F491542
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1197 | 621 | 2394 | 339 |
Family's Representative Sequence
| Representative Sequence | 3300005844|Ga0068862_100168346|Ga0068862_1001683462 |
| Length | 399 |
| Sequence | LTELHFSKTRVAGERASFRRRFKVQPAPPYNAPCLSFSPAYRDPSVPITRRRVFGVLAGAAAAVGVPSIWISNMKTYEGPVSDHFDGTRFFDPDGVPPKSLGEVLRWQFGTDRKRASWPDWVPNAHSDTPPPRVSGDKVRLSFVGHVTWLIQTANLNILIDPVWSMRASPVSFAGPHRHNDPGIAFDALPKIDVVLVSHGHYDHLDIATLSKLTEKFSPRVITPLGNDVTMRDTDAAIKAEGFDWQDRVELGNGIAVTLVPTRHWSARGLFDRNKALWASFVLETPAGKIYIVCDSGYGEGKHFRRVAEKHGPLRLAILPIGAYEPRWFMKDQHMNPSDAVKALADCGASQALAHHHGTFQLTDEAIDAPVMALDEALKEAKILPERFAALKPGQVYEI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 47 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 50 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 51 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 57 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 64 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 65 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 87 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 88 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 89 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 90 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 91 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 92 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 93 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 148 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 149 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 150 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 155 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 156 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 157 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 160 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 161 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 162 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 164 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 165 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 166 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 174 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 175 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 176 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 180 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 184 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 185 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 191 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 202 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 203 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 204 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 205 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 206 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 207 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 208 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 209 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 210 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 211 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 212 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 290 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 294 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 295 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 299 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 300 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 301 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 302 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 303 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 304 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 305 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 306 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 307 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 308 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 309 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 310 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 311 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 312 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 340 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 343 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 344 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 345 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 348 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 351 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 354 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 355 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 356 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 357 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 358 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 359 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 360 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 361 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 362 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 363 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 364 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 365 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 366 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 367 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 368 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 369 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 370 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 372 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 373 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 375 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 376 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 377 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 378 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 379 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 380 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 381 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 382 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 383 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 384 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 385 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 386 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 387 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 388 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 389 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 390 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 391 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 392 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 395 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 396 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 397 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 398 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 399 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 400 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 401 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 402 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 403 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 404 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 405 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 406 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 407 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 408 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 409 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 410 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 411 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 412 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 413 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 414 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 415 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 416 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 417 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 418 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 419 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 420 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 421 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 422 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 423 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 424 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 425 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 426 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 427 | 2791355199 | |||
| 428 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 429 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 430 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 431 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 432 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 433 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 434 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 435 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 436 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 437 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 438 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 439 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 440 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 441 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 442 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 443 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 444 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 445 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 446 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 447 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 448 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 449 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 450 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 451 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 452 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 453 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 454 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 455 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 456 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 457 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 458 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 459 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 460 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 461 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 462 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 463 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 464 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 465 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 466 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 467 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 468 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 469 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 470 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 471 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 472 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 473 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 474 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 475 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 476 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 477 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 478 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 479 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 480 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 481 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 482 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 483 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 484 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 485 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 486 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 487 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 488 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 489 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 490 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 491 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 492 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 493 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 494 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 495 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 496 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 497 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 498 | 2906610324 | |||
| 499 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 500 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 501 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 502 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 503 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 504 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 505 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 506 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 507 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 508 | 2922368715 | |||
| 509 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 510 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 511 | 2922425934 | |||
| 512 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 513 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 514 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 515 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 516 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 517 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 518 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 519 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 520 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 521 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 522 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 523 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 524 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 525 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 526 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 527 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 528 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 529 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 530 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 531 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 532 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 533 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 534 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 535 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 536 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 537 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 538 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 539 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 540 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 541 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 542 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 543 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 544 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 545 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 546 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 547 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 548 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 549 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 550 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 551 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 552 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 553 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 554 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 555 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 556 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 557 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 558 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 559 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 560 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 561 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 562 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 563 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 564 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 565 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 566 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 567 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 568 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 569 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 570 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 571 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 572 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 573 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 574 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 575 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 576 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 577 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 578 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 579 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 580 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 581 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 582 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 583 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 584 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 585 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 586 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 587 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 588 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 589 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 590 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 591 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 592 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 593 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 594 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 595 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 596 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 597 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 598 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 599 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 600 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 601 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 602 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 603 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 604 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 605 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 606 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 607 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 608 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 609 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 610 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 611 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 612 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 613 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 614 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 615 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 616 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 617 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 618 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 619 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 620 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 621 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.31 |
| Metatranscriptomes | 0 |
| Isolates | 18.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.28 |
| Nodule | 14.95 |
| Rhizoplane | 7.1 |
| Rhizosphere | 54.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068862_100168346 | 3300005844 | Bacteria | 1960 |
| 2 | JGI24737J22298_10014205 | 3300001990 | Bacteria | 2586 |
| 3 | JGI25406J46586_10045805 | 3300003203 | Bacteria | 1502 |
| 4 | JGI25153J46596_10006802 | 3300003215 | Bacteria | 5727 |
| 5 | JGI25153J46596_10011847 | 3300003215 | Bacteria | 3821 |
| 6 | JGI25153J46596_10015051 | 3300003215 | Bacteria | 3175 |
| 7 | JGI25153J46596_10015527 | 3300003215 | Bacteria | 3095 |
| 8 | JGI25160J50197_1012785 | 3300003354 | Bacteria | 2893 |
| 9 | JGI25404J52841_10005838 | 3300003659 | Bacteria | 2553 |
| 10 | JGI25404J52841_10017706 | 3300003659 | Bacteria | 1545 |
| 11 | JGI25404J52841_10018823 | 3300003659 | Bacteria | 1496 |
| 12 | Ga0055543_1014573 | 3300004625 | Bacteria | 1530 |
| 13 | Ga0065165_1004935 | 3300005262 | Bacteria | 7860 |
| 14 | Ga0065165_1005401 | 3300005262 | Bacteria | 7210 |
| 15 | Ga0065165_1021918 | 3300005262 | Bacteria | 2206 |
| 16 | Ga0070683_100047414 | 3300005329 | Bacteria | 3970 |
| 17 | Ga0070683_100120003 | 3300005329 | Bacteria | 2483 |
| 18 | Ga0070670_100183742 | 3300005331 | Bacteria | 1815 |
| 19 | Ga0070680_100053553 | 3300005336 | Bacteria | 3294 |
| 20 | Ga0070680_100114431 | 3300005336 | Bacteria | 2247 |
| 21 | Ga0070680_100370426 | 3300005336 | Bacteria | 1219 |
| 22 | Ga0070689_100271724 | 3300005340 | Bacteria | 1403 |
| 23 | Ga0070691_10115497 | 3300005341 | Bacteria | 1347 |
| 24 | Ga0070668_100031220 | 3300005347 | Bacteria | 4053 |
| 25 | Ga0070668_100052517 | 3300005347 | Bacteria | 3141 |
| 26 | Ga0070673_100352065 | 3300005364 | Bacteria | 1307 |
| 27 | Ga0070709_10000820 | 3300005434 | Bacteria | 17358 |
| 28 | Ga0070709_10007668 | 3300005434 | Bacteria | 5921 |
| 29 | Ga0070714_100011934 | 3300005435 | Bacteria | 6911 |
| 30 | Ga0070714_100025834 | 3300005435 | Bacteria | 4851 |
| 31 | Ga0070714_100034248 | 3300005435 | Bacteria | 4253 |
| 32 | Ga0070714_100062901 | 3300005435 | Bacteria | 3190 |
| 33 | Ga0070714_100079305 | 3300005435 | Bacteria | 2855 |
| 34 | Ga0070713_100003576 | 3300005436 | Bacteria | 10269 |
| 35 | Ga0070713_100047748 | 3300005436 | Bacteria | 3521 |
| 36 | Ga0070713_100081426 | 3300005436 | Bacteria | 2762 |
| 37 | Ga0070710_10000802 | 3300005437 | Bacteria | 15088 |
| 38 | Ga0070710_10001532 | 3300005437 | Bacteria | 10922 |
| 39 | Ga0070711_100009673 | 3300005439 | Bacteria | 5940 |
| 40 | Ga0070711_100012226 | 3300005439 | Bacteria | 5358 |
| 41 | Ga0070711_100012351 | 3300005439 | Bacteria | 5332 |
| 42 | Ga0070711_100158534 | 3300005439 | Bacteria | 1713 |
| 43 | Ga0070663_100032201 | 3300005455 | Bacteria | 3612 |
| 44 | Ga0070663_100045514 | 3300005455 | Bacteria | 3100 |
| 45 | Ga0070663_100071628 | 3300005455 | Bacteria | 2522 |
| 46 | Ga0070663_100085037 | 3300005455 | Bacteria | 2333 |
| 47 | Ga0070663_100156535 | 3300005455 | Bacteria | 1751 |
| 48 | Ga0070663_100175865 | 3300005455 | Bacteria | 1657 |
| 49 | Ga0070663_100184959 | 3300005455 | Bacteria | 1618 |
| 50 | Ga0070663_100366543 | 3300005455 | Bacteria | 1170 |
| 51 | Ga0070678_100263059 | 3300005456 | Bacteria | 1452 |
| 52 | Ga0070681_10001077 | 3300005458 | Bacteria | 23275 |
| 53 | Ga0070681_10028258 | 3300005458 | Bacteria | 5638 |
| 54 | Ga0070707_100149757 | 3300005468 | Bacteria | 2272 |
| 55 | Ga0070698_100090319 | 3300005471 | Bacteria | 3047 |
| 56 | Ga0070698_100264821 | 3300005471 | Bacteria | 1651 |
| 57 | Ga0070699_100359358 | 3300005518 | Bacteria | 1313 |
| 58 | Ga0070679_100002400 | 3300005530 | Bacteria | 16984 |
| 59 | Ga0070679_100009606 | 3300005530 | Bacteria | 9151 |
| 60 | Ga0070679_100085678 | 3300005530 | Bacteria | 3137 |
| 61 | Ga0070679_100109961 | 3300005530 | Bacteria | 2742 |
| 62 | Ga0070679_100135439 | 3300005530 | Bacteria | 2444 |
| 63 | Ga0070679_100158674 | 3300005530 | Bacteria | 2236 |
| 64 | Ga0070684_100025298 | 3300005535 | Bacteria | 4988 |
| 65 | Ga0068853_100031608 | 3300005539 | Bacteria | 4478 |
| 66 | Ga0068853_100045931 | 3300005539 | Bacteria | 3743 |
| 67 | Ga0068853_100048615 | 3300005539 | Bacteria | 3644 |
| 68 | Ga0068853_100068200 | 3300005539 | Bacteria | 3092 |
| 69 | Ga0068853_100273595 | 3300005539 | Bacteria | 1555 |
| 70 | Ga0070672_100135179 | 3300005543 | Bacteria | 2030 |
| 71 | Ga0070665_100029471 | 3300005548 | Bacteria | 5524 |
| 72 | Ga0070665_100031667 | 3300005548 | Bacteria | 5322 |
| 73 | Ga0070665_100065669 | 3300005548 | Bacteria | 3639 |
| 74 | Ga0070665_100081254 | 3300005548 | Bacteria | 3247 |
| 75 | Ga0070665_100104376 | 3300005548 | Bacteria | 2837 |
| 76 | Ga0070665_100109625 | 3300005548 | Bacteria | 2763 |
| 77 | Ga0068855_100037045 | 3300005563 | Bacteria | 5803 |
| 78 | Ga0068855_100060155 | 3300005563 | Bacteria | 4443 |
| 79 | Ga0068855_100063458 | 3300005563 | Bacteria | 4311 |
| 80 | Ga0068855_100378058 | 3300005563 | Bacteria | 1556 |
| 81 | Ga0070664_100283958 | 3300005564 | Bacteria | 1493 |
| 82 | Ga0070664_100481054 | 3300005564 | Bacteria | 1143 |
| 83 | Ga0068857_100001037 | 3300005577 | Bacteria | 21487 |
| 84 | Ga0068857_100025105 | 3300005577 | Bacteria | 5249 |
| 85 | Ga0068857_100033794 | 3300005577 | Bacteria | 4522 |
| 86 | Ga0068857_100300707 | 3300005577 | Bacteria | 1479 |
| 87 | Ga0068857_100461448 | 3300005577 | Bacteria | 1189 |
| 88 | Ga0068854_100034116 | 3300005578 | Bacteria | 3552 |
| 89 | Ga0068854_100138437 | 3300005578 | Bacteria | 1865 |
| 90 | Ga0068856_100000883 | 3300005614 | Bacteria | 32112 |
| 91 | Ga0068856_100142760 | 3300005614 | Bacteria | 2402 |
| 92 | Ga0068856_100258285 | 3300005614 | Bacteria | 1757 |
| 93 | Ga0068856_100260458 | 3300005614 | Bacteria | 1750 |
| 94 | Ga0070702_100137203 | 3300005615 | Bacteria | 1553 |
| 95 | Ga0068852_100094545 | 3300005616 | Bacteria | 2681 |
| 96 | Ga0068859_100047861 | 3300005617 | Bacteria | 4296 |
| 97 | Ga0068864_100072570 | 3300005618 | Bacteria | 3000 |
| 98 | Ga0068851_10000558 | 3300005834 | Bacteria | 16219 |
| 99 | Ga0068870_10135604 | 3300005840 | Bacteria | 1435 |
| 100 | Ga0068858_100495047 | 3300005842 | Bacteria | 1181 |
| 101 | Ga0068860_100000477 | 3300005843 | Bacteria | 49839 |
| 102 | Ga0068860_100209710 | 3300005843 | Bacteria | 1889 |
| 103 | Ga0068860_100289839 | 3300005843 | Bacteria | 1601 |
| 104 | Ga0081455_10002724 | 3300005937 | Bacteria | 20860 |
| 105 | Ga0081455_10007370 | 3300005937 | Bacteria | 11598 |
| 106 | Ga0081455_10042159 | 3300005937 | Bacteria | 4006 |
| 107 | Ga0081540_1003488 | 3300005983 | Bacteria | 12411 |
| 108 | Ga0081540_1007876 | 3300005983 | Bacteria | 7530 |
| 109 | Ga0081540_1008854 | 3300005983 | Bacteria | 6988 |
| 110 | Ga0081540_1014559 | 3300005983 | Bacteria | 5030 |
| 111 | Ga0081540_1020591 | 3300005983 | Bacteria | 3960 |
| 112 | Ga0081540_1029453 | 3300005983 | Bacteria | 3058 |
| 113 | Ga0081540_1033178 | 3300005983 | Bacteria | 2808 |
| 114 | Ga0081540_1041232 | 3300005983 | Bacteria | 2396 |
| 115 | Ga0081540_1042419 | 3300005983 | Bacteria | 2347 |
| 116 | Ga0081540_1049844 | 3300005983 | Bacteria | 2085 |
| 117 | Ga0081539_10000265 | 3300005985 | Bacteria | 120457 |
| 118 | Ga0081539_10000371 | 3300005985 | Bacteria | 98455 |
| 119 | Ga0081539_10043985 | 3300005985 | Bacteria | 2582 |
| 120 | Ga0081539_10085002 | 3300005985 | Bacteria | 1652 |
| 121 | Ga0070717_10016786 | 3300006028 | Bacteria | 5683 |
| 122 | Ga0070717_10061429 | 3300006028 | Bacteria | 3114 |
| 123 | Ga0075365_10008318 | 3300006038 | Bacteria | 5880 |
| 124 | Ga0075365_10066442 | 3300006038 | Bacteria | 2419 |
| 125 | Ga0075365_10067630 | 3300006038 | Bacteria | 2399 |
| 126 | Ga0075365_10109412 | 3300006038 | Bacteria | 1898 |
| 127 | Ga0075368_10002496 | 3300006042 | Bacteria | 6020 |
| 128 | Ga0075363_100004174 | 3300006048 | Bacteria | 6275 |
| 129 | Ga0075363_100028319 | 3300006048 | Bacteria | 2880 |
| 130 | Ga0075364_10058436 | 3300006051 | Bacteria | 2527 |
| 131 | Ga0070715_10000275 | 3300006163 | Bacteria | 12448 |
| 132 | Ga0070716_100019113 | 3300006173 | Bacteria | 3578 |
| 133 | Ga0070712_100005859 | 3300006175 | Bacteria | 7608 |
| 134 | Ga0070712_100078337 | 3300006175 | Bacteria | 2385 |
| 135 | Ga0075367_10010418 | 3300006178 | Bacteria | 4885 |
| 136 | Ga0075367_10087546 | 3300006178 | Bacteria | 1892 |
| 137 | Ga0075369_10022548 | 3300006186 | Bacteria | 2597 |
| 138 | Ga0075369_10022934 | 3300006186 | Bacteria | 2577 |
| 139 | Ga0075369_10047007 | 3300006186 | Bacteria | 1860 |
| 140 | Ga0075369_10101802 | 3300006186 | Bacteria | 1289 |
| 141 | Ga0075366_10017520 | 3300006195 | Bacteria | 4122 |
| 142 | Ga0075370_10010551 | 3300006353 | Bacteria | 4834 |
| 143 | Ga0075370_10102371 | 3300006353 | Bacteria | 1658 |
| 144 | Ga0075370_10127604 | 3300006353 | Bacteria | 1483 |
| 145 | Ga0075434_100107896 | 3300006871 | Bacteria | 2795 |
| 146 | Ga0068865_100068195 | 3300006881 | Bacteria | 2514 |
| 147 | Ga0068865_100073289 | 3300006881 | Bacteria | 2434 |
| 148 | Ga0068865_100082031 | 3300006881 | Bacteria | 2317 |
| 149 | Ga0097620_100047862 | 3300006931 | Bacteria | 4296 |
| 150 | Ga0099824_1010644 | 3300006942 | Bacteria | 10734 |
| 151 | Ga0099824_1012314 | 3300006942 | Bacteria | 9369 |
| 152 | Ga0099822_1012672 | 3300006943 | Bacteria | 10032 |
| 153 | Ga0099823_1023025 | 3300006944 | Bacteria | 5730 |
| 154 | Ga0075435_100053972 | 3300007076 | Bacteria | 3243 |
| 155 | Ga0099794_10029658 | 3300007265 | Bacteria | 2550 |
| 156 | Ga0099794_10093906 | 3300007265 | Bacteria | 1491 |
| 157 | Ga0099794_10122178 | 3300007265 | Bacteria | 1311 |
| 158 | Ga0105240_10002459 | 3300009093 | Bacteria | 29768 |
| 159 | Ga0105240_10012773 | 3300009093 | Bacteria | 11572 |
| 160 | Ga0105240_10014356 | 3300009093 | Bacteria | 10815 |
| 161 | Ga0105240_10075561 | 3300009093 | Bacteria | 4155 |
| 162 | Ga0105240_10088443 | 3300009093 | Bacteria | 3790 |
| 163 | Ga0105240_10171590 | 3300009093 | Bacteria | 2568 |
| 164 | Ga0105240_10211465 | 3300009093 | Bacteria | 2266 |
| 165 | Ga0105240_10409511 | 3300009093 | Bacteria | 1525 |
| 166 | Ga0105247_10099706 | 3300009101 | Bacteria | 1855 |
| 167 | Ga0105241_10000249 | 3300009174 | Bacteria | 40643 |
| 168 | Ga0105241_10067677 | 3300009174 | Bacteria | 2765 |
| 169 | Ga0105241_10427802 | 3300009174 | Bacteria | 1167 |
| 170 | Ga0105248_10126874 | 3300009177 | Bacteria | 2878 |
| 171 | Ga0105248_10173518 | 3300009177 | Bacteria | 2430 |
| 172 | Ga0105248_10294575 | 3300009177 | Bacteria | 1827 |
| 173 | Ga0105237_10017086 | 3300009545 | Bacteria | 7527 |
| 174 | Ga0105237_10050524 | 3300009545 | Bacteria | 4178 |
| 175 | Ga0105237_10094994 | 3300009545 | Bacteria | 2970 |
| 176 | Ga0105237_10130560 | 3300009545 | Bacteria | 2507 |
| 177 | Ga0105237_10264973 | 3300009545 | Bacteria | 1721 |
| 178 | Ga0105237_10399913 | 3300009545 | Bacteria | 1378 |
| 179 | Ga0105237_10473948 | 3300009545 | Bacteria | 1258 |
| 180 | Ga0105238_10014511 | 3300009551 | Bacteria | 7966 |
| 181 | Ga0105238_10038587 | 3300009551 | Bacteria | 4850 |
| 182 | Ga0105238_10186210 | 3300009551 | Bacteria | 2052 |
| 183 | Ga0105239_10047808 | 3300010375 | Bacteria | 4689 |
| 184 | Ga0105239_10096944 | 3300010375 | Bacteria | 3258 |
| 185 | Ga0105239_10170906 | 3300010375 | Bacteria | 2431 |
| 186 | Ga0105239_10171641 | 3300010375 | Bacteria | 2425 |
| 187 | Ga0105239_10297063 | 3300010375 | Bacteria | 1819 |
| 188 | Ga0105239_10334097 | 3300010375 | Bacteria | 1710 |
| 189 | Ga0105239_10347557 | 3300010375 | Bacteria | 1674 |
| 190 | Ga0105239_10481814 | 3300010375 | Bacteria | 1409 |
| 191 | Ga0105239_10511517 | 3300010375 | Bacteria | 1366 |
| 192 | Ga0105246_10059630 | 3300011119 | Bacteria | 2648 |
| 193 | Ga0105246_10286503 | 3300011119 | Bacteria | 1324 |
| 194 | Ga0157370_10365836 | 3300013104 | Bacteria | 1329 |
| 195 | Ga0157369_10040528 | 3300013105 | Bacteria | 5084 |
| 196 | Ga0157369_10128793 | 3300013105 | Bacteria | 2682 |
| 197 | Ga0157369_10331885 | 3300013105 | Bacteria | 1580 |
| 198 | Ga0157374_10356302 | 3300013296 | Bacteria | 1454 |
| 199 | Ga0157378_10087681 | 3300013297 | Bacteria | 2823 |
| 200 | Ga0157372_10072119 | 3300013307 | Bacteria | 3891 |
| 201 | Ga0157372_10448821 | 3300013307 | Bacteria | 1503 |
| 202 | Ga0157372_10537379 | 3300013307 | Bacteria | 1363 |
| 203 | Ga0157375_10015617 | 3300013308 | Bacteria | 6802 |
| 204 | Ga0157375_10364017 | 3300013308 | Bacteria | 1612 |
| 205 | Ga0163163_10018908 | 3300014325 | Bacteria | 6463 |
| 206 | Ga0157380_10053334 | 3300014326 | Bacteria | 3205 |
| 207 | Ga0157380_10707464 | 3300014326 | Bacteria | 1013 |
| 208 | Ga0157379_10041002 | 3300014968 | Bacteria | 4133 |
| 209 | Ga0157379_10430626 | 3300014968 | Bacteria | 1216 |
| 210 | Ga0163161_10100976 | 3300017792 | Bacteria | 2148 |
| 211 | Ga0163161_10196097 | 3300017792 | Bacteria | 1555 |
| 212 | Ga0163161_10241499 | 3300017792 | Bacteria | 1405 |
| 213 | Ga0214544_1000056 | 3300021320 | Bacteria | 132760 |
| 214 | Ga0214542_1000071 | 3300021321 | Bacteria | 124568 |
| 215 | Ga0214545_1000033 | 3300021324 | Bacteria | 124568 |
| 216 | Ga0214543_1000105 | 3300021327 | Bacteria | 108404 |
| 217 | Ga0213874_10047511 | 3300021377 | Bacteria | 1306 |
| 218 | Ga0213876_10002330 | 3300021384 | Bacteria | 11202 |
| 219 | Ga0213875_10000033 | 3300021388 | Bacteria | 170944 |
| 220 | Ga0209563_102230 | 3300025230 | Bacteria | 4492 |
| 221 | Ga0209677_102647 | 3300025253 | Bacteria | 6496 |
| 222 | Ga0209148_1000295 | 3300025254 | Bacteria | 73660 |
| 223 | Ga0209233_1003626 | 3300025261 | Bacteria | 5411 |
| 224 | Ga0209233_1011983 | 3300025261 | Bacteria | 2532 |
| 225 | Ga0209455_1005746 | 3300025272 | Bacteria | 3775 |
| 226 | Ga0209564_1006069 | 3300025295 | Bacteria | 6654 |
| 227 | Ga0209564_1014353 | 3300025295 | Bacteria | 3302 |
| 228 | Ga0209758_1000069 | 3300025297 | Bacteria | 286161 |
| 229 | Ga0209758_1001918 | 3300025297 | Bacteria | 22622 |
| 230 | Ga0209758_1002874 | 3300025297 | Bacteria | 16683 |
| 231 | Ga0209758_1004128 | 3300025297 | Bacteria | 12418 |
| 232 | Ga0209758_1004293 | 3300025297 | Bacteria | 12018 |
| 233 | Ga0209758_1014150 | 3300025297 | Bacteria | 4273 |
| 234 | Ga0209758_1020420 | 3300025297 | Bacteria | 3134 |
| 235 | Ga0209256_1004477 | 3300025299 | Bacteria | 8739 |
| 236 | Ga0207426_1002173 | 3300025302 | Bacteria | 13275 |
| 237 | Ga0207426_1007252 | 3300025302 | Bacteria | 4669 |
| 238 | Ga0207426_1007538 | 3300025302 | Bacteria | 4539 |
| 239 | Ga0207426_1022846 | 3300025302 | Bacteria | 2141 |
| 240 | Ga0207426_1034587 | 3300025302 | Bacteria | 1620 |
| 241 | Ga0209257_1011512 | 3300025304 | Bacteria | 4248 |
| 242 | Ga0209257_1022140 | 3300025304 | Bacteria | 2278 |
| 243 | Ga0207697_10070939 | 3300025315 | Bacteria | 1460 |
| 244 | Ga0207692_10000565 | 3300025898 | Bacteria | 13191 |
| 245 | Ga0207692_10003710 | 3300025898 | Bacteria | 5993 |
| 246 | Ga0207692_10062096 | 3300025898 | Bacteria | 1938 |
| 247 | Ga0207710_10030120 | 3300025900 | Bacteria | 2365 |
| 248 | Ga0207710_10052566 | 3300025900 | Bacteria | 1831 |
| 249 | Ga0207688_10039975 | 3300025901 | Bacteria | 2605 |
| 250 | Ga0207688_10160901 | 3300025901 | Bacteria | 1331 |
| 251 | Ga0207647_10009887 | 3300025904 | Bacteria | 6756 |
| 252 | Ga0207647_10015369 | 3300025904 | Bacteria | 5248 |
| 253 | Ga0207699_10000907 | 3300025906 | Bacteria | 14172 |
| 254 | Ga0207699_10017853 | 3300025906 | Bacteria | 3747 |
| 255 | Ga0207699_10018645 | 3300025906 | Bacteria | 3682 |
| 256 | Ga0207705_10150446 | 3300025909 | Bacteria | 1744 |
| 257 | Ga0207705_10292620 | 3300025909 | Bacteria | 1248 |
| 258 | Ga0207684_10283200 | 3300025910 | Bacteria | 1429 |
| 259 | Ga0207654_10000083 | 3300025911 | Bacteria | 62205 |
| 260 | Ga0207654_10037513 | 3300025911 | Bacteria | 2713 |
| 261 | Ga0207654_10037960 | 3300025911 | Bacteria | 2700 |
| 262 | Ga0207654_10046406 | 3300025911 | Bacteria | 2477 |
| 263 | Ga0207707_10001947 | 3300025912 | Bacteria | 18789 |
| 264 | Ga0207707_10007389 | 3300025912 | Bacteria | 9570 |
| 265 | Ga0207707_10244782 | 3300025912 | Bacteria | 1558 |
| 266 | Ga0207695_10000148 | 3300025913 | Bacteria | 208344 |
| 267 | Ga0207695_10000387 | 3300025913 | Bacteria | 99734 |
| 268 | Ga0207695_10025135 | 3300025913 | Bacteria | 6679 |
| 269 | Ga0207695_10060768 | 3300025913 | Bacteria | 3909 |
| 270 | Ga0207695_10168101 | 3300025913 | Bacteria | 2120 |
| 271 | Ga0207671_10003051 | 3300025914 | Bacteria | 17147 |
| 272 | Ga0207671_10077659 | 3300025914 | Bacteria | 2486 |
| 273 | Ga0207671_10215551 | 3300025914 | Bacteria | 1503 |
| 274 | Ga0207693_10001168 | 3300025915 | Bacteria | 23417 |
| 275 | Ga0207693_10010075 | 3300025915 | Bacteria | 7678 |
| 276 | Ga0207693_10035225 | 3300025915 | Bacteria | 3947 |
| 277 | Ga0207663_10004460 | 3300025916 | Bacteria | 6963 |
| 278 | Ga0207663_10004693 | 3300025916 | Bacteria | 6822 |
| 279 | Ga0207663_10019599 | 3300025916 | Bacteria | 3815 |
| 280 | Ga0207660_10042346 | 3300025917 | Bacteria | 3196 |
| 281 | Ga0207660_10196839 | 3300025917 | Bacteria | 1572 |
| 282 | Ga0207660_10273954 | 3300025917 | Bacteria | 1338 |
| 283 | Ga0207657_10009668 | 3300025919 | Bacteria | 9676 |
| 284 | Ga0207657_10024873 | 3300025919 | Bacteria | 5535 |
| 285 | Ga0207657_10064842 | 3300025919 | Bacteria | 3116 |
| 286 | Ga0207652_10014863 | 3300025921 | Bacteria | 6312 |
| 287 | Ga0207652_10041398 | 3300025921 | Bacteria | 3916 |
| 288 | Ga0207652_10175359 | 3300025921 | Bacteria | 1925 |
| 289 | Ga0207652_10188003 | 3300025921 | Bacteria | 1857 |
| 290 | Ga0207694_10000121 | 3300025924 | Bacteria | 83123 |
| 291 | Ga0207650_10143320 | 3300025925 | Bacteria | 1880 |
| 292 | Ga0207650_10285702 | 3300025925 | Bacteria | 1344 |
| 293 | Ga0207700_10021126 | 3300025928 | Bacteria | 4437 |
| 294 | Ga0207664_10012301 | 3300025929 | Bacteria | 6114 |
| 295 | Ga0207664_10016162 | 3300025929 | Bacteria | 5438 |
| 296 | Ga0207664_10063975 | 3300025929 | Bacteria | 2941 |
| 297 | Ga0207664_10081345 | 3300025929 | Bacteria | 2635 |
| 298 | Ga0207664_10107642 | 3300025929 | Bacteria | 2313 |
| 299 | Ga0207664_10182850 | 3300025929 | Bacteria | 1801 |
| 300 | Ga0207664_10203057 | 3300025929 | Bacteria | 1712 |
| 301 | Ga0207644_10054095 | 3300025931 | Bacteria | 2890 |
| 302 | Ga0207644_10147990 | 3300025931 | Bacteria | 1815 |
| 303 | Ga0207644_10282042 | 3300025931 | Bacteria | 1334 |
| 304 | Ga0207706_10321970 | 3300025933 | Bacteria | 1346 |
| 305 | Ga0207709_10007306 | 3300025935 | Bacteria | 6159 |
| 306 | Ga0207704_10025225 | 3300025938 | Bacteria | 3241 |
| 307 | Ga0207665_10000883 | 3300025939 | Bacteria | 20232 |
| 308 | Ga0207665_10002000 | 3300025939 | Bacteria | 13748 |
| 309 | Ga0207665_10182091 | 3300025939 | Bacteria | 1522 |
| 310 | Ga0207691_10046534 | 3300025940 | Bacteria | 3986 |
| 311 | Ga0207691_10115601 | 3300025940 | Bacteria | 2382 |
| 312 | Ga0207691_10120454 | 3300025940 | Bacteria | 2326 |
| 313 | Ga0207661_10002867 | 3300025944 | Bacteria | 11914 |
| 314 | Ga0207661_10037877 | 3300025944 | Bacteria | 3775 |
| 315 | Ga0207661_10297503 | 3300025944 | Bacteria | 1446 |
| 316 | Ga0207679_10161499 | 3300025945 | Bacteria | 1835 |
| 317 | Ga0207679_10279429 | 3300025945 | Bacteria | 1431 |
| 318 | Ga0207667_10099646 | 3300025949 | Bacteria | 2998 |
| 319 | Ga0207667_10106489 | 3300025949 | Bacteria | 2892 |
| 320 | Ga0207667_10113600 | 3300025949 | Bacteria | 2792 |
| 321 | Ga0207667_10145540 | 3300025949 | Bacteria | 2439 |
| 322 | Ga0207667_10293822 | 3300025949 | Bacteria | 1660 |
| 323 | Ga0207667_10320014 | 3300025949 | Bacteria | 1584 |
| 324 | Ga0207712_10170967 | 3300025961 | Bacteria | 1699 |
| 325 | Ga0207668_10055636 | 3300025972 | Bacteria | 2751 |
| 326 | Ga0207668_10071498 | 3300025972 | Bacteria | 2478 |
| 327 | Ga0207668_10089385 | 3300025972 | Bacteria | 2258 |
| 328 | Ga0207668_10134074 | 3300025972 | Bacteria | 1895 |
| 329 | Ga0207668_10201416 | 3300025972 | Bacteria | 1585 |
| 330 | Ga0207668_10208465 | 3300025972 | Bacteria | 1561 |
| 331 | Ga0207640_10055768 | 3300025981 | Bacteria | 2590 |
| 332 | Ga0207640_10111808 | 3300025981 | Bacteria | 1938 |
| 333 | Ga0207677_10109413 | 3300026023 | Bacteria | 2054 |
| 334 | Ga0207639_10105577 | 3300026041 | Bacteria | 2285 |
| 335 | Ga0207639_10105616 | 3300026041 | Bacteria | 2285 |
| 336 | Ga0207639_10273504 | 3300026041 | Bacteria | 1483 |
| 337 | Ga0207678_10007286 | 3300026067 | Bacteria | 9804 |
| 338 | Ga0207678_10023772 | 3300026067 | Bacteria | 5359 |
| 339 | Ga0207678_10030943 | 3300026067 | Bacteria | 4672 |
| 340 | Ga0207678_10049177 | 3300026067 | Bacteria | 3644 |
| 341 | Ga0207678_10053564 | 3300026067 | Bacteria | 3477 |
| 342 | Ga0207678_10095444 | 3300026067 | Bacteria | 2541 |
| 343 | Ga0207678_10178177 | 3300026067 | Bacteria | 1815 |
| 344 | Ga0207678_10411329 | 3300026067 | Bacteria | 1172 |
| 345 | Ga0207702_10000004 | 3300026078 | Bacteria | 422182 |
| 346 | Ga0207702_10000318 | 3300026078 | Bacteria | 55209 |
| 347 | Ga0207702_10512317 | 3300026078 | Bacteria | 1170 |
| 348 | Ga0207641_10354695 | 3300026088 | Bacteria | 1399 |
| 349 | Ga0207648_10111460 | 3300026089 | Bacteria | 2402 |
| 350 | Ga0207676_10142898 | 3300026095 | Bacteria | 2051 |
| 351 | Ga0207676_10280626 | 3300026095 | Bacteria | 1512 |
| 352 | Ga0207674_10005964 | 3300026116 | Bacteria | 14418 |
| 353 | Ga0207674_10006033 | 3300026116 | Bacteria | 14333 |
| 354 | Ga0207674_10012348 | 3300026116 | Bacteria | 9549 |
| 355 | Ga0207674_10108974 | 3300026116 | Bacteria | 2746 |
| 356 | Ga0207674_10336032 | 3300026116 | Bacteria | 1461 |
| 357 | Ga0207675_100026733 | 3300026118 | Bacteria | 5371 |
| 358 | Ga0207675_100221006 | 3300026118 | Bacteria | 1825 |
| 359 | Ga0207675_100317294 | 3300026118 | Bacteria | 1521 |
| 360 | Ga0207683_10063270 | 3300026121 | Bacteria | 3259 |
| 361 | Ga0207683_10175358 | 3300026121 | Bacteria | 1943 |
| 362 | Ga0207698_10128272 | 3300026142 | Bacteria | 2162 |
| 363 | Ga0207698_10263227 | 3300026142 | Bacteria | 1585 |
| 364 | Ga0209389_1000157 | 3300027296 | Bacteria | 56696 |
| 365 | Ga0209389_1000349 | 3300027296 | Bacteria | 27996 |
| 366 | Ga0209589_1000035 | 3300027357 | Bacteria | 134091 |
| 367 | Ga0209589_1003843 | 3300027357 | Bacteria | 26144 |
| 368 | Ga0209489_100079 | 3300027361 | Bacteria | 134091 |
| 369 | Ga0209489_101111 | 3300027361 | Bacteria | 54702 |
| 370 | Ga0209489_103974 | 3300027361 | Bacteria | 27996 |
| 371 | Ga0209700_100011 | 3300027363 | Bacteria | 362159 |
| 372 | Ga0209700_100077 | 3300027363 | Bacteria | 134091 |
| 373 | Ga0268266_10001236 | 3300028379 | Bacteria | 31292 |
| 374 | Ga0268266_10031941 | 3300028379 | Bacteria | 4473 |
| 375 | Ga0268266_10104133 | 3300028379 | Bacteria | 2505 |
| 376 | Ga0268266_10209638 | 3300028379 | Bacteria | 1786 |
| 377 | Ga0268265_10113357 | 3300028380 | Bacteria | 2218 |
| 378 | Ga0268265_10367284 | 3300028380 | Bacteria | 1319 |
| 379 | Ga0268264_10000062 | 3300028381 | Bacteria | 302110 |
| 380 | Ga0268264_10222966 | 3300028381 | Bacteria | 1736 |
| 381 | Ga0307517_10000175 | 3300028786 | Bacteria | 105567 |
| 382 | Ga0307517_10197719 | 3300028786 | Bacteria | 1263 |
| 383 | Ga0307515_10034911 | 3300028794 | Bacteria | 8205 |
| 384 | Ga0307515_10092532 | 3300028794 | Bacteria | 3762 |
| 385 | Ga0307515_10191196 | 3300028794 | Bacteria | 1956 |
| 386 | Ga0307511_10070832 | 3300030521 | Bacteria | 2549 |
| 387 | Ga0265330_10054095 | 3300031235 | Bacteria | 1755 |
| 388 | Ga0265332_10003278 | 3300031238 | Bacteria | 7865 |
| 389 | Ga0265332_10007021 | 3300031238 | Bacteria | 5099 |
| 390 | Ga0265328_10016314 | 3300031239 | Bacteria | 2893 |
| 391 | Ga0265325_10065075 | 3300031241 | Bacteria | 1842 |
| 392 | Ga0265340_10002509 | 3300031247 | Bacteria | 10431 |
| 393 | Ga0265339_10000738 | 3300031249 | Bacteria | 25301 |
| 394 | Ga0265339_10015187 | 3300031249 | Bacteria | 4623 |
| 395 | Ga0265339_10159401 | 3300031249 | Bacteria | 1136 |
| 396 | Ga0307513_10189506 | 3300031456 | Bacteria | 1910 |
| 397 | Ga0307509_10006160 | 3300031507 | Bacteria | 16260 |
| 398 | Ga0307509_10262543 | 3300031507 | Bacteria | 1501 |
| 399 | Ga0307509_10315318 | 3300031507 | Bacteria | 1304 |
| 400 | Ga0307508_10000045 | 3300031616 | Bacteria | 142824 |
| 401 | Ga0307508_10185394 | 3300031616 | Bacteria | 1683 |
| 402 | Ga0265314_10026793 | 3300031711 | Bacteria | 4325 |
| 403 | Ga0265342_10000789 | 3300031712 | Bacteria | 31942 |
| 404 | Ga0265342_10005212 | 3300031712 | Bacteria | 9983 |
| 405 | Ga0265342_10046291 | 3300031712 | Bacteria | 2615 |
| 406 | Ga0307516_10045874 | 3300031730 | Bacteria | 4314 |
| 407 | Ga0307516_10078174 | 3300031730 | Bacteria | 3155 |
| 408 | Ga0307516_10146981 | 3300031730 | Bacteria | 2122 |
| 409 | Ga0307406_10084190 | 3300031901 | Bacteria | 2123 |
| 410 | Ga0307412_10052998 | 3300031911 | Bacteria | 2688 |
| 411 | Ga0307416_100482080 | 3300032002 | Bacteria | 1300 |
| 412 | Ga0307415_100035854 | 3300032126 | Bacteria | 3244 |
| 413 | Ga0307507_10065520 | 3300033179 | Bacteria | 3340 |
| 414 | Ga0307510_10005941 | 3300033180 | Bacteria | 14568 |
| 415 | Ga0307510_10020148 | 3300033180 | Bacteria | 7804 |
| 416 | Ga0307510_10240881 | 3300033180 | Bacteria | 1303 |
| 417 | Ga0315911_1000008 | 3300033442 | Bacteria | 381285 |
| 418 | Ga0373934_0022652 | 3300035086 | Bacteria | 2424 |
| 419 | Ga0373940_0063221 | 3300035088 | Bacteria | 1063 |
| 420 | Ga0373923_0002779 | 3300035111 | Bacteria | 5474 |
| 421 | Ga0373923_0026195 | 3300035111 | Bacteria | 2318 |
| 422 | Ga0373923_0063281 | 3300035111 | Bacteria | 1575 |
| 423 | Ga0373936_0053633 | 3300035113 | Bacteria | 1635 |
| 424 | Ga0373945_0013723 | 3300035116 | Bacteria | 2707 |
| 425 | Ga0373954_0008952 | 3300035118 | Bacteria | 4406 |
| 426 | Ga0373954_0083214 | 3300035118 | Bacteria | 1531 |
| 427 | Ga0373956_0004385 | 3300035119 | Bacteria | 5652 |
| 428 | Ga0373956_0035419 | 3300035119 | Bacteria | 2201 |
| 429 | Ga0373957_0038777 | 3300035120 | Bacteria | 1785 |
| 430 | Ga0373943_0019810 | 3300035170 | Bacteria | 3097 |
| 431 | Ga0373943_0030555 | 3300035170 | Bacteria | 2551 |
| 432 | Ga0373946_0009807 | 3300035171 | Bacteria | 3536 |
| 433 | Ga0373955_0002044 | 3300035172 | Bacteria | 8678 |
| 434 | Ga0373955_0021308 | 3300035172 | Bacteria | 3270 |
| 435 | Ga0373924_0009573 | 3300035410 | Bacteria | 3554 |
| 436 | Ga0373924_0029224 | 3300035410 | Bacteria | 2202 |
| 437 | Ga0373924_0052734 | 3300035410 | Bacteria | 1688 |
| 438 | Ga0373931_0005215 | 3300035691 | Bacteria | 5994 |
| 439 | Ga0373935_0001683 | 3300035692 | Bacteria | 12361 |
| 440 | Ga0373935_0110751 | 3300035692 | Bacteria | 1822 |
| 441 | Ga0373927_0001064 | 3300035695 | Bacteria | 20972 |
| 442 | Ga0373927_0003727 | 3300035695 | Bacteria | 10831 |
| 443 | Ga0373927_0016324 | 3300035695 | Bacteria | 4900 |
| 444 | Ga0373927_0035670 | 3300035695 | Bacteria | 3234 |
| 445 | Ga0373927_0055863 | 3300035695 | Bacteria | 2552 |
| 446 | Ga0373927_0106543 | 3300035695 | Bacteria | 1825 |
| 447 | Ga0373933_0000068 | 3300035724 | Bacteria | 63195 |
| 448 | Ga0373933_0009248 | 3300035724 | Bacteria | 5379 |
| 449 | Ga0373933_0118519 | 3300035724 | Bacteria | 1656 |
| 450 | Ga0373947_0006319 | 3300035725 | Bacteria | 6885 |
| 451 | Ga0373947_0008648 | 3300035725 | Bacteria | 5859 |
| 452 | Ga0373947_0103908 | 3300035725 | Bacteria | 1788 |
| 453 | Ga0373947_0126323 | 3300035725 | Bacteria | 1629 |
| 454 | Ga0373947_0147077 | 3300035725 | Bacteria | 1515 |
| 455 | Ga0373937_0017394 | 3300036401 | Bacteria | 6403 |
| 456 | Ga0373937_0022449 | 3300036401 | Bacteria | 5674 |
| 457 | Ga0373937_0029705 | 3300036401 | Bacteria | 4952 |
| 458 | Ga0373937_0065670 | 3300036401 | Bacteria | 3340 |
| 459 | Ga0373937_0188107 | 3300036401 | Bacteria | 1939 |
| 460 | Ga0373925_0007638 | 3300037068 | Bacteria | 7875 |
| 461 | Ga0373925_0093233 | 3300037068 | Bacteria | 2304 |
| 462 | Ga0373925_0113305 | 3300037068 | Bacteria | 2097 |
| 463 | Ga0373925_0163374 | 3300037068 | Bacteria | 1755 |
| 464 | Ga0395899_0069720 | 3300037312 | Bacteria | 2574 |
| 465 | Ga0395900_0020656 | 3300037418 | Bacteria | 6729 |
| 466 | Ga0395900_0148706 | 3300037418 | Bacteria | 2394 |
| 467 | Ga0395900_0437877 | 3300037418 | Bacteria | 1265 |
| 468 | Ga0395900_0445273 | 3300037418 | Bacteria | 1252 |
| 469 | Ga0395898_0050745 | 3300037466 | Bacteria | 4059 |
| 470 | Ga0395898_0257194 | 3300037466 | Bacteria | 1665 |
| 471 | Ga0395898_0373450 | 3300037466 | Bacteria | 1360 |
| 472 | Ga0395905_0001948 | 3300037471 | Bacteria | 23653 |
| 473 | Ga0395905_0048386 | 3300037471 | Bacteria | 3985 |
| 474 | Ga0436364_0738225 | 3300037853 | Bacteria | 2323 |
| 475 | Ga0436364_1338082 | 3300037853 | Bacteria | 27858 |
| 476 | Ga0395901_0089489 | 3300038443 | Bacteria | 3221 |
| 477 | Ga0395901_0199025 | 3300038443 | Bacteria | 2100 |
| 478 | Ga0395901_0235797 | 3300038443 | Bacteria | 1909 |
| 479 | Ga0400483_063134 | 3300039062 | Bacteria | 5649 |
| 480 | Ga0400483_064073 | 3300039062 | Bacteria | 17035 |
| 481 | Ga0400483_170476 | 3300039062 | Bacteria | 20916 |
| 482 | Ga0400483_292171 | 3300039062 | Bacteria | 65188 |
| 483 | Ga0436363_0740465 | 3300039450 | Bacteria | 1303 |
| 484 | Ga0466969_0019790 | 3300044656 | Bacteria | 3492 |
| 485 | Ga0466969_0058661 | 3300044656 | Bacteria | 1873 |
| 486 | Ga0466972_0000299 | 3300044658 | Bacteria | 30012 |
| 487 | Ga0466972_0023246 | 3300044658 | Bacteria | 3083 |
| 488 | Ga0466966_0003365 | 3300044684 | Bacteria | 10543 |
| 489 | Ga0466961_0000709 | 3300044693 | Bacteria | 20961 |
| 490 | Ga0466963_0046772 | 3300044694 | Bacteria | 2854 |
| 491 | Ga0466957_0160598 | 3300044842 | Bacteria | 1459 |
| 492 | Ga0466959_0027413 | 3300045049 | Bacteria | 4226 |
| 493 | Ga0466959_0040311 | 3300045049 | Bacteria | 3450 |
| 494 | Ga0466958_0225078 | 3300045836 | Bacteria | 1197 |
| 495 | Ga0466967_0078628 | 3300045976 | Bacteria | 2972 |
| 496 | Ga0466967_0081393 | 3300045976 | Bacteria | 2925 |
| 497 | Ga0466967_0179066 | 3300045976 | Bacteria | 1998 |
| 498 | Ga0495592_0020736 | 3300046454 | Bacteria | 5000 |
| 499 | Ga0495592_0257244 | 3300046454 | Bacteria | 1151 |
| 500 | Ga0495603_0003128 | 3300046455 | Bacteria | 9841 |
| 501 | Ga0495603_0003243 | 3300046455 | Bacteria | 9693 |
| 502 | Ga0495603_0003728 | 3300046455 | Bacteria | 9063 |
| 503 | Ga0495603_0012063 | 3300046455 | Bacteria | 5233 |
| 504 | Ga0495629_0001107 | 3300046459 | Bacteria | 21326 |
| 505 | Ga0495629_0002800 | 3300046459 | Bacteria | 13295 |
| 506 | Ga0495629_0012976 | 3300046459 | Bacteria | 6025 |
| 507 | Ga0495629_0055191 | 3300046459 | Bacteria | 2778 |
| 508 | Ga0495629_0074497 | 3300046459 | Bacteria | 2370 |
| 509 | Ga0495638_0003712 | 3300046460 | Bacteria | 11885 |
| 510 | Ga0495638_0084885 | 3300046460 | Bacteria | 1915 |
| 511 | Ga0495641_0004022 | 3300046461 | Bacteria | 10651 |
| 512 | Ga0495641_0079333 | 3300046461 | Bacteria | 1471 |
| 513 | Ga0495641_0080734 | 3300046461 | Bacteria | 1457 |
| 514 | Ga0495651_0003711 | 3300046462 | Bacteria | 11696 |
| 515 | Ga0495651_0009193 | 3300046462 | Bacteria | 7588 |
| 516 | Ga0495651_0047740 | 3300046462 | Bacteria | 3308 |
| 517 | Ga0495651_0120736 | 3300046462 | Bacteria | 1926 |
| 518 | Ga0495653_0019489 | 3300046463 | Bacteria | 5501 |
| 519 | Ga0495653_0028503 | 3300046463 | Bacteria | 4464 |
| 520 | Ga0495653_0102842 | 3300046463 | Bacteria | 2067 |
| 521 | Ga0495653_0109292 | 3300046463 | Bacteria | 1990 |
| 522 | Ga0495650_0046873 | 3300046471 | Bacteria | 1811 |
| 523 | Ga0495580_0001546 | 3300046472 | Bacteria | 20242 |
| 524 | Ga0495580_0001981 | 3300046472 | Bacteria | 18011 |
| 525 | Ga0495580_0090322 | 3300046472 | Bacteria | 2133 |
| 526 | Ga0495605_0073665 | 3300046474 | Bacteria | 1608 |
| 527 | Ga0495639_0000072 | 3300046475 | Bacteria | 46904 |
| 528 | Ga0495662_0000510 | 3300046476 | Bacteria | 17683 |
| 529 | Ga0495662_0075704 | 3300046476 | Bacteria | 1633 |
| 530 | Ga0495664_0001402 | 3300046477 | Bacteria | 12752 |
| 531 | Ga0495664_0006292 | 3300046477 | Bacteria | 6555 |
| 532 | Ga0495664_0043294 | 3300046477 | Bacteria | 2667 |
| 533 | Ga0495664_0058400 | 3300046477 | Bacteria | 2295 |
| 534 | Ga0495585_0047603 | 3300046492 | Bacteria | 2388 |
| 535 | Ga0495585_0061098 | 3300046492 | Bacteria | 2073 |
| 536 | Ga0495585_0093709 | 3300046492 | Bacteria | 1615 |
| 537 | Ga0495594_0000467 | 3300046499 | Bacteria | 20554 |
| 538 | Ga0495594_0066615 | 3300046499 | Bacteria | 1998 |
| 539 | Ga0495594_0197900 | 3300046499 | Bacteria | 1145 |
| 540 | Ga0495583_0109755 | 3300046506 | Bacteria | 1170 |
| 541 | Ga0495606_0000831 | 3300046507 | Bacteria | 46699 |
| 542 | Ga0495606_0032054 | 3300046507 | Bacteria | 3645 |
| 543 | Ga0495608_0008312 | 3300046511 | Bacteria | 7281 |
| 544 | Ga0495608_0082821 | 3300046511 | Bacteria | 2083 |
| 545 | Ga0495608_0097634 | 3300046511 | Bacteria | 1896 |
| 546 | Ga0495618_0010639 | 3300046514 | Bacteria | 5569 |
| 547 | Ga0495618_0088763 | 3300046514 | Bacteria | 1977 |
| 548 | Ga0495620_0044570 | 3300046515 | Bacteria | 1927 |
| 549 | Ga0495620_0073373 | 3300046515 | Bacteria | 1395 |
| 550 | Ga0495628_0003465 | 3300046516 | Bacteria | 14119 |
| 551 | Ga0495628_0084162 | 3300046516 | Bacteria | 2468 |
| 552 | Ga0495630_0019769 | 3300046517 | Bacteria | 4955 |
| 553 | Ga0495631_0021538 | 3300046518 | Bacteria | 3002 |
| 554 | Ga0495631_0069979 | 3300046518 | Bacteria | 1517 |
| 555 | Ga0495632_0040436 | 3300046519 | Bacteria | 2348 |
| 556 | Ga0495637_0079670 | 3300046520 | Bacteria | 1308 |
| 557 | Ga0495643_0042004 | 3300046522 | Bacteria | 2492 |
| 558 | Ga0495644_0022119 | 3300046523 | Bacteria | 2424 |
| 559 | Ga0495648_0002061 | 3300046524 | Bacteria | 19020 |
| 560 | Ga0495648_0061546 | 3300046524 | Bacteria | 2228 |
| 561 | Ga0495648_0114593 | 3300046524 | Bacteria | 1460 |
| 562 | Ga0495648_0180034 | 3300046524 | Bacteria | 1075 |
| 563 | Ga0495666_0085145 | 3300046526 | Bacteria | 1493 |
| 564 | Ga0495652_0026176 | 3300046529 | Bacteria | 5155 |
| 565 | Ga0495652_0029317 | 3300046529 | Bacteria | 4835 |
| 566 | Ga0495652_0033141 | 3300046529 | Bacteria | 4513 |
| 567 | Ga0495652_0038958 | 3300046529 | Bacteria | 4112 |
| 568 | Ga0495652_0064423 | 3300046529 | Bacteria | 3082 |
| 569 | Ga0495652_0144035 | 3300046529 | Bacteria | 1871 |
| 570 | Ga0495654_0011888 | 3300046530 | Bacteria | 4695 |
| 571 | Ga0495665_0000128 | 3300046531 | Bacteria | 36043 |
| 572 | Ga0495665_0021707 | 3300046531 | Bacteria | 3452 |
| 573 | Ga0495640_0010120 | 3300046533 | Bacteria | 7310 |
| 574 | Ga0495640_0025681 | 3300046533 | Bacteria | 4268 |
| 575 | Ga0495640_0061431 | 3300046533 | Bacteria | 2552 |
| 576 | Ga0495640_0065803 | 3300046533 | Bacteria | 2446 |
| 577 | Ga0495587_0017095 | 3300046536 | Bacteria | 4509 |
| 578 | Ga0495587_0086702 | 3300046536 | Bacteria | 1812 |
| 579 | Ga0495645_0064764 | 3300046543 | Bacteria | 2644 |
| 580 | Ga0495622_0005892 | 3300046557 | Bacteria | 5692 |
| 581 | Ga0495622_0014876 | 3300046557 | Bacteria | 3617 |
| 582 | Ga0495622_0016799 | 3300046557 | Bacteria | 3409 |
| 583 | Ga0495622_0088499 | 3300046557 | Bacteria | 1423 |
| 584 | Ga0495622_0100094 | 3300046557 | Bacteria | 1329 |
| 585 | Ga0495633_0052514 | 3300046558 | Bacteria | 1920 |
| 586 | Ga0495667_0005488 | 3300046559 | Bacteria | 8568 |
| 587 | Ga0495667_0036453 | 3300046559 | Bacteria | 3283 |
| 588 | Ga0495656_0002973 | 3300046615 | Bacteria | 5691 |
| 589 | Ga0495668_0028813 | 3300046616 | Bacteria | 3138 |
| 590 | Ga0495668_0106411 | 3300046616 | Bacteria | 1534 |
| 591 | Ga0495634_0004246 | 3300046642 | Bacteria | 11306 |
| 592 | Ga0495634_0034915 | 3300046642 | Bacteria | 3448 |
| 593 | Ga0495634_0063611 | 3300046642 | Bacteria | 2448 |
| 594 | Ga0495625_0090229 | 3300046660 | Bacteria | 2120 |
| 595 | Ga0495625_0201733 | 3300046660 | Bacteria | 1312 |
| 596 | Ga0495635_0000564 | 3300046663 | Bacteria | 23651 |
| 597 | Ga0495635_0001868 | 3300046663 | Bacteria | 14260 |
| 598 | Ga0495635_0019084 | 3300046663 | Bacteria | 4787 |
| 599 | Ga0495635_0028708 | 3300046663 | Bacteria | 3866 |
| 600 | Ga0495635_0101694 | 3300046663 | Bacteria | 1964 |
| 601 | Ga0495635_0105019 | 3300046663 | Bacteria | 1930 |
| 602 | Ga0495659_0045116 | 3300046664 | Bacteria | 1587 |
| 603 | Ga0495661_0087811 | 3300046665 | Bacteria | 1777 |
| 604 | Ga0495588_0007923 | 3300046674 | Bacteria | 4855 |
| 605 | Ga0495588_0009177 | 3300046674 | Bacteria | 4564 |
| 606 | Ga0495657_0007182 | 3300046675 | Bacteria | 8638 |
| 607 | Ga0495657_0033568 | 3300046675 | Bacteria | 3572 |
| 608 | Ga0495657_0100805 | 3300046675 | Bacteria | 1840 |
| 609 | Ga0495599_0014153 | 3300046678 | Bacteria | 4938 |
| 610 | Ga0495599_0020349 | 3300046678 | Bacteria | 4132 |
| 611 | Ga0495599_0042374 | 3300046678 | Bacteria | 2856 |
| 612 | Ga0495599_0219207 | 3300046678 | Bacteria | 1165 |
| 613 | Ga0495623_0020666 | 3300046679 | Bacteria | 4255 |
| 614 | Ga0495623_0034663 | 3300046679 | Bacteria | 3236 |
| 615 | Ga0495646_0003182 | 3300046680 | Bacteria | 10197 |
| 616 | Ga0495646_0034504 | 3300046680 | Bacteria | 3142 |
| 617 | Ga0495646_0177965 | 3300046680 | Bacteria | 1169 |
| 618 | Ga0495647_0002893 | 3300046681 | Bacteria | 5449 |
| 619 | Ga0495658_0000707 | 3300046683 | Bacteria | 18088 |
| 620 | Ga0495669_0006578 | 3300046684 | Bacteria | 4858 |
| 621 | Ga0495669_0030472 | 3300046684 | Bacteria | 2368 |
| 622 | Ga0495669_0041240 | 3300046684 | Bacteria | 2049 |
| 623 | Ga0495613_0001986 | 3300046689 | Bacteria | 15542 |
| 624 | Ga0495613_0031628 | 3300046689 | Bacteria | 3931 |
| 625 | Ga0495613_0070841 | 3300046689 | Bacteria | 2542 |
| 626 | Ga0495613_0214027 | 3300046689 | Bacteria | 1354 |
| 627 | Ga0495613_0229984 | 3300046689 | Bacteria | 1299 |
| 628 | Ga0495624_0007718 | 3300046690 | Bacteria | 7549 |
| 629 | Ga0495624_0027338 | 3300046690 | Bacteria | 3735 |
| 630 | Ga0495670_0005603 | 3300046691 | Bacteria | 6160 |
| 631 | Ga0495670_0092874 | 3300046691 | Bacteria | 1546 |
| 632 | Ga0495589_0100633 | 3300046794 | Bacteria | 1399 |
| 633 | Ga0495600_0016480 | 3300046809 | Bacteria | 4690 |
| 634 | Ga0495600_0046117 | 3300046809 | Bacteria | 2844 |
| 635 | Ga0495581_0000030 | 3300047315 | Bacteria | 53487 |
| 636 | Ga0495581_0080105 | 3300047315 | Bacteria | 1890 |
| 637 | Ga0495581_0195670 | 3300047315 | Bacteria | 1183 |
| 638 | Ga0495604_0001746 | 3300047317 | Bacteria | 17757 |
| 639 | Ga0495604_0006243 | 3300047317 | Bacteria | 9452 |
| 640 | Ga0495604_0089587 | 3300047317 | Bacteria | 2286 |
| 641 | Ga0495604_0147504 | 3300047317 | Bacteria | 1675 |
| 642 | Ga0495604_0250564 | 3300047317 | Bacteria | 1207 |
| 643 | Ga0495674_0024013 | 3300047319 | Bacteria | 5609 |
| 644 | Ga0495674_0167017 | 3300047319 | Bacteria | 1838 |
| 645 | Ga0495674_0202283 | 3300047319 | Bacteria | 1647 |
| 646 | Ga0495672_0034357 | 3300047320 | Bacteria | 3133 |
| 647 | Ga0495676_0030732 | 3300047321 | Bacteria | 4552 |
| 648 | Ga0495676_0081675 | 3300047321 | Bacteria | 2449 |
| 649 | Ga0495676_0086878 | 3300047321 | Bacteria | 2352 |
| 650 | Ga0495680_0000836 | 3300047322 | Bacteria | 34084 |
| 651 | Ga0495680_0015081 | 3300047322 | Bacteria | 6673 |
| 652 | Ga0495680_0038283 | 3300047322 | Bacteria | 3834 |
| 653 | Ga0495683_0027504 | 3300047323 | Bacteria | 2908 |
| 654 | Ga0495687_051007 | 3300047443 | Bacteria | 1759 |
| 655 | Ga0495675_0005364 | 3300047444 | Bacteria | 7811 |
| 656 | Ga0495675_0017105 | 3300047444 | Bacteria | 4591 |
| 657 | Ga0495675_0234433 | 3300047444 | Bacteria | 1107 |
| 658 | Ga0495677_0032871 | 3300047445 | Bacteria | 1890 |
| 659 | Ga0495673_0062965 | 3300047469 | Bacteria | 1583 |
| 660 | Ga0495681_0058559 | 3300047470 | Bacteria | 1784 |
| 661 | Ga0495684_0004347 | 3300047471 | Bacteria | 11073 |
| 662 | Ga0495684_0005411 | 3300047471 | Bacteria | 9938 |
| 663 | Ga0495684_0006597 | 3300047471 | Bacteria | 9001 |
| 664 | Ga0495684_0037949 | 3300047471 | Bacteria | 3695 |
| 665 | Ga0495684_0121271 | 3300047471 | Bacteria | 1969 |
| 666 | Ga0495686_0028173 | 3300047472 | Bacteria | 3659 |
| 667 | Ga0495686_0064789 | 3300047472 | Bacteria | 2261 |
| 668 | Ga0495686_0149767 | 3300047472 | Bacteria | 1371 |
| 669 | Ga0495593_0000470 | 3300047673 | Bacteria | 22684 |
| 670 | Ga0495593_0009200 | 3300047673 | Bacteria | 5727 |
| 671 | Ga0495593_0013405 | 3300047673 | Bacteria | 4677 |
| 672 | Ga0495593_0093144 | 3300047673 | Bacteria | 1551 |
| 673 | Ga0495602_0013506 | 3300048088 | Bacteria | 8344 |
| 674 | Ga0495602_0022610 | 3300048088 | Bacteria | 6148 |
| 675 | Ga0495602_0190918 | 3300048088 | Bacteria | 1571 |
| 676 | Ga0495614_0124296 | 3300048089 | Bacteria | 1139 |
| 677 | Ga0496100_0014735 | 3300048903 | Bacteria | 4546 |
| 678 | Ga0496100_0046014 | 3300048903 | Bacteria | 2803 |
| 679 | Ga0496100_0130453 | 3300048903 | Bacteria | 1770 |
| 680 | Ga0496100_0165264 | 3300048903 | Bacteria | 1589 |
| 681 | Ga0496100_0245958 | 3300048903 | Bacteria | 1321 |
| 682 | Ga0496101_0132261 | 3300048904 | Bacteria | 1895 |
| 683 | Ga0496102_0011723 | 3300048905 | Bacteria | 7565 |
| 684 | Ga0496102_0039049 | 3300048905 | Bacteria | 4287 |
| 685 | Ga0496102_0195999 | 3300048905 | Bacteria | 1903 |
| 686 | Ga0496102_0219478 | 3300048905 | Bacteria | 1792 |
| 687 | Ga0496102_0271445 | 3300048905 | Bacteria | 1599 |
| 688 | Ga0496102_0309961 | 3300048905 | Bacteria | 1487 |
| 689 | Ga0496102_0321862 | 3300048905 | Bacteria | 1457 |
| 690 | Ga0496102_0368813 | 3300048905 | Bacteria | 1351 |
| 691 | Ga0496102_0432553 | 3300048905 | Bacteria | 1235 |
| 692 | Ga0496103_0207953 | 3300048906 | Bacteria | 1258 |
| 693 | Ga0496104_0004462 | 3300048907 | Bacteria | 12190 |
| 694 | Ga0496104_0045714 | 3300048907 | Bacteria | 4119 |
| 695 | Ga0496104_0062767 | 3300048907 | Bacteria | 3523 |
| 696 | Ga0496104_0173540 | 3300048907 | Bacteria | 2066 |
| 697 | Ga0496105_0032276 | 3300048908 | Bacteria | 4296 |
| 698 | Ga0496105_0032852 | 3300048908 | Bacteria | 4258 |
| 699 | Ga0496105_0033675 | 3300048908 | Bacteria | 4209 |
| 700 | Ga0496105_0123492 | 3300048908 | Bacteria | 2134 |
| 701 | Ga0496105_0188690 | 3300048908 | Bacteria | 1686 |
| 702 | Ga0496106_0001644 | 3300048909 | Bacteria | 16771 |
| 703 | Ga0496106_0316535 | 3300048909 | Bacteria | 1252 |
| 704 | Ga0496106_0334013 | 3300048909 | Bacteria | 1217 |
| 705 | Ga0496107_0003260 | 3300048910 | Bacteria | 10808 |
| 706 | Ga0496107_0033433 | 3300048910 | Bacteria | 3679 |
| 707 | Ga0496107_0037483 | 3300048910 | Bacteria | 3479 |
| 708 | Ga0496107_0095639 | 3300048910 | Bacteria | 2173 |
| 709 | Ga0496107_0129244 | 3300048910 | Bacteria | 1864 |
| 710 | Ga0496108_0000927 | 3300048911 | Bacteria | 22857 |
| 711 | Ga0496108_0062262 | 3300048911 | Bacteria | 3142 |
| 712 | Ga0496108_0089483 | 3300048911 | Bacteria | 2616 |
| 713 | Ga0496108_0181242 | 3300048911 | Bacteria | 1824 |
| 714 | Ga0496108_0188858 | 3300048911 | Bacteria | 1785 |
| 715 | Ga0496109_0000229 | 3300048912 | Bacteria | 54733 |
| 716 | Ga0496109_0056062 | 3300048912 | Bacteria | 3596 |
| 717 | Ga0496109_0075478 | 3300048912 | Bacteria | 3099 |
| 718 | Ga0496109_0108977 | 3300048912 | Bacteria | 2574 |
| 719 | Ga0496109_0120192 | 3300048912 | Bacteria | 2447 |
| 720 | Ga0496109_0208744 | 3300048912 | Bacteria | 1836 |
| 721 | Ga0496110_0014360 | 3300048913 | Bacteria | 6574 |
| 722 | Ga0496110_0024599 | 3300048913 | Bacteria | 5134 |
| 723 | Ga0496110_0049185 | 3300048913 | Bacteria | 3697 |
| 724 | Ga0496110_0066266 | 3300048913 | Bacteria | 3193 |
| 725 | Ga0496110_0069892 | 3300048913 | Bacteria | 3110 |
| 726 | Ga0496110_0198927 | 3300048913 | Bacteria | 1820 |
| 727 | Ga0496111_0042267 | 3300048914 | Bacteria | 3272 |
| 728 | Ga0496111_0057455 | 3300048914 | Bacteria | 2817 |
| 729 | Ga0496111_0145455 | 3300048914 | Bacteria | 1757 |
| 730 | Ga0496111_0213188 | 3300048914 | Bacteria | 1434 |
| 731 | Ga0496112_0000018 | 3300048915 | Bacteria | 188820 |
| 732 | Ga0496112_0001343 | 3300048915 | Bacteria | 18708 |
| 733 | Ga0496112_0005116 | 3300048915 | Bacteria | 11270 |
| 734 | Ga0496112_0022495 | 3300048915 | Bacteria | 6008 |
| 735 | Ga0496112_0036254 | 3300048915 | Bacteria | 4810 |
| 736 | Ga0496112_0061280 | 3300048915 | Bacteria | 3708 |
| 737 | Ga0496112_0116736 | 3300048915 | Bacteria | 2639 |
| 738 | Ga0496112_0204779 | 3300048915 | Bacteria | 1931 |
| 739 | Ga0496112_0397946 | 3300048915 | Bacteria | 1317 |
| 740 | Ga0496112_0506506 | 3300048915 | Bacteria | 1142 |
| 741 | Ga0496113_0025324 | 3300048916 | Bacteria | 4227 |
| 742 | Ga0496113_0029007 | 3300048916 | Bacteria | 3989 |
| 743 | Ga0496113_0075336 | 3300048916 | Bacteria | 2575 |
| 744 | Ga0496113_0080616 | 3300048916 | Bacteria | 2493 |
| 745 | Ga0496113_0129483 | 3300048916 | Bacteria | 1979 |
| 746 | Ga0496113_0186280 | 3300048916 | Bacteria | 1646 |
| 747 | Ga0496113_0408391 | 3300048916 | Bacteria | 1090 |
| 748 | Ga0496114_0146649 | 3300048917 | Bacteria | 2046 |
| 749 | Ga0496114_0161956 | 3300048917 | Bacteria | 1946 |
| 750 | Ga0496114_0481043 | 3300048917 | Bacteria | 1098 |
| 751 | Ga0496115_0002846 | 3300048918 | Bacteria | 12452 |
| 752 | Ga0496115_0026716 | 3300048918 | Bacteria | 4508 |
| 753 | Ga0496115_0062056 | 3300048918 | Bacteria | 3014 |
| 754 | Ga0496115_0076405 | 3300048918 | Bacteria | 2722 |
| 755 | Ga0496115_0078346 | 3300048918 | Bacteria | 2689 |
| 756 | Ga0496115_0251358 | 3300048918 | Bacteria | 1455 |
| 757 | Ga0496115_0259353 | 3300048918 | Bacteria | 1430 |
| 758 | Ga0496115_0263445 | 3300048918 | Bacteria | 1417 |
| 759 | Ga0496115_0398297 | 3300048918 | Bacteria | 1117 |
| 760 | Ga0496116_0039933 | 3300048919 | Bacteria | 3237 |
| 761 | Ga0496117_0038300 | 3300048920 | Bacteria | 3558 |
| 762 | Ga0496117_0070193 | 3300048920 | Bacteria | 2355 |
| 763 | Ga0496117_0082976 | 3300048920 | Bacteria | 2097 |
| 764 | Ga0496117_0180752 | 3300048920 | Bacteria | 1213 |
| 765 | Ga0496118_0021121 | 3300048921 | Bacteria | 5743 |
| 766 | Ga0496118_0032376 | 3300048921 | Bacteria | 4308 |
| 767 | Ga0496118_0034811 | 3300048921 | Bacteria | 4102 |
| 768 | Ga0496118_0036860 | 3300048921 | Bacteria | 3946 |
| 769 | Ga0496118_0037063 | 3300048921 | Bacteria | 3931 |
| 770 | Ga0496118_0105304 | 3300048921 | Bacteria | 1891 |
| 771 | Ga0496119_0013596 | 3300048922 | Bacteria | 6463 |
| 772 | Ga0496119_0067395 | 3300048922 | Bacteria | 2111 |
| 773 | Ga0496119_0116694 | 3300048922 | Bacteria | 1473 |
| 774 | Ga0496119_0132223 | 3300048922 | Bacteria | 1358 |
| 775 | Ga0496120_0022973 | 3300048923 | Bacteria | 3911 |
| 776 | Ga0496120_0042211 | 3300048923 | Bacteria | 2665 |
| 777 | Ga0496120_0056627 | 3300048923 | Bacteria | 2211 |
| 778 | Ga0496121_0000278 | 3300048924 | Bacteria | 106838 |
| 779 | Ga0496121_0000654 | 3300048924 | Bacteria | 64945 |
| 780 | Ga0496121_0001257 | 3300048924 | Bacteria | 43906 |
| 781 | Ga0496121_0004075 | 3300048924 | Bacteria | 20070 |
| 782 | Ga0496121_0010674 | 3300048924 | Bacteria | 10312 |
| 783 | Ga0496121_0018630 | 3300048924 | Bacteria | 6989 |
| 784 | Ga0496121_0062278 | 3300048924 | Bacteria | 3056 |
| 785 | Ga0496121_0068167 | 3300048924 | Bacteria | 2879 |
| 786 | Ga0496121_0075822 | 3300048924 | Bacteria | 2685 |
| 787 | Ga0496121_0109197 | 3300048924 | Bacteria | 2114 |
| 788 | Ga0496121_0122183 | 3300048924 | Bacteria | 1964 |
| 789 | Ga0496121_0164458 | 3300048924 | Bacteria | 1619 |
| 790 | Ga0496121_0215171 | 3300048924 | Bacteria | 1358 |
| 791 | Ga0496124_0003799 | 3300048927 | Bacteria | 18136 |
| 792 | Ga0496124_0175801 | 3300048927 | Bacteria | 1653 |
| 793 | Ga0496125_0003929 | 3300048928 | Bacteria | 17533 |
| 794 | Ga0496125_0050458 | 3300048928 | Bacteria | 3444 |
| 795 | Ga0496125_0063726 | 3300048928 | Bacteria | 2936 |
| 796 | Ga0496125_0076285 | 3300048928 | Bacteria | 2589 |
| 797 | Ga0496125_0089528 | 3300048928 | Bacteria | 2314 |
| 798 | Ga0496125_0126663 | 3300048928 | Bacteria | 1808 |
| 799 | Ga0496125_0175673 | 3300048928 | Bacteria | 1433 |
| 800 | Ga0496126_0005056 | 3300048929 | Bacteria | 15313 |
| 801 | Ga0496126_0006689 | 3300048929 | Bacteria | 12810 |
| 802 | Ga0496126_0013259 | 3300048929 | Bacteria | 8398 |
| 803 | Ga0496126_0014598 | 3300048929 | Bacteria | 7933 |
| 804 | Ga0496126_0021739 | 3300048929 | Bacteria | 6258 |
| 805 | Ga0496126_0038464 | 3300048929 | Bacteria | 4452 |
| 806 | Ga0496126_0048899 | 3300048929 | Bacteria | 3862 |
| 807 | Ga0496126_0050733 | 3300048929 | Bacteria | 3780 |
| 808 | Ga0496126_0062031 | 3300048929 | Bacteria | 3355 |
| 809 | Ga0496126_0073376 | 3300048929 | Bacteria | 3042 |
| 810 | Ga0496126_0077746 | 3300048929 | Bacteria | 2941 |
| 811 | Ga0496126_0126206 | 3300048929 | Bacteria | 2214 |
| 812 | Ga0496126_0145128 | 3300048929 | Bacteria | 2039 |
| 813 | Ga0496126_0253413 | 3300048929 | Bacteria | 1466 |
| 814 | Ga0495682_0031941 | 3300049460 | Bacteria | 1945 |
| 815 | Ga0501031_0000207 | 3300049568 | Bacteria | 33573 |
| 816 | Ga0501031_0169893 | 3300049568 | Bacteria | 1425 |
| 817 | Ga0501032_0000252 | 3300049569 | Bacteria | 44619 |
| 818 | Ga0501032_0238727 | 3300049569 | Bacteria | 1181 |
| 819 | Ga0501033_0000082 | 3300049570 | Bacteria | 89837 |
| 820 | Ga0501034_0000198 | 3300049571 | Bacteria | 113672 |
| 821 | Ga0501034_0076935 | 3300049571 | Bacteria | 3343 |
| 822 | Ga0501034_0107782 | 3300049571 | Bacteria | 2777 |
| 823 | Ga0501034_0164294 | 3300049571 | Bacteria | 2189 |
| 824 | Ga0501036_0001281 | 3300049572 | Bacteria | 19291 |
| 825 | Ga0501037_0000050 | 3300049573 | Bacteria | 112824 |
| 826 | Ga0501037_0013075 | 3300049573 | Bacteria | 6119 |
| 827 | Ga0501037_0037537 | 3300049573 | Bacteria | 3572 |
| 828 | Ga0501037_0237735 | 3300049573 | Bacteria | 1277 |
| 829 | Ga0501038_0000538 | 3300049574 | Bacteria | 33271 |
| 830 | Ga0501038_0000630 | 3300049574 | Bacteria | 31329 |
| 831 | Ga0501038_0021325 | 3300049574 | Bacteria | 5815 |
| 832 | Ga0501038_0045587 | 3300049574 | Bacteria | 3806 |
| 833 | Ga0501039_0000366 | 3300049575 | Bacteria | 32333 |
| 834 | Ga0501042_0017539 | 3300049578 | Bacteria | 4939 |
| 835 | Ga0501043_0002344 | 3300049579 | Bacteria | 16056 |
| 836 | Ga0501043_0027073 | 3300049579 | Bacteria | 4500 |
| 837 | Ga0501043_0128729 | 3300049579 | Bacteria | 1984 |
| 838 | Ga0501046_0149717 | 3300049580 | Bacteria | 1761 |
| 839 | Ga0501046_0279694 | 3300049580 | Bacteria | 1223 |
| 840 | Ga0501047_0000131 | 3300049581 | Bacteria | 91079 |
| 841 | Ga0501047_0196973 | 3300049581 | Bacteria | 1876 |
| 842 | Ga0501047_0248514 | 3300049581 | Bacteria | 1627 |
| 843 | Ga0501048_0000531 | 3300049582 | Bacteria | 26809 |
| 844 | Ga0501067_0057575 | 3300049583 | Bacteria | 2152 |
| 845 | Ga0501068_0011209 | 3300049584 | Bacteria | 5054 |
| 846 | Ga0501069_0001211 | 3300049585 | Bacteria | 12577 |
| 847 | Ga0501070_0097394 | 3300049586 | Bacteria | 2433 |
| 848 | Ga0501070_0199826 | 3300049586 | Bacteria | 1642 |
| 849 | Ga0501070_0358088 | 3300049586 | Bacteria | 1184 |
| 850 | Ga0501072_0000378 | 3300049588 | Bacteria | 31856 |
| 851 | Ga0501073_0029767 | 3300049589 | Bacteria | 3902 |
| 852 | Ga0501074_0000141 | 3300049590 | Bacteria | 37729 |
| 853 | Ga0501074_0018479 | 3300049590 | Bacteria | 5065 |
| 854 | Ga0501074_0051890 | 3300049590 | Bacteria | 2960 |
| 855 | Ga0501079_0036554 | 3300049741 | Bacteria | 3783 |
| 856 | Ga0501080_0019207 | 3300049742 | Bacteria | 6328 |
| 857 | Ga0501080_0146335 | 3300049742 | Bacteria | 2184 |
| 858 | Ga0501083_0000341 | 3300049744 | Bacteria | 29641 |
| 859 | Ga0501035_0000123 | 3300049822 | Bacteria | 93734 |
| 860 | Ga0501035_0035937 | 3300049822 | Bacteria | 4494 |
| 861 | Ga0501035_0152390 | 3300049822 | Bacteria | 2005 |
| 862 | Ga0501035_0193578 | 3300049822 | Bacteria | 1747 |
| 863 | Ga0501035_0202926 | 3300049822 | Bacteria | 1699 |
| 864 | Ga0501035_0225006 | 3300049822 | Bacteria | 1601 |
| 865 | Ga0501035_0339832 | 3300049822 | Bacteria | 1258 |
| 866 | Ga0501044_0000100 | 3300049823 | Bacteria | 106729 |
| 867 | Ga0501044_0039767 | 3300049823 | Bacteria | 4904 |
| 868 | Ga0501044_0079043 | 3300049823 | Bacteria | 3333 |
| 869 | Ga0501044_0093655 | 3300049823 | Bacteria | 3029 |
| 870 | Ga0501044_0102829 | 3300049823 | Bacteria | 2872 |
| 871 | Ga0501044_0150128 | 3300049823 | Bacteria | 2313 |
| 872 | Ga0501045_0016159 | 3300049824 | Bacteria | 5297 |
| 873 | Ga0501045_0278609 | 3300049824 | Bacteria | 1245 |
| 874 | nmdc:mga03n38_3346_c1 | 3300050490 | Bacteria | 5130 |
| 875 | nmdc:mga03n38_57171_c1 | 3300050490 | Bacteria | 1763 |
| 876 | nmdc:mga00v17_134825_c1 | 3300050491 | Bacteria | 1580 |
| 877 | nmdc:mga00v17_21851_c1 | 3300050491 | Bacteria | 3684 |
| 878 | nmdc:mga00v17_246680_c1 | 3300050491 | Bacteria | 1158 |
| 879 | nmdc:mga00v17_58165_c1 | 3300050491 | Bacteria | 1353 |
| 880 | nmdc:mga0yw44_25265_c1 | 3300050492 | Bacteria | 3375 |
| 881 | nmdc:mga0yw44_26768_c1 | 3300050492 | Bacteria | 3298 |
| 882 | nmdc:mga0yw44_32707_c1 | 3300050492 | Bacteria | 3033 |
| 883 | nmdc:mga0yw44_6182_c1 | 3300050492 | Bacteria | 5757 |
| 884 | nmdc:mga0yw44_90481_c1 | 3300050492 | Bacteria | 1933 |
| 885 | nmdc:mga0k408_125572_c1 | 3300050493 | Bacteria | 1522 |
| 886 | nmdc:mga0k408_26360_c1 | 3300050493 | Bacteria | 2178 |
| 887 | nmdc:mga06z11_25454_c1 | 3300050494 | Bacteria | 2805 |
| 888 | nmdc:mga06z11_30785_c1 | 3300050494 | Bacteria | 2600 |
| 889 | nmdc:mga07m45_117037_c1 | 3300050496 | Bacteria | 1538 |
| 890 | nmdc:mga07m45_14953_c1 | 3300050496 | Bacteria | 4143 |
| 891 | nmdc:mga07m45_3103_c1 | 3300050496 | Bacteria | 7739 |
| 892 | nmdc:mga08y16_363177_c1 | 3300050511 | Bacteria | 1486 |
| 893 | nmdc:mga0rr50_363005_c1 | 3300050513 | Bacteria | 1219 |
| 894 | nmdc:mga0sz30_32825_c1 | 3300050516 | Bacteria | 2155 |
| 895 | nmdc:mga0sz30_5173_c1 | 3300050516 | Bacteria | 4777 |
| 896 | Ga0495601_0032816 | 3300053077 | Bacteria | 3233 |
| 897 | Ga0495612_0013345 | 3300053078 | Bacteria | 3310 |
| 898 | Ga0495612_0023451 | 3300053078 | Bacteria | 2476 |
| 899 | Ga0500635_0005769 | 3300053080 | Bacteria | 3272 |
| 900 | Ga0495595_0001147 | 3300053084 | Bacteria | 10254 |
| 901 | Ga0495595_0101420 | 3300053084 | Bacteria | 1390 |
| 902 | Ga0495619_0050947 | 3300053085 | Bacteria | 2734 |
| 903 | Ga0500578_0029277 | 3300053086 | Bacteria | 3537 |
| 904 | Ga0500643_000076 | 3300053087 | Bacteria | 106911 |
| 905 | Ga0500643_044167 | 3300053087 | Bacteria | 1296 |
| 906 | Ga0500647_0008721 | 3300053091 | Bacteria | 4412 |
| 907 | Ga0500583_0031974 | 3300053092 | Bacteria | 2318 |
| 908 | Ga0500651_0013489 | 3300053093 | Bacteria | 4981 |
| 909 | Ga0500651_0044971 | 3300053093 | Bacteria | 2779 |
| 910 | Ga0500651_0168887 | 3300053093 | Bacteria | 1305 |
| 911 | Ga0500566_0000107 | 3300053094 | Bacteria | 42130 |
| 912 | Ga0500566_0001175 | 3300053094 | Bacteria | 15261 |
| 913 | Ga0500566_0003295 | 3300053094 | Bacteria | 9650 |
| 914 | Ga0500566_0052170 | 3300053094 | Bacteria | 2338 |
| 915 | Ga0500640_022898 | 3300053095 | Bacteria | 2703 |
| 916 | Ga0500641_0011398 | 3300053096 | Bacteria | 3225 |
| 917 | Ga0500641_0037171 | 3300053096 | Bacteria | 1951 |
| 918 | Ga0500650_0047668 | 3300053098 | Bacteria | 1986 |
| 919 | Ga0500650_0070051 | 3300053098 | Bacteria | 1640 |
| 920 | Ga0500556_0000081 | 3300053104 | Bacteria | 90508 |
| 921 | Ga0500557_000021 | 3300053105 | Bacteria | 89662 |
| 922 | Ga0500569_001078 | 3300053109 | Bacteria | 4973 |
| 923 | Ga0500572_036834 | 3300053111 | Bacteria | 1399 |
| 924 | Ga0500592_010490 | 3300053116 | Bacteria | 1476 |
| 925 | Ga0500595_001968 | 3300053119 | Bacteria | 10552 |
| 926 | Ga0500595_002941 | 3300053119 | Bacteria | 8136 |
| 927 | Ga0500595_003169 | 3300053119 | Bacteria | 7788 |
| 928 | Ga0500595_003647 | 3300053119 | Bacteria | 7128 |
| 929 | Ga0500595_038411 | 3300053119 | Bacteria | 1557 |
| 930 | Ga0500597_096638 | 3300053120 | Bacteria | 1284 |
| 931 | Ga0500608_000949 | 3300053122 | Bacteria | 10352 |
| 932 | Ga0500608_103597 | 3300053122 | Bacteria | 1315 |
| 933 | Ga0500618_013897 | 3300053125 | Bacteria | 2069 |
| 934 | Ga0500642_0000042 | 3300053130 | Bacteria | 86476 |
| 935 | Ga0500642_0000225 | 3300053130 | Bacteria | 22158 |
| 936 | Ga0500652_000365 | 3300053131 | Bacteria | 16300 |
| 937 | Ga0500658_0013217 | 3300053134 | Bacteria | 3048 |
| 938 | Ga0500559_0000106 | 3300053136 | Bacteria | 65670 |
| 939 | Ga0500559_0022835 | 3300053136 | Bacteria | 2653 |
| 940 | Ga0500559_0067344 | 3300053136 | Bacteria | 1607 |
| 941 | Ga0500559_0088352 | 3300053136 | Bacteria | 1416 |
| 942 | Ga0500568_0015314 | 3300053139 | Bacteria | 3434 |
| 943 | Ga0500568_0022805 | 3300053139 | Bacteria | 2670 |
| 944 | Ga0500568_0059026 | 3300053139 | Bacteria | 1489 |
| 945 | Ga0500577_0007820 | 3300053142 | Bacteria | 3014 |
| 946 | Ga0500577_0067911 | 3300053142 | Bacteria | 1390 |
| 947 | Ga0500589_052697 | 3300053147 | Bacteria | 1884 |
| 948 | Ga0500603_001588 | 3300053150 | Bacteria | 5133 |
| 949 | Ga0500604_0013529 | 3300053151 | Bacteria | 2212 |
| 950 | Ga0500616_0000227 | 3300053153 | Bacteria | 88098 |
| 951 | Ga0500620_001172 | 3300053155 | Bacteria | 4673 |
| 952 | Ga0500622_0005478 | 3300053156 | Bacteria | 7616 |
| 953 | Ga0500622_0055868 | 3300053156 | Bacteria | 2022 |
| 954 | Ga0500634_0045252 | 3300053161 | Bacteria | 2382 |
| 955 | Ga0500638_002181 | 3300053162 | Bacteria | 6670 |
| 956 | Ga0500638_074317 | 3300053162 | Bacteria | 1621 |
| 957 | Ga0500636_0001726 | 3300053177 | Bacteria | 11964 |
| 958 | Ga0500636_0007656 | 3300053177 | Bacteria | 6247 |
| 959 | Ga0500636_0052999 | 3300053177 | Bacteria | 2381 |
| 960 | Ga0500637_0005127 | 3300053178 | Bacteria | 6311 |
| 961 | Ga0500637_0069682 | 3300053178 | Bacteria | 2022 |
| 962 | Ga0500570_099933 | 3300053724 | Bacteria | 1224 |
| 963 | Ga0500625_020193 | 3300053729 | Bacteria | 3133 |
| 964 | Ga0500609_001334 | 3300053731 | Bacteria | 3640 |
| 965 | Ga0500599_001530 | 3300053736 | Bacteria | 2674 |
| 966 | Ga0500601_000261 | 3300053737 | Bacteria | 10015 |
| 967 | Ga0501084_0012059 | 3300054114 | Bacteria | 7158 |
| 968 | Ga0501084_0152257 | 3300054114 | Bacteria | 1950 |
| 969 | Ga0501082_0001776 | 3300060353 | Bacteria | 18967 |
| 970 | Ga0466962_0044409 | 3300061719 | Bacteria | 2126 |
| 971 | 2507505423 | 2507262055 | Bacteria | 8048963 |
| 972 | 2508539309 | 2508501009 | Bacteria | 7784016 |
| 973 | 2508695636 | 2508501042 | Bacteria | 8719808 |
| 974 | 2511399098 | 2511231028 | Bacteria | 8046582 |
| 975 | 2513623953 | 2513237092 | Bacteria | 8341956 |
| 976 | 2513651361 | 2513237095 | Bacteria | 8976980 |
| 977 | 2513659484 | 2513237096 | Bacteria | 8722461 |
| 978 | 2513676289 | 2513237098 | Bacteria | 9902361 |
| 979 | 2513695261 | 2513237101 | Bacteria | 7952346 |
| 980 | 2513718214 | 2513237104 | Bacteria | 10034502 |
| 981 | 2513859409 | 2513237137 | Bacteria | 9558895 |
| 982 | 2513873376 | 2513237139 | Bacteria | 8737671 |
| 983 | 2513888605 | 2513237141 | Bacteria | 8496279 |
| 984 | 2513921583 | 2513237145 | Bacteria | 8979722 |
| 985 | 2514014707 | 2513237161 | Bacteria | 8871253 |
| 986 | 2515627619 | 2515154112 | Bacteria | 8294334 |
| 987 | 2517106307 | 2517093001 | Bacteria | 9002274 |
| 988 | 2517889024 | 2517572143 | Bacteria | 9484767 |
| 989 | 2524441415 | 2524023205 | Bacteria | 8918781 |
| 990 | 2524467040 | 2524023210 | Bacteria | 9029266 |
| 991 | 2524537454 | 2524023228 | Bacteria | 10118060 |
| 992 | 2528853345 | 2528768022 | Bacteria | 10457665 |
| 993 | 2603858352 | 2602042107 | Bacteria | 6226103 |
| 994 | 2617352087 | 2617270735 | Bacteria | 9163226 |
| 995 | 2617373557 | 2617270741 | Bacteria | 8201522 |
| 996 | 2644291067 | 2643221651 | Bacteria | 4798932 |
| 997 | 2671122620 | 2667528175 | Bacteria | 7532676 |
| 998 | 2723841790 | 2721755755 | Bacteria | 8322773 |
| 999 | 2728748458 | 2728368998 | Bacteria | 8720350 |
| 1000 | 2745077549 | 2744054633 | Bacteria | 8678936 |
| 1001 | 2793062207 | 2791355196 | Bacteria | 7323613 |
| 1002 | 2793073670 | 2791355197 | Bacteria | 8420563 |
| 1003 | 2793078335 | |||
| 1004 | 2805920724 | 2802429603 | Bacteria | 8777136 |
| 1005 | 2818237828 | 2816332527 | Bacteria | 8933356 |
| 1006 | 2824607338 | 2824600985 | Bacteria | 8488197 |
| 1007 | 2824616902 | 2824609381 | Bacteria | 8672835 |
| 1008 | 2824626393 | 2824617872 | Bacteria | 8814715 |
| 1009 | 2824632759 | 2824626560 | Bacteria | 8813858 |
| 1010 | 2824643690 | 2824635225 | Bacteria | 8785348 |
| 1011 | 2824652316 | 2824644064 | Bacteria | 8743947 |
| 1012 | 2824659676 | 2824653114 | Bacteria | 8493680 |
| 1013 | 2824669430 | 2824661429 | Bacteria | 9877870 |
| 1014 | 2824679222 | 2824671348 | Bacteria | 8369588 |
| 1015 | 2824687384 | 2824679649 | Bacteria | 8248951 |
| 1016 | 2824695813 | 2824687955 | Bacteria | 8360029 |
| 1017 | 2824704179 | 2824696289 | Bacteria | 8335049 |
| 1018 | 2824713838 | 2824704595 | Bacteria | 9667483 |
| 1019 | 2824723157 | 2824714736 | Bacteria | 8717648 |
| 1020 | 2824732513 | 2824723954 | Bacteria | 8758240 |
| 1021 | 2824740203 | 2824732956 | Bacteria | 7810675 |
| 1022 | 2824751670 | 2824746037 | Bacteria | 7911610 |
| 1023 | 2824762565 | 2824753945 | Bacteria | 9787441 |
| 1024 | 2824771899 | 2824763712 | Bacteria | 9792355 |
| 1025 | 2824780808 | 2824773399 | Bacteria | 8360218 |
| 1026 | 2838124668 | 2838122688 | Bacteria | 8803140 |
| 1027 | 2841945359 | 2841941048 | Bacteria | 8688029 |
| 1028 | 2841952144 | 2841949485 | Bacteria | 8680857 |
| 1029 | 2841965373 | 2841957949 | Bacteria | 8652217 |
| 1030 | 2841970468 | 2841966195 | Bacteria | 8673214 |
| 1031 | 2841981716 | 2841974524 | Bacteria | 8931498 |
| 1032 | 2841984997 | 2841983080 | Bacteria | 8395090 |
| 1033 | 2842043351 | 2842038055 | Bacteria | 8002051 |
| 1034 | 2842052659 | 2842045827 | Bacteria | 8006841 |
| 1035 | 2844315516 | 2844315083 | Bacteria | 8138177 |
| 1036 | 2847931221 | 2847930680 | Bacteria | 9342022 |
| 1037 | 2847942312 | 2847939898 | Bacteria | 8606328 |
| 1038 | 2849083184 | 2849076700 | Bacteria | 7039503 |
| 1039 | 2857516382 | 2857509624 | Bacteria | 7472071 |
| 1040 | 2857526548 | 2857524615 | Bacteria | 6615449 |
| 1041 | 2874591659 | 2874590934 | Bacteria | 8299676 |
| 1042 | 2874607913 | 2874604998 | Bacteria | 7834745 |
| 1043 | 2874619086 | 2874612657 | Bacteria | 8252029 |
| 1044 | 2874621231 | 2874620515 | Bacteria | 8290088 |
| 1045 | 2874628629 | 2874628541 | Bacteria | 8630250 |
| 1046 | 2874646144 | 2874645413 | Bacteria | 8214782 |
| 1047 | 2876769613 | 2876761206 | Bacteria | 10111113 |
| 1048 | 2876771760 | 2876771140 | Bacteria | 8287509 |
| 1049 | 2876812476 | 2876808645 | Bacteria | 8824342 |
| 1050 | 2876819104 | 2876818435 | Bacteria | 8274608 |
| 1051 | 2879075649 | 2879074833 | Bacteria | 8279565 |
| 1052 | 2879085560 | 2879083081 | Bacteria | 8587928 |
| 1053 | 2879105866 | 2879099564 | Bacteria | 10442239 |
| 1054 | 2879113340 | 2879110137 | Bacteria | 8907982 |
| 1055 | 2879128458 | 2879127579 | Bacteria | 8294491 |
| 1056 | 2879143564 | 2879142872 | Bacteria | 8267021 |
| 1057 | 2881369253 | 2881364244 | Bacteria | 7710352 |
| 1058 | 2881669966 | 2881665667 | Bacteria | 8175609 |
| 1059 | 2885369362 | 2885366525 | Bacteria | 8326213 |
| 1060 | 2885382814 | 2885374607 | Bacteria | 8927485 |
| 1061 | 2885388526 | 2885383462 | Bacteria | 9473874 |
| 1062 | 2885418597 | 2885409591 | Bacteria | 9235467 |
| 1063 | 2888379430 | 2888378607 | Bacteria | 9652610 |
| 1064 | 2888390528 | 2888388044 | Bacteria | 7304136 |
| 1065 | 2888420151 | 2888419890 | Bacteria | 7857137 |
| 1066 | 2893067204 | 2893066018 | Bacteria | 6158120 |
| 1067 | 2903733469 | 2903727486 | Bacteria | 8281579 |
| 1068 | 2903758987 | 2903748898 | Bacteria | 9972761 |
| 1069 | 2903775494 | 2903768456 | Bacteria | 9749579 |
| 1070 | 2904667776 | 2904666416 | Bacteria | 8226587 |
| 1071 | 2904691032 | 2904690495 | Bacteria | 9412302 |
| 1072 | 2904716357 | 2904711408 | Bacteria | 9771557 |
| 1073 | 2906608605 | 2906602504 | Bacteria | 8295279 |
| 1074 | 2906613603 | |||
| 1075 | 2906628536 | 2906626472 | Bacteria | 8826946 |
| 1076 | 2906641607 | 2906635258 | Bacteria | 8601019 |
| 1077 | 2906652294 | 2906643746 | Bacteria | 8722424 |
| 1078 | 2906668134 | 2906660503 | Bacteria | 8595048 |
| 1079 | 2908747624 | 2908739725 | Bacteria | 8628932 |
| 1080 | 2908757090 | 2908756301 | Bacteria | 8864324 |
| 1081 | 2908776030 | 2908775508 | Bacteria | 8092255 |
| 1082 | 2919073632 | 2919073203 | Bacteria | 6531949 |
| 1083 | 2922363180 | 2922361189 | Bacteria | 7436256 |
| 1084 | 2922369416 | |||
| 1085 | 2922388515 | 2922386360 | Bacteria | 7017218 |
| 1086 | 2922398146 | 2922393267 | Bacteria | 8285685 |
| 1087 | 2922434039 | |||
| 1088 | 2929618756 | 2929615660 | Bacteria | 9193770 |
| 1089 | 2929628559 | 2929624759 | Bacteria | 9339455 |
| 1090 | 2932790938 | 2932784394 | Bacteria | 9704911 |
| 1091 | 2932794171 | 2932794094 | Bacteria | 7915132 |
| 1092 | 2932812011 | 2932809354 | Bacteria | 9135765 |
| 1093 | 2932825538 | 2932818245 | Bacteria | 9955613 |
| 1094 | 2932833654 | 2932828146 | Bacteria | 9745859 |
| 1095 | 2933580534 | 2933577622 | Bacteria | 9116884 |
| 1096 | 2935615548 | 2935608549 | Bacteria | 8203142 |
| 1097 | 2935623180 | 2935616580 | Bacteria | 9032984 |
| 1098 | 2935636071 | 2935630451 | Bacteria | 8169952 |
| 1099 | 2935644255 | 2935638405 | Bacteria | 10015038 |
| 1100 | 2935654478 | 2935648319 | Bacteria | 8801166 |
| 1101 | 2935663358 | 2935656913 | Bacteria | 8965014 |
| 1102 | 2935672163 | 2935665750 | Bacteria | 9571747 |
| 1103 | 2935679314 | 2935675223 | Bacteria | 9928132 |
| 1104 | 2935686557 | 2935684952 | Bacteria | 9590419 |
| 1105 | 2935700340 | 2935694250 | Bacteria | 9291695 |
| 1106 | 2935710288 | 2935703347 | Bacteria | 10242284 |
| 1107 | 2935716245 | 2935713505 | Bacteria | 9608509 |
| 1108 | 2935723631 | 2935722832 | Bacteria | 9608746 |
| 1109 | 2935735186 | 2935732158 | Bacteria | 9706831 |
| 1110 | 2935744023 | 2935741537 | Bacteria | 9707219 |
| 1111 | 2935752523 | 2935750917 | Bacteria | 9590372 |
| 1112 | 2935763345 | 2935760218 | Bacteria | 9817913 |
| 1113 | 2935772892 | 2935769743 | Bacteria | 7878163 |
| 1114 | 2935783318 | 2935777560 | Bacteria | 8077691 |
| 1115 | 2935788120 | 2935785616 | Bacteria | 7962367 |
| 1116 | 2935796304 | 2935793552 | Bacteria | 8012592 |
| 1117 | 2935808279 | 2935801545 | Bacteria | 9301974 |
| 1118 | 2935816110 | 2935810662 | Bacteria | 9401221 |
| 1119 | 2935825651 | 2935819856 | Bacteria | 8261050 |
| 1120 | 2935833501 | 2935827899 | Bacteria | 10038562 |
| 1121 | 2935844454 | 2935837841 | Bacteria | 9454360 |
| 1122 | 2935853415 | 2935847175 | Bacteria | 8228321 |
| 1123 | 2935861428 | 2935855204 | Bacteria | 9035059 |
| 1124 | 2935869547 | 2935864058 | Bacteria | 9784707 |
| 1125 | 2935879876 | 2935873716 | Bacteria | 9632195 |
| 1126 | 2935889198 | 2935883170 | Bacteria | 7964738 |
| 1127 | 2935915017 | 2935908558 | Bacteria | 8568796 |
| 1128 | 2935918865 | 2935916978 | Bacteria | 9113783 |
| 1129 | 2935931418 | 2935926038 | Bacteria | 8601059 |
| 1130 | 2935940015 | 2935934488 | Bacteria | 8602579 |
| 1131 | 2935947638 | 2935942939 | Bacteria | 8599779 |
| 1132 | 2935956409 | 2935951376 | Bacteria | 8602333 |
| 1133 | 2935966748 | 2935959822 | Bacteria | 7869783 |
| 1134 | 2935973203 | 2935967501 | Bacteria | 8603075 |
| 1135 | 2935990095 | 2935984226 | Bacteria | 8302647 |
| 1136 | 2935997901 | 2935992306 | Bacteria | 9802711 |
| 1137 | 2936008834 | 2936002035 | Bacteria | 9362176 |
| 1138 | 2936017483 | 2936011229 | Bacteria | 8801034 |
| 1139 | 2936026016 | 2936019824 | Bacteria | 8804134 |
| 1140 | 2936034858 | 2936028420 | Bacteria | 8965941 |
| 1141 | 2936041115 | 2936037263 | Bacteria | 9446081 |
| 1142 | 2936052884 | 2936046547 | Bacteria | 8903709 |
| 1143 | 2936060257 | 2936055302 | Bacteria | 8785755 |
| 1144 | 2940558436 | 2940556831 | Bacteria | 9590747 |
| 1145 | 2941512625 | 2941507105 | Bacteria | 8166816 |
| 1146 | 2941520537 | 2941515067 | Bacteria | 8166720 |
| 1147 | 2941528551 | 2941523033 | Bacteria | 8169134 |
| 1148 | 2941535370 | 2941531003 | Bacteria | 7653939 |
| 1149 | 2941543373 | 2941538514 | Bacteria | 9402094 |
| 1150 | 3005475246 | 3005474847 | Bacteria | 9259049 |
| 1151 | 3005486703 | 3005483717 | Bacteria | 7877331 |
| 1152 | 3005509008 | 3005506211 | Bacteria | 6943378 |
| 1153 | 3005594107 | 3005587118 | Bacteria | 7794411 |
| 1154 | 3005595206 | 3005594810 | Bacteria | 8716512 |
| 1155 | 3005711149 | 3005710791 | Bacteria | 7622528 |
| 1156 | 8006931949 | 8006926726 | Bacteria | 6749210 |
| 1157 | 8006936031 | 8006933436 | Bacteria | 10410654 |
| 1158 | 8006967609 | 8006964411 | Bacteria | 8966052 |
| 1159 | 8006975845 | 8006973647 | Bacteria | 10679141 |
| 1160 | 8006991078 | 8006984368 | Bacteria | 9651211 |
| 1161 | 8007000408 | 8006994254 | Bacteria | 8309700 |
| 1162 | 8016518021 | 8016511872 | Bacteria | 9921665 |
| 1163 | 8016526299 | 8016522445 | Bacteria | 8156687 |
| 1164 | 8016531360 | 8016530956 | Bacteria | 8155261 |
| 1165 | 8016544575 | 8016539877 | Bacteria | 8155419 |
| 1166 | 8016557501 | 8016548790 | Bacteria | 8155074 |
| 1167 | 8016565857 | 8016557553 | Bacteria | 8154380 |
| 1168 | 8016569626 | 8016566248 | Bacteria | 8158151 |
| 1169 | 8016582235 | 8016575299 | Bacteria | 8154085 |
| 1170 | 8016586265 | 8016583857 | Bacteria | 10421953 |
| 1171 | 8016603456 | 8016595262 | Bacteria | 8149947 |
| 1172 | 8016606397 | 8016603502 | Bacteria | 8731218 |
| 1173 | 8016618302 | 8016613128 | Bacteria | 8794220 |
| 1174 | 8016622951 | 8016622563 | Bacteria | 7999408 |
| 1175 | 8016635454 | 8016630954 | Bacteria | 9217207 |
| 1176 | 8017058622 | 8017057580 | Bacteria | 10023680 |
| 1177 | 8019531194 | 8019530166 | Bacteria | 8155624 |
| 1178 | 8019540359 | 8019538911 | Bacteria | 7872763 |
| 1179 | 8019549954 | 8019547302 | Bacteria | 7996444 |
| 1180 | 8019562623 | 8019555841 | Bacteria | 9642137 |
| 1181 | 8019572701 | 8019565922 | Bacteria | 9639779 |
| 1182 | 8019577037 | 8019576017 | Bacteria | 10049540 |
| 1183 | 8019595104 | 8019586578 | Bacteria | 10212056 |
| 1184 | 8019606636 | 8019597564 | Bacteria | 10041141 |
| 1185 | 8019611875 | 8019608314 | Bacteria | 10042931 |
| 1186 | 8019629964 | 8019629233 | Bacteria | 8687553 |
| 1187 | 8019640643 | 8019638758 | Bacteria | 9062356 |
| 1188 | 8019652310 | 8019648815 | Bacteria | 10014479 |
| 1189 | 8019666804 | 8019659431 | Bacteria | 8577854 |
| 1190 | 8019676562 | 8019668869 | Bacteria | 8791617 |
| 1191 | 8019679428 | 8019678201 | Bacteria | 8863603 |
| 1192 | 8019696077 | 8019687851 | Bacteria | 8712826 |
| 1193 | 8055742605 | 8055742211 | Bacteria | 9226248 |
| 1194 | 8056676112 | 8056673599 | Bacteria | 7871253 |
| 1195 | 8056682914 | 8056681323 | Bacteria | 8472857 |
| 1196 | 8056691117 | 8056689827 | Bacteria | 6712655 |
| 1197 | 8056971463 | 8056967851 | Bacteria | 9038162 |
| 1198 | Ga0068862_100168346 | |||
| 1199 | JGI24737J22298_10014205 | |||
| 1200 | JGI25406J46586_10045805 | |||
| 1201 | JGI25153J46596_10006802 | |||
| 1202 | JGI25153J46596_10011847 | |||
| 1203 | JGI25153J46596_10015051 | |||
| 1204 | JGI25153J46596_10015527 | |||
| 1205 | JGI25160J50197_1012785 | |||
| 1206 | JGI25404J52841_10005838 | |||
| 1207 | JGI25404J52841_10017706 | |||
| 1208 | JGI25404J52841_10018823 | |||
| 1209 | Ga0055543_1014573 | |||
| 1210 | Ga0065165_1004935 | |||
| 1211 | Ga0065165_1005401 | |||
| 1212 | Ga0065165_1021918 | |||
| 1213 | Ga0070683_100047414 | |||
| 1214 | Ga0070683_100120003 | |||
| 1215 | Ga0070670_100183742 | |||
| 1216 | Ga0070680_100053553 | |||
| 1217 | Ga0070680_100114431 | |||
| 1218 | Ga0070680_100370426 | |||
| 1219 | Ga0070689_100271724 | |||
| 1220 | Ga0070691_10115497 | |||
| 1221 | Ga0070668_100031220 | |||
| 1222 | Ga0070668_100052517 | |||
| 1223 | Ga0070673_100352065 | |||
| 1224 | Ga0070709_10000820 | |||
| 1225 | Ga0070709_10007668 | |||
| 1226 | Ga0070714_100011934 | |||
| 1227 | Ga0070714_100025834 | |||
| 1228 | Ga0070714_100034248 | |||
| 1229 | Ga0070714_100062901 | |||
| 1230 | Ga0070714_100079305 | |||
| 1231 | Ga0070713_100003576 | |||
| 1232 | Ga0070713_100047748 | |||
| 1233 | Ga0070713_100081426 | |||
| 1234 | Ga0070710_10000802 | |||
| 1235 | Ga0070710_10001532 | |||
| 1236 | Ga0070711_100009673 | |||
| 1237 | Ga0070711_100012226 | |||
| 1238 | Ga0070711_100012351 | |||
| 1239 | Ga0070711_100158534 | |||
| 1240 | Ga0070663_100032201 | |||
| 1241 | Ga0070663_100045514 | |||
| 1242 | Ga0070663_100071628 | |||
| 1243 | Ga0070663_100085037 | |||
| 1244 | Ga0070663_100156535 | |||
| 1245 | Ga0070663_100175865 | |||
| 1246 | Ga0070663_100184959 | |||
| 1247 | Ga0070663_100366543 | |||
| 1248 | Ga0070678_100263059 | |||
| 1249 | Ga0070681_10001077 | |||
| 1250 | Ga0070681_10028258 | |||
| 1251 | Ga0070707_100149757 | |||
| 1252 | Ga0070698_100090319 | |||
| 1253 | Ga0070698_100264821 | |||
| 1254 | Ga0070699_100359358 | |||
| 1255 | Ga0070679_100002400 | |||
| 1256 | Ga0070679_100009606 | |||
| 1257 | Ga0070679_100085678 | |||
| 1258 | Ga0070679_100109961 | |||
| 1259 | Ga0070679_100135439 | |||
| 1260 | Ga0070679_100158674 | |||
| 1261 | Ga0070684_100025298 | |||
| 1262 | Ga0068853_100031608 | |||
| 1263 | Ga0068853_100045931 | |||
| 1264 | Ga0068853_100048615 | |||
| 1265 | Ga0068853_100068200 | |||
| 1266 | Ga0068853_100273595 | |||
| 1267 | Ga0070672_100135179 | |||
| 1268 | Ga0070665_100029471 | |||
| 1269 | Ga0070665_100031667 | |||
| 1270 | Ga0070665_100065669 | |||
| 1271 | Ga0070665_100081254 | |||
| 1272 | Ga0070665_100104376 | |||
| 1273 | Ga0070665_100109625 | |||
| 1274 | Ga0068855_100037045 | |||
| 1275 | Ga0068855_100060155 | |||
| 1276 | Ga0068855_100063458 | |||
| 1277 | Ga0068855_100378058 | |||
| 1278 | Ga0070664_100283958 | |||
| 1279 | Ga0070664_100481054 | |||
| 1280 | Ga0068857_100001037 | |||
| 1281 | Ga0068857_100025105 | |||
| 1282 | Ga0068857_100033794 | |||
| 1283 | Ga0068857_100300707 | |||
| 1284 | Ga0068857_100461448 | |||
| 1285 | Ga0068854_100034116 | |||
| 1286 | Ga0068854_100138437 | |||
| 1287 | Ga0068856_100000883 | |||
| 1288 | Ga0068856_100142760 | |||
| 1289 | Ga0068856_100258285 | |||
| 1290 | Ga0068856_100260458 | |||
| 1291 | Ga0070702_100137203 | |||
| 1292 | Ga0068852_100094545 | |||
| 1293 | Ga0068859_100047861 | |||
| 1294 | Ga0068864_100072570 | |||
| 1295 | Ga0068851_10000558 | |||
| 1296 | Ga0068870_10135604 | |||
| 1297 | Ga0068858_100495047 | |||
| 1298 | Ga0068860_100000477 | |||
| 1299 | Ga0068860_100209710 | |||
| 1300 | Ga0068860_100289839 | |||
| 1301 | Ga0081455_10002724 | |||
| 1302 | Ga0081455_10007370 | |||
| 1303 | Ga0081455_10042159 | |||
| 1304 | Ga0081540_1003488 | |||
| 1305 | Ga0081540_1007876 | |||
| 1306 | Ga0081540_1008854 | |||
| 1307 | Ga0081540_1014559 | |||
| 1308 | Ga0081540_1020591 | |||
| 1309 | Ga0081540_1029453 | |||
| 1310 | Ga0081540_1033178 | |||
| 1311 | Ga0081540_1041232 | |||
| 1312 | Ga0081540_1042419 | |||
| 1313 | Ga0081540_1049844 | |||
| 1314 | Ga0081539_10000265 | |||
| 1315 | Ga0081539_10000371 | |||
| 1316 | Ga0081539_10043985 | |||
| 1317 | Ga0081539_10085002 | |||
| 1318 | Ga0070717_10016786 | |||
| 1319 | Ga0070717_10061429 | |||
| 1320 | Ga0075365_10008318 | |||
| 1321 | Ga0075365_10066442 | |||
| 1322 | Ga0075365_10067630 | |||
| 1323 | Ga0075365_10109412 | |||
| 1324 | Ga0075368_10002496 | |||
| 1325 | Ga0075363_100004174 | |||
| 1326 | Ga0075363_100028319 | |||
| 1327 | Ga0075364_10058436 | |||
| 1328 | Ga0070715_10000275 | |||
| 1329 | Ga0070716_100019113 | |||
| 1330 | Ga0070712_100005859 | |||
| 1331 | Ga0070712_100078337 | |||
| 1332 | Ga0075367_10010418 | |||
| 1333 | Ga0075367_10087546 | |||
| 1334 | Ga0075369_10022548 | |||
| 1335 | Ga0075369_10022934 | |||
| 1336 | Ga0075369_10047007 | |||
| 1337 | Ga0075369_10101802 | |||
| 1338 | Ga0075366_10017520 | |||
| 1339 | Ga0075370_10010551 | |||
| 1340 | Ga0075370_10102371 | |||
| 1341 | Ga0075370_10127604 | |||
| 1342 | Ga0075434_100107896 | |||
| 1343 | Ga0068865_100068195 | |||
| 1344 | Ga0068865_100073289 | |||
| 1345 | Ga0068865_100082031 | |||
| 1346 | Ga0097620_100047862 | |||
| 1347 | Ga0099824_1010644 | |||
| 1348 | Ga0099824_1012314 | |||
| 1349 | Ga0099822_1012672 | |||
| 1350 | Ga0099823_1023025 | |||
| 1351 | Ga0075435_100053972 | |||
| 1352 | Ga0099794_10029658 | |||
| 1353 | Ga0099794_10093906 | |||
| 1354 | Ga0099794_10122178 | |||
| 1355 | Ga0105240_10002459 | |||
| 1356 | Ga0105240_10012773 | |||
| 1357 | Ga0105240_10014356 | |||
| 1358 | Ga0105240_10075561 | |||
| 1359 | Ga0105240_10088443 | |||
| 1360 | Ga0105240_10171590 | |||
| 1361 | Ga0105240_10211465 | |||
| 1362 | Ga0105240_10409511 | |||
| 1363 | Ga0105247_10099706 | |||
| 1364 | Ga0105241_10000249 | |||
| 1365 | Ga0105241_10067677 | |||
| 1366 | Ga0105241_10427802 | |||
| 1367 | Ga0105248_10126874 | |||
| 1368 | Ga0105248_10173518 | |||
| 1369 | Ga0105248_10294575 | |||
| 1370 | Ga0105237_10017086 | |||
| 1371 | Ga0105237_10050524 | |||
| 1372 | Ga0105237_10094994 | |||
| 1373 | Ga0105237_10130560 | |||
| 1374 | Ga0105237_10264973 | |||
| 1375 | Ga0105237_10399913 | |||
| 1376 | Ga0105237_10473948 | |||
| 1377 | Ga0105238_10014511 | |||
| 1378 | Ga0105238_10038587 | |||
| 1379 | Ga0105238_10186210 | |||
| 1380 | Ga0105239_10047808 | |||
| 1381 | Ga0105239_10096944 | |||
| 1382 | Ga0105239_10170906 | |||
| 1383 | Ga0105239_10171641 | |||
| 1384 | Ga0105239_10297063 | |||
| 1385 | Ga0105239_10334097 | |||
| 1386 | Ga0105239_10347557 | |||
| 1387 | Ga0105239_10481814 | |||
| 1388 | Ga0105239_10511517 | |||
| 1389 | Ga0105246_10059630 | |||
| 1390 | Ga0105246_10286503 | |||
| 1391 | Ga0157370_10365836 | |||
| 1392 | Ga0157369_10040528 | |||
| 1393 | Ga0157369_10128793 | |||
| 1394 | Ga0157369_10331885 | |||
| 1395 | Ga0157374_10356302 | |||
| 1396 | Ga0157378_10087681 | |||
| 1397 | Ga0157372_10072119 | |||
| 1398 | Ga0157372_10448821 | |||
| 1399 | Ga0157372_10537379 | |||
| 1400 | Ga0157375_10015617 | |||
| 1401 | Ga0157375_10364017 | |||
| 1402 | Ga0163163_10018908 | |||
| 1403 | Ga0157380_10053334 | |||
| 1404 | Ga0157380_10707464 | |||
| 1405 | Ga0157379_10041002 | |||
| 1406 | Ga0157379_10430626 | |||
| 1407 | Ga0163161_10100976 | |||
| 1408 | Ga0163161_10196097 | |||
| 1409 | Ga0163161_10241499 | |||
| 1410 | Ga0214544_1000056 | |||
| 1411 | Ga0214542_1000071 | |||
| 1412 | Ga0214545_1000033 | |||
| 1413 | Ga0214543_1000105 | |||
| 1414 | Ga0213874_10047511 | |||
| 1415 | Ga0213876_10002330 | |||
| 1416 | Ga0213875_10000033 | |||
| 1417 | Ga0209563_102230 | |||
| 1418 | Ga0209677_102647 | |||
| 1419 | Ga0209148_1000295 | |||
| 1420 | Ga0209233_1003626 | |||
| 1421 | Ga0209233_1011983 | |||
| 1422 | Ga0209455_1005746 | |||
| 1423 | Ga0209564_1006069 | |||
| 1424 | Ga0209564_1014353 | |||
| 1425 | Ga0209758_1000069 | |||
| 1426 | Ga0209758_1001918 | |||
| 1427 | Ga0209758_1002874 | |||
| 1428 | Ga0209758_1004128 | |||
| 1429 | Ga0209758_1004293 | |||
| 1430 | Ga0209758_1014150 | |||
| 1431 | Ga0209758_1020420 | |||
| 1432 | Ga0209256_1004477 | |||
| 1433 | Ga0207426_1002173 | |||
| 1434 | Ga0207426_1007252 | |||
| 1435 | Ga0207426_1007538 | |||
| 1436 | Ga0207426_1022846 | |||
| 1437 | Ga0207426_1034587 | |||
| 1438 | Ga0209257_1011512 | |||
| 1439 | Ga0209257_1022140 | |||
| 1440 | Ga0207697_10070939 | |||
| 1441 | Ga0207692_10000565 | |||
| 1442 | Ga0207692_10003710 | |||
| 1443 | Ga0207692_10062096 | |||
| 1444 | Ga0207710_10030120 | |||
| 1445 | Ga0207710_10052566 | |||
| 1446 | Ga0207688_10039975 | |||
| 1447 | Ga0207688_10160901 | |||
| 1448 | Ga0207647_10009887 | |||
| 1449 | Ga0207647_10015369 | |||
| 1450 | Ga0207699_10000907 | |||
| 1451 | Ga0207699_10017853 | |||
| 1452 | Ga0207699_10018645 | |||
| 1453 | Ga0207705_10150446 | |||
| 1454 | Ga0207705_10292620 | |||
| 1455 | Ga0207684_10283200 | |||
| 1456 | Ga0207654_10000083 | |||
| 1457 | Ga0207654_10037513 | |||
| 1458 | Ga0207654_10037960 | |||
| 1459 | Ga0207654_10046406 | |||
| 1460 | Ga0207707_10001947 | |||
| 1461 | Ga0207707_10007389 | |||
| 1462 | Ga0207707_10244782 | |||
| 1463 | Ga0207695_10000148 | |||
| 1464 | Ga0207695_10000387 | |||
| 1465 | Ga0207695_10025135 | |||
| 1466 | Ga0207695_10060768 | |||
| 1467 | Ga0207695_10168101 | |||
| 1468 | Ga0207671_10003051 | |||
| 1469 | Ga0207671_10077659 | |||
| 1470 | Ga0207671_10215551 | |||
| 1471 | Ga0207693_10001168 | |||
| 1472 | Ga0207693_10010075 | |||
| 1473 | Ga0207693_10035225 | |||
| 1474 | Ga0207663_10004460 | |||
| 1475 | Ga0207663_10004693 | |||
| 1476 | Ga0207663_10019599 | |||
| 1477 | Ga0207660_10042346 | |||
| 1478 | Ga0207660_10196839 | |||
| 1479 | Ga0207660_10273954 | |||
| 1480 | Ga0207657_10009668 | |||
| 1481 | Ga0207657_10024873 | |||
| 1482 | Ga0207657_10064842 | |||
| 1483 | Ga0207652_10014863 | |||
| 1484 | Ga0207652_10041398 | |||
| 1485 | Ga0207652_10175359 | |||
| 1486 | Ga0207652_10188003 | |||
| 1487 | Ga0207694_10000121 | |||
| 1488 | Ga0207650_10143320 | |||
| 1489 | Ga0207650_10285702 | |||
| 1490 | Ga0207700_10021126 | |||
| 1491 | Ga0207664_10012301 | |||
| 1492 | Ga0207664_10016162 | |||
| 1493 | Ga0207664_10063975 | |||
| 1494 | Ga0207664_10081345 | |||
| 1495 | Ga0207664_10107642 | |||
| 1496 | Ga0207664_10182850 | |||
| 1497 | Ga0207664_10203057 | |||
| 1498 | Ga0207644_10054095 | |||
| 1499 | Ga0207644_10147990 | |||
| 1500 | Ga0207644_10282042 | |||
| 1501 | Ga0207706_10321970 | |||
| 1502 | Ga0207709_10007306 | |||
| 1503 | Ga0207704_10025225 | |||
| 1504 | Ga0207665_10000883 | |||
| 1505 | Ga0207665_10002000 | |||
| 1506 | Ga0207665_10182091 | |||
| 1507 | Ga0207691_10046534 | |||
| 1508 | Ga0207691_10115601 | |||
| 1509 | Ga0207691_10120454 | |||
| 1510 | Ga0207661_10002867 | |||
| 1511 | Ga0207661_10037877 | |||
| 1512 | Ga0207661_10297503 | |||
| 1513 | Ga0207679_10161499 | |||
| 1514 | Ga0207679_10279429 | |||
| 1515 | Ga0207667_10099646 | |||
| 1516 | Ga0207667_10106489 | |||
| 1517 | Ga0207667_10113600 | |||
| 1518 | Ga0207667_10145540 | |||
| 1519 | Ga0207667_10293822 | |||
| 1520 | Ga0207667_10320014 | |||
| 1521 | Ga0207712_10170967 | |||
| 1522 | Ga0207668_10055636 | |||
| 1523 | Ga0207668_10071498 | |||
| 1524 | Ga0207668_10089385 | |||
| 1525 | Ga0207668_10134074 | |||
| 1526 | Ga0207668_10201416 | |||
| 1527 | Ga0207668_10208465 | |||
| 1528 | Ga0207640_10055768 | |||
| 1529 | Ga0207640_10111808 | |||
| 1530 | Ga0207677_10109413 | |||
| 1531 | Ga0207639_10105577 | |||
| 1532 | Ga0207639_10105616 | |||
| 1533 | Ga0207639_10273504 | |||
| 1534 | Ga0207678_10007286 | |||
| 1535 | Ga0207678_10023772 | |||
| 1536 | Ga0207678_10030943 | |||
| 1537 | Ga0207678_10049177 | |||
| 1538 | Ga0207678_10053564 | |||
| 1539 | Ga0207678_10095444 | |||
| 1540 | Ga0207678_10178177 | |||
| 1541 | Ga0207678_10411329 | |||
| 1542 | Ga0207702_10000004 | |||
| 1543 | Ga0207702_10000318 | |||
| 1544 | Ga0207702_10512317 | |||
| 1545 | Ga0207641_10354695 | |||
| 1546 | Ga0207648_10111460 | |||
| 1547 | Ga0207676_10142898 | |||
| 1548 | Ga0207676_10280626 | |||
| 1549 | Ga0207674_10005964 | |||
| 1550 | Ga0207674_10006033 | |||
| 1551 | Ga0207674_10012348 | |||
| 1552 | Ga0207674_10108974 | |||
| 1553 | Ga0207674_10336032 | |||
| 1554 | Ga0207675_100026733 | |||
| 1555 | Ga0207675_100221006 | |||
| 1556 | Ga0207675_100317294 | |||
| 1557 | Ga0207683_10063270 | |||
| 1558 | Ga0207683_10175358 | |||
| 1559 | Ga0207698_10128272 | |||
| 1560 | Ga0207698_10263227 | |||
| 1561 | Ga0209389_1000157 | |||
| 1562 | Ga0209389_1000349 | |||
| 1563 | Ga0209589_1000035 | |||
| 1564 | Ga0209589_1003843 | |||
| 1565 | Ga0209489_100079 | |||
| 1566 | Ga0209489_101111 | |||
| 1567 | Ga0209489_103974 | |||
| 1568 | Ga0209700_100011 | |||
| 1569 | Ga0209700_100077 | |||
| 1570 | Ga0268266_10001236 | |||
| 1571 | Ga0268266_10031941 | |||
| 1572 | Ga0268266_10104133 | |||
| 1573 | Ga0268266_10209638 | |||
| 1574 | Ga0268265_10113357 | |||
| 1575 | Ga0268265_10367284 | |||
| 1576 | Ga0268264_10000062 | |||
| 1577 | Ga0268264_10222966 | |||
| 1578 | Ga0307517_10000175 | |||
| 1579 | Ga0307517_10197719 | |||
| 1580 | Ga0307515_10034911 | |||
| 1581 | Ga0307515_10092532 | |||
| 1582 | Ga0307515_10191196 | |||
| 1583 | Ga0307511_10070832 | |||
| 1584 | Ga0265330_10054095 | |||
| 1585 | Ga0265332_10003278 | |||
| 1586 | Ga0265332_10007021 | |||
| 1587 | Ga0265328_10016314 | |||
| 1588 | Ga0265325_10065075 | |||
| 1589 | Ga0265340_10002509 | |||
| 1590 | Ga0265339_10000738 | |||
| 1591 | Ga0265339_10015187 | |||
| 1592 | Ga0265339_10159401 | |||
| 1593 | Ga0307513_10189506 | |||
| 1594 | Ga0307509_10006160 | |||
| 1595 | Ga0307509_10262543 | |||
| 1596 | Ga0307509_10315318 | |||
| 1597 | Ga0307508_10000045 | |||
| 1598 | Ga0307508_10185394 | |||
| 1599 | Ga0265314_10026793 | |||
| 1600 | Ga0265342_10000789 | |||
| 1601 | Ga0265342_10005212 | |||
| 1602 | Ga0265342_10046291 | |||
| 1603 | Ga0307516_10045874 | |||
| 1604 | Ga0307516_10078174 | |||
| 1605 | Ga0307516_10146981 | |||
| 1606 | Ga0307406_10084190 | |||
| 1607 | Ga0307412_10052998 | |||
| 1608 | Ga0307416_100482080 | |||
| 1609 | Ga0307415_100035854 | |||
| 1610 | Ga0307507_10065520 | |||
| 1611 | Ga0307510_10005941 | |||
| 1612 | Ga0307510_10020148 | |||
| 1613 | Ga0307510_10240881 | |||
| 1614 | Ga0315911_1000008 | |||
| 1615 | Ga0373934_0022652 | |||
| 1616 | Ga0373940_0063221 | |||
| 1617 | Ga0373923_0002779 | |||
| 1618 | Ga0373923_0026195 | |||
| 1619 | Ga0373923_0063281 | |||
| 1620 | Ga0373936_0053633 | |||
| 1621 | Ga0373945_0013723 | |||
| 1622 | Ga0373954_0008952 | |||
| 1623 | Ga0373954_0083214 | |||
| 1624 | Ga0373956_0004385 | |||
| 1625 | Ga0373956_0035419 | |||
| 1626 | Ga0373957_0038777 | |||
| 1627 | Ga0373943_0019810 | |||
| 1628 | Ga0373943_0030555 | |||
| 1629 | Ga0373946_0009807 | |||
| 1630 | Ga0373955_0002044 | |||
| 1631 | Ga0373955_0021308 | |||
| 1632 | Ga0373924_0009573 | |||
| 1633 | Ga0373924_0029224 | |||
| 1634 | Ga0373924_0052734 | |||
| 1635 | Ga0373931_0005215 | |||
| 1636 | Ga0373935_0001683 | |||
| 1637 | Ga0373935_0110751 | |||
| 1638 | Ga0373927_0001064 | |||
| 1639 | Ga0373927_0003727 | |||
| 1640 | Ga0373927_0016324 | |||
| 1641 | Ga0373927_0035670 | |||
| 1642 | Ga0373927_0055863 | |||
| 1643 | Ga0373927_0106543 | |||
| 1644 | Ga0373933_0000068 | |||
| 1645 | Ga0373933_0009248 | |||
| 1646 | Ga0373933_0118519 | |||
| 1647 | Ga0373947_0006319 | |||
| 1648 | Ga0373947_0008648 | |||
| 1649 | Ga0373947_0103908 | |||
| 1650 | Ga0373947_0126323 | |||
| 1651 | Ga0373947_0147077 | |||
| 1652 | Ga0373937_0017394 | |||
| 1653 | Ga0373937_0022449 | |||
| 1654 | Ga0373937_0029705 | |||
| 1655 | Ga0373937_0065670 | |||
| 1656 | Ga0373937_0188107 | |||
| 1657 | Ga0373925_0007638 | |||
| 1658 | Ga0373925_0093233 | |||
| 1659 | Ga0373925_0113305 | |||
| 1660 | Ga0373925_0163374 | |||
| 1661 | Ga0395899_0069720 | |||
| 1662 | Ga0395900_0020656 | |||
| 1663 | Ga0395900_0148706 | |||
| 1664 | Ga0395900_0437877 | |||
| 1665 | Ga0395900_0445273 | |||
| 1666 | Ga0395898_0050745 | |||
| 1667 | Ga0395898_0257194 | |||
| 1668 | Ga0395898_0373450 | |||
| 1669 | Ga0395905_0001948 | |||
| 1670 | Ga0395905_0048386 | |||
| 1671 | Ga0436364_0738225 | |||
| 1672 | Ga0436364_1338082 | |||
| 1673 | Ga0395901_0089489 | |||
| 1674 | Ga0395901_0199025 | |||
| 1675 | Ga0395901_0235797 | |||
| 1676 | Ga0400483_063134 | |||
| 1677 | Ga0400483_064073 | |||
| 1678 | Ga0400483_170476 | |||
| 1679 | Ga0400483_292171 | |||
| 1680 | Ga0436363_0740465 | |||
| 1681 | Ga0466969_0019790 | |||
| 1682 | Ga0466969_0058661 | |||
| 1683 | Ga0466972_0000299 | |||
| 1684 | Ga0466972_0023246 | |||
| 1685 | Ga0466966_0003365 | |||
| 1686 | Ga0466961_0000709 | |||
| 1687 | Ga0466963_0046772 | |||
| 1688 | Ga0466957_0160598 | |||
| 1689 | Ga0466959_0027413 | |||
| 1690 | Ga0466959_0040311 | |||
| 1691 | Ga0466958_0225078 | |||
| 1692 | Ga0466967_0078628 | |||
| 1693 | Ga0466967_0081393 | |||
| 1694 | Ga0466967_0179066 | |||
| 1695 | Ga0495592_0020736 | |||
| 1696 | Ga0495592_0257244 | |||
| 1697 | Ga0495603_0003128 | |||
| 1698 | Ga0495603_0003243 | |||
| 1699 | Ga0495603_0003728 | |||
| 1700 | Ga0495603_0012063 | |||
| 1701 | Ga0495629_0001107 | |||
| 1702 | Ga0495629_0002800 | |||
| 1703 | Ga0495629_0012976 | |||
| 1704 | Ga0495629_0055191 | |||
| 1705 | Ga0495629_0074497 | |||
| 1706 | Ga0495638_0003712 | |||
| 1707 | Ga0495638_0084885 | |||
| 1708 | Ga0495641_0004022 | |||
| 1709 | Ga0495641_0079333 | |||
| 1710 | Ga0495641_0080734 | |||
| 1711 | Ga0495651_0003711 | |||
| 1712 | Ga0495651_0009193 | |||
| 1713 | Ga0495651_0047740 | |||
| 1714 | Ga0495651_0120736 | |||
| 1715 | Ga0495653_0019489 | |||
| 1716 | Ga0495653_0028503 | |||
| 1717 | Ga0495653_0102842 | |||
| 1718 | Ga0495653_0109292 | |||
| 1719 | Ga0495650_0046873 | |||
| 1720 | Ga0495580_0001546 | |||
| 1721 | Ga0495580_0001981 | |||
| 1722 | Ga0495580_0090322 | |||
| 1723 | Ga0495605_0073665 | |||
| 1724 | Ga0495639_0000072 | |||
| 1725 | Ga0495662_0000510 | |||
| 1726 | Ga0495662_0075704 | |||
| 1727 | Ga0495664_0001402 | |||
| 1728 | Ga0495664_0006292 | |||
| 1729 | Ga0495664_0043294 | |||
| 1730 | Ga0495664_0058400 | |||
| 1731 | Ga0495585_0047603 | |||
| 1732 | Ga0495585_0061098 | |||
| 1733 | Ga0495585_0093709 | |||
| 1734 | Ga0495594_0000467 | |||
| 1735 | Ga0495594_0066615 | |||
| 1736 | Ga0495594_0197900 | |||
| 1737 | Ga0495583_0109755 | |||
| 1738 | Ga0495606_0000831 | |||
| 1739 | Ga0495606_0032054 | |||
| 1740 | Ga0495608_0008312 | |||
| 1741 | Ga0495608_0082821 | |||
| 1742 | Ga0495608_0097634 | |||
| 1743 | Ga0495618_0010639 | |||
| 1744 | Ga0495618_0088763 | |||
| 1745 | Ga0495620_0044570 | |||
| 1746 | Ga0495620_0073373 | |||
| 1747 | Ga0495628_0003465 | |||
| 1748 | Ga0495628_0084162 | |||
| 1749 | Ga0495630_0019769 | |||
| 1750 | Ga0495631_0021538 | |||
| 1751 | Ga0495631_0069979 | |||
| 1752 | Ga0495632_0040436 | |||
| 1753 | Ga0495637_0079670 | |||
| 1754 | Ga0495643_0042004 | |||
| 1755 | Ga0495644_0022119 | |||
| 1756 | Ga0495648_0002061 | |||
| 1757 | Ga0495648_0061546 | |||
| 1758 | Ga0495648_0114593 | |||
| 1759 | Ga0495648_0180034 | |||
| 1760 | Ga0495666_0085145 | |||
| 1761 | Ga0495652_0026176 | |||
| 1762 | Ga0495652_0029317 | |||
| 1763 | Ga0495652_0033141 | |||
| 1764 | Ga0495652_0038958 | |||
| 1765 | Ga0495652_0064423 | |||
| 1766 | Ga0495652_0144035 | |||
| 1767 | Ga0495654_0011888 | |||
| 1768 | Ga0495665_0000128 | |||
| 1769 | Ga0495665_0021707 | |||
| 1770 | Ga0495640_0010120 | |||
| 1771 | Ga0495640_0025681 | |||
| 1772 | Ga0495640_0061431 | |||
| 1773 | Ga0495640_0065803 | |||
| 1774 | Ga0495587_0017095 | |||
| 1775 | Ga0495587_0086702 | |||
| 1776 | Ga0495645_0064764 | |||
| 1777 | Ga0495622_0005892 | |||
| 1778 | Ga0495622_0014876 | |||
| 1779 | Ga0495622_0016799 | |||
| 1780 | Ga0495622_0088499 | |||
| 1781 | Ga0495622_0100094 | |||
| 1782 | Ga0495633_0052514 | |||
| 1783 | Ga0495667_0005488 | |||
| 1784 | Ga0495667_0036453 | |||
| 1785 | Ga0495656_0002973 | |||
| 1786 | Ga0495668_0028813 | |||
| 1787 | Ga0495668_0106411 | |||
| 1788 | Ga0495634_0004246 | |||
| 1789 | Ga0495634_0034915 | |||
| 1790 | Ga0495634_0063611 | |||
| 1791 | Ga0495625_0090229 | |||
| 1792 | Ga0495625_0201733 | |||
| 1793 | Ga0495635_0000564 | |||
| 1794 | Ga0495635_0001868 | |||
| 1795 | Ga0495635_0019084 | |||
| 1796 | Ga0495635_0028708 | |||
| 1797 | Ga0495635_0101694 | |||
| 1798 | Ga0495635_0105019 | |||
| 1799 | Ga0495659_0045116 | |||
| 1800 | Ga0495661_0087811 | |||
| 1801 | Ga0495588_0007923 | |||
| 1802 | Ga0495588_0009177 | |||
| 1803 | Ga0495657_0007182 | |||
| 1804 | Ga0495657_0033568 | |||
| 1805 | Ga0495657_0100805 | |||
| 1806 | Ga0495599_0014153 | |||
| 1807 | Ga0495599_0020349 | |||
| 1808 | Ga0495599_0042374 | |||
| 1809 | Ga0495599_0219207 | |||
| 1810 | Ga0495623_0020666 | |||
| 1811 | Ga0495623_0034663 | |||
| 1812 | Ga0495646_0003182 | |||
| 1813 | Ga0495646_0034504 | |||
| 1814 | Ga0495646_0177965 | |||
| 1815 | Ga0495647_0002893 | |||
| 1816 | Ga0495658_0000707 | |||
| 1817 | Ga0495669_0006578 | |||
| 1818 | Ga0495669_0030472 | |||
| 1819 | Ga0495669_0041240 | |||
| 1820 | Ga0495613_0001986 | |||
| 1821 | Ga0495613_0031628 | |||
| 1822 | Ga0495613_0070841 | |||
| 1823 | Ga0495613_0214027 | |||
| 1824 | Ga0495613_0229984 | |||
| 1825 | Ga0495624_0007718 | |||
| 1826 | Ga0495624_0027338 | |||
| 1827 | Ga0495670_0005603 | |||
| 1828 | Ga0495670_0092874 | |||
| 1829 | Ga0495589_0100633 | |||
| 1830 | Ga0495600_0016480 | |||
| 1831 | Ga0495600_0046117 | |||
| 1832 | Ga0495581_0000030 | |||
| 1833 | Ga0495581_0080105 | |||
| 1834 | Ga0495581_0195670 | |||
| 1835 | Ga0495604_0001746 | |||
| 1836 | Ga0495604_0006243 | |||
| 1837 | Ga0495604_0089587 | |||
| 1838 | Ga0495604_0147504 | |||
| 1839 | Ga0495604_0250564 | |||
| 1840 | Ga0495674_0024013 | |||
| 1841 | Ga0495674_0167017 | |||
| 1842 | Ga0495674_0202283 | |||
| 1843 | Ga0495672_0034357 | |||
| 1844 | Ga0495676_0030732 | |||
| 1845 | Ga0495676_0081675 | |||
| 1846 | Ga0495676_0086878 | |||
| 1847 | Ga0495680_0000836 | |||
| 1848 | Ga0495680_0015081 | |||
| 1849 | Ga0495680_0038283 | |||
| 1850 | Ga0495683_0027504 | |||
| 1851 | Ga0495687_051007 | |||
| 1852 | Ga0495675_0005364 | |||
| 1853 | Ga0495675_0017105 | |||
| 1854 | Ga0495675_0234433 | |||
| 1855 | Ga0495677_0032871 | |||
| 1856 | Ga0495673_0062965 | |||
| 1857 | Ga0495681_0058559 | |||
| 1858 | Ga0495684_0004347 | |||
| 1859 | Ga0495684_0005411 | |||
| 1860 | Ga0495684_0006597 | |||
| 1861 | Ga0495684_0037949 | |||
| 1862 | Ga0495684_0121271 | |||
| 1863 | Ga0495686_0028173 | |||
| 1864 | Ga0495686_0064789 | |||
| 1865 | Ga0495686_0149767 | |||
| 1866 | Ga0495593_0000470 | |||
| 1867 | Ga0495593_0009200 | |||
| 1868 | Ga0495593_0013405 | |||
| 1869 | Ga0495593_0093144 | |||
| 1870 | Ga0495602_0013506 | |||
| 1871 | Ga0495602_0022610 | |||
| 1872 | Ga0495602_0190918 | |||
| 1873 | Ga0495614_0124296 | |||
| 1874 | Ga0496100_0014735 | |||
| 1875 | Ga0496100_0046014 | |||
| 1876 | Ga0496100_0130453 | |||
| 1877 | Ga0496100_0165264 | |||
| 1878 | Ga0496100_0245958 | |||
| 1879 | Ga0496101_0132261 | |||
| 1880 | Ga0496102_0011723 | |||
| 1881 | Ga0496102_0039049 | |||
| 1882 | Ga0496102_0195999 | |||
| 1883 | Ga0496102_0219478 | |||
| 1884 | Ga0496102_0271445 | |||
| 1885 | Ga0496102_0309961 | |||
| 1886 | Ga0496102_0321862 | |||
| 1887 | Ga0496102_0368813 | |||
| 1888 | Ga0496102_0432553 | |||
| 1889 | Ga0496103_0207953 | |||
| 1890 | Ga0496104_0004462 | |||
| 1891 | Ga0496104_0045714 | |||
| 1892 | Ga0496104_0062767 | |||
| 1893 | Ga0496104_0173540 | |||
| 1894 | Ga0496105_0032276 | |||
| 1895 | Ga0496105_0032852 | |||
| 1896 | Ga0496105_0033675 | |||
| 1897 | Ga0496105_0123492 | |||
| 1898 | Ga0496105_0188690 | |||
| 1899 | Ga0496106_0001644 | |||
| 1900 | Ga0496106_0316535 | |||
| 1901 | Ga0496106_0334013 | |||
| 1902 | Ga0496107_0003260 | |||
| 1903 | Ga0496107_0033433 | |||
| 1904 | Ga0496107_0037483 | |||
| 1905 | Ga0496107_0095639 | |||
| 1906 | Ga0496107_0129244 | |||
| 1907 | Ga0496108_0000927 | |||
| 1908 | Ga0496108_0062262 | |||
| 1909 | Ga0496108_0089483 | |||
| 1910 | Ga0496108_0181242 | |||
| 1911 | Ga0496108_0188858 | |||
| 1912 | Ga0496109_0000229 | |||
| 1913 | Ga0496109_0056062 | |||
| 1914 | Ga0496109_0075478 | |||
| 1915 | Ga0496109_0108977 | |||
| 1916 | Ga0496109_0120192 | |||
| 1917 | Ga0496109_0208744 | |||
| 1918 | Ga0496110_0014360 | |||
| 1919 | Ga0496110_0024599 | |||
| 1920 | Ga0496110_0049185 | |||
| 1921 | Ga0496110_0066266 | |||
| 1922 | Ga0496110_0069892 | |||
| 1923 | Ga0496110_0198927 | |||
| 1924 | Ga0496111_0042267 | |||
| 1925 | Ga0496111_0057455 | |||
| 1926 | Ga0496111_0145455 | |||
| 1927 | Ga0496111_0213188 | |||
| 1928 | Ga0496112_0000018 | |||
| 1929 | Ga0496112_0001343 | |||
| 1930 | Ga0496112_0005116 | |||
| 1931 | Ga0496112_0022495 | |||
| 1932 | Ga0496112_0036254 | |||
| 1933 | Ga0496112_0061280 | |||
| 1934 | Ga0496112_0116736 | |||
| 1935 | Ga0496112_0204779 | |||
| 1936 | Ga0496112_0397946 | |||
| 1937 | Ga0496112_0506506 | |||
| 1938 | Ga0496113_0025324 | |||
| 1939 | Ga0496113_0029007 | |||
| 1940 | Ga0496113_0075336 | |||
| 1941 | Ga0496113_0080616 | |||
| 1942 | Ga0496113_0129483 | |||
| 1943 | Ga0496113_0186280 | |||
| 1944 | Ga0496113_0408391 | |||
| 1945 | Ga0496114_0146649 | |||
| 1946 | Ga0496114_0161956 | |||
| 1947 | Ga0496114_0481043 | |||
| 1948 | Ga0496115_0002846 | |||
| 1949 | Ga0496115_0026716 | |||
| 1950 | Ga0496115_0062056 | |||
| 1951 | Ga0496115_0076405 | |||
| 1952 | Ga0496115_0078346 | |||
| 1953 | Ga0496115_0251358 | |||
| 1954 | Ga0496115_0259353 | |||
| 1955 | Ga0496115_0263445 | |||
| 1956 | Ga0496115_0398297 | |||
| 1957 | Ga0496116_0039933 | |||
| 1958 | Ga0496117_0038300 | |||
| 1959 | Ga0496117_0070193 | |||
| 1960 | Ga0496117_0082976 | |||
| 1961 | Ga0496117_0180752 | |||
| 1962 | Ga0496118_0021121 | |||
| 1963 | Ga0496118_0032376 | |||
| 1964 | Ga0496118_0034811 | |||
| 1965 | Ga0496118_0036860 | |||
| 1966 | Ga0496118_0037063 | |||
| 1967 | Ga0496118_0105304 | |||
| 1968 | Ga0496119_0013596 | |||
| 1969 | Ga0496119_0067395 | |||
| 1970 | Ga0496119_0116694 | |||
| 1971 | Ga0496119_0132223 | |||
| 1972 | Ga0496120_0022973 | |||
| 1973 | Ga0496120_0042211 | |||
| 1974 | Ga0496120_0056627 | |||
| 1975 | Ga0496121_0000278 | |||
| 1976 | Ga0496121_0000654 | |||
| 1977 | Ga0496121_0001257 | |||
| 1978 | Ga0496121_0004075 | |||
| 1979 | Ga0496121_0010674 | |||
| 1980 | Ga0496121_0018630 | |||
| 1981 | Ga0496121_0062278 | |||
| 1982 | Ga0496121_0068167 | |||
| 1983 | Ga0496121_0075822 | |||
| 1984 | Ga0496121_0109197 | |||
| 1985 | Ga0496121_0122183 | |||
| 1986 | Ga0496121_0164458 | |||
| 1987 | Ga0496121_0215171 | |||
| 1988 | Ga0496124_0003799 | |||
| 1989 | Ga0496124_0175801 | |||
| 1990 | Ga0496125_0003929 | |||
| 1991 | Ga0496125_0050458 | |||
| 1992 | Ga0496125_0063726 | |||
| 1993 | Ga0496125_0076285 | |||
| 1994 | Ga0496125_0089528 | |||
| 1995 | Ga0496125_0126663 | |||
| 1996 | Ga0496125_0175673 | |||
| 1997 | Ga0496126_0005056 | |||
| 1998 | Ga0496126_0006689 | |||
| 1999 | Ga0496126_0013259 | |||
| 2000 | Ga0496126_0014598 | |||
| 2001 | Ga0496126_0021739 | |||
| 2002 | Ga0496126_0038464 | |||
| 2003 | Ga0496126_0048899 | |||
| 2004 | Ga0496126_0050733 | |||
| 2005 | Ga0496126_0062031 | |||
| 2006 | Ga0496126_0073376 | |||
| 2007 | Ga0496126_0077746 | |||
| 2008 | Ga0496126_0126206 | |||
| 2009 | Ga0496126_0145128 | |||
| 2010 | Ga0496126_0253413 | |||
| 2011 | Ga0495682_0031941 | |||
| 2012 | Ga0501031_0000207 | |||
| 2013 | Ga0501031_0169893 | |||
| 2014 | Ga0501032_0000252 | |||
| 2015 | Ga0501032_0238727 | |||
| 2016 | Ga0501033_0000082 | |||
| 2017 | Ga0501034_0000198 | |||
| 2018 | Ga0501034_0076935 | |||
| 2019 | Ga0501034_0107782 | |||
| 2020 | Ga0501034_0164294 | |||
| 2021 | Ga0501036_0001281 | |||
| 2022 | Ga0501037_0000050 | |||
| 2023 | Ga0501037_0013075 | |||
| 2024 | Ga0501037_0037537 | |||
| 2025 | Ga0501037_0237735 | |||
| 2026 | Ga0501038_0000538 | |||
| 2027 | Ga0501038_0000630 | |||
| 2028 | Ga0501038_0021325 | |||
| 2029 | Ga0501038_0045587 | |||
| 2030 | Ga0501039_0000366 | |||
| 2031 | Ga0501042_0017539 | |||
| 2032 | Ga0501043_0002344 | |||
| 2033 | Ga0501043_0027073 | |||
| 2034 | Ga0501043_0128729 | |||
| 2035 | Ga0501046_0149717 | |||
| 2036 | Ga0501046_0279694 | |||
| 2037 | Ga0501047_0000131 | |||
| 2038 | Ga0501047_0196973 | |||
| 2039 | Ga0501047_0248514 | |||
| 2040 | Ga0501048_0000531 | |||
| 2041 | Ga0501067_0057575 | |||
| 2042 | Ga0501068_0011209 | |||
| 2043 | Ga0501069_0001211 | |||
| 2044 | Ga0501070_0097394 | |||
| 2045 | Ga0501070_0199826 | |||
| 2046 | Ga0501070_0358088 | |||
| 2047 | Ga0501072_0000378 | |||
| 2048 | Ga0501073_0029767 | |||
| 2049 | Ga0501074_0000141 | |||
| 2050 | Ga0501074_0018479 | |||
| 2051 | Ga0501074_0051890 | |||
| 2052 | Ga0501079_0036554 | |||
| 2053 | Ga0501080_0019207 | |||
| 2054 | Ga0501080_0146335 | |||
| 2055 | Ga0501083_0000341 | |||
| 2056 | Ga0501035_0000123 | |||
| 2057 | Ga0501035_0035937 | |||
| 2058 | Ga0501035_0152390 | |||
| 2059 | Ga0501035_0193578 | |||
| 2060 | Ga0501035_0202926 | |||
| 2061 | Ga0501035_0225006 | |||
| 2062 | Ga0501035_0339832 | |||
| 2063 | Ga0501044_0000100 | |||
| 2064 | Ga0501044_0039767 | |||
| 2065 | Ga0501044_0079043 | |||
| 2066 | Ga0501044_0093655 | |||
| 2067 | Ga0501044_0102829 | |||
| 2068 | Ga0501044_0150128 | |||
| 2069 | Ga0501045_0016159 | |||
| 2070 | Ga0501045_0278609 | |||
| 2071 | nmdc:mga03n38_3346_c1 | |||
| 2072 | nmdc:mga03n38_57171_c1 | |||
| 2073 | nmdc:mga00v17_134825_c1 | |||
| 2074 | nmdc:mga00v17_21851_c1 | |||
| 2075 | nmdc:mga00v17_246680_c1 | |||
| 2076 | nmdc:mga00v17_58165_c1 | |||
| 2077 | nmdc:mga0yw44_25265_c1 | |||
| 2078 | nmdc:mga0yw44_26768_c1 | |||
| 2079 | nmdc:mga0yw44_32707_c1 | |||
| 2080 | nmdc:mga0yw44_6182_c1 | |||
| 2081 | nmdc:mga0yw44_90481_c1 | |||
| 2082 | nmdc:mga0k408_125572_c1 | |||
| 2083 | nmdc:mga0k408_26360_c1 | |||
| 2084 | nmdc:mga06z11_25454_c1 | |||
| 2085 | nmdc:mga06z11_30785_c1 | |||
| 2086 | nmdc:mga07m45_117037_c1 | |||
| 2087 | nmdc:mga07m45_14953_c1 | |||
| 2088 | nmdc:mga07m45_3103_c1 | |||
| 2089 | nmdc:mga08y16_363177_c1 | |||
| 2090 | nmdc:mga0rr50_363005_c1 | |||
| 2091 | nmdc:mga0sz30_32825_c1 | |||
| 2092 | nmdc:mga0sz30_5173_c1 | |||
| 2093 | Ga0495601_0032816 | |||
| 2094 | Ga0495612_0013345 | |||
| 2095 | Ga0495612_0023451 | |||
| 2096 | Ga0500635_0005769 | |||
| 2097 | Ga0495595_0001147 | |||
| 2098 | Ga0495595_0101420 | |||
| 2099 | Ga0495619_0050947 | |||
| 2100 | Ga0500578_0029277 | |||
| 2101 | Ga0500643_000076 | |||
| 2102 | Ga0500643_044167 | |||
| 2103 | Ga0500647_0008721 | |||
| 2104 | Ga0500583_0031974 | |||
| 2105 | Ga0500651_0013489 | |||
| 2106 | Ga0500651_0044971 | |||
| 2107 | Ga0500651_0168887 | |||
| 2108 | Ga0500566_0000107 | |||
| 2109 | Ga0500566_0001175 | |||
| 2110 | Ga0500566_0003295 | |||
| 2111 | Ga0500566_0052170 | |||
| 2112 | Ga0500640_022898 | |||
| 2113 | Ga0500641_0011398 | |||
| 2114 | Ga0500641_0037171 | |||
| 2115 | Ga0500650_0047668 | |||
| 2116 | Ga0500650_0070051 | |||
| 2117 | Ga0500556_0000081 | |||
| 2118 | Ga0500557_000021 | |||
| 2119 | Ga0500569_001078 | |||
| 2120 | Ga0500572_036834 | |||
| 2121 | Ga0500592_010490 | |||
| 2122 | Ga0500595_001968 | |||
| 2123 | Ga0500595_002941 | |||
| 2124 | Ga0500595_003169 | |||
| 2125 | Ga0500595_003647 | |||
| 2126 | Ga0500595_038411 | |||
| 2127 | Ga0500597_096638 | |||
| 2128 | Ga0500608_000949 | |||
| 2129 | Ga0500608_103597 | |||
| 2130 | Ga0500618_013897 | |||
| 2131 | Ga0500642_0000042 | |||
| 2132 | Ga0500642_0000225 | |||
| 2133 | Ga0500652_000365 | |||
| 2134 | Ga0500658_0013217 | |||
| 2135 | Ga0500559_0000106 | |||
| 2136 | Ga0500559_0022835 | |||
| 2137 | Ga0500559_0067344 | |||
| 2138 | Ga0500559_0088352 | |||
| 2139 | Ga0500568_0015314 | |||
| 2140 | Ga0500568_0022805 | |||
| 2141 | Ga0500568_0059026 | |||
| 2142 | Ga0500577_0007820 | |||
| 2143 | Ga0500577_0067911 | |||
| 2144 | Ga0500589_052697 | |||
| 2145 | Ga0500603_001588 | |||
| 2146 | Ga0500604_0013529 | |||
| 2147 | Ga0500616_0000227 | |||
| 2148 | Ga0500620_001172 | |||
| 2149 | Ga0500622_0005478 | |||
| 2150 | Ga0500622_0055868 | |||
| 2151 | Ga0500634_0045252 | |||
| 2152 | Ga0500638_002181 | |||
| 2153 | Ga0500638_074317 | |||
| 2154 | Ga0500636_0001726 | |||
| 2155 | Ga0500636_0007656 | |||
| 2156 | Ga0500636_0052999 | |||
| 2157 | Ga0500637_0005127 | |||
| 2158 | Ga0500637_0069682 | |||
| 2159 | Ga0500570_099933 | |||
| 2160 | Ga0500625_020193 | |||
| 2161 | Ga0500609_001334 | |||
| 2162 | Ga0500599_001530 | |||
| 2163 | Ga0500601_000261 | |||
| 2164 | Ga0501084_0012059 | |||
| 2165 | Ga0501084_0152257 | |||
| 2166 | Ga0501082_0001776 | |||
| 2167 | Ga0466962_0044409 | |||
| 2168 | 2507505423 | |||
| 2169 | 2508539309 | |||
| 2170 | 2508695636 | |||
| 2171 | 2511399098 | |||
| 2172 | 2513623953 | |||
| 2173 | 2513651361 | |||
| 2174 | 2513659484 | |||
| 2175 | 2513676289 | |||
| 2176 | 2513695261 | |||
| 2177 | 2513718214 | |||
| 2178 | 2513859409 | |||
| 2179 | 2513873376 | |||
| 2180 | 2513888605 | |||
| 2181 | 2513921583 | |||
| 2182 | 2514014707 | |||
| 2183 | 2515627619 | |||
| 2184 | 2517106307 | |||
| 2185 | 2517889024 | |||
| 2186 | 2524441415 | |||
| 2187 | 2524467040 | |||
| 2188 | 2524537454 | |||
| 2189 | 2528853345 | |||
| 2190 | 2603858352 | |||
| 2191 | 2617352087 | |||
| 2192 | 2617373557 | |||
| 2193 | 2644291067 | |||
| 2194 | 2671122620 | |||
| 2195 | 2723841790 | |||
| 2196 | 2728748458 | |||
| 2197 | 2745077549 | |||
| 2198 | 2793062207 | |||
| 2199 | 2793073670 | |||
| 2200 | 2793078335 | |||
| 2201 | 2805920724 | |||
| 2202 | 2818237828 | |||
| 2203 | 2824607338 | |||
| 2204 | 2824616902 | |||
| 2205 | 2824626393 | |||
| 2206 | 2824632759 | |||
| 2207 | 2824643690 | |||
| 2208 | 2824652316 | |||
| 2209 | 2824659676 | |||
| 2210 | 2824669430 | |||
| 2211 | 2824679222 | |||
| 2212 | 2824687384 | |||
| 2213 | 2824695813 | |||
| 2214 | 2824704179 | |||
| 2215 | 2824713838 | |||
| 2216 | 2824723157 | |||
| 2217 | 2824732513 | |||
| 2218 | 2824740203 | |||
| 2219 | 2824751670 | |||
| 2220 | 2824762565 | |||
| 2221 | 2824771899 | |||
| 2222 | 2824780808 | |||
| 2223 | 2838124668 | |||
| 2224 | 2841945359 | |||
| 2225 | 2841952144 | |||
| 2226 | 2841965373 | |||
| 2227 | 2841970468 | |||
| 2228 | 2841981716 | |||
| 2229 | 2841984997 | |||
| 2230 | 2842043351 | |||
| 2231 | 2842052659 | |||
| 2232 | 2844315516 | |||
| 2233 | 2847931221 | |||
| 2234 | 2847942312 | |||
| 2235 | 2849083184 | |||
| 2236 | 2857516382 | |||
| 2237 | 2857526548 | |||
| 2238 | 2874591659 | |||
| 2239 | 2874607913 | |||
| 2240 | 2874619086 | |||
| 2241 | 2874621231 | |||
| 2242 | 2874628629 | |||
| 2243 | 2874646144 | |||
| 2244 | 2876769613 | |||
| 2245 | 2876771760 | |||
| 2246 | 2876812476 | |||
| 2247 | 2876819104 | |||
| 2248 | 2879075649 | |||
| 2249 | 2879085560 | |||
| 2250 | 2879105866 | |||
| 2251 | 2879113340 | |||
| 2252 | 2879128458 | |||
| 2253 | 2879143564 | |||
| 2254 | 2881369253 | |||
| 2255 | 2881669966 | |||
| 2256 | 2885369362 | |||
| 2257 | 2885382814 | |||
| 2258 | 2885388526 | |||
| 2259 | 2885418597 | |||
| 2260 | 2888379430 | |||
| 2261 | 2888390528 | |||
| 2262 | 2888420151 | |||
| 2263 | 2893067204 | |||
| 2264 | 2903733469 | |||
| 2265 | 2903758987 | |||
| 2266 | 2903775494 | |||
| 2267 | 2904667776 | |||
| 2268 | 2904691032 | |||
| 2269 | 2904716357 | |||
| 2270 | 2906608605 | |||
| 2271 | 2906613603 | |||
| 2272 | 2906628536 | |||
| 2273 | 2906641607 | |||
| 2274 | 2906652294 | |||
| 2275 | 2906668134 | |||
| 2276 | 2908747624 | |||
| 2277 | 2908757090 | |||
| 2278 | 2908776030 | |||
| 2279 | 2919073632 | |||
| 2280 | 2922363180 | |||
| 2281 | 2922369416 | |||
| 2282 | 2922388515 | |||
| 2283 | 2922398146 | |||
| 2284 | 2922434039 | |||
| 2285 | 2929618756 | |||
| 2286 | 2929628559 | |||
| 2287 | 2932790938 | |||
| 2288 | 2932794171 | |||
| 2289 | 2932812011 | |||
| 2290 | 2932825538 | |||
| 2291 | 2932833654 | |||
| 2292 | 2933580534 | |||
| 2293 | 2935615548 | |||
| 2294 | 2935623180 | |||
| 2295 | 2935636071 | |||
| 2296 | 2935644255 | |||
| 2297 | 2935654478 | |||
| 2298 | 2935663358 | |||
| 2299 | 2935672163 | |||
| 2300 | 2935679314 | |||
| 2301 | 2935686557 | |||
| 2302 | 2935700340 | |||
| 2303 | 2935710288 | |||
| 2304 | 2935716245 | |||
| 2305 | 2935723631 | |||
| 2306 | 2935735186 | |||
| 2307 | 2935744023 | |||
| 2308 | 2935752523 | |||
| 2309 | 2935763345 | |||
| 2310 | 2935772892 | |||
| 2311 | 2935783318 | |||
| 2312 | 2935788120 | |||
| 2313 | 2935796304 | |||
| 2314 | 2935808279 | |||
| 2315 | 2935816110 | |||
| 2316 | 2935825651 | |||
| 2317 | 2935833501 | |||
| 2318 | 2935844454 | |||
| 2319 | 2935853415 | |||
| 2320 | 2935861428 | |||
| 2321 | 2935869547 | |||
| 2322 | 2935879876 | |||
| 2323 | 2935889198 | |||
| 2324 | 2935915017 | |||
| 2325 | 2935918865 | |||
| 2326 | 2935931418 | |||
| 2327 | 2935940015 | |||
| 2328 | 2935947638 | |||
| 2329 | 2935956409 | |||
| 2330 | 2935966748 | |||
| 2331 | 2935973203 | |||
| 2332 | 2935990095 | |||
| 2333 | 2935997901 | |||
| 2334 | 2936008834 | |||
| 2335 | 2936017483 | |||
| 2336 | 2936026016 | |||
| 2337 | 2936034858 | |||
| 2338 | 2936041115 | |||
| 2339 | 2936052884 | |||
| 2340 | 2936060257 | |||
| 2341 | 2940558436 | |||
| 2342 | 2941512625 | |||
| 2343 | 2941520537 | |||
| 2344 | 2941528551 | |||
| 2345 | 2941535370 | |||
| 2346 | 2941543373 | |||
| 2347 | 3005475246 | |||
| 2348 | 3005486703 | |||
| 2349 | 3005509008 | |||
| 2350 | 3005594107 | |||
| 2351 | 3005595206 | |||
| 2352 | 3005711149 | |||
| 2353 | 8006931949 | |||
| 2354 | 8006936031 | |||
| 2355 | 8006967609 | |||
| 2356 | 8006975845 | |||
| 2357 | 8006991078 | |||
| 2358 | 8007000408 | |||
| 2359 | 8016518021 | |||
| 2360 | 8016526299 | |||
| 2361 | 8016531360 | |||
| 2362 | 8016544575 | |||
| 2363 | 8016557501 | |||
| 2364 | 8016565857 | |||
| 2365 | 8016569626 | |||
| 2366 | 8016582235 | |||
| 2367 | 8016586265 | |||
| 2368 | 8016603456 | |||
| 2369 | 8016606397 | |||
| 2370 | 8016618302 | |||
| 2371 | 8016622951 | |||
| 2372 | 8016635454 | |||
| 2373 | 8017058622 | |||
| 2374 | 8019531194 | |||
| 2375 | 8019540359 | |||
| 2376 | 8019549954 | |||
| 2377 | 8019562623 | |||
| 2378 | 8019572701 | |||
| 2379 | 8019577037 | |||
| 2380 | 8019595104 | |||
| 2381 | 8019606636 | |||
| 2382 | 8019611875 | |||
| 2383 | 8019629964 | |||
| 2384 | 8019640643 | |||
| 2385 | 8019652310 | |||
| 2386 | 8019666804 | |||
| 2387 | 8019676562 | |||
| 2388 | 8019679428 | |||
| 2389 | 8019696077 | |||
| 2390 | 8055742605 | |||
| 2391 | 8056676112 | |||
| 2392 | 8056682914 | |||
| 2393 | 8056691117 | |||
| 2394 | 8056971463 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3x30-assembly1.cif.gz_A | crystal structure of metallo-beta-lactamase from thermotoga maritima | 0.8247 | 65 | 325 |
| 7e3w-assembly1.cif.gz_C | metallo beta-lactamase fold protein (camp bound) | 0.8234 | 65 | 323 |
| 3x30-assembly1.cif.gz_A | crystal structure of metallo-beta-lactamase from thermotoga maritima | 0.8179 | 65 | 325 |
| 6hrg-assembly1.cif.gz_A | structure of igni18, a novel metallo hydrolase from the hyperthermophilic archaeon ignicoccus hospitalis kin4/i | 0.8111 | 64 | 325 |
| 7e3w-assembly1.cif.gz_C | metallo beta-lactamase fold protein (camp bound) | 0.8102 | 65 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8BH82_99_394_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9357 | 59 | 325 | 3.60.15.10 |
| af_Q55BC7_55_359_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9221 | 64 | 325 | 3.60.15.10 |
| af_A4HVR7_83_395_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9197 | 65 | 315 | 3.60.15.10 |
| af_Q8ILT3_120_417_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.908 | 39 | 325 | 3.60.15.10 |
| af_Q965X7_61_355_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9015 | 65 | 323 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U0UDD5-F1-model_v4 | deleted | 0.9699 | 1 | 325 |
|
| AF-A0A2U0UDD5-F1-model_v4 | deleted | 0.967 | 1 | 325 |
|
| AF-A0A2N3AQU9-F1-model_v4 | Metallo-beta-lactamase domain-containing protein | 0.9665 | 203 | 321 |
GO:0005737
|
| AF-A0A6G3XYC2-F1-model_v4 | MBL fold metallo-hydrolase | 0.965 | 65 | 153 |
GO:0005737
GO:0016787 |
| AF-A0A520FUQ1-F1-model_v4 | deleted | 0.9619 | 32 | 325 |
|