062_1307_2098 | 263 |
| 522 | 3300046683 | Ga0495658_0183251 | Ga0495658_0183251_196_987 | 263 |
| 523 | 3300046684 | Ga0495669_0003832 | Ga0495669_0003832_3967_4758 | 263 |
| 524 | 3300046689 | Ga0495613_0009382 | Ga0495613_0009382_333_1124 | 263 |
| 525 | 3300046689 | Ga0495613_0048777 | Ga0495613_0048777_2303_3094 | 263 |
| 526 | 3300046690 | Ga0495624_0007459 | Ga0495624_0007459_373_1164 | 263 |
| 527 | 3300046809 | Ga0495600_0001795 | Ga0495600_0001795_8055_8846 | 263 |
| 528 | 3300046809 | Ga0495600_0103023 | Ga0495600_0103023_701_1492 | 263 |
| 529 | 3300047315 | Ga0495581_0000567 | Ga0495581_0000567_2152_2943 | 263 |
| 530 | 3300047317 | Ga0495604_0005607 | Ga0495604_0005607_1663_2454 | 263 |
| 531 | 3300047317 | Ga0495604_0172956 | Ga0495604_0172956_73_864 | 263 |
| 532 | 3300047317 | Ga0495604_0211484 | Ga0495604_0211484_535_1326 | 263 |
| 533 | 3300047319 | Ga0495674_0007182 | Ga0495674_0007182_7279_8070 | 263 |
| 534 | 3300047319 | Ga0495674_0013705 | Ga0495674_0013705_3090_3884 | 263 |
| 535 | 3300047319 | Ga0495674_0015961 | Ga0495674_0015961_3568_4359 | 263 |
| 536 | 3300047319 | Ga0495674_0020569 | Ga0495674_0020569_281_1081 | 263 |
| 537 | 3300047320 | Ga0495672_0056827 | Ga0495672_0056827_573_1364 | 263 |
| 538 | 3300047322 | Ga0495680_0133851 | Ga0495680_0133851_932_1738 | 263 |
| 539 | 3300047444 | Ga0495675_0002644 | Ga0495675_0002644_2485_3276 | 263 |
| 540 | 3300047471 | Ga0495684_0003538 | Ga0495684_0003538_9254_10045 | 263 |
| 541 | 3300047471 | Ga0495684_0073429 | Ga0495684_0073429_1682_2473 | 263 |
| 542 | 3300047472 | Ga0495686_0122584 | Ga0495686_0122584_595_1386 | 263 |
| 543 | 3300047673 | Ga0495593_0002295 | Ga0495593_0002295_6470_7261 | 263 |
| 544 | 3300047673 | Ga0495593_0003406 | Ga0495593_0003406_76_867 | 263 |
| 545 | 3300048088 | Ga0495602_0272327 | Ga0495602_0272327_292_1086 | 263 |
| 546 | 3300048089 | Ga0495614_0025417 | Ga0495614_0025417_1018_1809 | 263 |
| 547 | 3300048903 | Ga0496100_0065578 | Ga0496100_0065578_319_1110 | 263 |
| 548 | 3300048904 | Ga0496101_0000875 | Ga0496101_0000875_6718_7509 | 263 |
| 549 | 3300048904 | Ga0496101_0180199 | Ga0496101_0180199_68_859 | 263 |
| 550 | 3300048905 | Ga0496102_0009695 | Ga0496102_0009695_7364_8155 | 263 |
| 551 | 3300048905 | Ga0496102_0715375 | Ga0496102_0715375_31_822 | 263 |
| 552 | 3300048906 | Ga0496103_0006163 | Ga0496103_0006163_577_1368 | 263 |
| 553 | 3300048906 | Ga0496103_0059635 | Ga0496103_0059635_740_1531 | 263 |
| 554 | 3300048907 | Ga0496104_0027410 | Ga0496104_0027410_281_1072 | 263 |
| 555 | 3300048907 | Ga0496104_0148417 | Ga0496104_0148417_142_933 | 263 |
| 556 | 3300048908 | Ga0496105_0013653 | Ga0496105_0013653_385_1176 | 263 |
| 557 | 3300048908 | Ga0496105_0017743 | Ga0496105_0017743_287_1078 | 263 |
| 558 | 3300048909 | Ga0496106_0054530 | Ga0496106_0054530_1261_2052 | 263 |
| 559 | 3300048909 | Ga0496106_0088453 | Ga0496106_0088453_1072_1863 | 263 |
| 560 | 3300048909 | Ga0496106_0548041 | Ga0496106_0548041_71_862 | 263 |
| 561 | 3300048910 | Ga0496107_0018903 | Ga0496107_0018903_385_1176 | 263 |
| 562 | 3300048910 | Ga0496107_0020915 | Ga0496107_0020915_1071_1862 | 263 |
| 563 | 3300048911 | Ga0496108_0002192 | Ga0496108_0002192_3015_3806 | 263 |
| 564 | 3300048912 | Ga0496109_0010462 | Ga0496109_0010462_1665_2456 | 263 |
| 565 | 3300048912 | Ga0496109_0224669 | Ga0496109_0224669_357_1148 | 263 |
| 566 | 3300048913 | Ga0496110_0005199 | Ga0496110_0005199_1119_1910 | 263 |
| 567 | 3300048913 | Ga0496110_0095144 | Ga0496110_0095144_172_963 | 263 |
| 568 | 3300048914 | Ga0496111_0094015 | Ga0496111_0094015_944_1735 | 263 |
| 569 | 3300048914 | Ga0496111_0234380 | Ga0496111_0234380_188_979 | 263 |
| 570 | 3300048915 | Ga0496112_0058027 | Ga0496112_0058027_1079_1870 | 263 |
| 571 | 3300048916 | Ga0496113_0001312 | Ga0496113_0001312_12791_13582 | 263 |
| 572 | 3300048917 | Ga0496114_0004461 | Ga0496114_0004461_3817_4608 | 263 |
| 573 | 3300048918 | Ga0496115_0002553 | Ga0496115_0002553_11719_12510 | 263 |
| 574 | 3300048919 | Ga0496116_0000555 | Ga0496116_0000555_23873_24673 | 263 |
| 575 | 3300048920 | Ga0496117_0116626 | Ga0496117_0116626_699_1490 | 263 |
| 576 | 3300048921 | Ga0496118_0189864 | Ga0496118_0189864_319_1110 | 263 |
| 577 | 3300048922 | Ga0496119_0082578 | Ga0496119_0082578_372_1163 | 263 |
| 578 | 3300048924 | Ga0496121_0000330 | Ga0496121_0000330_42749_43540 | 263 |
| 579 | 3300048925 | Ga0496122_0219257 | Ga0496122_0219257_100_891 | 263 |
| 580 | 3300048926 | Ga0496123_0064214 | Ga0496123_0064214_1033_1833 | 263 |
| 581 | 3300048927 | Ga0496124_0163019 | Ga0496124_0163019_429_1220 | 263 |
| 582 | 3300048929 | Ga0496126_0003590 | Ga0496126_0003590_4473_5264 | 263 |
| 583 | 3300048929 | Ga0496126_0004961 | Ga0496126_0004961_9381_10172 | 263 |
| 584 | 3300048929 | Ga0496126_0014351 | Ga0496126_0014351_4746_5540 | 263 |
| 585 | 3300048929 | Ga0496126_0021577 | Ga0496126_0021577_142_942 | 263 |
| 586 | 3300048929 | Ga0496126_0048825 | Ga0496126_0048825_503_1294 | 263 |
| 587 | 3300048929 | Ga0496126_0128019 | Ga0496126_0128019_833_1624 | 263 |
| 588 | 3300048929 | Ga0496126_0151272 | Ga0496126_0151272_244_1035 | 263 |
| 589 | 3300048929 | Ga0496126_0189831 | Ga0496126_0189831_203_994 | 263 |
| 590 | 3300050490 | nmdc:mga03n38_233572_c1 | nmdc:mga03n38_233572_c1_43_837 | 263 |
| 591 | 3300050492 | nmdc:mga0yw44_119137_c1 | nmdc:mga0yw44_119137_c1_85_876 | 263 |
| 592 | 3300050493 | nmdc:mga0k408_226252_c1 | nmdc:mga0k408_226252_c1_306_1097 | 263 |
| 593 | 3300050495 | nmdc:mga04h51_44777_c1 | nmdc:mga04h51_44777_c1_568_1359 | 263 |
| 594 | 3300053077 | Ga0495601_0007329 | Ga0495601_0007329_5643_6434 | 263 |
| 595 | 3300053077 | Ga0495601_0015690 | Ga0495601_0015690_440_1231 | 263 |
| 596 | 3300053077 | Ga0495601_0151677 | Ga0495601_0151677_22_813 | 263 |
| 597 | 3300053080 | Ga0500635_0006838 | Ga0500635_0006838_297_1088 | 263 |
| 598 | 3300053084 | Ga0495595_0000335 | Ga0495595_0000335_10125_10916 | 263 |
| 599 | 3300053085 | Ga0495619_0001292 | Ga0495619_0001292_6558_7349 | 263 |
| 600 | 3300053085 | Ga0495619_0317149 | Ga0495619_0317149_34_825 | 263 |
| 601 | 3300053093 | Ga0500651_0000753 | Ga0500651_0000753_14847_15638 | 263 |
| 602 | 3300053094 | Ga0500566_0104821 | Ga0500566_0104821_676_1467 | 263 |
| 603 | 3300053096 | Ga0500641_0026829 | Ga0500641_0026829_875_1666 | 263 |
| 604 | 3300053102 | Ga0500554_036547 | Ga0500554_036547_454_1245 | 263 |
| 605 | 3300053119 | Ga0500595_000468 | Ga0500595_000468_13224_14015 | 263 |
| 606 | 3300053119 | Ga0500595_003984 | Ga0500595_003984_1898_2689 | 263 |
| 607 | 3300053119 | Ga0500595_055296 | Ga0500595_055296_63_854 | 263 |
| 608 | 3300053130 | Ga0500642_0051893 | Ga0500642_0051893_802_1593 | 263 |
| 609 | 3300053136 | Ga0500559_0083158 | Ga0500559_0083158_352_1143 | 263 |
| 610 | 3300053139 | Ga0500568_0003017 | Ga0500568_0003017_6683_7474 | 263 |
| 611 | 3300053156 | Ga0500622_0161119 | Ga0500622_0161119_148_939 | 263 |
| 612 | 3300053162 | Ga0500638_002107 | Ga0500638_002107_5388_6179 | 263 |
| 613 | 3300053178 | Ga0500637_0000546 | Ga0500637_0000546_11200_11991 | 263 |
| 614 | 3300053730 | Ga0500645_025229 | Ga0500645_025229_930_1721 | 263 |
| 615 | 3300055283 | Ga0500661_000782 | Ga0500661_000782_4354_5145 | 263 |
| 616 | iso_pu_bacteria | 2643221607 | 2644048599 | 263 |
| 617 | iso_pu_bacteria | 2643221686 | 2644481400 | 263 |
| 618 | iso_pu_bacteria | 2876761206 | 2876767253 | 263 |
| 619 | 3300046454 | Ga0495592_0191388 | Ga0495592_0191388_449_1249 | 264 |
| 620 | 3300046455 | Ga0495603_0001638 | Ga0495603_0001638_2767_3567 | 264 |
| 621 | 3300046459 | Ga0495629_0000215 | Ga0495629_0000215_17053_17853 | 264 |
| 622 | 3300046462 | Ga0495651_0298257 | Ga0495651_0298257_239_1039 | 264 |
| 623 | 3300046463 | Ga0495653_0115439 | Ga0495653_0115439_1006_1806 | 264 |
| 624 | 3300046471 | Ga0495650_0001730 | Ga0495650_0001730_11821_12621 | 264 |
| 625 | 3300046471 | Ga0495650_0023114 | Ga0495650_0023114_1247_2047 | 264 |
| 626 | 3300046472 | Ga0495580_0003083 | Ga0495580_0003083_7027_7827 | 264 |
| 627 | 3300046477 | Ga0495664_0023152 | Ga0495664_0023152_2740_3540 | 264 |
| 628 | 3300046492 | Ga0495585_0100879 | Ga0495585_0100879_204_1004 | 264 |
| 629 | 3300046506 | Ga0495583_0057578 | Ga0495583_0057578_270_1070 | 264 |
| 630 | 3300046507 | Ga0495606_0002134 | Ga0495606_0002134_14844_15644 | 264 |
| 631 | 3300046507 | Ga0495606_0067765 | Ga0495606_0067765_1033_1833 | 264 |
| 632 | 3300046507 | Ga0495606_0182494 | Ga0495606_0182494_247_1047 | 264 |
| 633 | 3300046535 | Ga0495586_0106141 | Ga0495586_0106141_164_964 | 264 |
| 634 | 3300046542 | Ga0495597_0066410 | Ga0495597_0066410_697_1497 | 264 |
| 635 | 3300046543 | Ga0495645_0001582 | Ga0495645_0001582_11514_12314 | 264 |
| 636 | 3300046543 | Ga0495645_0023405 | Ga0495645_0023405_2717_3517 | 264 |
| 637 | 3300046559 | Ga0495667_0095980 | Ga0495667_0095980_996_1796 | 264 |
| 638 | 3300046674 | Ga0495588_0063205 | Ga0495588_0063205_646_1446 | 264 |
| 639 | 3300046680 | Ga0495646_0052471 | Ga0495646_0052471_1251_2051 | 264 |
| 640 | 3300046689 | Ga0495613_0019532 | Ga0495613_0019532_3240_4040 | 264 |
| 641 | 3300046691 | Ga0495670_0068778 | Ga0495670_0068778_22_822 | 264 |
| 642 | 3300046694 | Ga0495649_0003657 | Ga0495649_0003657_7316_8116 | 264 |
| 643 | 3300046794 | Ga0495589_0032881 | Ga0495589_0032881_202_1002 | 264 |
| 644 | 3300046809 | Ga0495600_0170027 | Ga0495600_0170027_299_1099 | 264 |
| 645 | 3300047315 | Ga0495581_0007237 | Ga0495581_0007237_1455_2255 | 264 |
| 646 | 3300047317 | Ga0495604_0396353 | Ga0495604_0396353_94_894 | 264 |
| 647 | 3300047317 | Ga0495604_0409167 | Ga0495604_0409167_81_881 | 264 |
| 648 | 3300047443 | Ga0495687_006263 | Ga0495687_006263_684_1484 | 264 |
| 649 | 3300047444 | Ga0495675_0017427 | Ga0495675_0017427_1779_2579 | 264 |
| 650 | 3300047446 | Ga0495679_027443 | Ga0495679_027443_837_1637 | 264 |
| 651 | 3300048088 | Ga0495602_0317786 | Ga0495602_0317786_179_979 | 264 |
| 652 | 3300048903 | Ga0496100_0168826 | Ga0496100_0168826_507_1307 | 264 |
| 653 | 3300048904 | Ga0496101_0058755 | Ga0496101_0058755_1962_2762 | 264 |
| 654 | 3300048907 | Ga0496104_0016857 | Ga0496104_0016857_3487_4287 | 264 |
| 655 | 3300048907 | Ga0496104_0416258 | Ga0496104_0416258_440_1240 | 264 |
| 656 | 3300048908 | Ga0496105_0019982 | Ga0496105_0019982_2618_3418 | 264 |
| 657 | 3300048908 | Ga0496105_0267473 | Ga0496105_0267473_13_813 | 264 |
| 658 | 3300048909 | Ga0496106_0000340 | Ga0496106_0000340_2478_3293 | 264 |
| 659 | 3300048918 | Ga0496115_0026735 | Ga0496115_0026735_1903_2703 | 264 |
| 660 | 3300048924 | Ga0496121_0088668 | Ga0496121_0088668_883_1698 | 264 |
| 661 | iso_pu_bacteria | 2508501009 | 2508543027 | 264 |
| 662 | iso_pu_bacteria | 2510917030 | 2511199825 | 264 |
| 663 | iso_pu_bacteria | 2511231028 | 2511401215 | 264 |
| 664 | iso_pu_bacteria | 2513237095 | 2513650241 | 264 |
| 665 | iso_pu_bacteria | 2513237102 | 2513702890 | 264 |
| 666 | iso_pu_bacteria | 2513237104 | 2513717919 | 264 |
| 667 | iso_pu_bacteria | 2513237139 | 2513872502 | 264 |
| 668 | iso_pu_bacteria | 2513237141 | 2513894330 | 264 |
| 669 | iso_pu_bacteria | 2513237161 | 2514015936 | 264 |
| 670 | iso_pu_bacteria | 2517093001 | 2517101522 | 264 |
| 671 | iso_pu_bacteria | 2524023205 | 2524442781 | 264 |
| 672 | iso_pu_bacteria | 2528768022 | 2528849763 | 264 |
| 673 | iso_pu_bacteria | 2534681796 | 2535519465 | 264 |
| 674 | iso_pu_bacteria | 2582581298 | 2585221557 | 264 |
| 675 | iso_pu_bacteria | 2585427529 | 2585544273 | 264 |
| 676 | iso_pu_bacteria | 2617270735 | 2617348725 | 264 |
| 677 | iso_pu_bacteria | 2671180139 | 2671693984 | 264 |
| 678 | iso_pu_bacteria | 2744054633 | 2745080082 | 264 |
| 679 | iso_pu_bacteria | 2791355196 | 2793064100 | 264 |
| 680 | iso_pu_bacteria | 2802429603 | 2805917911 | 264 |
| 681 | iso_pu_bacteria | 2802429634 | 2806056560 | 264 |
| 682 | iso_pu_bacteria | 2802429635 | 2806063684 | 264 |
| 683 | iso_pu_bacteria | 2816332527 | 2818241234 | 264 |
| 684 | iso_pu_bacteria | 2824600985 | 2824606499 | 264 |
| 685 | iso_pu_bacteria | 2824609381 | 2824614618 | 264 |
| 686 | iso_pu_bacteria | 2824617872 | 2824622675 | 264 |
| 687 | iso_pu_bacteria | 2824626560 | 2824631876 | 264 |
| 688 | iso_pu_bacteria | 2824635225 | 2824642766 | 264 |
| 689 | iso_pu_bacteria | 2824644064 | 2824650760 | 264 |
| 690 | iso_pu_bacteria | 2824653114 | 2824655898 | 264 |
| 691 | iso_pu_bacteria | 2824661429 | 2824669651 | 264 |
| 692 | iso_pu_bacteria | 2824671348 | 2824673857 | 264 |
| 693 | iso_pu_bacteria | 2824679649 | 2824686463 | 264 |
| 694 | iso_pu_bacteria | 2824687955 | 2824690508 | 264 |
| 695 | iso_pu_bacteria | 2824696289 | 2824698287 | 264 |
| 696 | iso_pu_bacteria | 2824704595 | 2824712144 | 264 |
| 697 | iso_pu_bacteria | 2824714736 | 2824720536 | 264 |
| 698 | iso_pu_bacteria | 2824723954 | 2824730808 | 264 |
| 699 | iso_pu_bacteria | 2824753945 | 2824762596 | 264 |
| 700 | iso_pu_bacteria | 2824763712 | 2824773018 | 264 |
| 701 | iso_pu_bacteria | 2824773399 | 2824776508 | 264 |
| 702 | iso_pu_bacteria | 2838122688 | 2838124047 | 264 |
| 703 | iso_pu_bacteria | 2841941048 | 2841943825 | 264 |
| 704 | iso_pu_bacteria | 2841949485 | 2841950148 | 264 |
| 705 | iso_pu_bacteria | 2841966195 | 2841966541 | 264 |
| 706 | iso_pu_bacteria | 2841974524 | 2841975281 | 264 |
| 707 | iso_pu_bacteria | 2841983080 | 2841983154 | 264 |
| 708 | iso_pu_bacteria | 2842038055 | 2842039352 | 264 |
| 709 | iso_pu_bacteria | 2842045827 | 2842047702 | 264 |
| 710 | iso_pu_bacteria | 2842509118 | 2842515383 | 264 |
| 711 | iso_pu_bacteria | 2844315083 | 2844318812 | 264 |
| 712 | iso_pu_bacteria | 2847939898 | 2847946271 | 264 |
| 713 | iso_pu_bacteria | 2849076700 | 2849079589 | 264 |
| 714 | iso_pu_bacteria | 2874612657 | 2874616099 | 264 |
| 715 | iso_pu_bacteria | 2874620515 | 2874627402 | 264 |
| 716 | iso_pu_bacteria | 2874628541 | 2874629848 | 264 |
| 717 | iso_pu_bacteria | 2879099564 | 2879101729 | 264 |
| 718 | iso_pu_bacteria | 2881364244 | 2881371700 | 264 |
| 719 | iso_pu_bacteria | 2885409591 | 2885418837 | 264 |
| 720 | iso_pu_bacteria | 2888378607 | 2888383770 | 264 |
| 721 | iso_pu_bacteria | 2888388044 | 2888394092 | 264 |
| 722 | iso_pu_bacteria | 2888388044 | 2888394190 | 264 |
| 723 | iso_pu_bacteria | 2888419890 | 2888424207 | 264 |
| 724 | iso_pu_bacteria | 2902405164 | 2902409272 | 264 |
| 725 | iso_pu_bacteria | 2903727486 | 2903732629 | 264 |
| 726 | iso_pu_bacteria | 2904666416 | 2904671080 | 264 |
| 727 | iso_pu_bacteria | 2904711408 | 2904720839 | 264 |
| 728 | iso_pu_bacteria | 2906602504 | 2906610306 | 264 |
| 729 | iso_pu_bacteria | 2906643746 | 2906646796 | 264 |
| 730 | iso_pu_bacteria | 2922368715 | 2922374018 | 264 |
| 731 | iso_pu_bacteria | 2922393267 | 2922397758 | 264 |
| 732 | iso_pu_bacteria | 2929615660 | 2929617724 | 264 |
| 733 | iso_pu_bacteria | 2929624759 | 2929627429 | 264 |
| 734 | iso_pu_bacteria | 2932784394 | 2932788477 | 264 |
| 735 | iso_pu_bacteria | 2932809354 | 2932816306 | 264 |
| 736 | iso_pu_bacteria | 2932818245 | 2932821476 | 264 |
| 737 | iso_pu_bacteria | 2932828146 | 2932831560 | 264 |
| 738 | iso_pu_bacteria | 2933577622 | 2933579680 | 264 |
| 739 | iso_pu_bacteria | 2935608549 | 2935612191 | 264 |
| 740 | iso_pu_bacteria | 2935616580 | 2935622393 | 264 |
| 741 | iso_pu_bacteria | 2935638405 | 2935645178 | 264 |
| 742 | iso_pu_bacteria | 2935665750 | 2935671793 | 264 |
| 743 | iso_pu_bacteria | 2935675223 | 2935678804 | 264 |
| 744 | iso_pu_bacteria | 2935684952 | 2935688875 | 264 |
| 745 | iso_pu_bacteria | 2935694250 | 2935696249 | 264 |
| 746 | iso_pu_bacteria | 2935703347 | 2935706995 | 264 |
| 747 | iso_pu_bacteria | 2935713505 | 2935715894 | 264 |
| 748 | iso_pu_bacteria | 2935722832 | 2935725542 | 264 |
| 749 | iso_pu_bacteria | 2935732158 | 2935738179 | 264 |
| 750 | iso_pu_bacteria | 2935741537 | 2935747554 | 264 |
| 751 | iso_pu_bacteria | 2935750917 | 2935753871 | 264 |
| 752 | iso_pu_bacteria | 2935760218 | 2935762877 | 264 |
| 753 | iso_pu_bacteria | 2935769743 | 2935775053 | 264 |
| 754 | iso_pu_bacteria | 2935777560 | 2935782686 | 264 |
| 755 | iso_pu_bacteria | 2935785616 | 2935791730 | 264 |
| 756 | iso_pu_bacteria | 2935793552 | 2935800038 | 264 |
| 757 | iso_pu_bacteria | 2935801545 | 2935807658 | 264 |
| 758 | iso_pu_bacteria | 2935810662 | 2935817074 | 264 |
| 759 | iso_pu_bacteria | 2935819856 | 2935821661 | 264 |
| 760 | iso_pu_bacteria | 2935827899 | 2935834645 | 264 |
| 761 | iso_pu_bacteria | 2935837841 | 2935840328 | 264 |
| 762 | iso_pu_bacteria | 2935847175 | 2935847262 | 264 |
| 763 | iso_pu_bacteria | 2935855204 | 2935860539 | 264 |
| 764 | iso_pu_bacteria | 2935864058 | 2935865423 | 264 |
| 765 | iso_pu_bacteria | 2935873716 | 2935878019 | 264 |
| 766 | iso_pu_bacteria | 2935908558 | 2935914635 | 264 |
| 767 | iso_pu_bacteria | 2935916978 | 2935924898 | 264 |
| 768 | iso_pu_bacteria | 2935926038 | 2935932287 | 264 |
| 769 | iso_pu_bacteria | 2935934488 | 2935940885 | 264 |
| 770 | iso_pu_bacteria | 2935942939 | 2935948958 | 264 |
| 771 | iso_pu_bacteria | 2935951376 | 2935957516 | 264 |
| 772 | iso_pu_bacteria | 2935959822 | 2935959959 | 264 |
| 773 | iso_pu_bacteria | 2935967501 | 2935973963 | 264 |
| 774 | iso_pu_bacteria | 2935992306 | 2935996032 | 264 |
| 775 | iso_pu_bacteria | 2936002035 | 2936009498 | 264 |
| 776 | iso_pu_bacteria | 2936037263 | 2936043453 | 264 |
| 777 | iso_pu_bacteria | 2940556831 | 2940560753 | 264 |
| 778 | iso_pu_bacteria | 2941531003 | 2941538345 | 264 |
| 779 | iso_pu_bacteria | 2941538514 | 2941541541 | 264 |
| 780 | iso_pu_bacteria | 3005452660 | 3005456984 | 264 |
| 781 | iso_pu_bacteria | 3005718088 | 3005724533 | 264 |
| 782 | iso_pu_bacteria | 643348564 | 643592636 | 264 |
| 783 | iso_pu_bacteria | 8005542996 | 8005547155 | 264 |
| 784 | iso_pu_bacteria | 8016511872 | 8016513638 | 264 |
| 785 | iso_pu_bacteria | 8016522445 | 8016529962 | 264 |
| 786 | iso_pu_bacteria | 8016530956 | 8016535199 | 264 |
| 787 | iso_pu_bacteria | 8016548790 | 8016553723 | 264 |
| 788 | iso_pu_bacteria | 8016557553 | 8016562100 | 264 |
| 789 | iso_pu_bacteria | 8016566248 | 8016573538 | 264 |
| 790 | iso_pu_bacteria | 8016575299 | 8016577665 | 264 |
| 791 | iso_pu_bacteria | 8016595262 | 8016599921 | 264 |
| 792 | iso_pu_bacteria | 8016603502 | 8016610888 | 264 |
| 793 | iso_pu_bacteria | 8016613128 | 8016614076 | 264 |
| 794 | iso_pu_bacteria | 8016622563 | 8016626980 | 264 |
| 795 | iso_pu_bacteria | 8019530166 | 8019534949 | 264 |
| 796 | iso_pu_bacteria | 8019538911 | 8019544516 | 264 |
| 797 | iso_pu_bacteria | 8019547302 | 8019554073 | 264 |
| 798 | iso_pu_bacteria | 8019576017 | 8019582245 | 264 |
| 799 | iso_pu_bacteria | 8019586578 | 8019589938 | 264 |
| 800 | iso_pu_bacteria | 8019597564 | 8019601333 | 264 |
| 801 | iso_pu_bacteria | 8019608314 | 8019617222 | 264 |
| 802 | iso_pu_bacteria | 8019687851 | 8019689673 | 264 |
| 803 | iso_pu_bacteria | 8055742211 | 8055746661 | 264 |
| 804 | iso_pu_bacteria | 8056967851 | 8056973195 | 264 |
| 805 | iso_pu_bacteria | 8057575449 | 8057578033 | 264 |
| 806 | 3300031247 | Ga0265340_10009852 | Ga0265340_100098522 | 266 |
| 807 | 3300031249 | Ga0265339_10005005 | Ga0265339_100050059 | 266 |
| 808 | 3300005530 | Ga0070679_100728112 | Ga0070679_1007281121 | 267 |
| 809 | 3300009093 | Ga0105240_10108885 | Ga0105240_101088854 | 267 |
| 810 | 3300013105 | Ga0157369_10144914 | Ga0157369_101449142 | 267 |
| 811 | 3300021377 | Ga0213874_10013586 | Ga0213874_100135862 | 267 |
| 812 | 3300025303 | Ga0209051_1007389 | Ga0209051_10073893 | 267 |
| 813 | 3300039437 | Ga0436365_0096880 | Ga0436365_0096880_850_1665 | 267 |
| 814 | 3300039437 | Ga0436365_0410894 | Ga0436365_0410894_99_914 | 267 |
| 815 | 3300039450 | Ga0436363_1511490 | Ga0436363_1511490_872_1684 | 267 |
| 816 | 3300044842 | Ga0466957_0263324 | Ga0466957_0263324_277_1092 | 267 |
| 817 | 3300045976 | Ga0466967_0208302 | Ga0466967_0208302_895_1710 | 267 |
| 818 | 3300048920 | Ga0496117_0040145 | Ga0496117_0040145_2562_3377 | 267 |
| 819 | 3300048924 | Ga0496121_0096160 | Ga0496121_0096160_1217_2032 | 267 |
| 820 | 3300048924 | Ga0496121_0215148 | Ga0496121_0215148_215_1027 | 267 |
| 821 | 3300049569 | Ga0501032_0127848 | Ga0501032_0127848_811_1623 | 267 |
| 822 | 3300049571 | Ga0501034_0081269 | Ga0501034_0081269_165_977 | 267 |
| 823 | 3300049574 | Ga0501038_0162296 | Ga0501038_0162296_307_1119 | 267 |
| 824 | 3300049588 | Ga0501072_0592059 | Ga0501072_0592059_50_862 | 267 |
| 825 | 3300049823 | Ga0501044_0058692 | Ga0501044_0058692_1999_2808 | 267 |
| 826 | 3300053177 | Ga0500636_0029443 | Ga0500636_0029443_132_944 | 267 |
| 827 | 3300053737 | Ga0500601_009479 | Ga0500601_009479_133_945 | 267 |
| 828 | 3300002739 | JGI25158J39367_1000016 | JGI25158J39367_10000166 | 268 |
| 829 | 3300002773 | JGI25152J39213_1000619 | JGI25152J39213_100061912 | 268 |
| 830 | 3300002987 | JGI25159J45721_1000637 | JGI25159J45721_100063713 | 268 |
| 831 | 3300003187 | JGI25151J46595_10000799 | JGI25151J46595_1000079917 | 268 |
| 832 | 3300003214 | JGI25165J46597_1000006 | JGI25165J46597_1000006466 | 268 |
| 833 | 3300003215 | JGI25153J46596_10001193 | JGI25153J46596_100011935 | 268 |
| 834 | 3300003215 | JGI25153J46596_10001417 | JGI25153J46596_100014175 | 268 |
| 835 | 3300003215 | JGI25153J46596_10007157 | JGI25153J46596_100071576 | 268 |
| 836 | 3300003215 | JGI25153J46596_10015144 | JGI25153J46596_100151442 | 268 |
| 837 | 3300003322 | rootL2_10217006 | rootL2_102170061 | 268 |
| 838 | 3300003354 | JGI25160J50197_1002213 | JGI25160J50197_100221311 | 268 |
| 839 | 3300003354 | JGI25160J50197_1003037 | JGI25160J50197_10030375 | 268 |
| 840 | 3300003374 | JGI25161J50226_1000096 | JGI25161J50226_10000966 | 268 |
| 841 | 3300003762 | Ga0055542_1006307 | Ga0055542_10063072 | 268 |
| 842 | 3300003771 | Ga0055526_1003664 | Ga0055526_10036645 | 268 |
| 843 | 3300003775 | Ga0055524_1005122 | Ga0055524_10051226 | 268 |
| 844 | 3300003790 | Ga0055528_1002007 | Ga0055528_100200710 | 268 |
| 845 | 3300003790 | Ga0055528_1004016 | Ga0055528_10040162 | 268 |
| 846 | 3300003792 | Ga0055540_1003592 | Ga0055540_10035926 | 268 |
| 847 | 3300003794 | Ga0055531_10004774 | Ga0055531_100047745 | 268 |
| 848 | 3300004625 | Ga0055543_1000183 | Ga0055543_100018352 | 268 |
| 849 | 3300005262 | Ga0065165_1001490 | Ga0065165_10014906 | 268 |
| 850 | 3300005262 | Ga0065165_1002488 | Ga0065165_10024886 | 268 |
| 851 | 3300005262 | Ga0065165_1003977 | Ga0065165_10039775 | 268 |
| 852 | 3300005262 | Ga0065165_1012513 | Ga0065165_10125132 | 268 |
| 853 | 3300005331 | Ga0070670_100048365 | Ga0070670_1000483653 | 268 |
| 854 | 3300005353 | Ga0070669_100194774 | Ga0070669_1001947742 | 268 |
| 855 | 3300005355 | Ga0070671_100035469 | Ga0070671_1000354695 | 268 |
| 856 | 3300005434 | Ga0070709_10003856 | Ga0070709_100038562 | 268 |
| 857 | 3300005435 | Ga0070714_100250700 | Ga0070714_1002507002 | 268 |
| 858 | 3300005436 | Ga0070713_100210757 | Ga0070713_1002107572 | 268 |
| 859 | 3300005437 | Ga0070710_10015620 | Ga0070710_100156202 | 268 |
| 860 | 3300005439 | Ga0070711_100076039 | Ga0070711_1000760392 | 268 |
| 861 | 3300005455 | Ga0070663_100359046 | Ga0070663_1003590461 | 268 |
| 862 | 3300005455 | Ga0070663_100505219 | Ga0070663_1005052191 | 268 |
| 863 | 3300005457 | Ga0070662_100268053 | Ga0070662_1002680532 | 268 |
| 864 | 3300005518 | Ga0070699_100571212 | Ga0070699_1005712121 | 268 |
| 865 | 3300005548 | Ga0070665_100027988 | Ga0070665_1000279883 | 268 |
| 866 | 3300005548 | Ga0070665_100330698 | Ga0070665_1003306982 | 268 |
| 867 | 3300005563 | Ga0068855_100167276 | Ga0068855_1001672762 | 268 |
| 868 | 3300005563 | Ga0068855_100585626 | Ga0068855_1005856261 | 268 |
| 869 | 3300005577 | Ga0068857_100204464 | Ga0068857_1002044642 | 268 |
| 870 | 3300005614 | Ga0068856_100160476 | Ga0068856_1001604763 | 268 |
| 871 | 3300005614 | Ga0068856_100262968 | Ga0068856_1002629682 | 268 |
| 872 | 3300005616 | Ga0068852_100012928 | Ga0068852_1000129285 | 268 |
| 873 | 3300005616 | Ga0068852_100277526 | Ga0068852_1002775262 | 268 |
| 874 | 3300005618 | Ga0068864_100186573 | Ga0068864_1001865733 | 268 |
| 875 | 3300005983 | Ga0081540_1002582 | Ga0081540_10025827 | 268 |
| 876 | 3300005983 | Ga0081540_1072054 | Ga0081540_10720542 | 268 |
| 877 | 3300006038 | Ga0075365_10074629 | Ga0075365_100746292 | 268 |
| 878 | 3300006038 | Ga0075365_10183211 | Ga0075365_101832111 | 268 |
| 879 | 3300006048 | Ga0075363_100220522 | Ga0075363_1002205221 | 268 |
| 880 | 3300006051 | Ga0075364_10037703 | Ga0075364_100377033 | 268 |
| 881 | 3300006173 | Ga0070716_100091085 | Ga0070716_1000910852 | 268 |
| 882 | 3300006178 | Ga0075367_10180409 | Ga0075367_101804092 | 268 |
| 883 | 3300006178 | Ga0075367_10357592 | Ga0075367_103575922 | 268 |
| 884 | 3300006195 | Ga0075366_10046435 | Ga0075366_100464353 | 268 |
| 885 | 3300006195 | Ga0075366_10148409 | Ga0075366_101484091 | 268 |
| 886 | 3300006353 | Ga0075370_10066372 | Ga0075370_100663723 | 268 |
| 887 | 3300006847 | Ga0075431_100661998 | Ga0075431_1006619981 | 268 |
| 888 | 3300009093 | Ga0105240_10010226 | Ga0105240_100102268 | 268 |
| 889 | 3300009093 | Ga0105240_10271484 | Ga0105240_102714841 | 268 |
| 890 | 3300009093 | Ga0105240_10354484 | Ga0105240_103544842 | 268 |
| 891 | 3300009098 | Ga0105245_10266042 | Ga0105245_102660422 | 268 |
| 892 | 3300009174 | Ga0105241_10119390 | Ga0105241_101193903 | 268 |
| 893 | 3300009174 | Ga0105241_10293804 | Ga0105241_102938042 | 268 |
| 894 | 3300009176 | Ga0105242_10273475 | Ga0105242_102734752 | 268 |
| 895 | 3300009177 | Ga0105248_10107619 | Ga0105248_101076192 | 268 |
| 896 | 3300009177 | Ga0105248_10523315 | Ga0105248_105233151 | 268 |
| 897 | 3300009545 | Ga0105237_10003658 | Ga0105237_1000365814 | 268 |
| 898 | 3300009545 | Ga0105237_10042573 | Ga0105237_100425735 | 268 |
| 899 | 3300009545 | Ga0105237_10323492 | Ga0105237_103234921 | 268 |
| 900 | 3300009551 | Ga0105238_10458082 | Ga0105238_104580822 | 268 |
| 901 | 3300009551 | Ga0105238_10784392 | Ga0105238_107843922 | 268 |
| 902 | 3300009553 | Ga0105249_10238250 | Ga0105249_102382503 | 268 |
| 903 | 3300010375 | Ga0105239_10048515 | Ga0105239_100485153 | 268 |
| 904 | 3300010375 | Ga0105239_10082916 | Ga0105239_100829165 | 268 |
| 905 | 3300010375 | Ga0105239_10174867 | Ga0105239_101748672 | 268 |
| 906 | 3300010375 | Ga0105239_10386009 | Ga0105239_103860092 | 268 |
| 907 | 3300010375 | Ga0105239_10606846 | Ga0105239_106068461 | 268 |
| 908 | 3300010375 | Ga0105239_10681093 | Ga0105239_106810931 | 268 |
| 909 | 3300013297 | Ga0157378_10597807 | Ga0157378_105978071 | 268 |
| 910 | 3300013308 | Ga0157375_10139188 | Ga0157375_101391882 | 268 |
| 911 | 3300014325 | Ga0163163_10003792 | Ga0163163_100037923 | 268 |
| 912 | 3300014325 | Ga0163163_10061180 | Ga0163163_100611802 | 268 |
| 913 | 3300014325 | Ga0163163_10787736 | Ga0163163_107877362 | 268 |
| 914 | 3300014326 | Ga0157380_10551717 | Ga0157380_105517171 | 268 |
| 915 | 3300014497 | Ga0182008_10030237 | Ga0182008_100302373 | 268 |
| 916 | 3300014497 | Ga0182008_10197176 | Ga0182008_101971761 | 268 |
| 917 | 3300014968 | Ga0157379_10088052 | Ga0157379_100880522 | 268 |
| 918 | 3300015261 | Ga0182006_1022019 | Ga0182006_10220193 | 268 |
| 919 | 3300015262 | Ga0182007_10032118 | Ga0182007_100321182 | 268 |
| 920 | 3300017792 | Ga0163161_10573995 | Ga0163161_105739952 | 268 |
| 921 | 3300025208 | Ga0209436_100004 | Ga0209436_100004153 | 268 |
| 922 | 3300025230 | Ga0209563_100449 | Ga0209563_10044911 | 268 |
| 923 | 3300025245 | Ga0207425_1011182 | Ga0207425_10111822 | 268 |
| 924 | 3300025254 | Ga0209148_1000929 | Ga0209148_10009295 | 268 |
| 925 | 3300025254 | Ga0209148_1002656 | Ga0209148_10026562 | 268 |
| 926 | 3300025258 | Ga0209129_1000082 | Ga0209129_100008224 | 268 |
| 927 | 3300025258 | Ga0209129_1001930 | Ga0209129_100193011 | 268 |
| 928 | 3300025258 | Ga0209129_1005362 | Ga0209129_10053624 | 268 |
| 929 | 3300025261 | Ga0209233_1000010 | Ga0209233_10000101045 | 268 |
| 930 | 3300025261 | Ga0209233_1003142 | Ga0209233_10031426 | 268 |
| 931 | 3300025261 | Ga0209233_1006358 | Ga0209233_10063583 | 268 |
| 932 | 3300025272 | Ga0209455_1000620 | Ga0209455_10006203 | 268 |
| 933 | 3300025273 | Ga0209673_1003625 | Ga0209673_10036252 | 268 |
| 934 | 3300025273 | Ga0209673_1027984 | Ga0209673_10279842 | 268 |
| 935 | 3300025284 | Ga0209130_1000001 | Ga0209130_1000001271 | 268 |
| 936 | 3300025294 | Ga0209025_1000172 | Ga0209025_100017283 | 268 |
| 937 | 3300025295 | Ga0209564_1001805 | Ga0209564_100180512 | 268 |
| 938 | 3300025295 | Ga0209564_1004735 | Ga0209564_10047356 | 268 |
| 939 | 3300025295 | Ga0209564_1011661 | Ga0209564_10116614 | 268 |
| 940 | 3300025295 | Ga0209564_1044776 | Ga0209564_10447762 | 268 |
| 941 | 3300025297 | Ga0209758_1000021 | Ga0209758_1000021405 | 268 |
| 942 | 3300025297 | Ga0209758_1000388 | Ga0209758_100038846 | 268 |
| 943 | 3300025297 | Ga0209758_1023778 | Ga0209758_10237782 | 268 |
| 944 | 3300025297 | Ga0209758_1025905 | Ga0209758_10259053 | 268 |
| 945 | 3300025297 | Ga0209758_1031377 | Ga0209758_10313772 | 268 |
| 946 | 3300025299 | Ga0209256_1001343 | Ga0209256_10013439 | 268 |
| 947 | 3300025299 | Ga0209256_1013699 | Ga0209256_10136992 | 268 |
| 948 | 3300025299 | Ga0209256_1018762 | Ga0209256_10187622 | 268 |
| 949 | 3300025302 | Ga0207426_1000005 | Ga0207426_1000005876 | 268 |
| 950 | 3300025302 | Ga0207426_1000143 | Ga0207426_100014383 | 268 |
| 951 | 3300025302 | Ga0207426_1000687 | Ga0207426_100068734 | 268 |
| 952 | 3300025302 | Ga0207426_1004068 | Ga0207426_10040685 | 268 |
| 953 | 3300025302 | Ga0207426_1026400 | Ga0207426_10264002 | 268 |
| 954 | 3300025302 | Ga0207426_1071450 | Ga0207426_10714502 | 268 |
| 955 | 3300025303 | Ga0209051_1014372 | Ga0209051_10143724 | 268 |
| 956 | 3300025304 | Ga0209257_1000455 | Ga0209257_100045515 | 268 |
| 957 | 3300025304 | Ga0209257_1012178 | Ga0209257_10121784 | 268 |
| 958 | 3300025304 | Ga0209257_1042696 | Ga0209257_10426961 | 268 |
| 959 | 3300025898 | Ga0207692_10022140 | Ga0207692_100221402 | 268 |
| 960 | 3300025901 | Ga0207688_10031251 | Ga0207688_100312512 | 268 |
| 961 | 3300025904 | Ga0207647_10006430 | Ga0207647_100064305 | 268 |
| 962 | 3300025906 | Ga0207699_10033697 | Ga0207699_100336972 | 268 |
| 963 | 3300025909 | Ga0207705_10131740 | Ga0207705_101317402 | 268 |
| 964 | 3300025911 | Ga0207654_10019392 | Ga0207654_100193924 | 268 |
| 965 | 3300025913 | Ga0207695_10000015 | Ga0207695_10000015399 | 268 |
| 966 | 3300025913 | Ga0207695_10156665 | Ga0207695_101566653 | 268 |
| 967 | 3300025914 | Ga0207671_10007700 | Ga0207671_100077009 | 268 |
| 968 | 3300025914 | Ga0207671_10204779 | Ga0207671_102047792 | 268 |
| 969 | 3300025914 | Ga0207671_10381049 | Ga0207671_103810491 | 268 |
| 970 | 3300025915 | Ga0207693_10144997 | Ga0207693_101449972 | 268 |
| 971 | 3300025919 | Ga0207657_10063817 | Ga0207657_100638173 | 268 |
| 972 | 3300025925 | Ga0207650_10164340 | Ga0207650_101643402 | 268 |
| 973 | 3300025927 | Ga0207687_10159535 | Ga0207687_101595352 | 268 |
| 974 | 3300025928 | Ga0207700_10287430 | Ga0207700_102874301 | 268 |
| 975 | 3300025931 | Ga0207644_10035292 | Ga0207644_100352924 | 268 |
| 976 | 3300025933 | Ga0207706_10276911 | Ga0207706_102769111 | 268 |
| 977 | 3300025938 | Ga0207704_10568185 | Ga0207704_105681851 | 268 |
| 978 | 3300025941 | Ga0207711_10083775 | Ga0207711_100837753 | 268 |
| 979 | 3300025949 | Ga0207667_10359872 | Ga0207667_103598722 | 268 |
| 980 | 3300025972 | Ga0207668_10053221 | Ga0207668_100532212 | 268 |
| 981 | 3300025972 | Ga0207668_10291585 | Ga0207668_102915851 | 268 |
| 982 | 3300026067 | Ga0207678_10049880 | Ga0207678_100498803 | 268 |
| 983 | 3300026067 | Ga0207678_10151597 | Ga0207678_101515972 | 268 |
| 984 | 3300026067 | Ga0207678_10192087 | Ga0207678_101920872 | 268 |
| 985 | 3300026067 | Ga0207678_10203469 | Ga0207678_102034692 | 268 |
| 986 | 3300026078 | Ga0207702_10141780 | Ga0207702_101417802 | 268 |
| 987 | 3300026078 | Ga0207702_10163134 | Ga0207702_101631343 | 268 |
| 988 | 3300026095 | Ga0207676_10083040 | Ga0207676_100830402 | 268 |
| 989 | 3300026142 | Ga0207698_10914398 | Ga0207698_109143981 | 268 |
| 990 | 3300028379 | Ga0268266_10029091 | Ga0268266_100290914 | 268 |
| 991 | 3300031507 | Ga0307509_10000779 | Ga0307509_1000077934 | 268 |
| 992 | 3300031616 | Ga0307508_10005559 | Ga0307508_100055598 | 268 |
| 993 | 3300031711 | Ga0265314_10011012 | Ga0265314_100110122 | 268 |
| 994 | 3300033180 | Ga0307510_10056799 | Ga0307510_100567995 | 268 |
| 995 | 3300033180 | Ga0307510_10080532 | Ga0307510_100805322 | 268 |
| 996 | 3300033180 | Ga0307510_10128261 | Ga0307510_101282612 | 268 |
| 997 | 3300033180 | Ga0307510_10327937 | Ga0307510_103279372 | 268 |
| 998 | 3300035170 | Ga0373943_0051944 | Ga0373943_0051944_802_1620 | 268 |
| 999 | 3300035692 | Ga0373935_0261912 | Ga0373935_0261912_25_843 | 268 |
| 1000 | 3300035725 | Ga0373947_0244381 | Ga0373947_0244381_103_921 | 268 |
| 1001 | 3300037418 | Ga0395900_0004826 | Ga0395900_0004826_7910_8725 | 268 |
| 1002 | 3300037418 | Ga0395900_0353364 | Ga0395900_0353364_134_949 | 268 |
| 1003 | 3300037466 | Ga0395898_0081232 | Ga0395898_0081232_2269_3081 | 268 |
| 1004 | 3300037466 | Ga0395898_0102696 | Ga0395898_0102696_959_1774 | 268 |
| 1005 | 3300037471 | Ga0395905_0022102 | Ga0395905_0022102_968_1783 | 268 |
| 1006 | 3300037471 | Ga0395905_0119904 | Ga0395905_0119904_1322_2137 | 268 |
| 1007 | 3300037471 | Ga0395905_0279868 | Ga0395905_0279868_47_865 | 268 |
| 1008 | 3300038443 | Ga0395901_0010567 | Ga0395901_0010567_1370_2185 | 268 |
| 1009 | 3300038443 | Ga0395901_0185005 | Ga0395901_0185005_715_1530 | 268 |
| 1010 | 3300039437 | Ga0436365_1476096 | Ga0436365_1476096_254_1072 | 268 |
| 1011 | 3300039438 | Ga0436360_0795597 | Ga0436360_0795597_374_1192 | 268 |
| 1012 | 3300041413 | Ga0439465_0006693 | Ga0439465_0006693_2732_3541 | 268 |
| 1013 | 3300041511 | Ga0451855_0177954 | Ga0451855_0177954_715_1530 | 268 |
| 1014 | 3300041512 | Ga0451853_0910860 | Ga0451853_0910860_6618_7433 | 268 |
| 1015 | 3300044656 | Ga0466969_0070745 | Ga0466969_0070745_149_964 | 268 |
| 1016 | 3300044684 | Ga0466966_0001170 | Ga0466966_0001170_13584_14399 | 268 |
| 1017 | 3300044693 | Ga0466961_0000375 | Ga0466961_0000375_16584_17399 | 268 |
| 1018 | 3300044901 | Ga0466960_0203387 | Ga0466960_0203387_149_964 | 268 |
| 1019 | 3300045049 | Ga0466959_0006481 | Ga0466959_0006481_3896_4711 | 268 |
| 1020 | 3300045976 | Ga0466967_0036461 | Ga0466967_0036461_2823_3638 | 268 |
| 1021 | 3300046454 | Ga0495592_0225893 | Ga0495592_0225893_416_1231 | 268 |
| 1022 | 3300046459 | Ga0495629_0019046 | Ga0495629_0019046_2798_3613 | 268 |
| 1023 | 3300046460 | Ga0495638_0008267 | Ga0495638_0008267_3186_4001 | 268 |
| 1024 | 3300046462 | Ga0495651_0014331 | Ga0495651_0014331_849_1664 | 268 |
| 1025 | 3300046462 | Ga0495651_0023242 | Ga0495651_0023242_2086_2904 | 268 |
| 1026 | 3300046463 | Ga0495653_0155372 | Ga0495653_0155372_84_899 | 268 |
| 1027 | 3300046475 | Ga0495639_0117968 | Ga0495639_0117968_202_1020 | 268 |
| 1028 | 3300046476 | Ga0495662_0178581 | Ga0495662_0178581_145_960 | 268 |
| 1029 | 3300046477 | Ga0495664_0051948 | Ga0495664_0051948_1011_1838 | 268 |
| 1030 | 3300046507 | Ga0495606_0043458 | Ga0495606_0043458_1548_2363 | 268 |
| 1031 | 3300046507 | Ga0495606_0249450 | Ga0495606_0249450_28_843 | 268 |
| 1032 | 3300046511 | Ga0495608_0022549 | Ga0495608_0022549_2810_3625 | 268 |
| 1033 | 3300046516 | Ga0495628_0517182 | Ga0495628_0517182_11_829 | 268 |
| 1034 | 3300046522 | Ga0495643_0047143 | Ga0495643_0047143_1249_2064 | 268 |
| 1035 | 3300046529 | Ga0495652_0126502 | Ga0495652_0126502_343_1158 | 268 |
| 1036 | 3300046529 | Ga0495652_0157078 | Ga0495652_0157078_807_1622 | 268 |
| 1037 | 3300046533 | Ga0495640_0020015 | Ga0495640_0020015_2200_3015 | 268 |
| 1038 | 3300046533 | Ga0495640_0112121 | Ga0495640_0112121_299_1114 | 268 |
| 1039 | 3300046543 | Ga0495645_0045991 | Ga0495645_0045991_2004_2819 | 268 |
| 1040 | 3300046557 | Ga0495622_0007815 | Ga0495622_0007815_3566_4381 | 268 |
| 1041 | 3300046559 | Ga0495667_0037821 | Ga0495667_0037821_825_1640 | 268 |
| 1042 | 3300046559 | Ga0495667_0130304 | Ga0495667_0130304_452_1270 | 268 |
| 1043 | 3300046616 | Ga0495668_0187067 | Ga0495668_0187067_24_839 | 268 |
| 1044 | 3300046642 | Ga0495634_0147156 | Ga0495634_0147156_402_1217 | 268 |
| 1045 | 3300046648 | Ga0495611_0087234 | Ga0495611_0087234_578_1393 | 268 |
| 1046 | 3300046663 | Ga0495635_0082311 | Ga0495635_0082311_867_1682 | 268 |
| 1047 | 3300046663 | Ga0495635_0156827 | Ga0495635_0156827_426_1241 | 268 |
| 1048 | 3300046675 | Ga0495657_0004962 | Ga0495657_0004962_1673_2488 | 268 |
| 1049 | 3300046675 | Ga0495657_0009569 | Ga0495657_0009569_4772_5587 | 268 |
| 1050 | 3300046678 | Ga0495599_0059991 | Ga0495599_0059991_773_1588 | 268 |
| 1051 | 3300046679 | Ga0495623_0023756 | Ga0495623_0023756_2745_3563 | 268 |
| 1052 | 3300046679 | Ga0495623_0049549 | Ga0495623_0049549_1173_1988 | 268 |
| 1053 | 3300046680 | Ga0495646_0026112 | Ga0495646_0026112_748_1563 | 268 |
| 1054 | 3300046689 | Ga0495613_0139728 | Ga0495613_0139728_662_1477 | 268 |
| 1055 | 3300046690 | Ga0495624_0051204 | Ga0495624_0051204_1187_2002 | 268 |
| 1056 | 3300046690 | Ga0495624_0193788 | Ga0495624_0193788_237_1055 | 268 |
| 1057 | 3300046694 | Ga0495649_0180508 | Ga0495649_0180508_266_1081 | 268 |
| 1058 | 3300046809 | Ga0495600_0004023 | Ga0495600_0004023_993_1808 | 268 |
| 1059 | 3300046809 | Ga0495600_0060700 | Ga0495600_0060700_708_1526 | 268 |
| 1060 | 3300047315 | Ga0495581_0065992 | Ga0495581_0065992_881_1699 | 268 |
| 1061 | 3300047317 | Ga0495604_0004281 | Ga0495604_0004281_10131_10946 | 268 |
| 1062 | 3300047317 | Ga0495604_0006726 | Ga0495604_0006726_1546_2361 | 268 |
| 1063 | 3300047317 | Ga0495604_0014661 | Ga0495604_0014661_4763_5581 | 268 |
| 1064 | 3300047319 | Ga0495674_0166386 | Ga0495674_0166386_674_1489 | 268 |
| 1065 | 3300047321 | Ga0495676_0051305 | Ga0495676_0051305_1578_2393 | 268 |
| 1066 | 3300047321 | Ga0495676_0275953 | Ga0495676_0275953_202_1020 | 268 |
| 1067 | 3300047322 | Ga0495680_0009178 | Ga0495680_0009178_3898_4713 | 268 |
| 1068 | 3300047322 | Ga0495680_0050126 | Ga0495680_0050126_64_882 | 268 |
| 1069 | 3300047323 | Ga0495683_0099101 | Ga0495683_0099101_486_1301 | 268 |
| 1070 | 3300047443 | Ga0495687_039374 | Ga0495687_039374_460_1275 | 268 |
| 1071 | 3300047444 | Ga0495675_0176218 | Ga0495675_0176218_197_1012 | 268 |
| 1072 | 3300047471 | Ga0495684_0183581 | Ga0495684_0183581_618_1433 | 268 |
| 1073 | 3300047472 | Ga0495686_0137614 | Ga0495686_0137614_332_1147 | 268 |
| 1074 | 3300048088 | Ga0495602_0057070 | Ga0495602_0057070_927_1742 | 268 |
| 1075 | 3300048088 | Ga0495602_0081463 | Ga0495602_0081463_1234_2049 | 268 |
| 1076 | 3300048904 | Ga0496101_0073003 | Ga0496101_0073003_1580_2398 | 268 |
| 1077 | 3300048905 | Ga0496102_0021478 | Ga0496102_0021478_2357_3172 | 268 |
| 1078 | 3300048905 | Ga0496102_0356779 | Ga0496102_0356779_130_945 | 268 |
| 1079 | 3300048906 | Ga0496103_0015179 | Ga0496103_0015179_741_1556 | 268 |
| 1080 | 3300048907 | Ga0496104_0006272 | Ga0496104_0006272_341_1153 | 268 |
| 1081 | 3300048907 | Ga0496104_0009754 | Ga0496104_0009754_5037_5852 | 268 |
| 1082 | 3300048907 | Ga0496104_0049962 | Ga0496104_0049962_2706_3521 | 268 |
| 1083 | 3300048907 | Ga0496104_0553105 | Ga0496104_0553105_79_894 | 268 |
| 1084 | 3300048908 | Ga0496105_0008791 | Ga0496105_0008791_5146_5958 | 268 |
| 1085 | 3300048908 | Ga0496105_0013347 | Ga0496105_0013347_5126_5941 | 268 |
| 1086 | 3300048908 | Ga0496105_0015561 | Ga0496105_0015561_3707_4525 | 268 |
| 1087 | 3300048908 | Ga0496105_0124523 | Ga0496105_0124523_280_1095 | 268 |
| 1088 | 3300048908 | Ga0496105_0174614 | Ga0496105_0174614_48_863 | 268 |
| 1089 | 3300048909 | Ga0496106_0000980 | Ga0496106_0000980_9017_9832 | 268 |
| 1090 | 3300048909 | Ga0496106_0338085 | Ga0496106_0338085_378_1193 | 268 |
| 1091 | 3300048910 | Ga0496107_0104295 | Ga0496107_0104295_281_1096 | 268 |
| 1092 | 3300048911 | Ga0496108_0024933 | Ga0496108_0024933_2822_3640 | 268 |
| 1093 | 3300048912 | Ga0496109_0008485 | Ga0496109_0008485_5040_5858 | 268 |
| 1094 | 3300048912 | Ga0496109_0016756 | Ga0496109_0016756_2959_3774 | 268 |
| 1095 | 3300048913 | Ga0496110_0052601 | Ga0496110_0052601_982_1800 | 268 |
| 1096 | 3300048913 | Ga0496110_0187839 | Ga0496110_0187839_889_1704 | 268 |
| 1097 | 3300048914 | Ga0496111_0008455 | Ga0496111_0008455_4275_5093 | 268 |
| 1098 | 3300048914 | Ga0496111_0198771 | Ga0496111_0198771_364_1176 | 268 |
| 1099 | 3300048914 | Ga0496111_0318632 | Ga0496111_0318632_323_1138 | 268 |
| 1100 | 3300048915 | Ga0496112_0011755 | Ga0496112_0011755_6216_7034 | 268 |
| 1101 | 3300048915 | Ga0496112_0045182 | Ga0496112_0045182_2274_3089 | 268 |
| 1102 | 3300048915 | Ga0496112_0694900 | Ga0496112_0694900_97_909 | 268 |
| 1103 | 3300048916 | Ga0496113_0004620 | Ga0496113_0004620_5168_5986 | 268 |
| 1104 | 3300048917 | Ga0496114_0068014 | Ga0496114_0068014_1591_2403 | 268 |
| 1105 | 3300048917 | Ga0496114_0228009 | Ga0496114_0228009_747_1562 | 268 |
| 1106 | 3300048917 | Ga0496114_0284169 | Ga0496114_0284169_471_1286 | 268 |
| 1107 | 3300048918 | Ga0496115_0070017 | Ga0496115_0070017_321_1139 | 268 |
| 1108 | 3300048918 | Ga0496115_0083471 | Ga0496115_0083471_782_1597 | 268 |
| 1109 | 3300048918 | Ga0496115_0218197 | Ga0496115_0218197_309_1124 | 268 |
| 1110 | 3300048920 | Ga0496117_0068342 | Ga0496117_0068342_1277_2092 | 268 |
| 1111 | 3300048920 | Ga0496117_0073771 | Ga0496117_0073771_386_1201 | 268 |
| 1112 | 3300048920 | Ga0496117_0104448 | Ga0496117_0104448_152_967 | 268 |
| 1113 | 3300048921 | Ga0496118_0014101 | Ga0496118_0014101_5918_6733 | 268 |
| 1114 | 3300048921 | Ga0496118_0126344 | Ga0496118_0126344_504_1319 | 268 |
| 1115 | 3300048921 | Ga0496118_0158501 | Ga0496118_0158501_326_1138 | 268 |
| 1116 | 3300048922 | Ga0496119_0015903 | Ga0496119_0015903_209_1024 | 268 |
| 1117 | 3300048922 | Ga0496119_0152820 | Ga0496119_0152820_143_958 | 268 |
| 1118 | 3300048923 | Ga0496120_0079787 | Ga0496120_0079787_872_1684 | 268 |
| 1119 | 3300048923 | Ga0496120_0135629 | Ga0496120_0135629_383_1198 | 268 |
| 1120 | 3300048924 | Ga0496121_0002350 | Ga0496121_0002350_16142_16954 | 268 |
| 1121 | 3300048924 | Ga0496121_0047898 | Ga0496121_0047898_1754_2569 | 268 |
| 1122 | 3300048924 | Ga0496121_0083183 | Ga0496121_0083183_194_1009 | 268 |
| 1123 | 3300048924 | Ga0496121_0117918 | Ga0496121_0117918_654_1469 | 268 |
| 1124 | 3300048924 | Ga0496121_0356939 | Ga0496121_0356939_135_950 | 268 |
| 1125 | 3300048925 | Ga0496122_0011018 | Ga0496122_0011018_6497_7312 | 268 |
| 1126 | 3300048925 | Ga0496122_0209944 | Ga0496122_0209944_122_937 | 268 |
| 1127 | 3300048927 | Ga0496124_0100937 | Ga0496124_0100937_1023_1835 | 268 |
| 1128 | 3300048927 | Ga0496124_0137125 | Ga0496124_0137125_316_1131 | 268 |
| 1129 | 3300048927 | Ga0496124_0183784 | Ga0496124_0183784_644_1459 | 268 |
| 1130 | 3300048928 | Ga0496125_0028905 | Ga0496125_0028905_1028_1843 | 268 |
| 1131 | 3300048928 | Ga0496125_0034333 | Ga0496125_0034333_261_1073 | 268 |
| 1132 | 3300048928 | Ga0496125_0038831 | Ga0496125_0038831_825_1640 | 268 |
| 1133 | 3300048928 | Ga0496125_0110409 | Ga0496125_0110409_357_1172 | 268 |
| 1134 | 3300048928 | Ga0496125_0127047 | Ga0496125_0127047_834_1649 | 268 |
| 1135 | 3300048928 | Ga0496125_0161986 | Ga0496125_0161986_125_940 | 268 |
| 1136 | 3300048928 | Ga0496125_0273739 | Ga0496125_0273739_205_1014 | 268 |
| 1137 | 3300048929 | Ga0496126_0008744 | Ga0496126_0008744_4389_5204 | 268 |
| 1138 | 3300048929 | Ga0496126_0073740 | Ga0496126_0073740_352_1164 | 268 |
| 1139 | 3300048929 | Ga0496126_0136250 | Ga0496126_0136250_1015_1830 | 268 |
| 1140 | 3300049569 | Ga0501032_0120620 | Ga0501032_0120620_682_1494 | 268 |
| 1141 | 3300049579 | Ga0501043_0015152 | Ga0501043_0015152_632_1444 | 268 |
| 1142 | 3300049580 | Ga0501046_0276539 | Ga0501046_0276539_266_1084 | 268 |
| 1143 | 3300049581 | Ga0501047_0069695 | Ga0501047_0069695_1965_2783 | 268 |
| 1144 | 3300049581 | Ga0501047_0187189 | Ga0501047_0187189_371_1189 | 268 |
| 1145 | 3300049586 | Ga0501070_0002569 | Ga0501070_0002569_3423_4241 | 268 |
| 1146 | 3300049589 | Ga0501073_0099041 | Ga0501073_0099041_520_1338 | 268 |
| 1147 | 3300049741 | Ga0501079_0447739 | Ga0501079_0447739_86_904 | 268 |
| 1148 | 3300049742 | Ga0501080_0051457 | Ga0501080_0051457_810_1628 | 268 |
| 1149 | 3300049822 | Ga0501035_0241920 | Ga0501035_0241920_166_984 | 268 |
| 1150 | 3300049823 | Ga0501044_0099517 | Ga0501044_0099517_1556_2374 | 268 |
| 1151 | 3300050492 | nmdc:mga0yw44_353071_c1 | nmdc:mga0yw44_353071_c1_129_944 | 268 |
| 1152 | 3300050493 | nmdc:mga0k408_56476_c1 | nmdc:mga0k408_56476_c1_189_1004 | 268 |
| 1153 | 3300050494 | nmdc:mga06z11_212317_c1 | nmdc:mga06z11_212317_c1_192_1007 | 268 |
| 1154 | 3300050495 | nmdc:mga04h51_43115_c1 | nmdc:mga04h51_43115_c1_235_1050 | 268 |
| 1155 | 3300050496 | nmdc:mga07m45_167480_c2 | nmdc:mga07m45_167480_c2_38_853 | 268 |
| 1156 | 3300050496 | nmdc:mga07m45_26783_c1 | nmdc:mga07m45_26783_c1_674_1489 | 268 |
| 1157 | 3300050516 | nmdc:mga0sz30_101728_c1 | nmdc:mga0sz30_101728_c1_333_1148 | 268 |
| 1158 | 3300050516 | nmdc:mga0sz30_7774_c1 | nmdc:mga0sz30_7774_c1_3090_3905 | 268 |
| 1159 | 3300053079 | Ga0500610_0098594 | Ga0500610_0098594_296_1111 | 268 |
| 1160 | 3300053080 | Ga0500635_0003164 | Ga0500635_0003164_35_850 | 268 |
| 1161 | 3300053083 | Ga0495655_0070491 | Ga0495655_0070491_94_909 | 268 |
| 1162 | 3300053085 | Ga0495619_0086548 | Ga0495619_0086548_1245_2060 | 268 |
| 1163 | 3300053087 | Ga0500643_000085 | Ga0500643_000085_82687_83502 | 268 |
| 1164 | 3300053091 | Ga0500647_0048749 | Ga0500647_0048749_783_1601 | 268 |
| 1165 | 3300053092 | Ga0500583_0057464 | Ga0500583_0057464_335_1150 | 268 |
| 1166 | 3300053093 | Ga0500651_0019704 | Ga0500651_0019704_1537_2352 | 268 |
| 1167 | 3300053093 | Ga0500651_0092317 | Ga0500651_0092317_992_1807 | 268 |
| 1168 | 3300053093 | Ga0500651_0157314 | Ga0500651_0157314_87_902 | 268 |
| 1169 | 3300053094 | Ga0500566_0040638 | Ga0500566_0040638_1436_2251 | 268 |
| 1170 | 3300053094 | Ga0500566_0152408 | Ga0500566_0152408_195_1010 | 268 |
| 1171 | 3300053098 | Ga0500650_0052623 | Ga0500650_0052623_782_1597 | 268 |
| 1172 | 3300053103 | Ga0500555_001913 | Ga0500555_001913_686_1501 | 268 |
| 1173 | 3300053105 | Ga0500557_000002 | Ga0500557_000002_90065_90883 | 268 |
| 1174 | 3300053108 | Ga0500562_013305 | Ga0500562_013305_724_1539 | 268 |
| 1175 | 3300053111 | Ga0500572_000025 | Ga0500572_000025_25247_26065 | 268 |
| 1176 | 3300053111 | Ga0500572_005987 | Ga0500572_005987_1178_1993 | 268 |
| 1177 | 3300053119 | Ga0500595_031540 | Ga0500595_031540_586_1401 | 268 |
| 1178 | 3300053126 | Ga0500621_113381 | Ga0500621_113381_133_948 | 268 |
| 1179 | 3300053130 | Ga0500642_0000144 | Ga0500642_0000144_10729_11547 | 268 |
| 1180 | 3300053130 | Ga0500642_0018643 | Ga0500642_0018643_502_1317 | 268 |
| 1181 | 3300053134 | Ga0500658_0004773 | Ga0500658_0004773_3152_3967 | 268 |
| 1182 | 3300053134 | Ga0500658_0051682 | Ga0500658_0051682_743_1558 | 268 |
| 1183 | 3300053136 | Ga0500559_0000289 | Ga0500559_0000289_19906_20724 | 268 |
| 1184 | 3300053139 | Ga0500568_0001209 | Ga0500568_0001209_7972_8787 | 268 |
| 1185 | 3300053142 | Ga0500577_0080777 | Ga0500577_0080777_257_1072 | 268 |
| 1186 | 3300053148 | Ga0500590_031643 | Ga0500590_031643_598_1413 | 268 |
| 1187 | 3300053151 | Ga0500604_0007881 | Ga0500604_0007881_560_1375 | 268 |
| 1188 | 3300053153 | Ga0500616_0073262 | Ga0500616_0073262_454_1269 | 268 |
| 1189 | 3300053155 | Ga0500620_001333 | Ga0500620_001333_3289_4104 | 268 |
| 1190 | 3300053156 | Ga0500622_0016487 | Ga0500622_0016487_2579_3394 | 268 |
| 1191 | 3300053160 | Ga0500633_0000136 | Ga0500633_0000136_952_1767 | 268 |
| 1192 | 3300053162 | Ga0500638_048019 | Ga0500638_048019_533_1348 | 268 |
| 1193 | 3300053163 | Ga0500639_113107 | Ga0500639_113107_299_1117 | 268 |
| 1194 | 3300053177 | Ga0500636_0000356 | Ga0500636_0000356_14137_14952 | 268 |
| 1195 | 3300053725 | Ga0500576_066515 | Ga0500576_066515_704_1522 | 268 |
| 1196 | 3300053729 | Ga0500625_005076 | Ga0500625_005076_1192_2010 | 268 |
| 1197 | 3300053731 | Ga0500609_001507 | Ga0500609_001507_2281_3096 | 268 |
| 1198 | 3300053735 | Ga0500596_001272 | Ga0500596_001272_895_1713 | 268 |
| 1199 | 3300053737 | Ga0500601_000107 | Ga0500601_000107_14972_15787 | 268 |
| 1200 | 3300055283 | Ga0500661_004482 | Ga0500661_004482_721_1536 | 268 |
| 1201 | 3300060353 | Ga0501082_0215851 | Ga0501082_0215851_760_1572 | 268 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4o1w-assembly2.cif.gz_B | crystal structure of colwellia psychrerythraea cytochrome c | 0.9649 | 92 | 166 |
| 2zzs-assembly1.cif.gz_A | crystal structure of cytochrome c554 from vibrio parahaemolyticus strain rimd2210633 | 0.956 | 92 | 166 |
| 2zzs-assembly29.cif.gz_3 | crystal structure of cytochrome c554 from vibrio parahaemolyticus strain rimd2210633 | 0.9334 | 92 | 166 |
| 4o1w-assembly2.cif.gz_B | crystal structure of colwellia psychrerythraea cytochrome c | 0.9174 | 92 | 166 |
| 5n1t-assembly1.cif.gz_B | crystal structure of complex between flavocytochrome c and copper chaperone copc from t. paradoxus | 0.9001 | 94 | 164 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4o1wD00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9633 | 92 | 166 | 1.10.760.10 |
| 2zzsS00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9435 | 92 | 166 | 1.10.760.10 |
| 3vrdA01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9365 | 95 | 168 | 1.10.760.10 |
| 2zzs300 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9334 | 92 | 166 | 1.10.760.10 |
| 2zzsM00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9312 | 93 | 164 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5PH06-F1-model_v4 | Cytochrome c | 0.9725 | 92 | 169 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A832E710-F1-model_v4 | Cytochrome c | 0.9686 | 90 | 166 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A5C8M5W2-F1-model_v4 | Cytochrome c | 0.9646 | 92 | 173 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A0N0JTD0-F1-model_v4 | Cytochrome c domain-containing protein | 0.9514 | 95 | 168 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A6N6P183-F1-model_v4 | C-type cytochrome | 0.95 | 94 | 166 |
GO:0009055
GO:0020037 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar