F491542

General Info

Members Datasets Scaffolds Average Seq Length
1197 621 2394 339

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100168346|Ga0068862_1001683462
Length 399
Sequence LTELHFSKTRVAGERASFRRRFKVQPAPPYNAPCLSFSPAYRDPSVPITRRRVFGVLAGAAAAVGVPSIWISNMKTYEGPVSDHFDGTRFFDPDGVPPKSLGEVLRWQFGTDRKRASWPDWVPNAHSDTPPPRVSGDKVRLSFVGHVTWLIQTANLNILIDPVWSMRASPVSFAGPHRHNDPGIAFDALPKIDVVLVSHGHYDHLDIATLSKLTEKFSPRVITPLGNDVTMRDTDAAIKAEGFDWQDRVELGNGIAVTLVPTRHWSARGLFDRNKALWASFVLETPAGKIYIVCDSGYGEGKHFRRVAEKHGPLRLAILPIGAYEPRWFMKDQHMNPSDAVKALADCGASQALAHHHGTFQLTDEAIDAPVMALDEALKEAKILPERFAALKPGQVYEI

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
64 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
65 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
87 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
88 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
89 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
90 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
148 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
149 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
150 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
157 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
165 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
168 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
217 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
224 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
225 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
228 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
235 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
236 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
239 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
240 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
241 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
242 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
248 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
251 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
252 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
256 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
265 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
266 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
267 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
268 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
271 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
277 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
280 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
281 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
282 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
283 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
287 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
304 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
305 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
306 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
307 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
310 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
311 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
312 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
313 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
327 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
328 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
329 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
330 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
331 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
332 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
339 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
341 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
342 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
347 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
348 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
349 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
350 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
351 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
352 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
353 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
354 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
355 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
356 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
357 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
358 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
359 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
360 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
361 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
362 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
363 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
364 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
365 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
366 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
367 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
368 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
369 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
370 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
371 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
372 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
373 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
374 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
375 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
376 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
377 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
378 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
379 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
380 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
381 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
382 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
383 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
384 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
385 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
386 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
387 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
388 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
389 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
390 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
391 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
392 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
393 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
394 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
395 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
396 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
397 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
398 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
399 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
400 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
401 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
402 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
403 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
404 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
405 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
406 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
407 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
408 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
409 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
410 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
411 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
412 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
413 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
414 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
415 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
416 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
417 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
418 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
419 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
420 2643221651 Afipia sp. Root123D2 Isolate Unclassified
421 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
422 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
423 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
424 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
425 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
426 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
427 2791355199
428 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
429 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
430 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
431 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
432 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
433 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
434 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
435 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
436 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
437 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
438 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
439 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
440 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
441 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
442 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
443 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
444 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
445 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
446 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
447 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
448 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
449 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
450 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
451 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
452 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
453 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
454 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
455 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
456 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
457 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
458 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
459 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
460 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
461 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
462 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
463 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
464 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
465 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
466 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
467 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
468 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
469 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
470 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
471 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
472 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
473 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
474 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
475 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
476 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
477 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
478 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
479 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
480 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
481 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
482 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
483 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
484 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
485 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
486 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
487 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
488 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
489 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
490 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
491 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
492 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
493 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
494 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
495 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
496 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
497 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
498 2906610324
499 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
500 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
501 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
502 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
503 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
504 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
505 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
506 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
507 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
508 2922368715
509 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
510 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
511 2922425934
512 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
513 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
514 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
515 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
516 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
517 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
518 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
519 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
520 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
521 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
522 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
523 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
524 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
525 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
526 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
527 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
528 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
529 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
530 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
531 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
532 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
533 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
534 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
535 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
536 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
537 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
538 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
539 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
540 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
541 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
542 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
543 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
544 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
545 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
546 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
547 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
548 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
549 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
550 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
551 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
552 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
553 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
554 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
555 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
556 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
557 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
558 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
559 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
560 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
561 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
562 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
563 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
564 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
565 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
566 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
567 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
568 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
569 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
570 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
571 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
572 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
573 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
574 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
575 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
576 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
577 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
578 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
579 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
580 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
581 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
582 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
583 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
584 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
585 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
586 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
587 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
588 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
589 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
590 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
591 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
592 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
593 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
594 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
595 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
596 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
597 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
598 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
599 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
600 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
601 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
602 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
603 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
604 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
605 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
606 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
607 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
608 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
609 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
610 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
611 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
612 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
613 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
614 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
615 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
616 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
617 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
618 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
619 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
620 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
621 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.31
Metatranscriptomes 0
Isolates 18.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.28
Nodule 14.95
Rhizoplane 7.1
Rhizosphere 54.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_100168346 3300005844 Bacteria 1960
2 JGI24737J22298_10014205 3300001990 Bacteria 2586
3 JGI25406J46586_10045805 3300003203 Bacteria 1502
4 JGI25153J46596_10006802 3300003215 Bacteria 5727
5 JGI25153J46596_10011847 3300003215 Bacteria 3821
6 JGI25153J46596_10015051 3300003215 Bacteria 3175
7 JGI25153J46596_10015527 3300003215 Bacteria 3095
8 JGI25160J50197_1012785 3300003354 Bacteria 2893
9 JGI25404J52841_10005838 3300003659 Bacteria 2553
10 JGI25404J52841_10017706 3300003659 Bacteria 1545
11 JGI25404J52841_10018823 3300003659 Bacteria 1496
12 Ga0055543_1014573 3300004625 Bacteria 1530
13 Ga0065165_1004935 3300005262 Bacteria 7860
14 Ga0065165_1005401 3300005262 Bacteria 7210
15 Ga0065165_1021918 3300005262 Bacteria 2206
16 Ga0070683_100047414 3300005329 Bacteria 3970
17 Ga0070683_100120003 3300005329 Bacteria 2483
18 Ga0070670_100183742 3300005331 Bacteria 1815
19 Ga0070680_100053553 3300005336 Bacteria 3294
20 Ga0070680_100114431 3300005336 Bacteria 2247
21 Ga0070680_100370426 3300005336 Bacteria 1219
22 Ga0070689_100271724 3300005340 Bacteria 1403
23 Ga0070691_10115497 3300005341 Bacteria 1347
24 Ga0070668_100031220 3300005347 Bacteria 4053
25 Ga0070668_100052517 3300005347 Bacteria 3141
26 Ga0070673_100352065 3300005364 Bacteria 1307
27 Ga0070709_10000820 3300005434 Bacteria 17358
28 Ga0070709_10007668 3300005434 Bacteria 5921
29 Ga0070714_100011934 3300005435 Bacteria 6911
30 Ga0070714_100025834 3300005435 Bacteria 4851
31 Ga0070714_100034248 3300005435 Bacteria 4253
32 Ga0070714_100062901 3300005435 Bacteria 3190
33 Ga0070714_100079305 3300005435 Bacteria 2855
34 Ga0070713_100003576 3300005436 Bacteria 10269
35 Ga0070713_100047748 3300005436 Bacteria 3521
36 Ga0070713_100081426 3300005436 Bacteria 2762
37 Ga0070710_10000802 3300005437 Bacteria 15088
38 Ga0070710_10001532 3300005437 Bacteria 10922
39 Ga0070711_100009673 3300005439 Bacteria 5940
40 Ga0070711_100012226 3300005439 Bacteria 5358
41 Ga0070711_100012351 3300005439 Bacteria 5332
42 Ga0070711_100158534 3300005439 Bacteria 1713
43 Ga0070663_100032201 3300005455 Bacteria 3612
44 Ga0070663_100045514 3300005455 Bacteria 3100
45 Ga0070663_100071628 3300005455 Bacteria 2522
46 Ga0070663_100085037 3300005455 Bacteria 2333
47 Ga0070663_100156535 3300005455 Bacteria 1751
48 Ga0070663_100175865 3300005455 Bacteria 1657
49 Ga0070663_100184959 3300005455 Bacteria 1618
50 Ga0070663_100366543 3300005455 Bacteria 1170
51 Ga0070678_100263059 3300005456 Bacteria 1452
52 Ga0070681_10001077 3300005458 Bacteria 23275
53 Ga0070681_10028258 3300005458 Bacteria 5638
54 Ga0070707_100149757 3300005468 Bacteria 2272
55 Ga0070698_100090319 3300005471 Bacteria 3047
56 Ga0070698_100264821 3300005471 Bacteria 1651
57 Ga0070699_100359358 3300005518 Bacteria 1313
58 Ga0070679_100002400 3300005530 Bacteria 16984
59 Ga0070679_100009606 3300005530 Bacteria 9151
60 Ga0070679_100085678 3300005530 Bacteria 3137
61 Ga0070679_100109961 3300005530 Bacteria 2742
62 Ga0070679_100135439 3300005530 Bacteria 2444
63 Ga0070679_100158674 3300005530 Bacteria 2236
64 Ga0070684_100025298 3300005535 Bacteria 4988
65 Ga0068853_100031608 3300005539 Bacteria 4478
66 Ga0068853_100045931 3300005539 Bacteria 3743
67 Ga0068853_100048615 3300005539 Bacteria 3644
68 Ga0068853_100068200 3300005539 Bacteria 3092
69 Ga0068853_100273595 3300005539 Bacteria 1555
70 Ga0070672_100135179 3300005543 Bacteria 2030
71 Ga0070665_100029471 3300005548 Bacteria 5524
72 Ga0070665_100031667 3300005548 Bacteria 5322
73 Ga0070665_100065669 3300005548 Bacteria 3639
74 Ga0070665_100081254 3300005548 Bacteria 3247
75 Ga0070665_100104376 3300005548 Bacteria 2837
76 Ga0070665_100109625 3300005548 Bacteria 2763
77 Ga0068855_100037045 3300005563 Bacteria 5803
78 Ga0068855_100060155 3300005563 Bacteria 4443
79 Ga0068855_100063458 3300005563 Bacteria 4311
80 Ga0068855_100378058 3300005563 Bacteria 1556
81 Ga0070664_100283958 3300005564 Bacteria 1493
82 Ga0070664_100481054 3300005564 Bacteria 1143
83 Ga0068857_100001037 3300005577 Bacteria 21487
84 Ga0068857_100025105 3300005577 Bacteria 5249
85 Ga0068857_100033794 3300005577 Bacteria 4522
86 Ga0068857_100300707 3300005577 Bacteria 1479
87 Ga0068857_100461448 3300005577 Bacteria 1189
88 Ga0068854_100034116 3300005578 Bacteria 3552
89 Ga0068854_100138437 3300005578 Bacteria 1865
90 Ga0068856_100000883 3300005614 Bacteria 32112
91 Ga0068856_100142760 3300005614 Bacteria 2402
92 Ga0068856_100258285 3300005614 Bacteria 1757
93 Ga0068856_100260458 3300005614 Bacteria 1750
94 Ga0070702_100137203 3300005615 Bacteria 1553
95 Ga0068852_100094545 3300005616 Bacteria 2681
96 Ga0068859_100047861 3300005617 Bacteria 4296
97 Ga0068864_100072570 3300005618 Bacteria 3000
98 Ga0068851_10000558 3300005834 Bacteria 16219
99 Ga0068870_10135604 3300005840 Bacteria 1435
100 Ga0068858_100495047 3300005842 Bacteria 1181
101 Ga0068860_100000477 3300005843 Bacteria 49839
102 Ga0068860_100209710 3300005843 Bacteria 1889
103 Ga0068860_100289839 3300005843 Bacteria 1601
104 Ga0081455_10002724 3300005937 Bacteria 20860
105 Ga0081455_10007370 3300005937 Bacteria 11598
106 Ga0081455_10042159 3300005937 Bacteria 4006
107 Ga0081540_1003488 3300005983 Bacteria 12411
108 Ga0081540_1007876 3300005983 Bacteria 7530
109 Ga0081540_1008854 3300005983 Bacteria 6988
110 Ga0081540_1014559 3300005983 Bacteria 5030
111 Ga0081540_1020591 3300005983 Bacteria 3960
112 Ga0081540_1029453 3300005983 Bacteria 3058
113 Ga0081540_1033178 3300005983 Bacteria 2808
114 Ga0081540_1041232 3300005983 Bacteria 2396
115 Ga0081540_1042419 3300005983 Bacteria 2347
116 Ga0081540_1049844 3300005983 Bacteria 2085
117 Ga0081539_10000265 3300005985 Bacteria 120457
118 Ga0081539_10000371 3300005985 Bacteria 98455
119 Ga0081539_10043985 3300005985 Bacteria 2582
120 Ga0081539_10085002 3300005985 Bacteria 1652
121 Ga0070717_10016786 3300006028 Bacteria 5683
122 Ga0070717_10061429 3300006028 Bacteria 3114
123 Ga0075365_10008318 3300006038 Bacteria 5880
124 Ga0075365_10066442 3300006038 Bacteria 2419
125 Ga0075365_10067630 3300006038 Bacteria 2399
126 Ga0075365_10109412 3300006038 Bacteria 1898
127 Ga0075368_10002496 3300006042 Bacteria 6020
128 Ga0075363_100004174 3300006048 Bacteria 6275
129 Ga0075363_100028319 3300006048 Bacteria 2880
130 Ga0075364_10058436 3300006051 Bacteria 2527
131 Ga0070715_10000275 3300006163 Bacteria 12448
132 Ga0070716_100019113 3300006173 Bacteria 3578
133 Ga0070712_100005859 3300006175 Bacteria 7608
134 Ga0070712_100078337 3300006175 Bacteria 2385
135 Ga0075367_10010418 3300006178 Bacteria 4885
136 Ga0075367_10087546 3300006178 Bacteria 1892
137 Ga0075369_10022548 3300006186 Bacteria 2597
138 Ga0075369_10022934 3300006186 Bacteria 2577
139 Ga0075369_10047007 3300006186 Bacteria 1860
140 Ga0075369_10101802 3300006186 Bacteria 1289
141 Ga0075366_10017520 3300006195 Bacteria 4122
142 Ga0075370_10010551 3300006353 Bacteria 4834
143 Ga0075370_10102371 3300006353 Bacteria 1658
144 Ga0075370_10127604 3300006353 Bacteria 1483
145 Ga0075434_100107896 3300006871 Bacteria 2795
146 Ga0068865_100068195 3300006881 Bacteria 2514
147 Ga0068865_100073289 3300006881 Bacteria 2434
148 Ga0068865_100082031 3300006881 Bacteria 2317
149 Ga0097620_100047862 3300006931 Bacteria 4296
150 Ga0099824_1010644 3300006942 Bacteria 10734
151 Ga0099824_1012314 3300006942 Bacteria 9369
152 Ga0099822_1012672 3300006943 Bacteria 10032
153 Ga0099823_1023025 3300006944 Bacteria 5730
154 Ga0075435_100053972 3300007076 Bacteria 3243
155 Ga0099794_10029658 3300007265 Bacteria 2550
156 Ga0099794_10093906 3300007265 Bacteria 1491
157 Ga0099794_10122178 3300007265 Bacteria 1311
158 Ga0105240_10002459 3300009093 Bacteria 29768
159 Ga0105240_10012773 3300009093 Bacteria 11572
160 Ga0105240_10014356 3300009093 Bacteria 10815
161 Ga0105240_10075561 3300009093 Bacteria 4155
162 Ga0105240_10088443 3300009093 Bacteria 3790
163 Ga0105240_10171590 3300009093 Bacteria 2568
164 Ga0105240_10211465 3300009093 Bacteria 2266
165 Ga0105240_10409511 3300009093 Bacteria 1525
166 Ga0105247_10099706 3300009101 Bacteria 1855
167 Ga0105241_10000249 3300009174 Bacteria 40643
168 Ga0105241_10067677 3300009174 Bacteria 2765
169 Ga0105241_10427802 3300009174 Bacteria 1167
170 Ga0105248_10126874 3300009177 Bacteria 2878
171 Ga0105248_10173518 3300009177 Bacteria 2430
172 Ga0105248_10294575 3300009177 Bacteria 1827
173 Ga0105237_10017086 3300009545 Bacteria 7527
174 Ga0105237_10050524 3300009545 Bacteria 4178
175 Ga0105237_10094994 3300009545 Bacteria 2970
176 Ga0105237_10130560 3300009545 Bacteria 2507
177 Ga0105237_10264973 3300009545 Bacteria 1721
178 Ga0105237_10399913 3300009545 Bacteria 1378
179 Ga0105237_10473948 3300009545 Bacteria 1258
180 Ga0105238_10014511 3300009551 Bacteria 7966
181 Ga0105238_10038587 3300009551 Bacteria 4850
182 Ga0105238_10186210 3300009551 Bacteria 2052
183 Ga0105239_10047808 3300010375 Bacteria 4689
184 Ga0105239_10096944 3300010375 Bacteria 3258
185 Ga0105239_10170906 3300010375 Bacteria 2431
186 Ga0105239_10171641 3300010375 Bacteria 2425
187 Ga0105239_10297063 3300010375 Bacteria 1819
188 Ga0105239_10334097 3300010375 Bacteria 1710
189 Ga0105239_10347557 3300010375 Bacteria 1674
190 Ga0105239_10481814 3300010375 Bacteria 1409
191 Ga0105239_10511517 3300010375 Bacteria 1366
192 Ga0105246_10059630 3300011119 Bacteria 2648
193 Ga0105246_10286503 3300011119 Bacteria 1324
194 Ga0157370_10365836 3300013104 Bacteria 1329
195 Ga0157369_10040528 3300013105 Bacteria 5084
196 Ga0157369_10128793 3300013105 Bacteria 2682
197 Ga0157369_10331885 3300013105 Bacteria 1580
198 Ga0157374_10356302 3300013296 Bacteria 1454
199 Ga0157378_10087681 3300013297 Bacteria 2823
200 Ga0157372_10072119 3300013307 Bacteria 3891
201 Ga0157372_10448821 3300013307 Bacteria 1503
202 Ga0157372_10537379 3300013307 Bacteria 1363
203 Ga0157375_10015617 3300013308 Bacteria 6802
204 Ga0157375_10364017 3300013308 Bacteria 1612
205 Ga0163163_10018908 3300014325 Bacteria 6463
206 Ga0157380_10053334 3300014326 Bacteria 3205
207 Ga0157380_10707464 3300014326 Bacteria 1013
208 Ga0157379_10041002 3300014968 Bacteria 4133
209 Ga0157379_10430626 3300014968 Bacteria 1216
210 Ga0163161_10100976 3300017792 Bacteria 2148
211 Ga0163161_10196097 3300017792 Bacteria 1555
212 Ga0163161_10241499 3300017792 Bacteria 1405
213 Ga0214544_1000056 3300021320 Bacteria 132760
214 Ga0214542_1000071 3300021321 Bacteria 124568
215 Ga0214545_1000033 3300021324 Bacteria 124568
216 Ga0214543_1000105 3300021327 Bacteria 108404
217 Ga0213874_10047511 3300021377 Bacteria 1306
218 Ga0213876_10002330 3300021384 Bacteria 11202
219 Ga0213875_10000033 3300021388 Bacteria 170944
220 Ga0209563_102230 3300025230 Bacteria 4492
221 Ga0209677_102647 3300025253 Bacteria 6496
222 Ga0209148_1000295 3300025254 Bacteria 73660
223 Ga0209233_1003626 3300025261 Bacteria 5411
224 Ga0209233_1011983 3300025261 Bacteria 2532
225 Ga0209455_1005746 3300025272 Bacteria 3775
226 Ga0209564_1006069 3300025295 Bacteria 6654
227 Ga0209564_1014353 3300025295 Bacteria 3302
228 Ga0209758_1000069 3300025297 Bacteria 286161
229 Ga0209758_1001918 3300025297 Bacteria 22622
230 Ga0209758_1002874 3300025297 Bacteria 16683
231 Ga0209758_1004128 3300025297 Bacteria 12418
232 Ga0209758_1004293 3300025297 Bacteria 12018
233 Ga0209758_1014150 3300025297 Bacteria 4273
234 Ga0209758_1020420 3300025297 Bacteria 3134
235 Ga0209256_1004477 3300025299 Bacteria 8739
236 Ga0207426_1002173 3300025302 Bacteria 13275
237 Ga0207426_1007252 3300025302 Bacteria 4669
238 Ga0207426_1007538 3300025302 Bacteria 4539
239 Ga0207426_1022846 3300025302 Bacteria 2141
240 Ga0207426_1034587 3300025302 Bacteria 1620
241 Ga0209257_1011512 3300025304 Bacteria 4248
242 Ga0209257_1022140 3300025304 Bacteria 2278
243 Ga0207697_10070939 3300025315 Bacteria 1460
244 Ga0207692_10000565 3300025898 Bacteria 13191
245 Ga0207692_10003710 3300025898 Bacteria 5993
246 Ga0207692_10062096 3300025898 Bacteria 1938
247 Ga0207710_10030120 3300025900 Bacteria 2365
248 Ga0207710_10052566 3300025900 Bacteria 1831
249 Ga0207688_10039975 3300025901 Bacteria 2605
250 Ga0207688_10160901 3300025901 Bacteria 1331
251 Ga0207647_10009887 3300025904 Bacteria 6756
252 Ga0207647_10015369 3300025904 Bacteria 5248
253 Ga0207699_10000907 3300025906 Bacteria 14172
254 Ga0207699_10017853 3300025906 Bacteria 3747
255 Ga0207699_10018645 3300025906 Bacteria 3682
256 Ga0207705_10150446 3300025909 Bacteria 1744
257 Ga0207705_10292620 3300025909 Bacteria 1248
258 Ga0207684_10283200 3300025910 Bacteria 1429
259 Ga0207654_10000083 3300025911 Bacteria 62205
260 Ga0207654_10037513 3300025911 Bacteria 2713
261 Ga0207654_10037960 3300025911 Bacteria 2700
262 Ga0207654_10046406 3300025911 Bacteria 2477
263 Ga0207707_10001947 3300025912 Bacteria 18789
264 Ga0207707_10007389 3300025912 Bacteria 9570
265 Ga0207707_10244782 3300025912 Bacteria 1558
266 Ga0207695_10000148 3300025913 Bacteria 208344
267 Ga0207695_10000387 3300025913 Bacteria 99734
268 Ga0207695_10025135 3300025913 Bacteria 6679
269 Ga0207695_10060768 3300025913 Bacteria 3909
270 Ga0207695_10168101 3300025913 Bacteria 2120
271 Ga0207671_10003051 3300025914 Bacteria 17147
272 Ga0207671_10077659 3300025914 Bacteria 2486
273 Ga0207671_10215551 3300025914 Bacteria 1503
274 Ga0207693_10001168 3300025915 Bacteria 23417
275 Ga0207693_10010075 3300025915 Bacteria 7678
276 Ga0207693_10035225 3300025915 Bacteria 3947
277 Ga0207663_10004460 3300025916 Bacteria 6963
278 Ga0207663_10004693 3300025916 Bacteria 6822
279 Ga0207663_10019599 3300025916 Bacteria 3815
280 Ga0207660_10042346 3300025917 Bacteria 3196
281 Ga0207660_10196839 3300025917 Bacteria 1572
282 Ga0207660_10273954 3300025917 Bacteria 1338
283 Ga0207657_10009668 3300025919 Bacteria 9676
284 Ga0207657_10024873 3300025919 Bacteria 5535
285 Ga0207657_10064842 3300025919 Bacteria 3116
286 Ga0207652_10014863 3300025921 Bacteria 6312
287 Ga0207652_10041398 3300025921 Bacteria 3916
288 Ga0207652_10175359 3300025921 Bacteria 1925
289 Ga0207652_10188003 3300025921 Bacteria 1857
290 Ga0207694_10000121 3300025924 Bacteria 83123
291 Ga0207650_10143320 3300025925 Bacteria 1880
292 Ga0207650_10285702 3300025925 Bacteria 1344
293 Ga0207700_10021126 3300025928 Bacteria 4437
294 Ga0207664_10012301 3300025929 Bacteria 6114
295 Ga0207664_10016162 3300025929 Bacteria 5438
296 Ga0207664_10063975 3300025929 Bacteria 2941
297 Ga0207664_10081345 3300025929 Bacteria 2635
298 Ga0207664_10107642 3300025929 Bacteria 2313
299 Ga0207664_10182850 3300025929 Bacteria 1801
300 Ga0207664_10203057 3300025929 Bacteria 1712
301 Ga0207644_10054095 3300025931 Bacteria 2890
302 Ga0207644_10147990 3300025931 Bacteria 1815
303 Ga0207644_10282042 3300025931 Bacteria 1334
304 Ga0207706_10321970 3300025933 Bacteria 1346
305 Ga0207709_10007306 3300025935 Bacteria 6159
306 Ga0207704_10025225 3300025938 Bacteria 3241
307 Ga0207665_10000883 3300025939 Bacteria 20232
308 Ga0207665_10002000 3300025939 Bacteria 13748
309 Ga0207665_10182091 3300025939 Bacteria 1522
310 Ga0207691_10046534 3300025940 Bacteria 3986
311 Ga0207691_10115601 3300025940 Bacteria 2382
312 Ga0207691_10120454 3300025940 Bacteria 2326
313 Ga0207661_10002867 3300025944 Bacteria 11914
314 Ga0207661_10037877 3300025944 Bacteria 3775
315 Ga0207661_10297503 3300025944 Bacteria 1446
316 Ga0207679_10161499 3300025945 Bacteria 1835
317 Ga0207679_10279429 3300025945 Bacteria 1431
318 Ga0207667_10099646 3300025949 Bacteria 2998
319 Ga0207667_10106489 3300025949 Bacteria 2892
320 Ga0207667_10113600 3300025949 Bacteria 2792
321 Ga0207667_10145540 3300025949 Bacteria 2439
322 Ga0207667_10293822 3300025949 Bacteria 1660
323 Ga0207667_10320014 3300025949 Bacteria 1584
324 Ga0207712_10170967 3300025961 Bacteria 1699
325 Ga0207668_10055636 3300025972 Bacteria 2751
326 Ga0207668_10071498 3300025972 Bacteria 2478
327 Ga0207668_10089385 3300025972 Bacteria 2258
328 Ga0207668_10134074 3300025972 Bacteria 1895
329 Ga0207668_10201416 3300025972 Bacteria 1585
330 Ga0207668_10208465 3300025972 Bacteria 1561
331 Ga0207640_10055768 3300025981 Bacteria 2590
332 Ga0207640_10111808 3300025981 Bacteria 1938
333 Ga0207677_10109413 3300026023 Bacteria 2054
334 Ga0207639_10105577 3300026041 Bacteria 2285
335 Ga0207639_10105616 3300026041 Bacteria 2285
336 Ga0207639_10273504 3300026041 Bacteria 1483
337 Ga0207678_10007286 3300026067 Bacteria 9804
338 Ga0207678_10023772 3300026067 Bacteria 5359
339 Ga0207678_10030943 3300026067 Bacteria 4672
340 Ga0207678_10049177 3300026067 Bacteria 3644
341 Ga0207678_10053564 3300026067 Bacteria 3477
342 Ga0207678_10095444 3300026067 Bacteria 2541
343 Ga0207678_10178177 3300026067 Bacteria 1815
344 Ga0207678_10411329 3300026067 Bacteria 1172
345 Ga0207702_10000004 3300026078 Bacteria 422182
346 Ga0207702_10000318 3300026078 Bacteria 55209
347 Ga0207702_10512317 3300026078 Bacteria 1170
348 Ga0207641_10354695 3300026088 Bacteria 1399
349 Ga0207648_10111460 3300026089 Bacteria 2402
350 Ga0207676_10142898 3300026095 Bacteria 2051
351 Ga0207676_10280626 3300026095 Bacteria 1512
352 Ga0207674_10005964 3300026116 Bacteria 14418
353 Ga0207674_10006033 3300026116 Bacteria 14333
354 Ga0207674_10012348 3300026116 Bacteria 9549
355 Ga0207674_10108974 3300026116 Bacteria 2746
356 Ga0207674_10336032 3300026116 Bacteria 1461
357 Ga0207675_100026733 3300026118 Bacteria 5371
358 Ga0207675_100221006 3300026118 Bacteria 1825
359 Ga0207675_100317294 3300026118 Bacteria 1521
360 Ga0207683_10063270 3300026121 Bacteria 3259
361 Ga0207683_10175358 3300026121 Bacteria 1943
362 Ga0207698_10128272 3300026142 Bacteria 2162
363 Ga0207698_10263227 3300026142 Bacteria 1585
364 Ga0209389_1000157 3300027296 Bacteria 56696
365 Ga0209389_1000349 3300027296 Bacteria 27996
366 Ga0209589_1000035 3300027357 Bacteria 134091
367 Ga0209589_1003843 3300027357 Bacteria 26144
368 Ga0209489_100079 3300027361 Bacteria 134091
369 Ga0209489_101111 3300027361 Bacteria 54702
370 Ga0209489_103974 3300027361 Bacteria 27996
371 Ga0209700_100011 3300027363 Bacteria 362159
372 Ga0209700_100077 3300027363 Bacteria 134091
373 Ga0268266_10001236 3300028379 Bacteria 31292
374 Ga0268266_10031941 3300028379 Bacteria 4473
375 Ga0268266_10104133 3300028379 Bacteria 2505
376 Ga0268266_10209638 3300028379 Bacteria 1786
377 Ga0268265_10113357 3300028380 Bacteria 2218
378 Ga0268265_10367284 3300028380 Bacteria 1319
379 Ga0268264_10000062 3300028381 Bacteria 302110
380 Ga0268264_10222966 3300028381 Bacteria 1736
381 Ga0307517_10000175 3300028786 Bacteria 105567
382 Ga0307517_10197719 3300028786 Bacteria 1263
383 Ga0307515_10034911 3300028794 Bacteria 8205
384 Ga0307515_10092532 3300028794 Bacteria 3762
385 Ga0307515_10191196 3300028794 Bacteria 1956
386 Ga0307511_10070832 3300030521 Bacteria 2549
387 Ga0265330_10054095 3300031235 Bacteria 1755
388 Ga0265332_10003278 3300031238 Bacteria 7865
389 Ga0265332_10007021 3300031238 Bacteria 5099
390 Ga0265328_10016314 3300031239 Bacteria 2893
391 Ga0265325_10065075 3300031241 Bacteria 1842
392 Ga0265340_10002509 3300031247 Bacteria 10431
393 Ga0265339_10000738 3300031249 Bacteria 25301
394 Ga0265339_10015187 3300031249 Bacteria 4623
395 Ga0265339_10159401 3300031249 Bacteria 1136
396 Ga0307513_10189506 3300031456 Bacteria 1910
397 Ga0307509_10006160 3300031507 Bacteria 16260
398 Ga0307509_10262543 3300031507 Bacteria 1501
399 Ga0307509_10315318 3300031507 Bacteria 1304
400 Ga0307508_10000045 3300031616 Bacteria 142824
401 Ga0307508_10185394 3300031616 Bacteria 1683
402 Ga0265314_10026793 3300031711 Bacteria 4325
403 Ga0265342_10000789 3300031712 Bacteria 31942
404 Ga0265342_10005212 3300031712 Bacteria 9983
405 Ga0265342_10046291 3300031712 Bacteria 2615
406 Ga0307516_10045874 3300031730 Bacteria 4314
407 Ga0307516_10078174 3300031730 Bacteria 3155
408 Ga0307516_10146981 3300031730 Bacteria 2122
409 Ga0307406_10084190 3300031901 Bacteria 2123
410 Ga0307412_10052998 3300031911 Bacteria 2688
411 Ga0307416_100482080 3300032002 Bacteria 1300
412 Ga0307415_100035854 3300032126 Bacteria 3244
413 Ga0307507_10065520 3300033179 Bacteria 3340
414 Ga0307510_10005941 3300033180 Bacteria 14568
415 Ga0307510_10020148 3300033180 Bacteria 7804
416 Ga0307510_10240881 3300033180 Bacteria 1303
417 Ga0315911_1000008 3300033442 Bacteria 381285
418 Ga0373934_0022652 3300035086 Bacteria 2424
419 Ga0373940_0063221 3300035088 Bacteria 1063
420 Ga0373923_0002779 3300035111 Bacteria 5474
421 Ga0373923_0026195 3300035111 Bacteria 2318
422 Ga0373923_0063281 3300035111 Bacteria 1575
423 Ga0373936_0053633 3300035113 Bacteria 1635
424 Ga0373945_0013723 3300035116 Bacteria 2707
425 Ga0373954_0008952 3300035118 Bacteria 4406
426 Ga0373954_0083214 3300035118 Bacteria 1531
427 Ga0373956_0004385 3300035119 Bacteria 5652
428 Ga0373956_0035419 3300035119 Bacteria 2201
429 Ga0373957_0038777 3300035120 Bacteria 1785
430 Ga0373943_0019810 3300035170 Bacteria 3097
431 Ga0373943_0030555 3300035170 Bacteria 2551
432 Ga0373946_0009807 3300035171 Bacteria 3536
433 Ga0373955_0002044 3300035172 Bacteria 8678
434 Ga0373955_0021308 3300035172 Bacteria 3270
435 Ga0373924_0009573 3300035410 Bacteria 3554
436 Ga0373924_0029224 3300035410 Bacteria 2202
437 Ga0373924_0052734 3300035410 Bacteria 1688
438 Ga0373931_0005215 3300035691 Bacteria 5994
439 Ga0373935_0001683 3300035692 Bacteria 12361
440 Ga0373935_0110751 3300035692 Bacteria 1822
441 Ga0373927_0001064 3300035695 Bacteria 20972
442 Ga0373927_0003727 3300035695 Bacteria 10831
443 Ga0373927_0016324 3300035695 Bacteria 4900
444 Ga0373927_0035670 3300035695 Bacteria 3234
445 Ga0373927_0055863 3300035695 Bacteria 2552
446 Ga0373927_0106543 3300035695 Bacteria 1825
447 Ga0373933_0000068 3300035724 Bacteria 63195
448 Ga0373933_0009248 3300035724 Bacteria 5379
449 Ga0373933_0118519 3300035724 Bacteria 1656
450 Ga0373947_0006319 3300035725 Bacteria 6885
451 Ga0373947_0008648 3300035725 Bacteria 5859
452 Ga0373947_0103908 3300035725 Bacteria 1788
453 Ga0373947_0126323 3300035725 Bacteria 1629
454 Ga0373947_0147077 3300035725 Bacteria 1515
455 Ga0373937_0017394 3300036401 Bacteria 6403
456 Ga0373937_0022449 3300036401 Bacteria 5674
457 Ga0373937_0029705 3300036401 Bacteria 4952
458 Ga0373937_0065670 3300036401 Bacteria 3340
459 Ga0373937_0188107 3300036401 Bacteria 1939
460 Ga0373925_0007638 3300037068 Bacteria 7875
461 Ga0373925_0093233 3300037068 Bacteria 2304
462 Ga0373925_0113305 3300037068 Bacteria 2097
463 Ga0373925_0163374 3300037068 Bacteria 1755
464 Ga0395899_0069720 3300037312 Bacteria 2574
465 Ga0395900_0020656 3300037418 Bacteria 6729
466 Ga0395900_0148706 3300037418 Bacteria 2394
467 Ga0395900_0437877 3300037418 Bacteria 1265
468 Ga0395900_0445273 3300037418 Bacteria 1252
469 Ga0395898_0050745 3300037466 Bacteria 4059
470 Ga0395898_0257194 3300037466 Bacteria 1665
471 Ga0395898_0373450 3300037466 Bacteria 1360
472 Ga0395905_0001948 3300037471 Bacteria 23653
473 Ga0395905_0048386 3300037471 Bacteria 3985
474 Ga0436364_0738225 3300037853 Bacteria 2323
475 Ga0436364_1338082 3300037853 Bacteria 27858
476 Ga0395901_0089489 3300038443 Bacteria 3221
477 Ga0395901_0199025 3300038443 Bacteria 2100
478 Ga0395901_0235797 3300038443 Bacteria 1909
479 Ga0400483_063134 3300039062 Bacteria 5649
480 Ga0400483_064073 3300039062 Bacteria 17035
481 Ga0400483_170476 3300039062 Bacteria 20916
482 Ga0400483_292171 3300039062 Bacteria 65188
483 Ga0436363_0740465 3300039450 Bacteria 1303
484 Ga0466969_0019790 3300044656 Bacteria 3492
485 Ga0466969_0058661 3300044656 Bacteria 1873
486 Ga0466972_0000299 3300044658 Bacteria 30012
487 Ga0466972_0023246 3300044658 Bacteria 3083
488 Ga0466966_0003365 3300044684 Bacteria 10543
489 Ga0466961_0000709 3300044693 Bacteria 20961
490 Ga0466963_0046772 3300044694 Bacteria 2854
491 Ga0466957_0160598 3300044842 Bacteria 1459
492 Ga0466959_0027413 3300045049 Bacteria 4226
493 Ga0466959_0040311 3300045049 Bacteria 3450
494 Ga0466958_0225078 3300045836 Bacteria 1197
495 Ga0466967_0078628 3300045976 Bacteria 2972
496 Ga0466967_0081393 3300045976 Bacteria 2925
497 Ga0466967_0179066 3300045976 Bacteria 1998
498 Ga0495592_0020736 3300046454 Bacteria 5000
499 Ga0495592_0257244 3300046454 Bacteria 1151
500 Ga0495603_0003128 3300046455 Bacteria 9841
501 Ga0495603_0003243 3300046455 Bacteria 9693
502 Ga0495603_0003728 3300046455 Bacteria 9063
503 Ga0495603_0012063 3300046455 Bacteria 5233
504 Ga0495629_0001107 3300046459 Bacteria 21326
505 Ga0495629_0002800 3300046459 Bacteria 13295
506 Ga0495629_0012976 3300046459 Bacteria 6025
507 Ga0495629_0055191 3300046459 Bacteria 2778
508 Ga0495629_0074497 3300046459 Bacteria 2370
509 Ga0495638_0003712 3300046460 Bacteria 11885
510 Ga0495638_0084885 3300046460 Bacteria 1915
511 Ga0495641_0004022 3300046461 Bacteria 10651
512 Ga0495641_0079333 3300046461 Bacteria 1471
513 Ga0495641_0080734 3300046461 Bacteria 1457
514 Ga0495651_0003711 3300046462 Bacteria 11696
515 Ga0495651_0009193 3300046462 Bacteria 7588
516 Ga0495651_0047740 3300046462 Bacteria 3308
517 Ga0495651_0120736 3300046462 Bacteria 1926
518 Ga0495653_0019489 3300046463 Bacteria 5501
519 Ga0495653_0028503 3300046463 Bacteria 4464
520 Ga0495653_0102842 3300046463 Bacteria 2067
521 Ga0495653_0109292 3300046463 Bacteria 1990
522 Ga0495650_0046873 3300046471 Bacteria 1811
523 Ga0495580_0001546 3300046472 Bacteria 20242
524 Ga0495580_0001981 3300046472 Bacteria 18011
525 Ga0495580_0090322 3300046472 Bacteria 2133
526 Ga0495605_0073665 3300046474 Bacteria 1608
527 Ga0495639_0000072 3300046475 Bacteria 46904
528 Ga0495662_0000510 3300046476 Bacteria 17683
529 Ga0495662_0075704 3300046476 Bacteria 1633
530 Ga0495664_0001402 3300046477 Bacteria 12752
531 Ga0495664_0006292 3300046477 Bacteria 6555
532 Ga0495664_0043294 3300046477 Bacteria 2667
533 Ga0495664_0058400 3300046477 Bacteria 2295
534 Ga0495585_0047603 3300046492 Bacteria 2388
535 Ga0495585_0061098 3300046492 Bacteria 2073
536 Ga0495585_0093709 3300046492 Bacteria 1615
537 Ga0495594_0000467 3300046499 Bacteria 20554
538 Ga0495594_0066615 3300046499 Bacteria 1998
539 Ga0495594_0197900 3300046499 Bacteria 1145
540 Ga0495583_0109755 3300046506 Bacteria 1170
541 Ga0495606_0000831 3300046507 Bacteria 46699
542 Ga0495606_0032054 3300046507 Bacteria 3645
543 Ga0495608_0008312 3300046511 Bacteria 7281
544 Ga0495608_0082821 3300046511 Bacteria 2083
545 Ga0495608_0097634 3300046511 Bacteria 1896
546 Ga0495618_0010639 3300046514 Bacteria 5569
547 Ga0495618_0088763 3300046514 Bacteria 1977
548 Ga0495620_0044570 3300046515 Bacteria 1927
549 Ga0495620_0073373 3300046515 Bacteria 1395
550 Ga0495628_0003465 3300046516 Bacteria 14119
551 Ga0495628_0084162 3300046516 Bacteria 2468
552 Ga0495630_0019769 3300046517 Bacteria 4955
553 Ga0495631_0021538 3300046518 Bacteria 3002
554 Ga0495631_0069979 3300046518 Bacteria 1517
555 Ga0495632_0040436 3300046519 Bacteria 2348
556 Ga0495637_0079670 3300046520 Bacteria 1308
557 Ga0495643_0042004 3300046522 Bacteria 2492
558 Ga0495644_0022119 3300046523 Bacteria 2424
559 Ga0495648_0002061 3300046524 Bacteria 19020
560 Ga0495648_0061546 3300046524 Bacteria 2228
561 Ga0495648_0114593 3300046524 Bacteria 1460
562 Ga0495648_0180034 3300046524 Bacteria 1075
563 Ga0495666_0085145 3300046526 Bacteria 1493
564 Ga0495652_0026176 3300046529 Bacteria 5155
565 Ga0495652_0029317 3300046529 Bacteria 4835
566 Ga0495652_0033141 3300046529 Bacteria 4513
567 Ga0495652_0038958 3300046529 Bacteria 4112
568 Ga0495652_0064423 3300046529 Bacteria 3082
569 Ga0495652_0144035 3300046529 Bacteria 1871
570 Ga0495654_0011888 3300046530 Bacteria 4695
571 Ga0495665_0000128 3300046531 Bacteria 36043
572 Ga0495665_0021707 3300046531 Bacteria 3452
573 Ga0495640_0010120 3300046533 Bacteria 7310
574 Ga0495640_0025681 3300046533 Bacteria 4268
575 Ga0495640_0061431 3300046533 Bacteria 2552
576 Ga0495640_0065803 3300046533 Bacteria 2446
577 Ga0495587_0017095 3300046536 Bacteria 4509
578 Ga0495587_0086702 3300046536 Bacteria 1812
579 Ga0495645_0064764 3300046543 Bacteria 2644
580 Ga0495622_0005892 3300046557 Bacteria 5692
581 Ga0495622_0014876 3300046557 Bacteria 3617
582 Ga0495622_0016799 3300046557 Bacteria 3409
583 Ga0495622_0088499 3300046557 Bacteria 1423
584 Ga0495622_0100094 3300046557 Bacteria 1329
585 Ga0495633_0052514 3300046558 Bacteria 1920
586 Ga0495667_0005488 3300046559 Bacteria 8568
587 Ga0495667_0036453 3300046559 Bacteria 3283
588 Ga0495656_0002973 3300046615 Bacteria 5691
589 Ga0495668_0028813 3300046616 Bacteria 3138
590 Ga0495668_0106411 3300046616 Bacteria 1534
591 Ga0495634_0004246 3300046642 Bacteria 11306
592 Ga0495634_0034915 3300046642 Bacteria 3448
593 Ga0495634_0063611 3300046642 Bacteria 2448
594 Ga0495625_0090229 3300046660 Bacteria 2120
595 Ga0495625_0201733 3300046660 Bacteria 1312
596 Ga0495635_0000564 3300046663 Bacteria 23651
597 Ga0495635_0001868 3300046663 Bacteria 14260
598 Ga0495635_0019084 3300046663 Bacteria 4787
599 Ga0495635_0028708 3300046663 Bacteria 3866
600 Ga0495635_0101694 3300046663 Bacteria 1964
601 Ga0495635_0105019 3300046663 Bacteria 1930
602 Ga0495659_0045116 3300046664 Bacteria 1587
603 Ga0495661_0087811 3300046665 Bacteria 1777
604 Ga0495588_0007923 3300046674 Bacteria 4855
605 Ga0495588_0009177 3300046674 Bacteria 4564
606 Ga0495657_0007182 3300046675 Bacteria 8638
607 Ga0495657_0033568 3300046675 Bacteria 3572
608 Ga0495657_0100805 3300046675 Bacteria 1840
609 Ga0495599_0014153 3300046678 Bacteria 4938
610 Ga0495599_0020349 3300046678 Bacteria 4132
611 Ga0495599_0042374 3300046678 Bacteria 2856
612 Ga0495599_0219207 3300046678 Bacteria 1165
613 Ga0495623_0020666 3300046679 Bacteria 4255
614 Ga0495623_0034663 3300046679 Bacteria 3236
615 Ga0495646_0003182 3300046680 Bacteria 10197
616 Ga0495646_0034504 3300046680 Bacteria 3142
617 Ga0495646_0177965 3300046680 Bacteria 1169
618 Ga0495647_0002893 3300046681 Bacteria 5449
619 Ga0495658_0000707 3300046683 Bacteria 18088
620 Ga0495669_0006578 3300046684 Bacteria 4858
621 Ga0495669_0030472 3300046684 Bacteria 2368
622 Ga0495669_0041240 3300046684 Bacteria 2049
623 Ga0495613_0001986 3300046689 Bacteria 15542
624 Ga0495613_0031628 3300046689 Bacteria 3931
625 Ga0495613_0070841 3300046689 Bacteria 2542
626 Ga0495613_0214027 3300046689 Bacteria 1354
627 Ga0495613_0229984 3300046689 Bacteria 1299
628 Ga0495624_0007718 3300046690 Bacteria 7549
629 Ga0495624_0027338 3300046690 Bacteria 3735
630 Ga0495670_0005603 3300046691 Bacteria 6160
631 Ga0495670_0092874 3300046691 Bacteria 1546
632 Ga0495589_0100633 3300046794 Bacteria 1399
633 Ga0495600_0016480 3300046809 Bacteria 4690
634 Ga0495600_0046117 3300046809 Bacteria 2844
635 Ga0495581_0000030 3300047315 Bacteria 53487
636 Ga0495581_0080105 3300047315 Bacteria 1890
637 Ga0495581_0195670 3300047315 Bacteria 1183
638 Ga0495604_0001746 3300047317 Bacteria 17757
639 Ga0495604_0006243 3300047317 Bacteria 9452
640 Ga0495604_0089587 3300047317 Bacteria 2286
641 Ga0495604_0147504 3300047317 Bacteria 1675
642 Ga0495604_0250564 3300047317 Bacteria 1207
643 Ga0495674_0024013 3300047319 Bacteria 5609
644 Ga0495674_0167017 3300047319 Bacteria 1838
645 Ga0495674_0202283 3300047319 Bacteria 1647
646 Ga0495672_0034357 3300047320 Bacteria 3133
647 Ga0495676_0030732 3300047321 Bacteria 4552
648 Ga0495676_0081675 3300047321 Bacteria 2449
649 Ga0495676_0086878 3300047321 Bacteria 2352
650 Ga0495680_0000836 3300047322 Bacteria 34084
651 Ga0495680_0015081 3300047322 Bacteria 6673
652 Ga0495680_0038283 3300047322 Bacteria 3834
653 Ga0495683_0027504 3300047323 Bacteria 2908
654 Ga0495687_051007 3300047443 Bacteria 1759
655 Ga0495675_0005364 3300047444 Bacteria 7811
656 Ga0495675_0017105 3300047444 Bacteria 4591
657 Ga0495675_0234433 3300047444 Bacteria 1107
658 Ga0495677_0032871 3300047445 Bacteria 1890
659 Ga0495673_0062965 3300047469 Bacteria 1583
660 Ga0495681_0058559 3300047470 Bacteria 1784
661 Ga0495684_0004347 3300047471 Bacteria 11073
662 Ga0495684_0005411 3300047471 Bacteria 9938
663 Ga0495684_0006597 3300047471 Bacteria 9001
664 Ga0495684_0037949 3300047471 Bacteria 3695
665 Ga0495684_0121271 3300047471 Bacteria 1969
666 Ga0495686_0028173 3300047472 Bacteria 3659
667 Ga0495686_0064789 3300047472 Bacteria 2261
668 Ga0495686_0149767 3300047472 Bacteria 1371
669 Ga0495593_0000470 3300047673 Bacteria 22684
670 Ga0495593_0009200 3300047673 Bacteria 5727
671 Ga0495593_0013405 3300047673 Bacteria 4677
672 Ga0495593_0093144 3300047673 Bacteria 1551
673 Ga0495602_0013506 3300048088 Bacteria 8344
674 Ga0495602_0022610 3300048088 Bacteria 6148
675 Ga0495602_0190918 3300048088 Bacteria 1571
676 Ga0495614_0124296 3300048089 Bacteria 1139
677 Ga0496100_0014735 3300048903 Bacteria 4546
678 Ga0496100_0046014 3300048903 Bacteria 2803
679 Ga0496100_0130453 3300048903 Bacteria 1770
680 Ga0496100_0165264 3300048903 Bacteria 1589
681 Ga0496100_0245958 3300048903 Bacteria 1321
682 Ga0496101_0132261 3300048904 Bacteria 1895
683 Ga0496102_0011723 3300048905 Bacteria 7565
684 Ga0496102_0039049 3300048905 Bacteria 4287
685 Ga0496102_0195999 3300048905 Bacteria 1903
686 Ga0496102_0219478 3300048905 Bacteria 1792
687 Ga0496102_0271445 3300048905 Bacteria 1599
688 Ga0496102_0309961 3300048905 Bacteria 1487
689 Ga0496102_0321862 3300048905 Bacteria 1457
690 Ga0496102_0368813 3300048905 Bacteria 1351
691 Ga0496102_0432553 3300048905 Bacteria 1235
692 Ga0496103_0207953 3300048906 Bacteria 1258
693 Ga0496104_0004462 3300048907 Bacteria 12190
694 Ga0496104_0045714 3300048907 Bacteria 4119
695 Ga0496104_0062767 3300048907 Bacteria 3523
696 Ga0496104_0173540 3300048907 Bacteria 2066
697 Ga0496105_0032276 3300048908 Bacteria 4296
698 Ga0496105_0032852 3300048908 Bacteria 4258
699 Ga0496105_0033675 3300048908 Bacteria 4209
700 Ga0496105_0123492 3300048908 Bacteria 2134
701 Ga0496105_0188690 3300048908 Bacteria 1686
702 Ga0496106_0001644 3300048909 Bacteria 16771
703 Ga0496106_0316535 3300048909 Bacteria 1252
704 Ga0496106_0334013 3300048909 Bacteria 1217
705 Ga0496107_0003260 3300048910 Bacteria 10808
706 Ga0496107_0033433 3300048910 Bacteria 3679
707 Ga0496107_0037483 3300048910 Bacteria 3479
708 Ga0496107_0095639 3300048910 Bacteria 2173
709 Ga0496107_0129244 3300048910 Bacteria 1864
710 Ga0496108_0000927 3300048911 Bacteria 22857
711 Ga0496108_0062262 3300048911 Bacteria 3142
712 Ga0496108_0089483 3300048911 Bacteria 2616
713 Ga0496108_0181242 3300048911 Bacteria 1824
714 Ga0496108_0188858 3300048911 Bacteria 1785
715 Ga0496109_0000229 3300048912 Bacteria 54733
716 Ga0496109_0056062 3300048912 Bacteria 3596
717 Ga0496109_0075478 3300048912 Bacteria 3099
718 Ga0496109_0108977 3300048912 Bacteria 2574
719 Ga0496109_0120192 3300048912 Bacteria 2447
720 Ga0496109_0208744 3300048912 Bacteria 1836
721 Ga0496110_0014360 3300048913 Bacteria 6574
722 Ga0496110_0024599 3300048913 Bacteria 5134
723 Ga0496110_0049185 3300048913 Bacteria 3697
724 Ga0496110_0066266 3300048913 Bacteria 3193
725 Ga0496110_0069892 3300048913 Bacteria 3110
726 Ga0496110_0198927 3300048913 Bacteria 1820
727 Ga0496111_0042267 3300048914 Bacteria 3272
728 Ga0496111_0057455 3300048914 Bacteria 2817
729 Ga0496111_0145455 3300048914 Bacteria 1757
730 Ga0496111_0213188 3300048914 Bacteria 1434
731 Ga0496112_0000018 3300048915 Bacteria 188820
732 Ga0496112_0001343 3300048915 Bacteria 18708
733 Ga0496112_0005116 3300048915 Bacteria 11270
734 Ga0496112_0022495 3300048915 Bacteria 6008
735 Ga0496112_0036254 3300048915 Bacteria 4810
736 Ga0496112_0061280 3300048915 Bacteria 3708
737 Ga0496112_0116736 3300048915 Bacteria 2639
738 Ga0496112_0204779 3300048915 Bacteria 1931
739 Ga0496112_0397946 3300048915 Bacteria 1317
740 Ga0496112_0506506 3300048915 Bacteria 1142
741 Ga0496113_0025324 3300048916 Bacteria 4227
742 Ga0496113_0029007 3300048916 Bacteria 3989
743 Ga0496113_0075336 3300048916 Bacteria 2575
744 Ga0496113_0080616 3300048916 Bacteria 2493
745 Ga0496113_0129483 3300048916 Bacteria 1979
746 Ga0496113_0186280 3300048916 Bacteria 1646
747 Ga0496113_0408391 3300048916 Bacteria 1090
748 Ga0496114_0146649 3300048917 Bacteria 2046
749 Ga0496114_0161956 3300048917 Bacteria 1946
750 Ga0496114_0481043 3300048917 Bacteria 1098
751 Ga0496115_0002846 3300048918 Bacteria 12452
752 Ga0496115_0026716 3300048918 Bacteria 4508
753 Ga0496115_0062056 3300048918 Bacteria 3014
754 Ga0496115_0076405 3300048918 Bacteria 2722
755 Ga0496115_0078346 3300048918 Bacteria 2689
756 Ga0496115_0251358 3300048918 Bacteria 1455
757 Ga0496115_0259353 3300048918 Bacteria 1430
758 Ga0496115_0263445 3300048918 Bacteria 1417
759 Ga0496115_0398297 3300048918 Bacteria 1117
760 Ga0496116_0039933 3300048919 Bacteria 3237
761 Ga0496117_0038300 3300048920 Bacteria 3558
762 Ga0496117_0070193 3300048920 Bacteria 2355
763 Ga0496117_0082976 3300048920 Bacteria 2097
764 Ga0496117_0180752 3300048920 Bacteria 1213
765 Ga0496118_0021121 3300048921 Bacteria 5743
766 Ga0496118_0032376 3300048921 Bacteria 4308
767 Ga0496118_0034811 3300048921 Bacteria 4102
768 Ga0496118_0036860 3300048921 Bacteria 3946
769 Ga0496118_0037063 3300048921 Bacteria 3931
770 Ga0496118_0105304 3300048921 Bacteria 1891
771 Ga0496119_0013596 3300048922 Bacteria 6463
772 Ga0496119_0067395 3300048922 Bacteria 2111
773 Ga0496119_0116694 3300048922 Bacteria 1473
774 Ga0496119_0132223 3300048922 Bacteria 1358
775 Ga0496120_0022973 3300048923 Bacteria 3911
776 Ga0496120_0042211 3300048923 Bacteria 2665
777 Ga0496120_0056627 3300048923 Bacteria 2211
778 Ga0496121_0000278 3300048924 Bacteria 106838
779 Ga0496121_0000654 3300048924 Bacteria 64945
780 Ga0496121_0001257 3300048924 Bacteria 43906
781 Ga0496121_0004075 3300048924 Bacteria 20070
782 Ga0496121_0010674 3300048924 Bacteria 10312
783 Ga0496121_0018630 3300048924 Bacteria 6989
784 Ga0496121_0062278 3300048924 Bacteria 3056
785 Ga0496121_0068167 3300048924 Bacteria 2879
786 Ga0496121_0075822 3300048924 Bacteria 2685
787 Ga0496121_0109197 3300048924 Bacteria 2114
788 Ga0496121_0122183 3300048924 Bacteria 1964
789 Ga0496121_0164458 3300048924 Bacteria 1619
790 Ga0496121_0215171 3300048924 Bacteria 1358
791 Ga0496124_0003799 3300048927 Bacteria 18136
792 Ga0496124_0175801 3300048927 Bacteria 1653
793 Ga0496125_0003929 3300048928 Bacteria 17533
794 Ga0496125_0050458 3300048928 Bacteria 3444
795 Ga0496125_0063726 3300048928 Bacteria 2936
796 Ga0496125_0076285 3300048928 Bacteria 2589
797 Ga0496125_0089528 3300048928 Bacteria 2314
798 Ga0496125_0126663 3300048928 Bacteria 1808
799 Ga0496125_0175673 3300048928 Bacteria 1433
800 Ga0496126_0005056 3300048929 Bacteria 15313
801 Ga0496126_0006689 3300048929 Bacteria 12810
802 Ga0496126_0013259 3300048929 Bacteria 8398
803 Ga0496126_0014598 3300048929 Bacteria 7933
804 Ga0496126_0021739 3300048929 Bacteria 6258
805 Ga0496126_0038464 3300048929 Bacteria 4452
806 Ga0496126_0048899 3300048929 Bacteria 3862
807 Ga0496126_0050733 3300048929 Bacteria 3780
808 Ga0496126_0062031 3300048929 Bacteria 3355
809 Ga0496126_0073376 3300048929 Bacteria 3042
810 Ga0496126_0077746 3300048929 Bacteria 2941
811 Ga0496126_0126206 3300048929 Bacteria 2214
812 Ga0496126_0145128 3300048929 Bacteria 2039
813 Ga0496126_0253413 3300048929 Bacteria 1466
814 Ga0495682_0031941 3300049460 Bacteria 1945
815 Ga0501031_0000207 3300049568 Bacteria 33573
816 Ga0501031_0169893 3300049568 Bacteria 1425
817 Ga0501032_0000252 3300049569 Bacteria 44619
818 Ga0501032_0238727 3300049569 Bacteria 1181
819 Ga0501033_0000082 3300049570 Bacteria 89837
820 Ga0501034_0000198 3300049571 Bacteria 113672
821 Ga0501034_0076935 3300049571 Bacteria 3343
822 Ga0501034_0107782 3300049571 Bacteria 2777
823 Ga0501034_0164294 3300049571 Bacteria 2189
824 Ga0501036_0001281 3300049572 Bacteria 19291
825 Ga0501037_0000050 3300049573 Bacteria 112824
826 Ga0501037_0013075 3300049573 Bacteria 6119
827 Ga0501037_0037537 3300049573 Bacteria 3572
828 Ga0501037_0237735 3300049573 Bacteria 1277
829 Ga0501038_0000538 3300049574 Bacteria 33271
830 Ga0501038_0000630 3300049574 Bacteria 31329
831 Ga0501038_0021325 3300049574 Bacteria 5815
832 Ga0501038_0045587 3300049574 Bacteria 3806
833 Ga0501039_0000366 3300049575 Bacteria 32333
834 Ga0501042_0017539 3300049578 Bacteria 4939
835 Ga0501043_0002344 3300049579 Bacteria 16056
836 Ga0501043_0027073 3300049579 Bacteria 4500
837 Ga0501043_0128729 3300049579 Bacteria 1984
838 Ga0501046_0149717 3300049580 Bacteria 1761
839 Ga0501046_0279694 3300049580 Bacteria 1223
840 Ga0501047_0000131 3300049581 Bacteria 91079
841 Ga0501047_0196973 3300049581 Bacteria 1876
842 Ga0501047_0248514 3300049581 Bacteria 1627
843 Ga0501048_0000531 3300049582 Bacteria 26809
844 Ga0501067_0057575 3300049583 Bacteria 2152
845 Ga0501068_0011209 3300049584 Bacteria 5054
846 Ga0501069_0001211 3300049585 Bacteria 12577
847 Ga0501070_0097394 3300049586 Bacteria 2433
848 Ga0501070_0199826 3300049586 Bacteria 1642
849 Ga0501070_0358088 3300049586 Bacteria 1184
850 Ga0501072_0000378 3300049588 Bacteria 31856
851 Ga0501073_0029767 3300049589 Bacteria 3902
852 Ga0501074_0000141 3300049590 Bacteria 37729
853 Ga0501074_0018479 3300049590 Bacteria 5065
854 Ga0501074_0051890 3300049590 Bacteria 2960
855 Ga0501079_0036554 3300049741 Bacteria 3783
856 Ga0501080_0019207 3300049742 Bacteria 6328
857 Ga0501080_0146335 3300049742 Bacteria 2184
858 Ga0501083_0000341 3300049744 Bacteria 29641
859 Ga0501035_0000123 3300049822 Bacteria 93734
860 Ga0501035_0035937 3300049822 Bacteria 4494
861 Ga0501035_0152390 3300049822 Bacteria 2005
862 Ga0501035_0193578 3300049822 Bacteria 1747
863 Ga0501035_0202926 3300049822 Bacteria 1699
864 Ga0501035_0225006 3300049822 Bacteria 1601
865 Ga0501035_0339832 3300049822 Bacteria 1258
866 Ga0501044_0000100 3300049823 Bacteria 106729
867 Ga0501044_0039767 3300049823 Bacteria 4904
868 Ga0501044_0079043 3300049823 Bacteria 3333
869 Ga0501044_0093655 3300049823 Bacteria 3029
870 Ga0501044_0102829 3300049823 Bacteria 2872
871 Ga0501044_0150128 3300049823 Bacteria 2313
872 Ga0501045_0016159 3300049824 Bacteria 5297
873 Ga0501045_0278609 3300049824 Bacteria 1245
874 nmdc:mga03n38_3346_c1 3300050490 Bacteria 5130
875 nmdc:mga03n38_57171_c1 3300050490 Bacteria 1763
876 nmdc:mga00v17_134825_c1 3300050491 Bacteria 1580
877 nmdc:mga00v17_21851_c1 3300050491 Bacteria 3684
878 nmdc:mga00v17_246680_c1 3300050491 Bacteria 1158
879 nmdc:mga00v17_58165_c1 3300050491 Bacteria 1353
880 nmdc:mga0yw44_25265_c1 3300050492 Bacteria 3375
881 nmdc:mga0yw44_26768_c1 3300050492 Bacteria 3298
882 nmdc:mga0yw44_32707_c1 3300050492 Bacteria 3033
883 nmdc:mga0yw44_6182_c1 3300050492 Bacteria 5757
884 nmdc:mga0yw44_90481_c1 3300050492 Bacteria 1933
885 nmdc:mga0k408_125572_c1 3300050493 Bacteria 1522
886 nmdc:mga0k408_26360_c1 3300050493 Bacteria 2178
887 nmdc:mga06z11_25454_c1 3300050494 Bacteria 2805
888 nmdc:mga06z11_30785_c1 3300050494 Bacteria 2600
889 nmdc:mga07m45_117037_c1 3300050496 Bacteria 1538
890 nmdc:mga07m45_14953_c1 3300050496 Bacteria 4143
891 nmdc:mga07m45_3103_c1 3300050496 Bacteria 7739
892 nmdc:mga08y16_363177_c1 3300050511 Bacteria 1486
893 nmdc:mga0rr50_363005_c1 3300050513 Bacteria 1219
894 nmdc:mga0sz30_32825_c1 3300050516 Bacteria 2155
895 nmdc:mga0sz30_5173_c1 3300050516 Bacteria 4777
896 Ga0495601_0032816 3300053077 Bacteria 3233
897 Ga0495612_0013345 3300053078 Bacteria 3310
898 Ga0495612_0023451 3300053078 Bacteria 2476
899 Ga0500635_0005769 3300053080 Bacteria 3272
900 Ga0495595_0001147 3300053084 Bacteria 10254
901 Ga0495595_0101420 3300053084 Bacteria 1390
902 Ga0495619_0050947 3300053085 Bacteria 2734
903 Ga0500578_0029277 3300053086 Bacteria 3537
904 Ga0500643_000076 3300053087 Bacteria 106911
905 Ga0500643_044167 3300053087 Bacteria 1296
906 Ga0500647_0008721 3300053091 Bacteria 4412
907 Ga0500583_0031974 3300053092 Bacteria 2318
908 Ga0500651_0013489 3300053093 Bacteria 4981
909 Ga0500651_0044971 3300053093 Bacteria 2779
910 Ga0500651_0168887 3300053093 Bacteria 1305
911 Ga0500566_0000107 3300053094 Bacteria 42130
912 Ga0500566_0001175 3300053094 Bacteria 15261
913 Ga0500566_0003295 3300053094 Bacteria 9650
914 Ga0500566_0052170 3300053094 Bacteria 2338
915 Ga0500640_022898 3300053095 Bacteria 2703
916 Ga0500641_0011398 3300053096 Bacteria 3225
917 Ga0500641_0037171 3300053096 Bacteria 1951
918 Ga0500650_0047668 3300053098 Bacteria 1986
919 Ga0500650_0070051 3300053098 Bacteria 1640
920 Ga0500556_0000081 3300053104 Bacteria 90508
921 Ga0500557_000021 3300053105 Bacteria 89662
922 Ga0500569_001078 3300053109 Bacteria 4973
923 Ga0500572_036834 3300053111 Bacteria 1399
924 Ga0500592_010490 3300053116 Bacteria 1476
925 Ga0500595_001968 3300053119 Bacteria 10552
926 Ga0500595_002941 3300053119 Bacteria 8136
927 Ga0500595_003169 3300053119 Bacteria 7788
928 Ga0500595_003647 3300053119 Bacteria 7128
929 Ga0500595_038411 3300053119 Bacteria 1557
930 Ga0500597_096638 3300053120 Bacteria 1284
931 Ga0500608_000949 3300053122 Bacteria 10352
932 Ga0500608_103597 3300053122 Bacteria 1315
933 Ga0500618_013897 3300053125 Bacteria 2069
934 Ga0500642_0000042 3300053130 Bacteria 86476
935 Ga0500642_0000225 3300053130 Bacteria 22158
936 Ga0500652_000365 3300053131 Bacteria 16300
937 Ga0500658_0013217 3300053134 Bacteria 3048
938 Ga0500559_0000106 3300053136 Bacteria 65670
939 Ga0500559_0022835 3300053136 Bacteria 2653
940 Ga0500559_0067344 3300053136 Bacteria 1607
941 Ga0500559_0088352 3300053136 Bacteria 1416
942 Ga0500568_0015314 3300053139 Bacteria 3434
943 Ga0500568_0022805 3300053139 Bacteria 2670
944 Ga0500568_0059026 3300053139 Bacteria 1489
945 Ga0500577_0007820 3300053142 Bacteria 3014
946 Ga0500577_0067911 3300053142 Bacteria 1390
947 Ga0500589_052697 3300053147 Bacteria 1884
948 Ga0500603_001588 3300053150 Bacteria 5133
949 Ga0500604_0013529 3300053151 Bacteria 2212
950 Ga0500616_0000227 3300053153 Bacteria 88098
951 Ga0500620_001172 3300053155 Bacteria 4673
952 Ga0500622_0005478 3300053156 Bacteria 7616
953 Ga0500622_0055868 3300053156 Bacteria 2022
954 Ga0500634_0045252 3300053161 Bacteria 2382
955 Ga0500638_002181 3300053162 Bacteria 6670
956 Ga0500638_074317 3300053162 Bacteria 1621
957 Ga0500636_0001726 3300053177 Bacteria 11964
958 Ga0500636_0007656 3300053177 Bacteria 6247
959 Ga0500636_0052999 3300053177 Bacteria 2381
960 Ga0500637_0005127 3300053178 Bacteria 6311
961 Ga0500637_0069682 3300053178 Bacteria 2022
962 Ga0500570_099933 3300053724 Bacteria 1224
963 Ga0500625_020193 3300053729 Bacteria 3133
964 Ga0500609_001334 3300053731 Bacteria 3640
965 Ga0500599_001530 3300053736 Bacteria 2674
966 Ga0500601_000261 3300053737 Bacteria 10015
967 Ga0501084_0012059 3300054114 Bacteria 7158
968 Ga0501084_0152257 3300054114 Bacteria 1950
969 Ga0501082_0001776 3300060353 Bacteria 18967
970 Ga0466962_0044409 3300061719 Bacteria 2126
971 2507505423 2507262055 Bacteria 8048963
972 2508539309 2508501009 Bacteria 7784016
973 2508695636 2508501042 Bacteria 8719808
974 2511399098 2511231028 Bacteria 8046582
975 2513623953 2513237092 Bacteria 8341956
976 2513651361 2513237095 Bacteria 8976980
977 2513659484 2513237096 Bacteria 8722461
978 2513676289 2513237098 Bacteria 9902361
979 2513695261 2513237101 Bacteria 7952346
980 2513718214 2513237104 Bacteria 10034502
981 2513859409 2513237137 Bacteria 9558895
982 2513873376 2513237139 Bacteria 8737671
983 2513888605 2513237141 Bacteria 8496279
984 2513921583 2513237145 Bacteria 8979722
985 2514014707 2513237161 Bacteria 8871253
986 2515627619 2515154112 Bacteria 8294334
987 2517106307 2517093001 Bacteria 9002274
988 2517889024 2517572143 Bacteria 9484767
989 2524441415 2524023205 Bacteria 8918781
990 2524467040 2524023210 Bacteria 9029266
991 2524537454 2524023228 Bacteria 10118060
992 2528853345 2528768022 Bacteria 10457665
993 2603858352 2602042107 Bacteria 6226103
994 2617352087 2617270735 Bacteria 9163226
995 2617373557 2617270741 Bacteria 8201522
996 2644291067 2643221651 Bacteria 4798932
997 2671122620 2667528175 Bacteria 7532676
998 2723841790 2721755755 Bacteria 8322773
999 2728748458 2728368998 Bacteria 8720350
1000 2745077549 2744054633 Bacteria 8678936
1001 2793062207 2791355196 Bacteria 7323613
1002 2793073670 2791355197 Bacteria 8420563
1003 2793078335
1004 2805920724 2802429603 Bacteria 8777136
1005 2818237828 2816332527 Bacteria 8933356
1006 2824607338 2824600985 Bacteria 8488197
1007 2824616902 2824609381 Bacteria 8672835
1008 2824626393 2824617872 Bacteria 8814715
1009 2824632759 2824626560 Bacteria 8813858
1010 2824643690 2824635225 Bacteria 8785348
1011 2824652316 2824644064 Bacteria 8743947
1012 2824659676 2824653114 Bacteria 8493680
1013 2824669430 2824661429 Bacteria 9877870
1014 2824679222 2824671348 Bacteria 8369588
1015 2824687384 2824679649 Bacteria 8248951
1016 2824695813 2824687955 Bacteria 8360029
1017 2824704179 2824696289 Bacteria 8335049
1018 2824713838 2824704595 Bacteria 9667483
1019 2824723157 2824714736 Bacteria 8717648
1020 2824732513 2824723954 Bacteria 8758240
1021 2824740203 2824732956 Bacteria 7810675
1022 2824751670 2824746037 Bacteria 7911610
1023 2824762565 2824753945 Bacteria 9787441
1024 2824771899 2824763712 Bacteria 9792355
1025 2824780808 2824773399 Bacteria 8360218
1026 2838124668 2838122688 Bacteria 8803140
1027 2841945359 2841941048 Bacteria 8688029
1028 2841952144 2841949485 Bacteria 8680857
1029 2841965373 2841957949 Bacteria 8652217
1030 2841970468 2841966195 Bacteria 8673214
1031 2841981716 2841974524 Bacteria 8931498
1032 2841984997 2841983080 Bacteria 8395090
1033 2842043351 2842038055 Bacteria 8002051
1034 2842052659 2842045827 Bacteria 8006841
1035 2844315516 2844315083 Bacteria 8138177
1036 2847931221 2847930680 Bacteria 9342022
1037 2847942312 2847939898 Bacteria 8606328
1038 2849083184 2849076700 Bacteria 7039503
1039 2857516382 2857509624 Bacteria 7472071
1040 2857526548 2857524615 Bacteria 6615449
1041 2874591659 2874590934 Bacteria 8299676
1042 2874607913 2874604998 Bacteria 7834745
1043 2874619086 2874612657 Bacteria 8252029
1044 2874621231 2874620515 Bacteria 8290088
1045 2874628629 2874628541 Bacteria 8630250
1046 2874646144 2874645413 Bacteria 8214782
1047 2876769613 2876761206 Bacteria 10111113
1048 2876771760 2876771140 Bacteria 8287509
1049 2876812476 2876808645 Bacteria 8824342
1050 2876819104 2876818435 Bacteria 8274608
1051 2879075649 2879074833 Bacteria 8279565
1052 2879085560 2879083081 Bacteria 8587928
1053 2879105866 2879099564 Bacteria 10442239
1054 2879113340 2879110137 Bacteria 8907982
1055 2879128458 2879127579 Bacteria 8294491
1056 2879143564 2879142872 Bacteria 8267021
1057 2881369253 2881364244 Bacteria 7710352
1058 2881669966 2881665667 Bacteria 8175609
1059 2885369362 2885366525 Bacteria 8326213
1060 2885382814 2885374607 Bacteria 8927485
1061 2885388526 2885383462 Bacteria 9473874
1062 2885418597 2885409591 Bacteria 9235467
1063 2888379430 2888378607 Bacteria 9652610
1064 2888390528 2888388044 Bacteria 7304136
1065 2888420151 2888419890 Bacteria 7857137
1066 2893067204 2893066018 Bacteria 6158120
1067 2903733469 2903727486 Bacteria 8281579
1068 2903758987 2903748898 Bacteria 9972761
1069 2903775494 2903768456 Bacteria 9749579
1070 2904667776 2904666416 Bacteria 8226587
1071 2904691032 2904690495 Bacteria 9412302
1072 2904716357 2904711408 Bacteria 9771557
1073 2906608605 2906602504 Bacteria 8295279
1074 2906613603
1075 2906628536 2906626472 Bacteria 8826946
1076 2906641607 2906635258 Bacteria 8601019
1077 2906652294 2906643746 Bacteria 8722424
1078 2906668134 2906660503 Bacteria 8595048
1079 2908747624 2908739725 Bacteria 8628932
1080 2908757090 2908756301 Bacteria 8864324
1081 2908776030 2908775508 Bacteria 8092255
1082 2919073632 2919073203 Bacteria 6531949
1083 2922363180 2922361189 Bacteria 7436256
1084 2922369416
1085 2922388515 2922386360 Bacteria 7017218
1086 2922398146 2922393267 Bacteria 8285685
1087 2922434039
1088 2929618756 2929615660 Bacteria 9193770
1089 2929628559 2929624759 Bacteria 9339455
1090 2932790938 2932784394 Bacteria 9704911
1091 2932794171 2932794094 Bacteria 7915132
1092 2932812011 2932809354 Bacteria 9135765
1093 2932825538 2932818245 Bacteria 9955613
1094 2932833654 2932828146 Bacteria 9745859
1095 2933580534 2933577622 Bacteria 9116884
1096 2935615548 2935608549 Bacteria 8203142
1097 2935623180 2935616580 Bacteria 9032984
1098 2935636071 2935630451 Bacteria 8169952
1099 2935644255 2935638405 Bacteria 10015038
1100 2935654478 2935648319 Bacteria 8801166
1101 2935663358 2935656913 Bacteria 8965014
1102 2935672163 2935665750 Bacteria 9571747
1103 2935679314 2935675223 Bacteria 9928132
1104 2935686557 2935684952 Bacteria 9590419
1105 2935700340 2935694250 Bacteria 9291695
1106 2935710288 2935703347 Bacteria 10242284
1107 2935716245 2935713505 Bacteria 9608509
1108 2935723631 2935722832 Bacteria 9608746
1109 2935735186 2935732158 Bacteria 9706831
1110 2935744023 2935741537 Bacteria 9707219
1111 2935752523 2935750917 Bacteria 9590372
1112 2935763345 2935760218 Bacteria 9817913
1113 2935772892 2935769743 Bacteria 7878163
1114 2935783318 2935777560 Bacteria 8077691
1115 2935788120 2935785616 Bacteria 7962367
1116 2935796304 2935793552 Bacteria 8012592
1117 2935808279 2935801545 Bacteria 9301974
1118 2935816110 2935810662 Bacteria 9401221
1119 2935825651 2935819856 Bacteria 8261050
1120 2935833501 2935827899 Bacteria 10038562
1121 2935844454 2935837841 Bacteria 9454360
1122 2935853415 2935847175 Bacteria 8228321
1123 2935861428 2935855204 Bacteria 9035059
1124 2935869547 2935864058 Bacteria 9784707
1125 2935879876 2935873716 Bacteria 9632195
1126 2935889198 2935883170 Bacteria 7964738
1127 2935915017 2935908558 Bacteria 8568796
1128 2935918865 2935916978 Bacteria 9113783
1129 2935931418 2935926038 Bacteria 8601059
1130 2935940015 2935934488 Bacteria 8602579
1131 2935947638 2935942939 Bacteria 8599779
1132 2935956409 2935951376 Bacteria 8602333
1133 2935966748 2935959822 Bacteria 7869783
1134 2935973203 2935967501 Bacteria 8603075
1135 2935990095 2935984226 Bacteria 8302647
1136 2935997901 2935992306 Bacteria 9802711
1137 2936008834 2936002035 Bacteria 9362176
1138 2936017483 2936011229 Bacteria 8801034
1139 2936026016 2936019824 Bacteria 8804134
1140 2936034858 2936028420 Bacteria 8965941
1141 2936041115 2936037263 Bacteria 9446081
1142 2936052884 2936046547 Bacteria 8903709
1143 2936060257 2936055302 Bacteria 8785755
1144 2940558436 2940556831 Bacteria 9590747
1145 2941512625 2941507105 Bacteria 8166816
1146 2941520537 2941515067 Bacteria 8166720
1147 2941528551 2941523033 Bacteria 8169134
1148 2941535370 2941531003 Bacteria 7653939
1149 2941543373 2941538514 Bacteria 9402094
1150 3005475246 3005474847 Bacteria 9259049
1151 3005486703 3005483717 Bacteria 7877331
1152 3005509008 3005506211 Bacteria 6943378
1153 3005594107 3005587118 Bacteria 7794411
1154 3005595206 3005594810 Bacteria 8716512
1155 3005711149 3005710791 Bacteria 7622528
1156 8006931949 8006926726 Bacteria 6749210
1157 8006936031 8006933436 Bacteria 10410654
1158 8006967609 8006964411 Bacteria 8966052
1159 8006975845 8006973647 Bacteria 10679141
1160 8006991078 8006984368 Bacteria 9651211
1161 8007000408 8006994254 Bacteria 8309700
1162 8016518021 8016511872 Bacteria 9921665
1163 8016526299 8016522445 Bacteria 8156687
1164 8016531360 8016530956 Bacteria 8155261
1165 8016544575 8016539877 Bacteria 8155419
1166 8016557501 8016548790 Bacteria 8155074
1167 8016565857 8016557553 Bacteria 8154380
1168 8016569626 8016566248 Bacteria 8158151
1169 8016582235 8016575299 Bacteria 8154085
1170 8016586265 8016583857 Bacteria 10421953
1171 8016603456 8016595262 Bacteria 8149947
1172 8016606397 8016603502 Bacteria 8731218
1173 8016618302 8016613128 Bacteria 8794220
1174 8016622951 8016622563 Bacteria 7999408
1175 8016635454 8016630954 Bacteria 9217207
1176 8017058622 8017057580 Bacteria 10023680
1177 8019531194 8019530166 Bacteria 8155624
1178 8019540359 8019538911 Bacteria 7872763
1179 8019549954 8019547302 Bacteria 7996444
1180 8019562623 8019555841 Bacteria 9642137
1181 8019572701 8019565922 Bacteria 9639779
1182 8019577037 8019576017 Bacteria 10049540
1183 8019595104 8019586578 Bacteria 10212056
1184 8019606636 8019597564 Bacteria 10041141
1185 8019611875 8019608314 Bacteria 10042931
1186 8019629964 8019629233 Bacteria 8687553
1187 8019640643 8019638758 Bacteria 9062356
1188 8019652310 8019648815 Bacteria 10014479
1189 8019666804 8019659431 Bacteria 8577854
1190 8019676562 8019668869 Bacteria 8791617
1191 8019679428 8019678201 Bacteria 8863603
1192 8019696077 8019687851 Bacteria 8712826
1193 8055742605 8055742211 Bacteria 9226248
1194 8056676112 8056673599 Bacteria 7871253
1195 8056682914 8056681323 Bacteria 8472857
1196 8056691117 8056689827 Bacteria 6712655
1197 8056971463 8056967851 Bacteria 9038162
1198 Ga0068862_100168346
1199 JGI24737J22298_10014205
1200 JGI25406J46586_10045805
1201 JGI25153J46596_10006802
1202 JGI25153J46596_10011847
1203 JGI25153J46596_10015051
1204 JGI25153J46596_10015527
1205 JGI25160J50197_1012785
1206 JGI25404J52841_10005838
1207 JGI25404J52841_10017706
1208 JGI25404J52841_10018823
1209 Ga0055543_1014573
1210 Ga0065165_1004935
1211 Ga0065165_1005401
1212 Ga0065165_1021918
1213 Ga0070683_100047414
1214 Ga0070683_100120003
1215 Ga0070670_100183742
1216 Ga0070680_100053553
1217 Ga0070680_100114431
1218 Ga0070680_100370426
1219 Ga0070689_100271724
1220 Ga0070691_10115497
1221 Ga0070668_100031220
1222 Ga0070668_100052517
1223 Ga0070673_100352065
1224 Ga0070709_10000820
1225 Ga0070709_10007668
1226 Ga0070714_100011934
1227 Ga0070714_100025834
1228 Ga0070714_100034248
1229 Ga0070714_100062901
1230 Ga0070714_100079305
1231 Ga0070713_100003576
1232 Ga0070713_100047748
1233 Ga0070713_100081426
1234 Ga0070710_10000802
1235 Ga0070710_10001532
1236 Ga0070711_100009673
1237 Ga0070711_100012226
1238 Ga0070711_100012351
1239 Ga0070711_100158534
1240 Ga0070663_100032201
1241 Ga0070663_100045514
1242 Ga0070663_100071628
1243 Ga0070663_100085037
1244 Ga0070663_100156535
1245 Ga0070663_100175865
1246 Ga0070663_100184959
1247 Ga0070663_100366543
1248 Ga0070678_100263059
1249 Ga0070681_10001077
1250 Ga0070681_10028258
1251 Ga0070707_100149757
1252 Ga0070698_100090319
1253 Ga0070698_100264821
1254 Ga0070699_100359358
1255 Ga0070679_100002400
1256 Ga0070679_100009606
1257 Ga0070679_100085678
1258 Ga0070679_100109961
1259 Ga0070679_100135439
1260 Ga0070679_100158674
1261 Ga0070684_100025298
1262 Ga0068853_100031608
1263 Ga0068853_100045931
1264 Ga0068853_100048615
1265 Ga0068853_100068200
1266 Ga0068853_100273595
1267 Ga0070672_100135179
1268 Ga0070665_100029471
1269 Ga0070665_100031667
1270 Ga0070665_100065669
1271 Ga0070665_100081254
1272 Ga0070665_100104376
1273 Ga0070665_100109625
1274 Ga0068855_100037045
1275 Ga0068855_100060155
1276 Ga0068855_100063458
1277 Ga0068855_100378058
1278 Ga0070664_100283958
1279 Ga0070664_100481054
1280 Ga0068857_100001037
1281 Ga0068857_100025105
1282 Ga0068857_100033794
1283 Ga0068857_100300707
1284 Ga0068857_100461448
1285 Ga0068854_100034116
1286 Ga0068854_100138437
1287 Ga0068856_100000883
1288 Ga0068856_100142760
1289 Ga0068856_100258285
1290 Ga0068856_100260458
1291 Ga0070702_100137203
1292 Ga0068852_100094545
1293 Ga0068859_100047861
1294 Ga0068864_100072570
1295 Ga0068851_10000558
1296 Ga0068870_10135604
1297 Ga0068858_100495047
1298 Ga0068860_100000477
1299 Ga0068860_100209710
1300 Ga0068860_100289839
1301 Ga0081455_10002724
1302 Ga0081455_10007370
1303 Ga0081455_10042159
1304 Ga0081540_1003488
1305 Ga0081540_1007876
1306 Ga0081540_1008854
1307 Ga0081540_1014559
1308 Ga0081540_1020591
1309 Ga0081540_1029453
1310 Ga0081540_1033178
1311 Ga0081540_1041232
1312 Ga0081540_1042419
1313 Ga0081540_1049844
1314 Ga0081539_10000265
1315 Ga0081539_10000371
1316 Ga0081539_10043985
1317 Ga0081539_10085002
1318 Ga0070717_10016786
1319 Ga0070717_10061429
1320 Ga0075365_10008318
1321 Ga0075365_10066442
1322 Ga0075365_10067630
1323 Ga0075365_10109412
1324 Ga0075368_10002496
1325 Ga0075363_100004174
1326 Ga0075363_100028319
1327 Ga0075364_10058436
1328 Ga0070715_10000275
1329 Ga0070716_100019113
1330 Ga0070712_100005859
1331 Ga0070712_100078337
1332 Ga0075367_10010418
1333 Ga0075367_10087546
1334 Ga0075369_10022548
1335 Ga0075369_10022934
1336 Ga0075369_10047007
1337 Ga0075369_10101802
1338 Ga0075366_10017520
1339 Ga0075370_10010551
1340 Ga0075370_10102371
1341 Ga0075370_10127604
1342 Ga0075434_100107896
1343 Ga0068865_100068195
1344 Ga0068865_100073289
1345 Ga0068865_100082031
1346 Ga0097620_100047862
1347 Ga0099824_1010644
1348 Ga0099824_1012314
1349 Ga0099822_1012672
1350 Ga0099823_1023025
1351 Ga0075435_100053972
1352 Ga0099794_10029658
1353 Ga0099794_10093906
1354 Ga0099794_10122178
1355 Ga0105240_10002459
1356 Ga0105240_10012773
1357 Ga0105240_10014356
1358 Ga0105240_10075561
1359 Ga0105240_10088443
1360 Ga0105240_10171590
1361 Ga0105240_10211465
1362 Ga0105240_10409511
1363 Ga0105247_10099706
1364 Ga0105241_10000249
1365 Ga0105241_10067677
1366 Ga0105241_10427802
1367 Ga0105248_10126874
1368 Ga0105248_10173518
1369 Ga0105248_10294575
1370 Ga0105237_10017086
1371 Ga0105237_10050524
1372 Ga0105237_10094994
1373 Ga0105237_10130560
1374 Ga0105237_10264973
1375 Ga0105237_10399913
1376 Ga0105237_10473948
1377 Ga0105238_10014511
1378 Ga0105238_10038587
1379 Ga0105238_10186210
1380 Ga0105239_10047808
1381 Ga0105239_10096944
1382 Ga0105239_10170906
1383 Ga0105239_10171641
1384 Ga0105239_10297063
1385 Ga0105239_10334097
1386 Ga0105239_10347557
1387 Ga0105239_10481814
1388 Ga0105239_10511517
1389 Ga0105246_10059630
1390 Ga0105246_10286503
1391 Ga0157370_10365836
1392 Ga0157369_10040528
1393 Ga0157369_10128793
1394 Ga0157369_10331885
1395 Ga0157374_10356302
1396 Ga0157378_10087681
1397 Ga0157372_10072119
1398 Ga0157372_10448821
1399 Ga0157372_10537379
1400 Ga0157375_10015617
1401 Ga0157375_10364017
1402 Ga0163163_10018908
1403 Ga0157380_10053334
1404 Ga0157380_10707464
1405 Ga0157379_10041002
1406 Ga0157379_10430626
1407 Ga0163161_10100976
1408 Ga0163161_10196097
1409 Ga0163161_10241499
1410 Ga0214544_1000056
1411 Ga0214542_1000071
1412 Ga0214545_1000033
1413 Ga0214543_1000105
1414 Ga0213874_10047511
1415 Ga0213876_10002330
1416 Ga0213875_10000033
1417 Ga0209563_102230
1418 Ga0209677_102647
1419 Ga0209148_1000295
1420 Ga0209233_1003626
1421 Ga0209233_1011983
1422 Ga0209455_1005746
1423 Ga0209564_1006069
1424 Ga0209564_1014353
1425 Ga0209758_1000069
1426 Ga0209758_1001918
1427 Ga0209758_1002874
1428 Ga0209758_1004128
1429 Ga0209758_1004293
1430 Ga0209758_1014150
1431 Ga0209758_1020420
1432 Ga0209256_1004477
1433 Ga0207426_1002173
1434 Ga0207426_1007252
1435 Ga0207426_1007538
1436 Ga0207426_1022846
1437 Ga0207426_1034587
1438 Ga0209257_1011512
1439 Ga0209257_1022140
1440 Ga0207697_10070939
1441 Ga0207692_10000565
1442 Ga0207692_10003710
1443 Ga0207692_10062096
1444 Ga0207710_10030120
1445 Ga0207710_10052566
1446 Ga0207688_10039975
1447 Ga0207688_10160901
1448 Ga0207647_10009887
1449 Ga0207647_10015369
1450 Ga0207699_10000907
1451 Ga0207699_10017853
1452 Ga0207699_10018645
1453 Ga0207705_10150446
1454 Ga0207705_10292620
1455 Ga0207684_10283200
1456 Ga0207654_10000083
1457 Ga0207654_10037513
1458 Ga0207654_10037960
1459 Ga0207654_10046406
1460 Ga0207707_10001947
1461 Ga0207707_10007389
1462 Ga0207707_10244782
1463 Ga0207695_10000148
1464 Ga0207695_10000387
1465 Ga0207695_10025135
1466 Ga0207695_10060768
1467 Ga0207695_10168101
1468 Ga0207671_10003051
1469 Ga0207671_10077659
1470 Ga0207671_10215551
1471 Ga0207693_10001168
1472 Ga0207693_10010075
1473 Ga0207693_10035225
1474 Ga0207663_10004460
1475 Ga0207663_10004693
1476 Ga0207663_10019599
1477 Ga0207660_10042346
1478 Ga0207660_10196839
1479 Ga0207660_10273954
1480 Ga0207657_10009668
1481 Ga0207657_10024873
1482 Ga0207657_10064842
1483 Ga0207652_10014863
1484 Ga0207652_10041398
1485 Ga0207652_10175359
1486 Ga0207652_10188003
1487 Ga0207694_10000121
1488 Ga0207650_10143320
1489 Ga0207650_10285702
1490 Ga0207700_10021126
1491 Ga0207664_10012301
1492 Ga0207664_10016162
1493 Ga0207664_10063975
1494 Ga0207664_10081345
1495 Ga0207664_10107642
1496 Ga0207664_10182850
1497 Ga0207664_10203057
1498 Ga0207644_10054095
1499 Ga0207644_10147990
1500 Ga0207644_10282042
1501 Ga0207706_10321970
1502 Ga0207709_10007306
1503 Ga0207704_10025225
1504 Ga0207665_10000883
1505 Ga0207665_10002000
1506 Ga0207665_10182091
1507 Ga0207691_10046534
1508 Ga0207691_10115601
1509 Ga0207691_10120454
1510 Ga0207661_10002867
1511 Ga0207661_10037877
1512 Ga0207661_10297503
1513 Ga0207679_10161499
1514 Ga0207679_10279429
1515 Ga0207667_10099646
1516 Ga0207667_10106489
1517 Ga0207667_10113600
1518 Ga0207667_10145540
1519 Ga0207667_10293822
1520 Ga0207667_10320014
1521 Ga0207712_10170967
1522 Ga0207668_10055636
1523 Ga0207668_10071498
1524 Ga0207668_10089385
1525 Ga0207668_10134074
1526 Ga0207668_10201416
1527 Ga0207668_10208465
1528 Ga0207640_10055768
1529 Ga0207640_10111808
1530 Ga0207677_10109413
1531 Ga0207639_10105577
1532 Ga0207639_10105616
1533 Ga0207639_10273504
1534 Ga0207678_10007286
1535 Ga0207678_10023772
1536 Ga0207678_10030943
1537 Ga0207678_10049177
1538 Ga0207678_10053564
1539 Ga0207678_10095444
1540 Ga0207678_10178177
1541 Ga0207678_10411329
1542 Ga0207702_10000004
1543 Ga0207702_10000318
1544 Ga0207702_10512317
1545 Ga0207641_10354695
1546 Ga0207648_10111460
1547 Ga0207676_10142898
1548 Ga0207676_10280626
1549 Ga0207674_10005964
1550 Ga0207674_10006033
1551 Ga0207674_10012348
1552 Ga0207674_10108974
1553 Ga0207674_10336032
1554 Ga0207675_100026733
1555 Ga0207675_100221006
1556 Ga0207675_100317294
1557 Ga0207683_10063270
1558 Ga0207683_10175358
1559 Ga0207698_10128272
1560 Ga0207698_10263227
1561 Ga0209389_1000157
1562 Ga0209389_1000349
1563 Ga0209589_1000035
1564 Ga0209589_1003843
1565 Ga0209489_100079
1566 Ga0209489_101111
1567 Ga0209489_103974
1568 Ga0209700_100011
1569 Ga0209700_100077
1570 Ga0268266_10001236
1571 Ga0268266_10031941
1572 Ga0268266_10104133
1573 Ga0268266_10209638
1574 Ga0268265_10113357
1575 Ga0268265_10367284
1576 Ga0268264_10000062
1577 Ga0268264_10222966
1578 Ga0307517_10000175
1579 Ga0307517_10197719
1580 Ga0307515_10034911
1581 Ga0307515_10092532
1582 Ga0307515_10191196
1583 Ga0307511_10070832
1584 Ga0265330_10054095
1585 Ga0265332_10003278
1586 Ga0265332_10007021
1587 Ga0265328_10016314
1588 Ga0265325_10065075
1589 Ga0265340_10002509
1590 Ga0265339_10000738
1591 Ga0265339_10015187
1592 Ga0265339_10159401
1593 Ga0307513_10189506
1594 Ga0307509_10006160
1595 Ga0307509_10262543
1596 Ga0307509_10315318
1597 Ga0307508_10000045
1598 Ga0307508_10185394
1599 Ga0265314_10026793
1600 Ga0265342_10000789
1601 Ga0265342_10005212
1602 Ga0265342_10046291
1603 Ga0307516_10045874
1604 Ga0307516_10078174
1605 Ga0307516_10146981
1606 Ga0307406_10084190
1607 Ga0307412_10052998
1608 Ga0307416_100482080
1609 Ga0307415_100035854
1610 Ga0307507_10065520
1611 Ga0307510_10005941
1612 Ga0307510_10020148
1613 Ga0307510_10240881
1614 Ga0315911_1000008
1615 Ga0373934_0022652
1616 Ga0373940_0063221
1617 Ga0373923_0002779
1618 Ga0373923_0026195
1619 Ga0373923_0063281
1620 Ga0373936_0053633
1621 Ga0373945_0013723
1622 Ga0373954_0008952
1623 Ga0373954_0083214
1624 Ga0373956_0004385
1625 Ga0373956_0035419
1626 Ga0373957_0038777
1627 Ga0373943_0019810
1628 Ga0373943_0030555
1629 Ga0373946_0009807
1630 Ga0373955_0002044
1631 Ga0373955_0021308
1632 Ga0373924_0009573
1633 Ga0373924_0029224
1634 Ga0373924_0052734
1635 Ga0373931_0005215
1636 Ga0373935_0001683
1637 Ga0373935_0110751
1638 Ga0373927_0001064
1639 Ga0373927_0003727
1640 Ga0373927_0016324
1641 Ga0373927_0035670
1642 Ga0373927_0055863
1643 Ga0373927_0106543
1644 Ga0373933_0000068
1645 Ga0373933_0009248
1646 Ga0373933_0118519
1647 Ga0373947_0006319
1648 Ga0373947_0008648
1649 Ga0373947_0103908
1650 Ga0373947_0126323
1651 Ga0373947_0147077
1652 Ga0373937_0017394
1653 Ga0373937_0022449
1654 Ga0373937_0029705
1655 Ga0373937_0065670
1656 Ga0373937_0188107
1657 Ga0373925_0007638
1658 Ga0373925_0093233
1659 Ga0373925_0113305
1660 Ga0373925_0163374
1661 Ga0395899_0069720
1662 Ga0395900_0020656
1663 Ga0395900_0148706
1664 Ga0395900_0437877
1665 Ga0395900_0445273
1666 Ga0395898_0050745
1667 Ga0395898_0257194
1668 Ga0395898_0373450
1669 Ga0395905_0001948
1670 Ga0395905_0048386
1671 Ga0436364_0738225
1672 Ga0436364_1338082
1673 Ga0395901_0089489
1674 Ga0395901_0199025
1675 Ga0395901_0235797
1676 Ga0400483_063134
1677 Ga0400483_064073
1678 Ga0400483_170476
1679 Ga0400483_292171
1680 Ga0436363_0740465
1681 Ga0466969_0019790
1682 Ga0466969_0058661
1683 Ga0466972_0000299
1684 Ga0466972_0023246
1685 Ga0466966_0003365
1686 Ga0466961_0000709
1687 Ga0466963_0046772
1688 Ga0466957_0160598
1689 Ga0466959_0027413
1690 Ga0466959_0040311
1691 Ga0466958_0225078
1692 Ga0466967_0078628
1693 Ga0466967_0081393
1694 Ga0466967_0179066
1695 Ga0495592_0020736
1696 Ga0495592_0257244
1697 Ga0495603_0003128
1698 Ga0495603_0003243
1699 Ga0495603_0003728
1700 Ga0495603_0012063
1701 Ga0495629_0001107
1702 Ga0495629_0002800
1703 Ga0495629_0012976
1704 Ga0495629_0055191
1705 Ga0495629_0074497
1706 Ga0495638_0003712
1707 Ga0495638_0084885
1708 Ga0495641_0004022
1709 Ga0495641_0079333
1710 Ga0495641_0080734
1711 Ga0495651_0003711
1712 Ga0495651_0009193
1713 Ga0495651_0047740
1714 Ga0495651_0120736
1715 Ga0495653_0019489
1716 Ga0495653_0028503
1717 Ga0495653_0102842
1718 Ga0495653_0109292
1719 Ga0495650_0046873
1720 Ga0495580_0001546
1721 Ga0495580_0001981
1722 Ga0495580_0090322
1723 Ga0495605_0073665
1724 Ga0495639_0000072
1725 Ga0495662_0000510
1726 Ga0495662_0075704
1727 Ga0495664_0001402
1728 Ga0495664_0006292
1729 Ga0495664_0043294
1730 Ga0495664_0058400
1731 Ga0495585_0047603
1732 Ga0495585_0061098
1733 Ga0495585_0093709
1734 Ga0495594_0000467
1735 Ga0495594_0066615
1736 Ga0495594_0197900
1737 Ga0495583_0109755
1738 Ga0495606_0000831
1739 Ga0495606_0032054
1740 Ga0495608_0008312
1741 Ga0495608_0082821
1742 Ga0495608_0097634
1743 Ga0495618_0010639
1744 Ga0495618_0088763
1745 Ga0495620_0044570
1746 Ga0495620_0073373
1747 Ga0495628_0003465
1748 Ga0495628_0084162
1749 Ga0495630_0019769
1750 Ga0495631_0021538
1751 Ga0495631_0069979
1752 Ga0495632_0040436
1753 Ga0495637_0079670
1754 Ga0495643_0042004
1755 Ga0495644_0022119
1756 Ga0495648_0002061
1757 Ga0495648_0061546
1758 Ga0495648_0114593
1759 Ga0495648_0180034
1760 Ga0495666_0085145
1761 Ga0495652_0026176
1762 Ga0495652_0029317
1763 Ga0495652_0033141
1764 Ga0495652_0038958
1765 Ga0495652_0064423
1766 Ga0495652_0144035
1767 Ga0495654_0011888
1768 Ga0495665_0000128
1769 Ga0495665_0021707
1770 Ga0495640_0010120
1771 Ga0495640_0025681
1772 Ga0495640_0061431
1773 Ga0495640_0065803
1774 Ga0495587_0017095
1775 Ga0495587_0086702
1776 Ga0495645_0064764
1777 Ga0495622_0005892
1778 Ga0495622_0014876
1779 Ga0495622_0016799
1780 Ga0495622_0088499
1781 Ga0495622_0100094
1782 Ga0495633_0052514
1783 Ga0495667_0005488
1784 Ga0495667_0036453
1785 Ga0495656_0002973
1786 Ga0495668_0028813
1787 Ga0495668_0106411
1788 Ga0495634_0004246
1789 Ga0495634_0034915
1790 Ga0495634_0063611
1791 Ga0495625_0090229
1792 Ga0495625_0201733
1793 Ga0495635_0000564
1794 Ga0495635_0001868
1795 Ga0495635_0019084
1796 Ga0495635_0028708
1797 Ga0495635_0101694
1798 Ga0495635_0105019
1799 Ga0495659_0045116
1800 Ga0495661_0087811
1801 Ga0495588_0007923
1802 Ga0495588_0009177
1803 Ga0495657_0007182
1804 Ga0495657_0033568
1805 Ga0495657_0100805
1806 Ga0495599_0014153
1807 Ga0495599_0020349
1808 Ga0495599_0042374
1809 Ga0495599_0219207
1810 Ga0495623_0020666
1811 Ga0495623_0034663
1812 Ga0495646_0003182
1813 Ga0495646_0034504
1814 Ga0495646_0177965
1815 Ga0495647_0002893
1816 Ga0495658_0000707
1817 Ga0495669_0006578
1818 Ga0495669_0030472
1819 Ga0495669_0041240
1820 Ga0495613_0001986
1821 Ga0495613_0031628
1822 Ga0495613_0070841
1823 Ga0495613_0214027
1824 Ga0495613_0229984
1825 Ga0495624_0007718
1826 Ga0495624_0027338
1827 Ga0495670_0005603
1828 Ga0495670_0092874
1829 Ga0495589_0100633
1830 Ga0495600_0016480
1831 Ga0495600_0046117
1832 Ga0495581_0000030
1833 Ga0495581_0080105
1834 Ga0495581_0195670
1835 Ga0495604_0001746
1836 Ga0495604_0006243
1837 Ga0495604_0089587
1838 Ga0495604_0147504
1839 Ga0495604_0250564
1840 Ga0495674_0024013
1841 Ga0495674_0167017
1842 Ga0495674_0202283
1843 Ga0495672_0034357
1844 Ga0495676_0030732
1845 Ga0495676_0081675
1846 Ga0495676_0086878
1847 Ga0495680_0000836
1848 Ga0495680_0015081
1849 Ga0495680_0038283
1850 Ga0495683_0027504
1851 Ga0495687_051007
1852 Ga0495675_0005364
1853 Ga0495675_0017105
1854 Ga0495675_0234433
1855 Ga0495677_0032871
1856 Ga0495673_0062965
1857 Ga0495681_0058559
1858 Ga0495684_0004347
1859 Ga0495684_0005411
1860 Ga0495684_0006597
1861 Ga0495684_0037949
1862 Ga0495684_0121271
1863 Ga0495686_0028173
1864 Ga0495686_0064789
1865 Ga0495686_0149767
1866 Ga0495593_0000470
1867 Ga0495593_0009200
1868 Ga0495593_0013405
1869 Ga0495593_0093144
1870 Ga0495602_0013506
1871 Ga0495602_0022610
1872 Ga0495602_0190918
1873 Ga0495614_0124296
1874 Ga0496100_0014735
1875 Ga0496100_0046014
1876 Ga0496100_0130453
1877 Ga0496100_0165264
1878 Ga0496100_0245958
1879 Ga0496101_0132261
1880 Ga0496102_0011723
1881 Ga0496102_0039049
1882 Ga0496102_0195999
1883 Ga0496102_0219478
1884 Ga0496102_0271445
1885 Ga0496102_0309961
1886 Ga0496102_0321862
1887 Ga0496102_0368813
1888 Ga0496102_0432553
1889 Ga0496103_0207953
1890 Ga0496104_0004462
1891 Ga0496104_0045714
1892 Ga0496104_0062767
1893 Ga0496104_0173540
1894 Ga0496105_0032276
1895 Ga0496105_0032852
1896 Ga0496105_0033675
1897 Ga0496105_0123492
1898 Ga0496105_0188690
1899 Ga0496106_0001644
1900 Ga0496106_0316535
1901 Ga0496106_0334013
1902 Ga0496107_0003260
1903 Ga0496107_0033433
1904 Ga0496107_0037483
1905 Ga0496107_0095639
1906 Ga0496107_0129244
1907 Ga0496108_0000927
1908 Ga0496108_0062262
1909 Ga0496108_0089483
1910 Ga0496108_0181242
1911 Ga0496108_0188858
1912 Ga0496109_0000229
1913 Ga0496109_0056062
1914 Ga0496109_0075478
1915 Ga0496109_0108977
1916 Ga0496109_0120192
1917 Ga0496109_0208744
1918 Ga0496110_0014360
1919 Ga0496110_0024599
1920 Ga0496110_0049185
1921 Ga0496110_0066266
1922 Ga0496110_0069892
1923 Ga0496110_0198927
1924 Ga0496111_0042267
1925 Ga0496111_0057455
1926 Ga0496111_0145455
1927 Ga0496111_0213188
1928 Ga0496112_0000018
1929 Ga0496112_0001343
1930 Ga0496112_0005116
1931 Ga0496112_0022495
1932 Ga0496112_0036254
1933 Ga0496112_0061280
1934 Ga0496112_0116736
1935 Ga0496112_0204779
1936 Ga0496112_0397946
1937 Ga0496112_0506506
1938 Ga0496113_0025324
1939 Ga0496113_0029007
1940 Ga0496113_0075336
1941 Ga0496113_0080616
1942 Ga0496113_0129483
1943 Ga0496113_0186280
1944 Ga0496113_0408391
1945 Ga0496114_0146649
1946 Ga0496114_0161956
1947 Ga0496114_0481043
1948 Ga0496115_0002846
1949 Ga0496115_0026716
1950 Ga0496115_0062056
1951 Ga0496115_0076405
1952 Ga0496115_0078346
1953 Ga0496115_0251358
1954 Ga0496115_0259353
1955 Ga0496115_0263445
1956 Ga0496115_0398297
1957 Ga0496116_0039933
1958 Ga0496117_0038300
1959 Ga0496117_0070193
1960 Ga0496117_0082976
1961 Ga0496117_0180752
1962 Ga0496118_0021121
1963 Ga0496118_0032376
1964 Ga0496118_0034811
1965 Ga0496118_0036860
1966 Ga0496118_0037063
1967 Ga0496118_0105304
1968 Ga0496119_0013596
1969 Ga0496119_0067395
1970 Ga0496119_0116694
1971 Ga0496119_0132223
1972 Ga0496120_0022973
1973 Ga0496120_0042211
1974 Ga0496120_0056627
1975 Ga0496121_0000278
1976 Ga0496121_0000654
1977 Ga0496121_0001257
1978 Ga0496121_0004075
1979 Ga0496121_0010674
1980 Ga0496121_0018630
1981 Ga0496121_0062278
1982 Ga0496121_0068167
1983 Ga0496121_0075822
1984 Ga0496121_0109197
1985 Ga0496121_0122183
1986 Ga0496121_0164458
1987 Ga0496121_0215171
1988 Ga0496124_0003799
1989 Ga0496124_0175801
1990 Ga0496125_0003929
1991 Ga0496125_0050458
1992 Ga0496125_0063726
1993 Ga0496125_0076285
1994 Ga0496125_0089528
1995 Ga0496125_0126663
1996 Ga0496125_0175673
1997 Ga0496126_0005056
1998 Ga0496126_0006689
1999 Ga0496126_0013259
2000 Ga0496126_0014598
2001 Ga0496126_0021739
2002 Ga0496126_0038464
2003 Ga0496126_0048899
2004 Ga0496126_0050733
2005 Ga0496126_0062031
2006 Ga0496126_0073376
2007 Ga0496126_0077746
2008 Ga0496126_0126206
2009 Ga0496126_0145128
2010 Ga0496126_0253413
2011 Ga0495682_0031941
2012 Ga0501031_0000207
2013 Ga0501031_0169893
2014 Ga0501032_0000252
2015 Ga0501032_0238727
2016 Ga0501033_0000082
2017 Ga0501034_0000198
2018 Ga0501034_0076935
2019 Ga0501034_0107782
2020 Ga0501034_0164294
2021 Ga0501036_0001281
2022 Ga0501037_0000050
2023 Ga0501037_0013075
2024 Ga0501037_0037537
2025 Ga0501037_0237735
2026 Ga0501038_0000538
2027 Ga0501038_0000630
2028 Ga0501038_0021325
2029 Ga0501038_0045587
2030 Ga0501039_0000366
2031 Ga0501042_0017539
2032 Ga0501043_0002344
2033 Ga0501043_0027073
2034 Ga0501043_0128729
2035 Ga0501046_0149717
2036 Ga0501046_0279694
2037 Ga0501047_0000131
2038 Ga0501047_0196973
2039 Ga0501047_0248514
2040 Ga0501048_0000531
2041 Ga0501067_0057575
2042 Ga0501068_0011209
2043 Ga0501069_0001211
2044 Ga0501070_0097394
2045 Ga0501070_0199826
2046 Ga0501070_0358088
2047 Ga0501072_0000378
2048 Ga0501073_0029767
2049 Ga0501074_0000141
2050 Ga0501074_0018479
2051 Ga0501074_0051890
2052 Ga0501079_0036554
2053 Ga0501080_0019207
2054 Ga0501080_0146335
2055 Ga0501083_0000341
2056 Ga0501035_0000123
2057 Ga0501035_0035937
2058 Ga0501035_0152390
2059 Ga0501035_0193578
2060 Ga0501035_0202926
2061 Ga0501035_0225006
2062 Ga0501035_0339832
2063 Ga0501044_0000100
2064 Ga0501044_0039767
2065 Ga0501044_0079043
2066 Ga0501044_0093655
2067 Ga0501044_0102829
2068 Ga0501044_0150128
2069 Ga0501045_0016159
2070 Ga0501045_0278609
2071 nmdc:mga03n38_3346_c1
2072 nmdc:mga03n38_57171_c1
2073 nmdc:mga00v17_134825_c1
2074 nmdc:mga00v17_21851_c1
2075 nmdc:mga00v17_246680_c1
2076 nmdc:mga00v17_58165_c1
2077 nmdc:mga0yw44_25265_c1
2078 nmdc:mga0yw44_26768_c1
2079 nmdc:mga0yw44_32707_c1
2080 nmdc:mga0yw44_6182_c1
2081 nmdc:mga0yw44_90481_c1
2082 nmdc:mga0k408_125572_c1
2083 nmdc:mga0k408_26360_c1
2084 nmdc:mga06z11_25454_c1
2085 nmdc:mga06z11_30785_c1
2086 nmdc:mga07m45_117037_c1
2087 nmdc:mga07m45_14953_c1
2088 nmdc:mga07m45_3103_c1
2089 nmdc:mga08y16_363177_c1
2090 nmdc:mga0rr50_363005_c1
2091 nmdc:mga0sz30_32825_c1
2092 nmdc:mga0sz30_5173_c1
2093 Ga0495601_0032816
2094 Ga0495612_0013345
2095 Ga0495612_0023451
2096 Ga0500635_0005769
2097 Ga0495595_0001147
2098 Ga0495595_0101420
2099 Ga0495619_0050947
2100 Ga0500578_0029277
2101 Ga0500643_000076
2102 Ga0500643_044167
2103 Ga0500647_0008721
2104 Ga0500583_0031974
2105 Ga0500651_0013489
2106 Ga0500651_0044971
2107 Ga0500651_0168887
2108 Ga0500566_0000107
2109 Ga0500566_0001175
2110 Ga0500566_0003295
2111 Ga0500566_0052170
2112 Ga0500640_022898
2113 Ga0500641_0011398
2114 Ga0500641_0037171
2115 Ga0500650_0047668
2116 Ga0500650_0070051
2117 Ga0500556_0000081
2118 Ga0500557_000021
2119 Ga0500569_001078
2120 Ga0500572_036834
2121 Ga0500592_010490
2122 Ga0500595_001968
2123 Ga0500595_002941
2124 Ga0500595_003169
2125 Ga0500595_003647
2126 Ga0500595_038411
2127 Ga0500597_096638
2128 Ga0500608_000949
2129 Ga0500608_103597
2130 Ga0500618_013897
2131 Ga0500642_0000042
2132 Ga0500642_0000225
2133 Ga0500652_000365
2134 Ga0500658_0013217
2135 Ga0500559_0000106
2136 Ga0500559_0022835
2137 Ga0500559_0067344
2138 Ga0500559_0088352
2139 Ga0500568_0015314
2140 Ga0500568_0022805
2141 Ga0500568_0059026
2142 Ga0500577_0007820
2143 Ga0500577_0067911
2144 Ga0500589_052697
2145 Ga0500603_001588
2146 Ga0500604_0013529
2147 Ga0500616_0000227
2148 Ga0500620_001172
2149 Ga0500622_0005478
2150 Ga0500622_0055868
2151 Ga0500634_0045252
2152 Ga0500638_002181
2153 Ga0500638_074317
2154 Ga0500636_0001726
2155 Ga0500636_0007656
2156 Ga0500636_0052999
2157 Ga0500637_0005127
2158 Ga0500637_0069682
2159 Ga0500570_099933
2160 Ga0500625_020193
2161 Ga0500609_001334
2162 Ga0500599_001530
2163 Ga0500601_000261
2164 Ga0501084_0012059
2165 Ga0501084_0152257
2166 Ga0501082_0001776
2167 Ga0466962_0044409
2168 2507505423
2169 2508539309
2170 2508695636
2171 2511399098
2172 2513623953
2173 2513651361
2174 2513659484
2175 2513676289
2176 2513695261
2177 2513718214
2178 2513859409
2179 2513873376
2180 2513888605
2181 2513921583
2182 2514014707
2183 2515627619
2184 2517106307
2185 2517889024
2186 2524441415
2187 2524467040
2188 2524537454
2189 2528853345
2190 2603858352
2191 2617352087
2192 2617373557
2193 2644291067
2194 2671122620
2195 2723841790
2196 2728748458
2197 2745077549
2198 2793062207
2199 2793073670
2200 2793078335
2201 2805920724
2202 2818237828
2203 2824607338
2204 2824616902
2205 2824626393
2206 2824632759
2207 2824643690
2208 2824652316
2209 2824659676
2210 2824669430
2211 2824679222
2212 2824687384
2213 2824695813
2214 2824704179
2215 2824713838
2216 2824723157
2217 2824732513
2218 2824740203
2219 2824751670
2220 2824762565
2221 2824771899
2222 2824780808
2223 2838124668
2224 2841945359
2225 2841952144
2226 2841965373
2227 2841970468
2228 2841981716
2229 2841984997
2230 2842043351
2231 2842052659
2232 2844315516
2233 2847931221
2234 2847942312
2235 2849083184
2236 2857516382
2237 2857526548
2238 2874591659
2239 2874607913
2240 2874619086
2241 2874621231
2242 2874628629
2243 2874646144
2244 2876769613
2245 2876771760
2246 2876812476
2247 2876819104
2248 2879075649
2249 2879085560
2250 2879105866
2251 2879113340
2252 2879128458
2253 2879143564
2254 2881369253
2255 2881669966
2256 2885369362
2257 2885382814
2258 2885388526
2259 2885418597
2260 2888379430
2261 2888390528
2262 2888420151
2263 2893067204
2264 2903733469
2265 2903758987
2266 2903775494
2267 2904667776
2268 2904691032
2269 2904716357
2270 2906608605
2271 2906613603
2272 2906628536
2273 2906641607
2274 2906652294
2275 2906668134
2276 2908747624
2277 2908757090
2278 2908776030
2279 2919073632
2280 2922363180
2281 2922369416
2282 2922388515
2283 2922398146
2284 2922434039
2285 2929618756
2286 2929628559
2287 2932790938
2288 2932794171
2289 2932812011
2290 2932825538
2291 2932833654
2292 2933580534
2293 2935615548
2294 2935623180
2295 2935636071
2296 2935644255
2297 2935654478
2298 2935663358
2299 2935672163
2300 2935679314
2301 2935686557
2302 2935700340
2303 2935710288
2304 2935716245
2305 2935723631
2306 2935735186
2307 2935744023
2308 2935752523
2309 2935763345
2310 2935772892
2311 2935783318
2312 2935788120
2313 2935796304
2314 2935808279
2315 2935816110
2316 2935825651
2317 2935833501
2318 2935844454
2319 2935853415
2320 2935861428
2321 2935869547
2322 2935879876
2323 2935889198
2324 2935915017
2325 2935918865
2326 2935931418
2327 2935940015
2328 2935947638
2329 2935956409
2330 2935966748
2331 2935973203
2332 2935990095
2333 2935997901
2334 2936008834
2335 2936017483
2336 2936026016
2337 2936034858
2338 2936041115
2339 2936052884
2340 2936060257
2341 2940558436
2342 2941512625
2343 2941520537
2344 2941528551
2345 2941535370
2346 2941543373
2347 3005475246
2348 3005486703
2349 3005509008
2350 3005594107
2351 3005595206
2352 3005711149
2353 8006931949
2354 8006936031
2355 8006967609
2356 8006975845
2357 8006991078
2358 8007000408
2359 8016518021
2360 8016526299
2361 8016531360
2362 8016544575
2363 8016557501
2364 8016565857
2365 8016569626
2366 8016582235
2367 8016586265
2368 8016603456
2369 8016606397
2370 8016618302
2371 8016622951
2372 8016635454
2373 8017058622
2374 8019531194
2375 8019540359
2376 8019549954
2377 8019562623
2378 8019572701
2379 8019577037
2380 8019595104
2381 8019606636
2382 8019611875
2383 8019629964
2384 8019640643
2385 8019652310
2386 8019666804
2387 8019676562
2388 8019679428
2389 8019696077
2390 8055742605
2391 8056676112
2392 8056682914
2393 8056691117
2394 8056971463

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

156

357

0.88

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

141

270

0.82

PF13483

Lactamase_B_3

Beta-lactamase superfamily domain

140

344

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3x30-assembly1.cif.gz_A crystal structure of metallo-beta-lactamase from thermotoga maritima 0.8247 65 325
7e3w-assembly1.cif.gz_C metallo beta-lactamase fold protein (camp bound) 0.8234 65 323
3x30-assembly1.cif.gz_A crystal structure of metallo-beta-lactamase from thermotoga maritima 0.8179 65 325
6hrg-assembly1.cif.gz_A structure of igni18, a novel metallo hydrolase from the hyperthermophilic archaeon ignicoccus hospitalis kin4/i 0.8111 64 325
7e3w-assembly1.cif.gz_C metallo beta-lactamase fold protein (camp bound) 0.8102 65 323
ID Description Score Start End Superfamily
af_Q8BH82_99_394_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9357 59 325 3.60.15.10
af_Q55BC7_55_359_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9221 64 325 3.60.15.10
af_A4HVR7_83_395_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9197 65 315 3.60.15.10
af_Q8ILT3_120_417_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.908 39 325 3.60.15.10
af_Q965X7_61_355_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9015 65 323 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A2U0UDD5-F1-model_v4 deleted 0.9699 1 325
AF-A0A2U0UDD5-F1-model_v4 deleted 0.967 1 325
AF-A0A2N3AQU9-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9665 203 321 GO:0005737
AF-A0A6G3XYC2-F1-model_v4 MBL fold metallo-hydrolase 0.965 65 153 GO:0005737
GO:0016787
AF-A0A520FUQ1-F1-model_v4 deleted 0.9619 32 325

Map