F491466

General Info

Members Datasets Scaffolds Average Seq Length
1191 569 1097 122

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0076123|Ga0496100_0076123_1359_1799
Length 146
Sequence LTHVSILTYGPSCQITDTNPKEAIVPVTGPDFISLQATDLDASRAFYEQYLGLVRSQAGPPHAIVFETTPIAFALRDVVTGTDLASAAQPGIGAAIWLHATDVQAIHDALAADGHTIVSAPIDGPFGRTFTFADPDGYHVTLHDRA

Samples

Sample ID Description Type Environment
1 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
2 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
3 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
4 2643221553 Microbacterium sp. Root553 Isolate Unclassified
5 2643221572 Leifsonia sp. Root60 Isolate Unclassified
6 2643221616 Leifsonia sp. Root227 Isolate Unclassified
7 2643221647 Streptomyces sp. Root369 Isolate Unclassified
8 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
9 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
10 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
11 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
12 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
13 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
14 2643221711 Terrabacter sp. Root85 Isolate Unclassified
15 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
16 2739367898 Nocardioides sp. CF479 Isolate Unclassified
17 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
18 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
19 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
20 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
21 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
22 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
23 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
24 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
25 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
26 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
27 2808606394 Promicromonospora sp. C35 Isolate Unclassified
28 2808606448 Streptomyces sp. 193411 Isolate Unclassified
29 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
30 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
31 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
32 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
33 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
34 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
35 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
36 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
37 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
38 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
39 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
40 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
41 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
42 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
43 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
44 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
45 2891562705 Microbispora tritici MT50 Isolate Unclassified
46 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
47 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
48 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
49 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
50 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
51 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
52 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
53 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
54 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
55 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
56 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
57 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
58 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
59 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
60 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
61 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
62 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
63 2928153084 Leifsonia sp. 563 Isolate Unclassified
64 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
65 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
66 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
67 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
68 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
69 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
70 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
71 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
72 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
73 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
74 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
75 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
76 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
77 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
78 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
79 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
80 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
81 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
82 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
83 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
84 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
85 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
86 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
87 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
88 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
89 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
90 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
91 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
92 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
93 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
94 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
95 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
96 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
97 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
98 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
100 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
101 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
102 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
103 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
104 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
105 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
106 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
107 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
108 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
109 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
110 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
111 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
112 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
113 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
114 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
115 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
116 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
117 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
118 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
119 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
120 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
121 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
122 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
123 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
124 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
125 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
126 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
127 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
128 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
129 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
130 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
131 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
132 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
133 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
134 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
135 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
136 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
137 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
138 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
139 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
140 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
141 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
142 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
143 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
144 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
145 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
146 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
147 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
148 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
149 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
150 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
151 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
152 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
153 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
154 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
155 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
156 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
157 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
158 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
159 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
160 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
161 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
162 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
163 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
164 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
165 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
166 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
167 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
168 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
169 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
170 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
171 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
172 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
173 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
174 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
175 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
176 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
177 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
178 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
179 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
180 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
181 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
182 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
183 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
184 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
185 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
186 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
187 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
188 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
189 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
190 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
191 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
192 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
193 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
194 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
195 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
196 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
197 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
198 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
199 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
200 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
201 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
202 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
203 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
204 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
205 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
206 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
207 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
208 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
209 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
210 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
211 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
212 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
213 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
214 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
215 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
216 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
217 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
218 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
219 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
220 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
222 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
228 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
233 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
234 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
295 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
296 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
297 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
301 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
302 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
303 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
304 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
306 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
307 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
308 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
309 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
310 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
311 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
312 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
313 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
314 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
315 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
316 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
317 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
318 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
319 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
320 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
321 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
322 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
323 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
324 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
325 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
326 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
327 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
328 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
329 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
330 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
331 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
332 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
333 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
334 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
335 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
336 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
337 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
338 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
339 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
340 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
341 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
342 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
343 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
344 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
345 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
346 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
347 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
348 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
349 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
350 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
351 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
352 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
353 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
354 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
355 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
356 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
357 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
358 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
359 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
360 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
361 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
362 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
363 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
364 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
365 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
366 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
367 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
368 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
369 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
370 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
371 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
372 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
373 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
374 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
375 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
376 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
377 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
378 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
379 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
380 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
381 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
382 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
383 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
384 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
385 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
386 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
387 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
388 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
389 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
390 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
391 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
392 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
393 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
394 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
395 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
396 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
397 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
398 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
399 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
400 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
401 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
402 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
403 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
404 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
405 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
406 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
407 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
408 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
409 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
410 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
411 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
412 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
413 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
414 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
415 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
416 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
417 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
418 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
419 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
420 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
421 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
422 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
423 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
424 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
425 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
426 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
427 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
428 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
429 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
430 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
431 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
432 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
433 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
434 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
435 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
436 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
437 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
438 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
439 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
440 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
441 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
442 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
443 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
444 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
445 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
446 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
447 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
448 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
449 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
450 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
451 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
452 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
453 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
454 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
455 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
456 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
457 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
458 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
459 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
460 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
461 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
462 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
463 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
464 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
465 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
466 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
467 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
468 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
469 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
470 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
471 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
472 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
473 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
474 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
475 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
476 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
477 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
478 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
479 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
480 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
481 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
482 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
483 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
484 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
485 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
486 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
487 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
488 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
489 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
490 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
491 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
492 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
493 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
494 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
495 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
496 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
497 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
498 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
501 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
502 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
503 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
504 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
505 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
506 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
507 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
508 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
509 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
510 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
511 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
512 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
513 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
514 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
515 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
516 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
517 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
518 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
519 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
520 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
521 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
522 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
523 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
524 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
525 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
526 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
527 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
528 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
529 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
530 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
531 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
532 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
533 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
534 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
535 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
536 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
537 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
538 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
539 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
540 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
541 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
542 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
543 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
544 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
545 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
546 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
547 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
548 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
549 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
550 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
551 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
552 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
553 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
554 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
555 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
556 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
557 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
558 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
559 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
560 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
561 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
562 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
563 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
564 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
565 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
566 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
567 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
568 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
569 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.51
Metatranscriptomes 1.51
Isolates 7.98

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 12.01
Nodule 0.08
Rhizoplane 8.98
Rhizosphere 62.22
Stem 0
Stem Tuber 0
Unclassified 16.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1010536 3300001976 Bacteria 1205
2 JGI24735J21928_10048869 3300002067 Bacteria 1223
3 rootL2_10219826 3300003322 Bacteria 1981
4 rootH1_10035436 3300003316 Bacteria 3249
5 rootH1_10035436 3300003323 Bacteria 1923
6 rootH1_10186625 3300003323 Bacteria 1754
7 Ga0006562J51391_1027142 3300003578 Bacteria 5900
8 Ga0006562J51391_1083918 3300003578 Bacteria 2811
9 Ga0055539_1003713 3300003752 Bacteria 2088
10 Ga0055533_1000002 3300003756 Bacteria 1196393
11 Ga0055532_1006111 3300003758 Bacteria 1632
12 Ga0055525_1000022 3300003759 Bacteria 368755
13 Ga0055527_1000003 3300003760 Bacteria 705001
14 Ga0055542_1000005 3300003762 Bacteria 550280
15 Ga0055529_1000006 3300003763 Bacteria 416978
16 Ga0055540_1001685 3300003792 Bacteria 12748
17 Ga0055540_1012590 3300003792 Bacteria 2644
18 Ga0055541_1001766 3300003841 Bacteria 4534
19 JGI25405J52794_10013514 3300003911 Bacteria 1584
20 Ga0070658_10069021 3300005327 Bacteria 2891
21 Ga0070658_10155907 3300005327 Bacteria 1914
22 Ga0070683_100831485 3300005329 Bacteria 885
23 Ga0070670_100267040 3300005331 Bacteria 1492
24 Ga0070670_100768960 3300005331 Bacteria 869
25 Ga0068869_100093729 3300005334 Bacteria 2263
26 Ga0068869_100199627 3300005334 Bacteria 1576
27 Ga0068869_100348330 3300005334 Bacteria 1207
28 Ga0068869_100593625 3300005334 Bacteria 935
29 Ga0070680_100014073 3300005336 Bacteria 6247
30 Ga0070682_100050528 3300005337 Bacteria 2596
31 Ga0070682_100089350 3300005337 Bacteria 2012
32 Ga0070682_100119829 3300005337 Bacteria 1765
33 Ga0070682_100330123 3300005337 Bacteria 1130
34 Ga0070682_100719045 3300005337 Bacteria 803
35 Ga0068868_100207661 3300005338 Bacteria 1635
36 Ga0068868_100278091 3300005338 Bacteria 1416
37 Ga0068868_101021408 3300005338 Bacteria 757
38 Ga0070660_100184357 3300005339 Bacteria 1690
39 Ga0070660_101876016 3300005339 Bacteria 511
40 Ga0070689_100281940 3300005340 Bacteria 1379
41 Ga0070691_10048526 3300005341 Bacteria 2021
42 Ga0070661_100064464 3300005344 Bacteria 2692
43 Ga0070692_10023689 3300005345 Bacteria 3010
44 Ga0070692_10221566 3300005345 Bacteria 1118
45 Ga0070668_100003885 3300005347 Bacteria 11032
46 Ga0070668_100021409 3300005347 Bacteria 4884
47 Ga0070668_100022785 3300005347 Bacteria 4734
48 Ga0070668_100783834 3300005347 Bacteria 846
49 Ga0070668_101783442 3300005347 Bacteria 566
50 Ga0070675_100055477 3300005354 Bacteria 3262
51 Ga0070675_100173026 3300005354 Bacteria 1863
52 Ga0070671_100005155 3300005355 Bacteria 10401
53 Ga0070671_100016974 3300005355 Bacteria 5887
54 Ga0070674_100370167 3300005356 Bacteria 1163
55 Ga0070674_100489125 3300005356 Bacteria 1023
56 Ga0070673_100197383 3300005364 Bacteria 1732
57 Ga0070688_100860365 3300005365 Bacteria 713
58 Ga0070659_100187444 3300005366 Bacteria 1699
59 Ga0070667_100277600 3300005367 Bacteria 1504
60 Ga0070709_10208941 3300005434 Bacteria 1387
61 Ga0070714_100000844 3300005435 Bacteria 21724
62 Ga0070714_100008410 3300005435 Bacteria 8055
63 Ga0070714_100144784 3300005435 Bacteria 2136
64 Ga0070714_100483152 3300005435 Bacteria 1179
65 Ga0070714_100518302 3300005435 Bacteria 1138
66 Ga0070713_100554308 3300005436 Bacteria 1089
67 Ga0070710_10000233 3300005437 Bacteria 25969
68 Ga0070710_10758533 3300005437 Bacteria 690
69 Ga0070701_10142430 3300005438 Bacteria 1373
70 Ga0070663_100003232 3300005455 Bacteria 9369
71 Ga0070663_100040305 3300005455 Bacteria 3269
72 Ga0070663_100236500 3300005455 Bacteria 1440
73 Ga0070663_100796930 3300005455 Bacteria 810
74 Ga0070663_101421462 3300005455 Bacteria 615
75 Ga0070663_101441029 3300005455 Bacteria 611
76 Ga0070678_100049155 3300005456 Bacteria 3042
77 Ga0070678_100346766 3300005456 Bacteria 1275
78 Ga0070678_100921968 3300005456 Bacteria 800
79 Ga0070681_10143224 3300005458 Bacteria 2319
80 Ga0070681_11762978 3300005458 Bacteria 546
81 Ga0068867_100044791 3300005459 Bacteria 3242
82 Ga0068867_100905698 3300005459 Bacteria 794
83 Ga0070685_10785618 3300005466 Bacteria 701
84 Ga0070706_101378621 3300005467 Bacteria 646
85 Ga0070699_101091550 3300005518 Bacteria 732
86 Ga0070679_100063441 3300005530 Bacteria 3682
87 Ga0070679_100275266 3300005530 Bacteria 1636
88 Ga0070679_101586491 3300005530 Bacteria 602
89 Ga0070679_101734524 3300005530 Bacteria 573
90 Ga0070684_100051065 3300005535 Bacteria 3592
91 Ga0068853_100586664 3300005539 Bacteria 1058
92 Ga0068853_101426743 3300005539 Bacteria 670
93 Ga0070672_100126901 3300005543 Bacteria 2093
94 Ga0070672_100328130 3300005543 Bacteria 1302
95 Ga0070672_100439339 3300005543 Bacteria 1123
96 Ga0070696_100646810 3300005546 Bacteria 857
97 Ga0070693_100020573 3300005547 Bacteria 3482
98 Ga0070665_100001588 3300005548 Bacteria 26177
99 Ga0070665_100367292 3300005548 Bacteria 1446
100 Ga0070665_101537980 3300005548 Bacteria 674
101 Ga0070664_100346996 3300005564 Bacteria 1349
102 Ga0068857_100000219 3300005577 Bacteria 37769
103 Ga0068857_100266513 3300005577 Bacteria 1573
104 Ga0068854_100351327 3300005578 Bacteria 1207
105 Ga0068854_100635870 3300005578 Bacteria 915
106 Ga0068854_101491514 3300005578 Bacteria 614
107 Ga0068856_100268053 3300005614 Bacteria 1723
108 Ga0068856_100338758 3300005614 Bacteria 1522
109 Ga0068856_101343796 3300005614 Bacteria 729
110 Ga0070702_100040249 3300005615 Bacteria 2614
111 Ga0070702_100049029 3300005615 Bacteria 2406
112 Ga0070702_100560366 3300005615 Bacteria 850
113 Ga0068852_100231788 3300005616 Bacteria 1760
114 Ga0068852_100426429 3300005616 Bacteria 1309
115 Ga0068852_100939471 3300005616 Bacteria 883
116 Ga0068852_101205920 3300005616 Bacteria 778
117 Ga0068859_100026048 3300005617 Bacteria 5868
118 Ga0068864_100572740 3300005618 Bacteria 1093
119 Ga0068866_10591238 3300005718 Bacteria 748
120 Ga0068861_100236197 3300005719 Bacteria 1553
121 Ga0068861_100395029 3300005719 Bacteria 1226
122 Ga0068851_10014251 3300005834 Bacteria 3773
123 Ga0068870_10018071 3300005840 Bacteria 3398
124 Ga0068870_10437243 3300005840 Bacteria 860
125 Ga0068870_10670152 3300005840 Bacteria 713
126 Ga0068863_100063922 3300005841 Bacteria 3480
127 Ga0068863_100293918 3300005841 Bacteria 1575
128 Ga0068858_100001421 3300005842 Bacteria 24630
129 Ga0068858_100246436 3300005842 Bacteria 1696
130 Ga0068860_100059898 3300005843 Bacteria 3619
131 Ga0068860_100481054 3300005843 Bacteria 1238
132 Ga0068860_100711073 3300005843 Bacteria 1015
133 Ga0068862_100893611 3300005844 Bacteria 873
134 Ga0068862_101063908 3300005844 Bacteria 803
135 Ga0068862_101416235 3300005844 Bacteria 699
136 Ga0081455_10000483 3300005937 Bacteria 51674
137 Ga0081539_10071622 3300005985 Bacteria 1855
138 Ga0081539_10192406 3300005985 Bacteria 948
139 Ga0075365_10000731 3300006038 Bacteria 13278
140 Ga0075365_10031922 3300006038 Bacteria 3382
141 Ga0075365_10039802 3300006038 Bacteria 3063
142 Ga0075365_10060232 3300006038 Bacteria 2532
143 Ga0075365_10154275 3300006038 Bacteria 1598
144 Ga0075365_10177935 3300006038 Bacteria 1486
145 Ga0075365_10236714 3300006038 Bacteria 1282
146 Ga0075365_10270631 3300006038 Bacteria 1195
147 Ga0075365_10278935 3300006038 Bacteria 1176
148 Ga0075365_10285571 3300006038 Bacteria 1161
149 Ga0075365_10383656 3300006038 Bacteria 991
150 Ga0075365_10686158 3300006038 Bacteria 724
151 Ga0075365_11131960 3300006038 Bacteria 551
152 Ga0075368_10008004 3300006042 Bacteria 3748
153 Ga0075368_10178749 3300006042 Bacteria 894
154 Ga0075363_100007181 3300006048 Bacteria 5102
155 Ga0075363_100187031 3300006048 Bacteria 1180
156 Ga0075364_10005118 3300006051 Bacteria 7599
157 Ga0075364_10016785 3300006051 Bacteria 4561
158 Ga0075364_10023072 3300006051 Bacteria 3937
159 Ga0075364_10051767 3300006051 Bacteria 2682
160 Ga0075364_10173877 3300006051 Bacteria 1456
161 Ga0075364_10208586 3300006051 Bacteria 1325
162 Ga0075364_10238670 3300006051 Bacteria 1234
163 Ga0075364_10272332 3300006051 Bacteria 1152
164 Ga0075364_10327572 3300006051 Bacteria 1043
165 Ga0075364_10330049 3300006051 Bacteria 1039
166 Ga0075364_10349401 3300006051 Bacteria 1008
167 Ga0075364_10484534 3300006051 Bacteria 845
168 Ga0075364_10616472 3300006051 Bacteria 741
169 Ga0075432_10044504 3300006058 Bacteria 1556
170 Ga0070716_100558415 3300006173 Bacteria 855
171 Ga0075362_10339103 3300006177 Bacteria 751
172 Ga0075367_10000964 3300006178 Bacteria 11746
173 Ga0075367_10087900 3300006178 Bacteria 1888
174 Ga0075367_10108529 3300006178 Bacteria 1702
175 Ga0075367_10709031 3300006178 Bacteria 640
176 Ga0075369_10006285 3300006186 Bacteria 4487
177 Ga0075369_10015288 3300006186 Bacteria 3079
178 Ga0075369_10040628 3300006186 Bacteria 1989
179 Ga0097621_100163311 3300006237 Bacteria 1916
180 Ga0075370_10008827 3300006353 Bacteria 5204
181 Ga0075370_10113285 3300006353 Bacteria 1576
182 Ga0075370_10182640 3300006353 Bacteria 1235
183 Ga0068871_100169990 3300006358 Bacteria 1868
184 Ga0075431_101077486 3300006847 Bacteria 769
185 Ga0075433_10385350 3300006852 Bacteria 1237
186 Ga0075434_100310396 3300006871 Bacteria 1597
187 Ga0068865_101025395 3300006881 Bacteria 724
188 Ga0068865_101873214 3300006881 Bacteria 543
189 Ga0075436_100035970 3300006914 Bacteria 3416
190 Ga0097620_100026048 3300006931 Bacteria 5868
191 Ga0099826_10340863 3300006948 Bacteria 749
192 Ga0075435_100043739 3300007076 Bacteria 3586
193 Ga0099795_10128415 3300007788 Bacteria 1020
194 Ga0105251_10065735 3300009011 Bacteria 1697
195 Ga0105244_10016522 3300009036 Bacteria 4202
196 Ga0105244_10017359 3300009036 Bacteria 4068
197 Ga0105244_10019572 3300009036 Bacteria 3775
198 Ga0105244_10054498 3300009036 Bacteria 2028
199 Ga0105244_10194218 3300009036 Bacteria 959
200 Ga0105244_10382996 3300009036 Bacteria 647
201 Ga0105240_10090033 3300009093 Bacteria 3751
202 Ga0105240_10620532 3300009093 Bacteria 1188
203 Ga0105240_11978664 3300009093 Bacteria 606
204 Ga0111539_10051853 3300009094 Bacteria 4885
205 Ga0105245_10231936 3300009098 Bacteria 1786
206 Ga0105245_10566266 3300009098 Bacteria 1159
207 Ga0105247_10153706 3300009101 Bacteria 1518
208 Ga0105247_10569714 3300009101 Bacteria 835
209 Ga0114129_11105562 3300009147 Bacteria 992
210 Ga0105243_10003992 3300009148 Bacteria 11754
211 Ga0105243_10005136 3300009148 Bacteria 10258
212 Ga0105243_10131058 3300009148 Bacteria 2127
213 Ga0105243_10355725 3300009148 Bacteria 1346
214 Ga0105243_10751527 3300009148 Bacteria 956
215 Ga0105243_10975037 3300009148 Bacteria 848
216 Ga0105243_12167731 3300009148 Bacteria 592
217 Ga0105241_10040904 3300009174 Bacteria 3501
218 Ga0105242_12435950 3300009176 Bacteria 571
219 Ga0105248_10001035 3300009177 Bacteria 30787
220 Ga0105248_10269060 3300009177 Bacteria 1919
221 Ga0105248_11639086 3300009177 Bacteria 729
222 Ga0105237_10333189 3300009545 Bacteria 1522
223 Ga0105237_10367662 3300009545 Bacteria 1443
224 Ga0105238_10218806 3300009551 Bacteria 1880
225 Ga0105238_10273108 3300009551 Bacteria 1671
226 Ga0105238_10385670 3300009551 Bacteria 1393
227 Ga0105238_10394620 3300009551 Bacteria 1376
228 Ga0105249_10507688 3300009553 Bacteria 1252
229 Ga0099796_10300559 3300010159 Bacteria 680
230 Ga0105239_10010822 3300010375 Bacteria 10194
231 Ga0105239_10449641 3300010375 Bacteria 1461
232 Ga0105239_10656549 3300010375 Bacteria 1198
233 Ga0105239_12602529 3300010375 Bacteria 590
234 Ga0105246_10000044 3300011119 Bacteria 47668
235 Ga0105246_10043650 3300011119 Bacteria 3043
236 Ga0105246_11032581 3300011119 Bacteria 746
237 Ga0105246_11120916 3300011119 Bacteria 720
238 Ga0105246_11725969 3300011119 Bacteria 596
239 Ga0157342_1013526 3300012507 Bacteria 873
240 Ga0157327_1043020 3300012512 Bacteria 615
241 Ga0157338_1079959 3300012515 Bacteria 527
242 Ga0157373_10197183 3300013100 Bacteria 1419
243 Ga0157371_10102271 3300013102 Bacteria 2033
244 Ga0157371_11640155 3300013102 Bacteria 504
245 Ga0157370_10111705 3300013104 Bacteria 2554
246 Ga0157370_10159688 3300013104 Bacteria 2098
247 Ga0157370_11438004 3300013104 Bacteria 620
248 Ga0157369_10029320 3300013105 Bacteria 6082
249 Ga0157369_10070492 3300013105 Bacteria 3755
250 Ga0157369_10192999 3300013105 Bacteria 2139
251 Ga0157369_10283932 3300013105 Bacteria 1724
252 Ga0157369_10419368 3300013105 Bacteria 1388
253 Ga0157369_11292593 3300013105 Bacteria 744
254 Ga0157369_12244627 3300013105 Bacteria 553
255 Ga0157374_10059174 3300013296 Bacteria 3581
256 Ga0157374_11941248 3300013296 Bacteria 615
257 Ga0157378_10585023 3300013297 Bacteria 1126
258 Ga0157378_11445838 3300013297 Bacteria 731
259 Ga0157378_12300611 3300013297 Bacteria 590
260 Ga0163162_10580219 3300013306 Bacteria 1248
261 Ga0163162_11018708 3300013306 Bacteria 936
262 Ga0157372_10099931 3300013307 Bacteria 3310
263 Ga0157372_10365947 3300013307 Bacteria 1680
264 Ga0157372_10751174 3300013307 Bacteria 1134
265 Ga0157372_10905491 3300013307 Bacteria 1023
266 Ga0157372_11216273 3300013307 Bacteria 870
267 Ga0157372_12143934 3300013307 Bacteria 642
268 Ga0157372_12306724 3300013307 Bacteria 618
269 Ga0157375_10248371 3300013308 Bacteria 1940
270 Ga0157375_10496971 3300013308 Bacteria 1384
271 Ga0157375_10683779 3300013308 Bacteria 1180
272 Ga0157375_12145089 3300013308 Bacteria 665
273 Ga0163163_10107231 3300014325 Bacteria 2820
274 Ga0163163_11710802 3300014325 Bacteria 690
275 Ga0157380_10018061 3300014326 Bacteria 5231
276 Ga0157380_10829662 3300014326 Bacteria 944
277 Ga0157380_11070181 3300014326 Bacteria 844
278 Ga0157380_13064422 3300014326 Bacteria 533
279 Ga0157377_10043815 3300014745 Bacteria 2492
280 Ga0157377_10209474 3300014745 Bacteria 1242
281 Ga0157377_11123691 3300014745 Bacteria 603
282 Ga0157379_10131373 3300014968 Bacteria 2254
283 Ga0157376_10273378 3300014969 Bacteria 1588
284 Ga0183367_1004 3300015688 Bacteria 716880
285 Ga0163161_10032074 3300017792 Bacteria 3748
286 Ga0163161_10121019 3300017792 Bacteria 1967
287 Ga0163161_10730264 3300017792 Bacteria 827
288 Ga0163161_11954360 3300017792 Bacteria 522
289 Ga0197907_11039976 3300020069 Bacteria 974
290 Ga0197907_11497675 3300020069 Bacteria 925
291 Ga0206356_10230095 3300020070 Bacteria 668
292 Ga0206356_11269870 3300020070 Bacteria 539
293 Ga0206349_1124982 3300020075 Bacteria 834
294 Ga0206351_10641595 3300020077 Bacteria 907
295 Ga0206350_11557265 3300020080 Bacteria 785
296 Ga0206354_10195925 3300020081 Bacteria 888
297 Ga0206353_10846297 3300020082 Bacteria 3817
298 Ga0206353_12056045 3300020082 Bacteria 1699
299 Ga0154015_1392376 3300020610 Bacteria 965
300 Ga0154015_1424168 3300020610 Bacteria 1582
301 Ga0224712_10023372 3300022467 Bacteria 2146
302 Ga0209566_100032 3300025225 Bacteria 338313
303 Ga0209674_100001 3300025226 Bacteria 4013750
304 Ga0209672_100003 3300025228 Bacteria 1560476
305 Ga0209672_109945 3300025228 Bacteria 1311
306 Ga0209147_100551 3300025229 Bacteria 21239
307 Ga0209563_100001 3300025230 Bacteria 4013775
308 Ga0209437_100662 3300025233 Bacteria 19091
309 Ga0209258_108829 3300025242 Bacteria 1387
310 Ga0209677_100001 3300025253 Bacteria 4013787
311 Ga0209677_101476 3300025253 Bacteria 10116
312 Ga0209148_1000004 3300025254 Bacteria 1844481
313 Ga0209455_1000091 3300025272 Bacteria 223115
314 Ga0209455_1000975 3300025272 Bacteria 14462
315 Ga0209673_1019300 3300025273 Bacteria 2451
316 Ga0209025_1077803 3300025294 Bacteria 1141
317 Ga0209051_1005852 3300025303 Bacteria 7072
318 Ga0209051_1008594 3300025303 Bacteria 5385
319 Ga0209051_1018280 3300025303 Bacteria 3105
320 Ga0209051_1026798 3300025303 Bacteria 2313
321 Ga0207656_10075654 3300025321 Bacteria 1504
322 Ga0207655_1002175 3300025728 Bacteria 16307
323 Ga0207655_1019753 3300025728 Bacteria 3502
324 Ga0207655_1090282 3300025728 Bacteria 1080
325 Ga0207682_10266515 3300025893 Bacteria 799
326 Ga0207692_10010715 3300025898 Bacteria 3876
327 Ga0207642_10952538 3300025899 Bacteria 551
328 Ga0207710_10065927 3300025900 Bacteria 1651
329 Ga0207688_10207301 3300025901 Bacteria 1177
330 Ga0207647_10360937 3300025904 Bacteria 822
331 Ga0207699_10728986 3300025906 Bacteria 726
332 Ga0207643_10022279 3300025908 Bacteria 3486
333 Ga0207643_10567461 3300025908 Bacteria 729
334 Ga0207705_10038350 3300025909 Bacteria 3430
335 Ga0207705_10057363 3300025909 Bacteria 2808
336 Ga0207705_10863799 3300025909 Bacteria 701
337 Ga0207654_10103715 3300025911 Bacteria 1757
338 Ga0207707_10134437 3300025912 Bacteria 2162
339 Ga0207695_10074454 3300025913 Bacteria 3457
340 Ga0207695_10666180 3300025913 Bacteria 921
341 Ga0207671_10225677 3300025914 Bacteria 1468
342 Ga0207671_10244640 3300025914 Bacteria 1409
343 Ga0207671_10711107 3300025914 Bacteria 799
344 Ga0207693_10269273 3300025915 Bacteria 1335
345 Ga0207663_10396367 3300025916 Bacteria 1055
346 Ga0207660_10430509 3300025917 Bacteria 1065
347 Ga0207657_10160115 3300025919 Bacteria 1829
348 Ga0207649_10100375 3300025920 Bacteria 1914
349 Ga0207652_10027978 3300025921 Bacteria 4701
350 Ga0207652_11212895 3300025921 Bacteria 656
351 Ga0207681_11832645 3300025923 Bacteria 506
352 Ga0207694_10300894 3300025924 Bacteria 1321
353 Ga0207694_10505264 3300025924 Bacteria 1012
354 Ga0207650_10097869 3300025925 Bacteria 2253
355 Ga0207650_10543289 3300025925 Bacteria 974
356 Ga0207659_10456912 3300025926 Bacteria 1076
357 Ga0207659_10901267 3300025926 Bacteria 760
358 Ga0207687_10301113 3300025927 Bacteria 1292
359 Ga0207687_11946913 3300025927 Bacteria 502
360 Ga0207664_10045644 3300025929 Bacteria 3437
361 Ga0207664_10368313 3300025929 Bacteria 1274
362 Ga0207644_10026063 3300025931 Bacteria 4025
363 Ga0207644_10051697 3300025931 Bacteria 2950
364 Ga0207644_11370363 3300025931 Bacteria 594
365 Ga0207690_10125531 3300025932 Bacteria 1870
366 Ga0207706_10134108 3300025933 Bacteria 2178
367 Ga0207709_10006092 3300025935 Bacteria 6795
368 Ga0207709_10065896 3300025935 Bacteria 2279
369 Ga0207709_10108400 3300025935 Bacteria 1852
370 Ga0207709_11180590 3300025935 Bacteria 630
371 Ga0207670_10173692 3300025936 Bacteria 1618
372 Ga0207669_10371062 3300025937 Bacteria 1112
373 Ga0207704_10849835 3300025938 Bacteria 765
374 Ga0207665_10219242 3300025939 Bacteria 1393
375 Ga0207691_10122681 3300025940 Bacteria 2301
376 Ga0207691_10232112 3300025940 Bacteria 1597
377 Ga0207691_10322967 3300025940 Bacteria 1323
378 Ga0207691_11063913 3300025940 Bacteria 674
379 Ga0207711_10000519 3300025941 Bacteria 39605
380 Ga0207711_11091875 3300025941 Bacteria 739
381 Ga0207689_10051546 3300025942 Bacteria 3392
382 Ga0207689_10404260 3300025942 Bacteria 1138
383 Ga0207689_10963367 3300025942 Bacteria 720
384 Ga0207661_10190292 3300025944 Bacteria 1798
385 Ga0207661_11162946 3300025944 Bacteria 710
386 Ga0207679_10335069 3300025945 Bacteria 1314
387 Ga0207667_10021672 3300025949 Bacteria 7118
388 Ga0207667_10366642 3300025949 Bacteria 1469
389 Ga0207651_10582200 3300025960 Bacteria 976
390 Ga0207668_10006122 3300025972 Bacteria 7097
391 Ga0207668_10028517 3300025972 Bacteria 3650
392 Ga0207668_10096609 3300025972 Bacteria 2184
393 Ga0207668_11317763 3300025972 Bacteria 650
394 Ga0207640_10070755 3300025981 Bacteria 2348
395 Ga0207658_10255904 3300025986 Bacteria 1490
396 Ga0207658_10340981 3300025986 Bacteria 1302
397 Ga0207677_10173622 3300026023 Bacteria 1688
398 Ga0207677_10902634 3300026023 Bacteria 797
399 Ga0207703_10001728 3300026035 Bacteria 19637
400 Ga0207639_10226101 3300026041 Bacteria 1619
401 Ga0207678_10000523 3300026067 Bacteria 34843
402 Ga0207678_10114218 3300026067 Bacteria 2304
403 Ga0207678_10197485 3300026067 Bacteria 1719
404 Ga0207678_10218475 3300026067 Bacteria 1631
405 Ga0207678_10992075 3300026067 Bacteria 743
406 Ga0207708_10116776 3300026075 Bacteria 2076
407 Ga0207702_10003794 3300026078 Bacteria 13641
408 Ga0207702_10767265 3300026078 Bacteria 952
409 Ga0207641_10189307 3300026088 Bacteria 1890
410 Ga0207641_10262913 3300026088 Bacteria 1616
411 Ga0207641_10322650 3300026088 Bacteria 1465
412 Ga0207648_10379223 3300026089 Bacteria 1278
413 Ga0207676_10277319 3300026095 Bacteria 1520
414 Ga0207676_12271600 3300026095 Bacteria 540
415 Ga0207674_10004533 3300026116 Bacteria 16682
416 Ga0207674_10225383 3300026116 Bacteria 1823
417 Ga0207675_100509749 3300026118 Bacteria 1198
418 Ga0207683_10063441 3300026121 Bacteria 3255
419 Ga0207683_10671955 3300026121 Bacteria 960
420 Ga0207698_10301324 3300026142 Bacteria 1492
421 Ga0207698_10309087 3300026142 Bacteria 1475
422 Ga0207698_11715878 3300026142 Bacteria 643
423 Ga0209371_1026907 3300027312 Bacteria 1301
424 Ga0209813_10039242 3300027866 Bacteria 1435
425 Ga0209813_10162578 3300027866 Bacteria 806
426 Ga0207428_10055196 3300027907 Bacteria 3160
427 Ga0265356_1012565 3300028017 Bacteria 929
428 Ga0268266_10262357 3300028379 Bacteria 1601
429 Ga0268266_10270079 3300028379 Bacteria 1578
430 Ga0268266_10317821 3300028379 Bacteria 1457
431 Ga0268266_11683963 3300028379 Bacteria 609
432 Ga0268265_10064135 3300028380 Bacteria 2829
433 Ga0268265_10167741 3300028380 Bacteria 1873
434 Ga0268265_11507675 3300028380 Bacteria 676
435 Ga0268264_10068251 3300028381 Bacteria 3004
436 Ga0268264_10458365 3300028381 Bacteria 1236
437 Ga0268264_10680120 3300028381 Bacteria 1021
438 Ga0268264_11915145 3300028381 Bacteria 602
439 Ga0307517_10527502 3300028786 Bacteria 595
440 Ga0307517_10628325 3300028786 Bacteria 525
441 Ga0307515_10000476 3300028794 Bacteria 95453
442 Ga0307515_10006481 3300028794 Bacteria 23417
443 Ga0307515_10027722 3300028794 Bacteria 9664
444 Ga0307515_10147113 3300028794 Bacteria 2488
445 Ga0307515_10150139 3300028794 Bacteria 2441
446 Ga0307515_10347340 3300028794 Bacteria 1132
447 Ga0307511_10143414 3300030521 Bacteria 1395
448 Ga0307512_10016370 3300030522 Bacteria 6846
449 Ga0307512_10077703 3300030522 Bacteria 2410
450 Ga0265760_10061215 3300031090 Unclassified 1144
451 Ga0265340_10000636 3300031247 Bacteria 19656
452 Ga0265327_10000019 3300031251 Bacteria 427653
453 Ga0265327_10000071 3300031251 Bacteria 215502
454 Ga0307513_10000123 3300031456 Bacteria 108854
455 Ga0307513_10011893 3300031456 Bacteria 10781
456 Ga0307513_10195295 3300031456 Bacteria 1870
457 Ga0307513_10222619 3300031456 Bacteria 1706
458 Ga0307513_10366606 3300031456 Bacteria 1184
459 Ga0307513_10887487 3300031456 Bacteria 599
460 Ga0307408_100571890 3300031548 Bacteria 1000
461 Ga0307508_10105434 3300031616 Bacteria 2417
462 Ga0307514_10032573 3300031649 Bacteria 4169
463 Ga0307514_10041798 3300031649 Bacteria 3608
464 Ga0307514_10108662 3300031649 Bacteria 1971
465 Ga0307514_10118788 3300031649 Bacteria 1851
466 Ga0307516_10001960 3300031730 Bacteria 28187
467 Ga0307516_10037037 3300031730 Bacteria 4878
468 Ga0307516_10159378 3300031730 Bacteria 2008
469 Ga0307516_10889491 3300031730 Bacteria 556
470 Ga0307413_10176423 3300031824 Bacteria 1519
471 Ga0307413_11585064 3300031824 Bacteria 581
472 Ga0307413_11677767 3300031824 Bacteria 566
473 Ga0307518_10001506 3300031838 Bacteria 17266
474 Ga0307518_10016128 3300031838 Bacteria 5351
475 Ga0307518_10095620 3300031838 Bacteria 2133
476 Ga0307518_10413369 3300031838 Bacteria 745
477 Ga0307410_10061901 3300031852 Bacteria 2562
478 Ga0307410_10509644 3300031852 Bacteria 991
479 Ga0307406_10284363 3300031901 Bacteria 1263
480 Ga0307406_11641234 3300031901 Bacteria 569
481 Ga0307407_10611108 3300031903 Bacteria 813
482 Ga0307407_10738820 3300031903 Bacteria 744
483 Ga0307412_10028693 3300031911 Bacteria 3485
484 Ga0307412_11417523 3300031911 Bacteria 629
485 Ga0307409_100126389 3300031995 Bacteria 2176
486 Ga0307409_100224941 3300031995 Bacteria 1697
487 Ga0307409_102768669 3300031995 Bacteria 518
488 Ga0307416_100348795 3300032002 Bacteria 1497
489 Ga0307416_101237705 3300032002 Bacteria 852
490 Ga0307414_10141732 3300032004 Bacteria 1883
491 Ga0307414_11051467 3300032004 Bacteria 751
492 Ga0307414_11481923 3300032004 Bacteria 631
493 Ga0307414_12287257 3300032004 Bacteria 505
494 Ga0307411_11335360 3300032005 Bacteria 654
495 Ga0307415_100103128 3300032126 Bacteria 2098
496 Ga0307415_100631784 3300032126 Bacteria 957
497 Ga0307415_100744800 3300032126 Bacteria 889
498 Ga0307415_101069387 3300032126 Bacteria 754
499 Ga0307415_101840240 3300032126 Bacteria 587
500 Ga0307507_10052583 3300033179 Bacteria 3902
501 Ga0307507_10075955 3300033179 Bacteria 3001
502 Ga0307510_10038499 3300033180 Bacteria 5287
503 Ga0316214_1007998 3300033545 Bacteria 1419
504 Ga0316212_1036648 3300033547 Bacteria 691
505 Ga0373948_0064811 3300034817 Bacteria 809
506 Ga0373938_0025982 3300034957 Bacteria 1222
507 Ga0373940_0168083 3300035088 Bacteria 707
508 Ga0373944_0309178 3300035089 Bacteria 595
509 Ga0373951_0000075 3300035091 Bacteria 39283
510 Ga0373952_0249473 3300035092 Bacteria 537
511 Ga0373939_0370450 3300035114 Bacteria 587
512 Ga0373945_0156024 3300035116 Bacteria 928
513 Ga0373943_0771462 3300035170 Bacteria 571
514 Ga0373942_0002622 3300035207 Bacteria 4326
515 Ga0373961_0293823 3300035241 Bacteria 599
516 Ga0373962_0067115 3300035242 Bacteria 1064
517 Ga0373931_0145114 3300035691 Bacteria 1379
518 Ga0373935_0845373 3300035692 Bacteria 677
519 Ga0373947_0353874 3300035725 Bacteria 986
520 Ga0372808_031836 3300036459 Bacteria 756
521 Ga0372808_051894 3300036459 Bacteria 587
522 Ga0373925_0000954 3300037068 Bacteria 26314
523 Ga0395899_0002933 3300037312 Bacteria 13691
524 Ga0395899_0026682 3300037312 Bacteria 4358
525 Ga0395900_0002361 3300037418 Bacteria 20877
526 Ga0395900_0592148 3300037418 Bacteria 1050
527 Ga0395898_0000321 3300037466 Bacteria 110293
528 Ga0395898_1417179 3300037466 Bacteria 622
529 Ga0436364_1195756 3300037853 Bacteria 3845
530 Ga0451787_032442 3300041441 Bacteria 736
531 Ga0451789_0213093 3300041443 Bacteria 620
532 Ga0451789_0854918 3300041443 Bacteria 1980
533 Ga0451791_0259315 3300041451 Bacteria 1676
534 Ga0451791_0533426 3300041451 Bacteria 12768
535 Ga0451791_1568974 3300041451 Bacteria 829
536 Ga0451793_0945660 3300041452 Bacteria 4545
537 Ga0451797_0223534 3300041453 Bacteria 3311
538 Ga0451797_0260210 3300041453 Bacteria 770
539 Ga0451797_1010462 3300041453 Bacteria 713
540 Ga0451797_1326552 3300041453 Bacteria 512
541 Ga0451797_1447719 3300041453 Bacteria 513
542 Ga0451795_0232793 3300041456 Bacteria 1747
543 Ga0451795_1243454 3300041456 Bacteria 677
544 Ga0451798_1164732 3300041458 Bacteria 684
545 Ga0451800_0611837 3300041459 Bacteria 1905
546 Ga0451800_1547848 3300041459 Bacteria 541
547 Ga0451802_1237693 3300041460 Bacteria 660
548 Ga0451807_1812773 3300041486 Bacteria 1302
549 Ga0451807_2448106 3300041486 Bacteria 691
550 Ga0451833_0593006 3300041491 Bacteria 998
551 Ga0451835_0715652 3300041492 Bacteria 632
552 Ga0451837_0160372 3300041494 Bacteria 715
553 Ga0451837_0260143 3300041494 Bacteria 1511
554 Ga0451837_0336078 3300041494 Bacteria 2293
555 Ga0451837_0663881 3300041494 Bacteria 2095
556 Ga0451839_0040102 3300041496 Bacteria 808
557 Ga0451841_0838650 3300041498 Bacteria 902
558 Ga0451841_1169559 3300041498 Bacteria 635
559 Ga0451849_0568500 3300041505 Bacteria 1395
560 Ga0451849_0617852 3300041505 Bacteria 782
561 Ga0451851_0764749 3300041507 Bacteria 613
562 Ga0451843_0405326 3300041509 Bacteria 1376
563 Ga0451855_1955659 3300041511 Bacteria 609
564 Ga0451853_0678185 3300041512 Bacteria 2590
565 Ga0451853_1645114 3300041512 Bacteria 516
566 Ga0451853_1865336 3300041512 Bacteria 1892
567 Ga0451853_2013961 3300041512 Bacteria 713
568 Ga0451853_3422223 3300041512 Bacteria 1350
569 Ga0439448_0006511 3300042005 Bacteria 3363
570 Ga0439450_055731 3300042008 Bacteria 947
571 Ga0439455_0020868 3300042012 Bacteria 1556
572 Ga0450903_000098 3300042138 Bacteria 18290
573 Ga0439458_0004682 3300042157 Bacteria 3119
574 Ga0439458_0142526 3300042157 Bacteria 639
575 Ga0466969_0431474 3300044656 Bacteria 599
576 Ga0466972_0001226 3300044658 Bacteria 12366
577 Ga0466972_0053157 3300044658 Bacteria 1951
578 Ga0466972_0067717 3300044658 Bacteria 1705
579 Ga0466972_0228617 3300044658 Bacteria 870
580 Ga0466972_0472748 3300044658 Bacteria 589
581 Ga0466965_0000017 3300044683 Bacteria 72634
582 Ga0466965_0000816 3300044683 Bacteria 11748
583 Ga0466965_0003732 3300044683 Bacteria 6720
584 Ga0466965_0065005 3300044683 Bacteria 1827
585 Ga0466965_0091930 3300044683 Bacteria 1545
586 Ga0466965_0236732 3300044683 Bacteria 976
587 Ga0466965_0412316 3300044683 Bacteria 748
588 Ga0466966_0038933 3300044684 Bacteria 3062
589 Ga0466961_0058089 3300044693 Bacteria 2461
590 Ga0466961_0400771 3300044693 Bacteria 833
591 Ga0466963_0003809 3300044694 Bacteria 8699
592 Ga0466963_0718766 3300044694 Bacteria 705
593 Ga0466963_0909669 3300044694 Bacteria 620
594 Ga0466964_0244160 3300044706 Bacteria 882
595 Ga0466964_0501336 3300044706 Bacteria 652
596 Ga0466971_0251759 3300044719 Bacteria 842
597 Ga0466971_0404362 3300044719 Bacteria 666
598 Ga0466968_0049755 3300044735 Bacteria 1786
599 Ga0466968_0185830 3300044735 Bacteria 968
600 Ga0466968_0209818 3300044735 Bacteria 915
601 Ga0466970_0030921 3300044765 Bacteria 2825
602 Ga0466970_0068558 3300044765 Bacteria 1905
603 Ga0466970_0075918 3300044765 Bacteria 1810
604 Ga0466970_0181213 3300044765 Bacteria 1169
605 Ga0466970_0702820 3300044765 Bacteria 589
606 Ga0466957_0040034 3300044842 Bacteria 2829
607 Ga0466957_0332365 3300044842 Bacteria 1027
608 Ga0466957_0947076 3300044842 Bacteria 617
609 Ga0466957_1077109 3300044842 Bacteria 579
610 Ga0466960_0009553 3300044901 Bacteria 4002
611 Ga0466960_0034536 3300044901 Bacteria 2357
612 Ga0466960_0052319 3300044901 Bacteria 1975
613 Ga0466960_0102313 3300044901 Bacteria 1477
614 Ga0466960_0156450 3300044901 Bacteria 1221
615 Ga0466960_0696971 3300044901 Bacteria 609
616 Ga0466959_0031024 3300045049 Bacteria 3956
617 Ga0466959_0181327 3300045049 Bacteria 1472
618 Ga0466959_0199166 3300045049 Bacteria 1395
619 Ga0466958_0181039 3300045836 Bacteria 1337
620 Ga0466967_0005714 3300045976 Bacteria 8675
621 Ga0466967_0053877 3300045976 Bacteria 3538
622 Ga0466967_0189953 3300045976 Bacteria 1941
623 Ga0466967_0251319 3300045976 Bacteria 1689
624 Ga0495617_085387 3300046452 Bacteria 1032
625 Ga0495627_102149 3300046453 Bacteria 818
626 Ga0495592_0023504 3300046454 Bacteria 4687
627 Ga0495592_0108135 3300046454 Bacteria 1971
628 Ga0495603_0029051 3300046455 Bacteria 3335
629 Ga0495603_0894576 3300046455 Bacteria 504
630 Ga0495591_036353 3300046458 Bacteria 1434
631 Ga0495629_0000982 3300046459 Bacteria 22889
632 Ga0495629_0112678 3300046459 Bacteria 1896
633 Ga0495638_0028057 3300046460 Bacteria 3638
634 Ga0495638_0088264 3300046460 Bacteria 1872
635 Ga0495653_0151184 3300046463 Bacteria 1622
636 Ga0495653_0817920 3300046463 Bacteria 559
637 Ga0495582_0081190 3300046473 Bacteria 1800
638 Ga0495605_0008148 3300046474 Bacteria 5925
639 Ga0495639_0455835 3300046475 Bacteria 650
640 Ga0495662_0014479 3300046476 Bacteria 3834
641 Ga0495664_0139994 3300046477 Bacteria 1467
642 Ga0495664_0732035 3300046477 Bacteria 583
643 Ga0495584_0453336 3300046491 Bacteria 652
644 Ga0495585_0076551 3300046492 Bacteria 1817
645 Ga0495594_0020582 3300046499 Bacteria 3514
646 Ga0495596_0064718 3300046500 Bacteria 1422
647 Ga0495583_0016760 3300046506 Bacteria 3921
648 Ga0495606_0018741 3300046507 Bacteria 5178
649 Ga0495606_0527280 3300046507 Bacteria 592
650 Ga0495610_0180783 3300046512 Bacteria 877
651 Ga0495618_0425420 3300046514 Bacteria 809
652 Ga0495620_0007132 3300046515 Bacteria 6091
653 Ga0495628_0025087 3300046516 Bacteria 4873
654 Ga0495628_0138616 3300046516 Bacteria 1857
655 Ga0495630_0081587 3300046517 Bacteria 2440
656 Ga0495631_0050312 3300046518 Bacteria 1823
657 Ga0495632_0383370 3300046519 Bacteria 615
658 Ga0495632_0492680 3300046519 Bacteria 529
659 Ga0495643_0001930 3300046522 Bacteria 17469
660 Ga0495644_0108656 3300046523 Bacteria 1052
661 Ga0495648_0027291 3300046524 Bacteria 3825
662 Ga0495666_0002237 3300046526 Bacteria 9631
663 Ga0495666_0228632 3300046526 Bacteria 850
664 Ga0495652_0172925 3300046529 Bacteria 1665
665 Ga0495652_0229077 3300046529 Bacteria 1391
666 Ga0495654_0176224 3300046530 Bacteria 929
667 Ga0495640_0006860 3300046533 Bacteria 8970
668 Ga0495586_0137735 3300046535 Bacteria 1369
669 Ga0495586_0365108 3300046535 Bacteria 830
670 Ga0495586_0646462 3300046535 Bacteria 611
671 Ga0495587_0013767 3300046536 Bacteria 5082
672 Ga0495598_0361293 3300046537 Bacteria 561
673 Ga0495609_0035339 3300046538 Bacteria 2262
674 Ga0495609_0179317 3300046538 Bacteria 892
675 Ga0495597_0050030 3300046542 Bacteria 1846
676 Ga0495645_0050631 3300046543 Bacteria 3023
677 Ga0495645_0062011 3300046543 Bacteria 2709
678 Ga0495622_0053476 3300046557 Bacteria 1873
679 Ga0495633_0100709 3300046558 Bacteria 1341
680 Ga0495668_0029608 3300046616 Bacteria 3092
681 Ga0495668_0106124 3300046616 Bacteria 1536
682 Ga0495634_0071466 3300046642 Bacteria 2284
683 Ga0495634_0333959 3300046642 Bacteria 910
684 Ga0495611_0090190 3300046648 Bacteria 1416
685 Ga0495625_0049407 3300046660 Bacteria 3024
686 Ga0495625_0241546 3300046660 Bacteria 1175
687 Ga0495625_0606882 3300046660 Bacteria 656
688 Ga0495635_0061084 3300046663 Bacteria 2588
689 Ga0495588_0049151 3300046674 Bacteria 2168
690 Ga0495588_0276904 3300046674 Bacteria 884
691 Ga0495657_0030531 3300046675 Bacteria 3773
692 Ga0495599_0110964 3300046678 Bacteria 1708
693 Ga0495623_0120130 3300046679 Bacteria 1582
694 Ga0495646_0025052 3300046680 Bacteria 3753
695 Ga0495646_0037069 3300046680 Bacteria 3018
696 Ga0495658_0477619 3300046683 Bacteria 797
697 Ga0495613_0001044 3300046689 Bacteria 21114
698 Ga0495613_0001732 3300046689 Bacteria 16603
699 Ga0495613_0525494 3300046689 Bacteria 794
700 Ga0495624_0159730 3300046690 Bacteria 1377
701 Ga0495624_0277363 3300046690 Bacteria 1012
702 Ga0495670_0345942 3300046691 Bacteria 800
703 Ga0495649_0098405 3300046694 Bacteria 1556
704 Ga0495589_0129097 3300046794 Bacteria 1214
705 Ga0495600_0288390 3300046809 Bacteria 1037
706 Ga0495600_0494724 3300046809 Bacteria 752
707 Ga0495581_0088708 3300047315 Bacteria 1793
708 Ga0495581_0278477 3300047315 Bacteria 978
709 Ga0495604_0017135 3300047317 Bacteria 5794
710 Ga0495604_0037319 3300047317 Bacteria 3828
711 Ga0495674_0141314 3300047319 Bacteria 2023
712 Ga0495674_0707342 3300047319 Bacteria 790
713 Ga0495672_0094304 3300047320 Bacteria 1637
714 Ga0495676_0138621 3300047321 Bacteria 1745
715 Ga0495680_0010041 3300047322 Bacteria 8465
716 Ga0495683_0201837 3300047323 Bacteria 896
717 Ga0495687_026764 3300047443 Bacteria 2709
718 Ga0495677_0028704 3300047445 Bacteria 2022
719 Ga0495685_055018 3300047447 Bacteria 1346
720 Ga0495684_0123862 3300047471 Bacteria 1945
721 Ga0495686_0230372 3300047472 Bacteria 1049
722 Ga0495593_0306077 3300047673 Bacteria 795
723 Ga0495602_0026806 3300048088 Bacteria 5551
724 Ga0495602_0764262 3300048088 Bacteria 651
725 Ga0495614_0029193 3300048089 Bacteria 2374
726 Ga0495614_0150332 3300048089 Bacteria 1038
727 Ga0495615_0121537 3300048090 Bacteria 756
728 Ga0495626_0091416 3300048091 Bacteria 1338
729 Ga0496100_0033625 3300048903 Bacteria 3210
730 Ga0496100_0076123 3300048903 Bacteria 2252
731 Ga0496100_0151959 3300048903 Bacteria 1652
732 Ga0496100_0215462 3300048903 Bacteria 1407
733 Ga0496100_0583050 3300048903 Bacteria 867
734 Ga0496100_0596082 3300048903 Bacteria 858
735 Ga0496100_0750467 3300048903 Bacteria 763
736 Ga0496100_1006038 3300048903 Bacteria 656
737 Ga0496100_1066840 3300048903 Bacteria 636
738 Ga0496101_0028715 3300048904 Bacteria 3886
739 Ga0496101_0036006 3300048904 Bacteria 3503
740 Ga0496101_0379726 3300048904 Bacteria 1112
741 Ga0496101_0911821 3300048904 Bacteria 692
742 Ga0496102_0000382 3300048905 Bacteria 52442
743 Ga0496102_0001329 3300048905 Bacteria 22197
744 Ga0496102_0007191 3300048905 Bacteria 9506
745 Ga0496102_0012230 3300048905 Bacteria 7422
746 Ga0496102_0130420 3300048905 Bacteria 2352
747 Ga0496102_0169657 3300048905 Bacteria 2054
748 Ga0496102_0398092 3300048905 Bacteria 1295
749 Ga0496102_1516976 3300048905 Bacteria 589
750 Ga0496103_0009301 3300048906 Bacteria 5822
751 Ga0496103_0170983 3300048906 Bacteria 1395
752 Ga0496103_0185528 3300048906 Bacteria 1337
753 Ga0496103_0268020 3300048906 Bacteria 1098
754 Ga0496104_0009817 3300048907 Bacteria 8534
755 Ga0496104_0023016 3300048907 Bacteria 5725
756 Ga0496104_0084182 3300048907 Bacteria 3034
757 Ga0496104_0412535 3300048907 Bacteria 1263
758 Ga0496104_0422852 3300048907 Bacteria 1244
759 Ga0496104_1811517 3300048907 Bacteria 512
760 Ga0496105_0002836 3300048908 Bacteria 12681
761 Ga0496105_0004398 3300048908 Bacteria 10607
762 Ga0496105_0057755 3300048908 Bacteria 3203
763 Ga0496105_0060212 3300048908 Bacteria 3133
764 Ga0496105_0178064 3300048908 Bacteria 1741
765 Ga0496105_0243058 3300048908 Bacteria 1460
766 Ga0496105_0257325 3300048908 Bacteria 1413
767 Ga0496105_0263754 3300048908 Bacteria 1392
768 Ga0496105_0753365 3300048908 Bacteria 744
769 Ga0496106_0173611 3300048909 Bacteria 1709
770 Ga0496106_1076483 3300048909 Bacteria 630
771 Ga0496107_0118918 3300048910 Bacteria 1946
772 Ga0496107_0178105 3300048910 Bacteria 1578
773 Ga0496107_0488870 3300048910 Bacteria 913
774 Ga0496108_0000056 3300048911 Bacteria 124850
775 Ga0496108_0006907 3300048911 Bacteria 9188
776 Ga0496108_0019641 3300048911 Bacteria 5549
777 Ga0496108_0052557 3300048911 Bacteria 3415
778 Ga0496108_0121424 3300048911 Bacteria 2241
779 Ga0496109_0038374 3300048912 Bacteria 4330
780 Ga0496109_0082889 3300048912 Bacteria 2956
781 Ga0496109_0423227 3300048912 Bacteria 1258
782 Ga0496109_1864014 3300048912 Bacteria 534
783 Ga0496110_0000297 3300048913 Bacteria 32605
784 Ga0496110_0316915 3300048913 Bacteria 1420
785 Ga0496110_0328060 3300048913 Bacteria 1394
786 Ga0496110_0614509 3300048913 Bacteria 985
787 Ga0496110_0936383 3300048913 Bacteria 773
788 Ga0496110_1112012 3300048913 Bacteria 698
789 Ga0496111_0139449 3300048914 Bacteria 1796
790 Ga0496112_0032466 3300048915 Bacteria 5070
791 Ga0496112_0178346 3300048915 Bacteria 2088
792 Ga0496112_1213446 3300048915 Bacteria 671
793 Ga0496113_0127960 3300048916 Bacteria 1990
794 Ga0496113_0946576 3300048916 Bacteria 680
795 Ga0496113_1109382 3300048916 Bacteria 620
796 Ga0496114_0003141 3300048917 Bacteria 12678
797 Ga0496114_0038863 3300048917 Bacteria 3938
798 Ga0496114_0063167 3300048917 Bacteria 3100
799 Ga0496114_0076810 3300048917 Bacteria 2815
800 Ga0496114_0095403 3300048917 Bacteria 2531
801 Ga0496114_0100515 3300048917 Bacteria 2468
802 Ga0496114_0123409 3300048917 Bacteria 2230
803 Ga0496114_0194230 3300048917 Bacteria 1776
804 Ga0496114_0499473 3300048917 Bacteria 1076
805 Ga0496114_0560226 3300048917 Bacteria 1009
806 Ga0496114_0629878 3300048917 Bacteria 944
807 Ga0496114_0861464 3300048917 Bacteria 786
808 Ga0496114_0878038 3300048917 Bacteria 777
809 Ga0496114_1156328 3300048917 Bacteria 659
810 Ga0496114_1530310 3300048917 Bacteria 555
811 Ga0496115_0054361 3300048918 Bacteria 3215
812 Ga0496115_0090964 3300048918 Bacteria 2493
813 Ga0496115_0103985 3300048918 Bacteria 2330
814 Ga0496115_1350687 3300048918 Bacteria 528
815 Ga0496116_0004331 3300048919 Bacteria 13577
816 Ga0496116_0302593 3300048919 Bacteria 760
817 Ga0496117_0000455 3300048920 Bacteria 68272
818 Ga0496117_0009489 3300048920 Bacteria 9044
819 Ga0496117_0037996 3300048920 Bacteria 3578
820 Ga0496117_0066401 3300048920 Bacteria 2447
821 Ga0496117_0153245 3300048920 Bacteria 1361
822 Ga0496117_0289589 3300048920 Bacteria 872
823 Ga0496117_0336917 3300048920 Bacteria 784
824 Ga0496118_0000447 3300048921 Bacteria 68342
825 Ga0496118_0006679 3300048921 Bacteria 12584
826 Ga0496118_0103571 3300048921 Bacteria 1913
827 Ga0496118_0152983 3300048921 Bacteria 1441
828 Ga0496118_0210158 3300048921 Bacteria 1143
829 Ga0496118_0215274 3300048921 Bacteria 1123
830 Ga0496118_0454149 3300048921 Bacteria 650
831 Ga0496119_0000762 3300048922 Bacteria 43203
832 Ga0496119_0004415 3300048922 Bacteria 14018
833 Ga0496119_0005312 3300048922 Bacteria 12394
834 Ga0496119_0007168 3300048922 Bacteria 10107
835 Ga0496119_0037325 3300048922 Bacteria 3158
836 Ga0496119_0042229 3300048922 Bacteria 2894
837 Ga0496119_0080893 3300048922 Bacteria 1873
838 Ga0496119_0106053 3300048922 Bacteria 1569
839 Ga0496119_0132222 3300048922 Bacteria 1358
840 Ga0496119_0366410 3300048922 Bacteria 694
841 Ga0496119_0476902 3300048922 Bacteria 584
842 Ga0496119_0520971 3300048922 Bacteria 550
843 Ga0496119_0587701 3300048922 Bacteria 508
844 Ga0496120_0000500 3300048923 Bacteria 61218
845 Ga0496120_0002282 3300048923 Bacteria 19894
846 Ga0496120_0034809 3300048923 Bacteria 3014
847 Ga0496120_0041657 3300048923 Bacteria 2688
848 Ga0496120_0059050 3300048923 Bacteria 2151
849 Ga0496120_0080326 3300048923 Bacteria 1768
850 Ga0496120_0088877 3300048923 Bacteria 1655
851 Ga0496120_0173300 3300048923 Bacteria 1065
852 Ga0496120_0250554 3300048923 Bacteria 831
853 Ga0496121_0000098 3300048924 Bacteria 200516
854 Ga0496121_0381746 3300048924 Bacteria 929
855 Ga0496121_0533513 3300048924 Bacteria 738
856 Ga0496121_0593715 3300048924 Bacteria 685
857 Ga0496122_0000705 3300048925 Bacteria 65974
858 Ga0496122_0000978 3300048925 Bacteria 51309
859 Ga0496122_0008896 3300048925 Bacteria 10701
860 Ga0496122_0033847 3300048925 Bacteria 4194
861 Ga0496122_0036228 3300048925 Bacteria 3995
862 Ga0496122_0189516 3300048925 Bacteria 1216
863 Ga0496122_0348285 3300048925 Bacteria 775
864 Ga0496122_0443693 3300048925 Bacteria 646
865 Ga0496123_0000304 3300048926 Bacteria 95535
866 Ga0496123_0006643 3300048926 Bacteria 11158
867 Ga0496123_0030985 3300048926 Bacteria 3901
868 Ga0496123_0220459 3300048926 Bacteria 957
869 Ga0496123_0285735 3300048926 Bacteria 795
870 Ga0496123_0305148 3300048926 Bacteria 758
871 Ga0496123_0486224 3300048926 Bacteria 542
872 Ga0496124_0005987 3300048927 Bacteria 13423
873 Ga0496124_0032523 3300048927 Bacteria 4604
874 Ga0496124_0039999 3300048927 Bacteria 4059
875 Ga0496124_0136429 3300048927 Bacteria 1942
876 Ga0496124_0235448 3300048927 Bacteria 1365
877 Ga0496124_0265439 3300048927 Bacteria 1260
878 Ga0496124_0296299 3300048927 Bacteria 1171
879 Ga0496124_0437708 3300048927 Bacteria 896
880 Ga0496124_0547271 3300048927 Bacteria 765
881 Ga0496124_0967117 3300048927 Bacteria 510
882 Ga0496125_0000069 3300048928 Bacteria 246981
883 Ga0496125_0000626 3300048928 Bacteria 59339
884 Ga0496125_0001892 3300048928 Bacteria 28717
885 Ga0496125_0013813 3300048928 Bacteria 7909
886 Ga0496126_0001101 3300048929 Bacteria 45352
887 Ga0496126_0005987 3300048929 Bacteria 13665
888 Ga0496126_0007418 3300048929 Bacteria 12031
889 Ga0496126_0007949 3300048929 Bacteria 11525
890 Ga0496126_0014170 3300048929 Bacteria 8071
891 Ga0496126_0056376 3300048929 Bacteria 3552
892 Ga0496126_0068908 3300048929 Bacteria 3157
893 Ga0496126_0198042 3300048929 Bacteria 1698
894 Ga0496126_0670698 3300048929 Bacteria 809
895 Ga0496126_1298154 3300048929 Bacteria 530
896 Ga0495678_028339 3300049459 Bacteria 2364
897 Ga0495682_0103322 3300049460 Bacteria 1022
898 Ga0501031_0003477 3300049568 Bacteria 10109
899 Ga0501031_0005744 3300049568 Bacteria 8084
900 Ga0501031_0023746 3300049568 Bacteria 3997
901 Ga0501031_0150341 3300049568 Bacteria 1521
902 Ga0501032_0005320 3300049569 Bacteria 9575
903 Ga0501032_0044843 3300049569 Bacteria 2992
904 Ga0501032_0161473 3300049569 Bacteria 1471
905 Ga0501032_0228315 3300049569 Bacteria 1210
906 Ga0501032_0235220 3300049569 Bacteria 1191
907 Ga0501033_0003891 3300049570 Bacteria 12138
908 Ga0501033_0004594 3300049570 Bacteria 11063
909 Ga0501033_0106473 3300049570 Bacteria 2043
910 Ga0501033_0178364 3300049570 Bacteria 1523
911 Ga0501033_0223532 3300049570 Bacteria 1339
912 Ga0501033_0227459 3300049570 Bacteria 1326
913 Ga0501034_0054720 3300049571 Bacteria 4017
914 Ga0501034_0151536 3300049571 Bacteria 2294
915 Ga0501034_0157244 3300049571 Bacteria 2246
916 Ga0501034_0168883 3300049571 Bacteria 2155
917 Ga0501034_0179134 3300049571 Bacteria 2085
918 Ga0501034_0250415 3300049571 Bacteria 1716
919 Ga0501034_0250636 3300049571 Bacteria 1715
920 Ga0501034_0720880 3300049571 Bacteria 894
921 Ga0501034_1436740 3300049571 Bacteria 564
922 Ga0501036_0015125 3300049572 Bacteria 6443
923 Ga0501036_0025236 3300049572 Bacteria 5015
924 Ga0501036_0028243 3300049572 Bacteria 4742
925 Ga0501036_0063061 3300049572 Bacteria 3139
926 Ga0501036_0066493 3300049572 Bacteria 3050
927 Ga0501036_0949412 3300049572 Bacteria 705
928 Ga0501036_1007711 3300049572 Bacteria 682
929 Ga0501037_0009033 3300049573 Bacteria 7304
930 Ga0501037_0075874 3300049573 Bacteria 2441
931 Ga0501037_0080134 3300049573 Bacteria 2369
932 Ga0501037_0133057 3300049573 Bacteria 1782
933 Ga0501037_0219868 3300049573 Bacteria 1337
934 Ga0501037_0277462 3300049573 Bacteria 1168
935 Ga0501038_0013350 3300049574 Bacteria 7490
936 Ga0501038_0014325 3300049574 Bacteria 7224
937 Ga0501038_0026637 3300049574 Bacteria 5148
938 Ga0501038_0031984 3300049574 Bacteria 4646
939 Ga0501038_0113488 3300049574 Bacteria 2242
940 Ga0501038_0327847 3300049574 Bacteria 1196
941 Ga0501039_0013460 3300049575 Bacteria 6257
942 Ga0501039_0018121 3300049575 Bacteria 5404
943 Ga0501039_0130770 3300049575 Bacteria 1970
944 Ga0501039_0620398 3300049575 Bacteria 847
945 Ga0501042_0007367 3300049578 Bacteria 7206
946 Ga0501042_0008101 3300049578 Bacteria 6917
947 Ga0501042_0020230 3300049578 Bacteria 4631
948 Ga0501043_0016876 3300049579 Bacteria 5723
949 Ga0501043_0023448 3300049579 Bacteria 4840
950 Ga0501043_0025840 3300049579 Bacteria 4606
951 Ga0501043_0040998 3300049579 Bacteria 3638
952 Ga0501043_0144375 3300049579 Bacteria 1863
953 Ga0501043_0148363 3300049579 Bacteria 1836
954 Ga0501043_0411657 3300049579 Bacteria 1020
955 Ga0501046_0006076 3300049580 Bacteria 10744
956 Ga0501046_0020284 3300049580 Bacteria 5500
957 Ga0501046_0052539 3300049580 Bacteria 3211
958 Ga0501046_0745556 3300049580 Bacteria 688
959 Ga0501047_0002353 3300049581 Bacteria 18076
960 Ga0501047_0021705 3300049581 Bacteria 6164
961 Ga0501047_0023560 3300049581 Bacteria 5908
962 Ga0501047_0025365 3300049581 Bacteria 5698
963 Ga0501047_0100854 3300049581 Bacteria 2766
964 Ga0501047_0124851 3300049581 Bacteria 2454
965 Ga0501047_0180517 3300049581 Bacteria 1977
966 Ga0501047_0239537 3300049581 Bacteria 1665
967 Ga0501048_0065848 3300049582 Bacteria 2561
968 Ga0501048_0074058 3300049582 Bacteria 2402
969 Ga0501067_0426769 3300049583 Bacteria 740
970 Ga0501068_0431234 3300049584 Bacteria 852
971 Ga0501069_0112891 3300049585 Bacteria 1549
972 Ga0501069_0533225 3300049585 Bacteria 702
973 Ga0501070_0000515 3300049586 Bacteria 35467
974 Ga0501070_0079626 3300049586 Bacteria 2711
975 Ga0501070_0110360 3300049586 Bacteria 2273
976 Ga0501070_0944339 3300049586 Bacteria 671
977 Ga0501070_1041536 3300049586 Bacteria 633
978 Ga0501072_0275753 3300049588 Bacteria 1338
979 Ga0501072_1081479 3300049588 Bacteria 624
980 Ga0501073_0008299 3300049589 Bacteria 7704
981 Ga0501073_0060531 3300049589 Bacteria 2642
982 Ga0501073_0352223 3300049589 Bacteria 1017
983 Ga0501074_0021577 3300049590 Bacteria 4676
984 Ga0501074_0039574 3300049590 Bacteria 3415
985 Ga0501074_0051476 3300049590 Bacteria 2972
986 Ga0501080_0142711 3300049742 Bacteria 2214
987 Ga0501080_0520407 3300049742 Bacteria 1061
988 Ga0501080_0641595 3300049742 Bacteria 940
989 Ga0501080_1311669 3300049742 Bacteria 620
990 Ga0501080_1473844 3300049742 Bacteria 579
991 Ga0501080_1503254 3300049742 Bacteria 572
992 Ga0501083_0132689 3300049744 Bacteria 1633
993 Ga0501083_0278158 3300049744 Bacteria 1089
994 Ga0501035_0001713 3300049822 Bacteria 22159
995 Ga0501035_0031721 3300049822 Bacteria 4812
996 Ga0501035_0055081 3300049822 Bacteria 3551
997 Ga0501035_0113823 3300049822 Bacteria 2369
998 Ga0501035_0233552 3300049822 Bacteria 1566
999 Ga0501035_0742237 3300049822 Bacteria 788
1000 Ga0501035_1174919 3300049822 Bacteria 596
1001 Ga0501044_0005944 3300049823 Bacteria 13510
1002 Ga0501044_0042700 3300049823 Bacteria 4714
1003 Ga0501044_0044738 3300049823 Bacteria 4591
1004 Ga0501044_0049479 3300049823 Bacteria 4338
1005 Ga0501044_0073064 3300049823 Bacteria 3486
1006 Ga0501044_0079162 3300049823 Bacteria 3330
1007 Ga0501044_0183058 3300049823 Bacteria 2061
1008 Ga0501044_0190558 3300049823 Bacteria 2013
1009 Ga0501044_0781069 3300049823 Bacteria 835
1010 Ga0501044_1519825 3300049823 Bacteria 534
1011 Ga0501045_0258409 3300049824 Bacteria 1296
1012 Ga0501045_0374978 3300049824 Bacteria 1059
1013 Ga0501045_1428778 3300049824 Bacteria 502
1014 nmdc:mga03n38_19199_c1 3300050490 Bacteria 2712
1015 nmdc:mga03n38_728110_c1 3300050490 Bacteria 573
1016 nmdc:mga00v17_108997_c1 3300050491 Bacteria 1755
1017 nmdc:mga00v17_13901_c1 3300050491 Bacteria 4479
1018 nmdc:mga00v17_171559_c1 3300050491 Bacteria 1399
1019 nmdc:mga00v17_181797_c1 3300050491 Bacteria 1357
1020 nmdc:mga00v17_291348_c1 3300050491 Bacteria 1060
1021 nmdc:mga00v17_430484_c1 3300050491 Bacteria 857
1022 nmdc:mga00v17_4782_c1 3300050491 Bacteria 7087
1023 nmdc:mga00v17_6583_c1 3300050491 Bacteria 6169
1024 nmdc:mga00v17_749696_c1 3300050491 Bacteria 624
1025 nmdc:mga00v17_97382_c1 3300050491 Bacteria 1854
1026 nmdc:mga0yw44_101984_c1 3300050492 Bacteria 1829
1027 nmdc:mga0yw44_113595_c1 3300050492 Bacteria 1738
1028 nmdc:mga0yw44_122613_c1 3300050492 Bacteria 1675
1029 nmdc:mga0yw44_173869_c1 3300050492 Bacteria 1415
1030 nmdc:mga0yw44_194469_c1 3300050492 Bacteria 1338
1031 nmdc:mga0yw44_208487_c1 3300050492 Bacteria 1292
1032 nmdc:mga0yw44_215398_c1 3300050492 Bacteria 1271
1033 nmdc:mga0yw44_232946_c1 3300050492 Bacteria 1223
1034 nmdc:mga0yw44_74100_c1 3300050492 Bacteria 2120
1035 nmdc:mga0yw44_78093_c1 3300050492 Bacteria 2070
1036 nmdc:mga0yw44_81627_c1 3300050492 Bacteria 2027
1037 nmdc:mga0yw44_915380_c1 3300050492 Bacteria 595
1038 nmdc:mga0yw44_925585_c1 3300050492 Bacteria 591
1039 nmdc:mga0k408_394032_c1 3300050493 Bacteria 824
1040 nmdc:mga0k408_885809_c1 3300050493 Bacteria 518
1041 nmdc:mga06z11_386675_c1 3300050494 Bacteria 841
1042 nmdc:mga06z11_49909_c1 3300050494 Bacteria 2137
1043 nmdc:mga06z11_63871_c1 3300050494 Bacteria 1928
1044 nmdc:mga04h51_188287_c1 3300050495 Bacteria 806
1045 nmdc:mga04h51_6044_c1 3300050495 Bacteria 3118
1046 nmdc:mga07m45_19564_c1 3300050496 Bacteria 3669
1047 nmdc:mga07m45_493206_c1 3300050496 Bacteria 709
1048 nmdc:mga06r32_824203_c1 3300050510 Bacteria 887
1049 nmdc:mga08y16_66782_c1 3300050511 Bacteria 3754
1050 nmdc:mga0n895_340654_c1 3300050512 Bacteria 1519
1051 nmdc:mga0rr50_33750_c1 3300050513 Bacteria 3659
1052 nmdc:mga08x19_142796_c1 3300050514 Bacteria 1618
1053 nmdc:mga0a205_96969_c1 3300050515 Bacteria 2848
1054 nmdc:mga0sz30_11515_c1 3300050516 Bacteria 3417
1055 nmdc:mga0sz30_266832_c1 3300050516 Bacteria 762
1056 nmdc:mga0sz30_49386_c1 3300050516 Bacteria 1782
1057 nmdc:mga0sz30_57472_c1 3300050516 Bacteria 1658
1058 Ga0495601_0047478 3300053077 Bacteria 2703
1059 Ga0495612_0258817 3300053078 Bacteria 775
1060 Ga0500610_0343925 3300053079 Bacteria 635
1061 Ga0500635_0000067 3300053080 Bacteria 69061
1062 Ga0495595_0019616 3300053084 Bacteria 2936
1063 Ga0495619_0095178 3300053085 Bacteria 2021
1064 Ga0500644_0315564 3300053088 Bacteria 671
1065 Ga0500646_0000795 3300053090 Bacteria 8763
1066 Ga0500583_0259962 3300053092 Bacteria 856
1067 Ga0500651_0000194 3300053093 Bacteria 38826
1068 Ga0500556_0000095 3300053104 Bacteria 82300
1069 Ga0500556_0001225 3300053104 Bacteria 11963
1070 Ga0500556_0421944 3300053104 Bacteria 510
1071 Ga0500562_009929 3300053108 Bacteria 2407
1072 Ga0500562_011098 3300053108 Bacteria 2286
1073 Ga0500593_001106 3300053117 Bacteria 9714
1074 Ga0500652_395241 3300053131 Bacteria 513
1075 Ga0500559_0000753 3300053136 Bacteria 21265
1076 Ga0500559_0160491 3300053136 Bacteria 1056
1077 Ga0500568_0000223 3300053139 Bacteria 48626
1078 Ga0500573_0002012 3300053140 Bacteria 9962
1079 Ga0500573_0279293 3300053140 Bacteria 846
1080 Ga0500577_0306280 3300053142 Bacteria 694
1081 Ga0500588_0291405 3300053146 Bacteria 617
1082 Ga0500600_0162141 3300053149 Bacteria 1098
1083 Ga0500600_0206847 3300053149 Bacteria 919
1084 Ga0500604_0202978 3300053151 Bacteria 682
1085 Ga0500616_0000233 3300053153 Bacteria 87378
1086 Ga0500616_0000257 3300053153 Bacteria 82013
1087 Ga0500616_0009623 3300053153 Bacteria 5861
1088 Ga0500616_0033874 3300053153 Bacteria 2786
1089 Ga0500616_0127346 3300053153 Bacteria 1207
1090 Ga0500620_004744 3300053155 Bacteria 3071
1091 Ga0500620_122537 3300053155 Bacteria 911
1092 Ga0500627_0394095 3300053158 Bacteria 591
1093 Ga0500634_0298827 3300053161 Bacteria 640
1094 Ga0500645_008303 3300053730 Bacteria 3555
1095 Ga0501084_0193537 3300054114 Bacteria 1716
1096 Ga0466962_0032349 3300061719 Bacteria 2504
1097 Ga0466962_0091666 3300061719 Bacteria 1456

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2891395885 2891404307 117
2 iso_pu_bacteria 8056037122 8056040021 117
3 iso_pu_bacteria 2551306166 2552113740 118
4 iso_pu_bacteria 2582581313 2585311102 118
5 iso_pu_bacteria 2585427649 2586063085 118
6 iso_pu_bacteria 2643221553 2643786633 118
7 iso_pu_bacteria 2643221572 2643876112 118
8 iso_pu_bacteria 2643221616 2644097937 118
9 iso_pu_bacteria 2643221647 2644265596 118
10 iso_pu_bacteria 2643221669 2644383167 118
11 iso_pu_bacteria 2643221678 2644438949 118
12 iso_pu_bacteria 2643221681 2644455316 118
13 iso_pu_bacteria 2643221687 2644486835 118
14 iso_pu_bacteria 2643221694 2644527741 118
15 iso_pu_bacteria 2643221697 2644536297 118
16 iso_pu_bacteria 2643221711 2644608128 118
17 iso_pu_bacteria 2643221724 2644681314 118
18 iso_pu_bacteria 2739367898 2740166164 118
19 iso_pu_bacteria 2747842429 2747954619 118
20 iso_pu_bacteria 2751185788 2753303902 118
21 iso_pu_bacteria 2757320536 2758224644 118
22 iso_pu_bacteria 2758568522 2760307053 118
23 iso_pu_bacteria 2784132148 2784585569 118
24 iso_pu_bacteria 2784746763 2785343260 118
25 iso_pu_bacteria 2784746768 2785366427 118
26 iso_pu_bacteria 2786546132 2786666870 118
27 iso_pu_bacteria 2791355406 2793977220 118
28 iso_pu_bacteria 2808606359 2808849175 118
29 iso_pu_bacteria 2808606394 2809026390 118
30 iso_pu_bacteria 2808606448 2809229049 118
31 iso_pu_bacteria 2811994880 2812362333 118
32 iso_pu_bacteria 2818991318 2819424816 118
33 iso_pu_bacteria 2844841374 2844843180 118
34 iso_pu_bacteria 2852663356 2852666497 118
35 iso_pu_bacteria 2856741275 2856742240 118
36 iso_pu_bacteria 2856741275 2856742435 118
37 iso_pu_bacteria 2857481737 2857484874 118
38 iso_pu_bacteria 2857723135 2857725661 118
39 iso_pu_bacteria 2857729791 2857731179 118
40 iso_pu_bacteria 2861520306 2861524295 118
41 iso_pu_bacteria 2866612099 2866617681 118
42 iso_pu_bacteria 2873314349 2873320392 118
43 iso_pu_bacteria 2877676314 2877684106 118
44 iso_pu_bacteria 2884693830 2884698719 118
45 iso_pu_bacteria 2889042446 2889042909 118
46 iso_pu_bacteria 2891562705 2891563722 118
47 iso_pu_bacteria 2891968417 2891970898 118
48 iso_pu_bacteria 2895442618 2895451301 118
49 iso_pu_bacteria 2895660088 2895660321 118
50 iso_pu_bacteria 2899359706 2899366550 118
51 iso_pu_bacteria 2902837492 2902841834 118
52 iso_pu_bacteria 2904430863 2904431821 118
53 iso_pu_bacteria 2904490793 2904495864 118
54 iso_pu_bacteria 2904509784 2904510263 118
55 iso_pu_bacteria 2904776348 2904777073 118
56 iso_pu_bacteria 2910809715 2910812187 118
57 iso_pu_bacteria 2917736166 2917740233 118
58 iso_pu_bacteria 2919042368 2919044481 118
59 iso_pu_bacteria 2919055335 2919058667 118
60 iso_pu_bacteria 2919523602 2919525544 118
61 iso_pu_bacteria 2928104781 2928107933 118
62 iso_pu_bacteria 2928121344 2928122260 118
63 iso_pu_bacteria 2928153084 2928153315 118
64 iso_pu_bacteria 2931384279 2931386335 118
65 iso_pu_bacteria 2932398195 2932400052 118
66 iso_pu_bacteria 2938649242 2938651091 118
67 iso_pu_bacteria 2939657138 2939660335 118
68 iso_pu_bacteria 2946003308 2946004606 118
69 iso_pu_bacteria 2946080515 2946082621 118
70 iso_pu_bacteria 2954380949 2954381150 118
71 iso_pu_bacteria 2954673503 2954681956 118
72 iso_pu_bacteria 2954682443 2954690969 118
73 iso_pu_bacteria 2966921586 2966924324 118
74 iso_pu_bacteria 2968558590 2968562653 118
75 iso_pu_bacteria 2971403814 2971405017 118
76 iso_pu_bacteria 2977228692 2977230416 118
77 iso_pu_bacteria 2977236895 2977239218 118
78 iso_pu_bacteria 2977251589 2977252805 118
79 iso_pu_bacteria 2977264416 2977265659 118
80 iso_pu_bacteria 2984542743 2984542998 118
81 iso_pu_bacteria 2984551494 2984552176 118
82 iso_pu_bacteria 2988225383 2988230307 118
83 iso_pu_bacteria 2996632988 2996634523 118
84 iso_pu_bacteria 8004021418 8004023931 118
85 iso_pu_bacteria 8016254467 8016254959 118
86 iso_pu_bacteria 8023623736 8023625255 118
87 iso_pu_bacteria 8047893842 8047902013 118
88 iso_pu_bacteria 8048356638 8048366077 118
89 iso_pu_bacteria 8048369669 8048369809 118
90 iso_pu_bacteria 8048379754 8048389534 118
91 iso_pu_bacteria 8053945823 8053953866 118
92 iso_pu_bacteria 8055037949 8055039616 118
93 iso_pu_bacteria 8057345674 8057346950 118
94 3300006038 Ga0075365_10000731 Ga0075365_1000073113 119
95 3300006051 Ga0075364_10005118 Ga0075364_100051185 119
96 3300046492 Ga0495585_0076551 Ga0495585_0076551_10_414 119
97 3300050491 nmdc:mga00v17_6583_c1 nmdc:mga00v17_6583_c1_2569_2928 119
98 3300050492 nmdc:mga0yw44_101984_c1 nmdc:mga0yw44_101984_c1_344_703 119
99 iso_pu_bacteria 2839986021 2839988536 119
100 iso_pu_bacteria 2919713450 2919716419 119
101 3300005327 Ga0070658_10069021 Ga0070658_100690213 120
102 3300005577 Ga0068857_100000219 Ga0068857_10000021914 120
103 3300005614 Ga0068856_101343796 Ga0068856_1013437961 120
104 3300025909 Ga0207705_10038350 Ga0207705_100383504 120
105 3300026116 Ga0207674_10004533 Ga0207674_1000453317 120
106 3300044693 Ga0466961_0400771 Ga0466961_0400771_421_783 120
107 3300046535 Ga0495586_0646462 Ga0495586_0646462_89_451 120
108 3300053084 Ga0495595_0019616 Ga0495595_0019616_766_1152 120
109 3300009101 Ga0105247_10569714 Ga0105247_105697142 121
110 3300032004 Ga0307414_11051467 Ga0307414_110514672 121
111 3300041443 Ga0451789_0854918 Ga0451789_0854918_1351_1716 121
112 3300041453 Ga0451797_1326552 Ga0451797_1326552_47_412 121
113 3300044658 Ga0466972_0001226 Ga0466972_0001226_8790_9155 121
114 3300044765 Ga0466970_0181213 Ga0466970_0181213_318_683 121
115 3300044901 Ga0466960_0102313 Ga0466960_0102313_587_952 121
116 3300048907 Ga0496104_0412535 Ga0496104_0412535_109_474 121
117 3300053140 Ga0500573_0002012 Ga0500573_0002012_6776_7162 121
118 3300053140 Ga0500573_0279293 Ga0500573_0279293_48_413 121
119 3300053153 Ga0500616_0000233 Ga0500616_0000233_77490_77855 121
120 3300001976 JGI24752J21851_1010536 JGI24752J21851_10105362 122
121 3300002067 JGI24735J21928_10048869 JGI24735J21928_100488692 122
122 3300003322 rootL2_10219826 rootL2_102198262 122
123 3300003323 rootH1_10035436 rootH1_100354363 122
124 3300003323 rootH1_10186625 rootH1_101866252 122
125 3300003578 Ga0006562J51391_1027142 Ga0006562J51391_10271428 122
126 3300003578 Ga0006562J51391_1083918 Ga0006562J51391_10839184 122
127 3300003752 Ga0055539_1003713 Ga0055539_10037132 122
128 3300003756 Ga0055533_1000002 Ga0055533_1000002213 122
129 3300003758 Ga0055532_1006111 Ga0055532_10061113 122
130 3300003759 Ga0055525_1000022 Ga0055525_10000228 122
131 3300003760 Ga0055527_1000003 Ga0055527_1000003333 122
132 3300003762 Ga0055542_1000005 Ga0055542_1000005197 122
133 3300003763 Ga0055529_1000006 Ga0055529_1000006333 122
134 3300003792 Ga0055540_1001685 Ga0055540_100168514 122
135 3300003792 Ga0055540_1012590 Ga0055540_10125903 122
136 3300003841 Ga0055541_1001766 Ga0055541_10017664 122
137 3300003911 JGI25405J52794_10013514 JGI25405J52794_100135143 122
138 3300005327 Ga0070658_10155907 Ga0070658_101559073 122
139 3300005329 Ga0070683_100831485 Ga0070683_1008314852 122
140 3300005331 Ga0070670_100267040 Ga0070670_1002670403 122
141 3300005331 Ga0070670_100768960 Ga0070670_1007689602 122
142 3300005334 Ga0068869_100093729 Ga0068869_1000937291 122
143 3300005334 Ga0068869_100199627 Ga0068869_1001996271 122
144 3300005334 Ga0068869_100348330 Ga0068869_1003483301 122
145 3300005334 Ga0068869_100593625 Ga0068869_1005936252 122
146 3300005336 Ga0070680_100014073 Ga0070680_1000140736 122
147 3300005337 Ga0070682_100050528 Ga0070682_1000505284 122
148 3300005337 Ga0070682_100089350 Ga0070682_1000893502 122
149 3300005337 Ga0070682_100119829 Ga0070682_1001198292 122
150 3300005337 Ga0070682_100330123 Ga0070682_1003301232 122
151 3300005337 Ga0070682_100719045 Ga0070682_1007190451 122
152 3300005338 Ga0068868_100207661 Ga0068868_1002076613 122
153 3300005338 Ga0068868_100278091 Ga0068868_1002780912 122
154 3300005338 Ga0068868_101021408 Ga0068868_1010214082 122
155 3300005339 Ga0070660_100184357 Ga0070660_1001843573 122
156 3300005339 Ga0070660_101876016 Ga0070660_1018760161 122
157 3300005340 Ga0070689_100281940 Ga0070689_1002819403 122
158 3300005341 Ga0070691_10048526 Ga0070691_100485263 122
159 3300005344 Ga0070661_100064464 Ga0070661_1000644644 122
160 3300005345 Ga0070692_10023689 Ga0070692_100236892 122
161 3300005345 Ga0070692_10221566 Ga0070692_102215661 122
162 3300005347 Ga0070668_100003885 Ga0070668_1000038859 122
163 3300005347 Ga0070668_100021409 Ga0070668_1000214095 122
164 3300005347 Ga0070668_100022785 Ga0070668_1000227853 122
165 3300005347 Ga0070668_100783834 Ga0070668_1007838341 122
166 3300005347 Ga0070668_101783442 Ga0070668_1017834421 122
167 3300005354 Ga0070675_100055477 Ga0070675_1000554774 122
168 3300005354 Ga0070675_100173026 Ga0070675_1001730261 122
169 3300005355 Ga0070671_100005155 Ga0070671_10000515510 122
170 3300005355 Ga0070671_100016974 Ga0070671_1000169747 122
171 3300005356 Ga0070674_100370167 Ga0070674_1003701673 122
172 3300005356 Ga0070674_100489125 Ga0070674_1004891252 122
173 3300005364 Ga0070673_100197383 Ga0070673_1001973832 122
174 3300005365 Ga0070688_100860365 Ga0070688_1008603651 122
175 3300005366 Ga0070659_100187444 Ga0070659_1001874442 122
176 3300005367 Ga0070667_100277600 Ga0070667_1002776003 122
177 3300005434 Ga0070709_10208941 Ga0070709_102089412 122
178 3300005435 Ga0070714_100000844 Ga0070714_10000084412 122
179 3300005435 Ga0070714_100008410 Ga0070714_1000084101 122
180 3300005435 Ga0070714_100144784 Ga0070714_1001447843 122
181 3300005435 Ga0070714_100483152 Ga0070714_1004831521 122
182 3300005435 Ga0070714_100518302 Ga0070714_1005183021 122
183 3300005436 Ga0070713_100554308 Ga0070713_1005543082 122
184 3300005437 Ga0070710_10000233 Ga0070710_100002334 122
185 3300005437 Ga0070710_10758533 Ga0070710_107585331 122
186 3300005438 Ga0070701_10142430 Ga0070701_101424302 122
187 3300005455 Ga0070663_100003232 Ga0070663_1000032324 122
188 3300005455 Ga0070663_100040305 Ga0070663_1000403052 122
189 3300005455 Ga0070663_100236500 Ga0070663_1002365001 122
190 3300005455 Ga0070663_100796930 Ga0070663_1007969301 122
191 3300005455 Ga0070663_101421462 Ga0070663_1014214621 122
192 3300005455 Ga0070663_101441029 Ga0070663_1014410291 122
193 3300005456 Ga0070678_100049155 Ga0070678_1000491554 122
194 3300005456 Ga0070678_100346766 Ga0070678_1003467662 122
195 3300005456 Ga0070678_100921968 Ga0070678_1009219682 122
196 3300005458 Ga0070681_10143224 Ga0070681_101432244 122
197 3300005458 Ga0070681_11762978 Ga0070681_117629781 122
198 3300005459 Ga0068867_100044791 Ga0068867_1000447913 122
199 3300005459 Ga0068867_100905698 Ga0068867_1009056982 122
200 3300005466 Ga0070685_10785618 Ga0070685_107856181 122
201 3300005467 Ga0070706_101378621 Ga0070706_1013786211 122
202 3300005518 Ga0070699_101091550 Ga0070699_1010915501 122
203 3300005530 Ga0070679_100063441 Ga0070679_1000634414 122
204 3300005530 Ga0070679_100275266 Ga0070679_1002752662 122
205 3300005530 Ga0070679_101586491 Ga0070679_1015864911 122
206 3300005530 Ga0070679_101734524 Ga0070679_1017345241 122
207 3300005535 Ga0070684_100051065 Ga0070684_1000510653 122
208 3300005539 Ga0068853_100586664 Ga0068853_1005866643 122
209 3300005539 Ga0068853_101426743 Ga0068853_1014267431 122
210 3300005543 Ga0070672_100126901 Ga0070672_1001269014 122
211 3300005543 Ga0070672_100328130 Ga0070672_1003281302 122
212 3300005543 Ga0070672_100439339 Ga0070672_1004393392 122
213 3300005546 Ga0070696_100646810 Ga0070696_1006468102 122
214 3300005547 Ga0070693_100020573 Ga0070693_1000205733 122
215 3300005548 Ga0070665_100001588 Ga0070665_10000158811 122
216 3300005548 Ga0070665_100367292 Ga0070665_1003672922 122
217 3300005548 Ga0070665_101537980 Ga0070665_1015379802 122
218 3300005564 Ga0070664_100346996 Ga0070664_1003469963 122
219 3300005577 Ga0068857_100266513 Ga0068857_1002665132 122
220 3300005578 Ga0068854_100351327 Ga0068854_1003513272 122
221 3300005578 Ga0068854_100635870 Ga0068854_1006358702 122
222 3300005578 Ga0068854_101491514 Ga0068854_1014915142 122
223 3300005614 Ga0068856_100268053 Ga0068856_1002680533 122
224 3300005614 Ga0068856_100338758 Ga0068856_1003387582 122
225 3300005615 Ga0070702_100040249 Ga0070702_1000402494 122
226 3300005615 Ga0070702_100049029 Ga0070702_1000490293 122
227 3300005615 Ga0070702_100560366 Ga0070702_1005603662 122
228 3300005616 Ga0068852_100231788 Ga0068852_1002317883 122
229 3300005616 Ga0068852_100426429 Ga0068852_1004264292 122
230 3300005616 Ga0068852_100939471 Ga0068852_1009394712 122
231 3300005616 Ga0068852_101205920 Ga0068852_1012059202 122
232 3300005617 Ga0068859_100026048 Ga0068859_1000260484 122
233 3300005618 Ga0068864_100572740 Ga0068864_1005727401 122
234 3300005718 Ga0068866_10591238 Ga0068866_105912381 122
235 3300005719 Ga0068861_100236197 Ga0068861_1002361972 122
236 3300005719 Ga0068861_100395029 Ga0068861_1003950292 122
237 3300005834 Ga0068851_10014251 Ga0068851_100142514 122
238 3300005840 Ga0068870_10018071 Ga0068870_100180714 122
239 3300005840 Ga0068870_10437243 Ga0068870_104372432 122
240 3300005840 Ga0068870_10670152 Ga0068870_106701522 122
241 3300005841 Ga0068863_100063922 Ga0068863_1000639224 122
242 3300005841 Ga0068863_100293918 Ga0068863_1002939182 122
243 3300005842 Ga0068858_100001421 Ga0068858_10000142132 122
244 3300005842 Ga0068858_100246436 Ga0068858_1002464362 122
245 3300005843 Ga0068860_100059898 Ga0068860_1000598983 122
246 3300005843 Ga0068860_100481054 Ga0068860_1004810542 122
247 3300005843 Ga0068860_100711073 Ga0068860_1007110731 122
248 3300005844 Ga0068862_100893611 Ga0068862_1008936112 122
249 3300005844 Ga0068862_101063908 Ga0068862_1010639082 122
250 3300005844 Ga0068862_101416235 Ga0068862_1014162351 122
251 3300005937 Ga0081455_10000483 Ga0081455_1000048341 122
252 3300005985 Ga0081539_10071622 Ga0081539_100716221 122
253 3300005985 Ga0081539_10192406 Ga0081539_101924062 122
254 3300006038 Ga0075365_10031922 Ga0075365_100319224 122
255 3300006038 Ga0075365_10039802 Ga0075365_100398023 122
256 3300006038 Ga0075365_10060232 Ga0075365_100602324 122
257 3300006038 Ga0075365_10154275 Ga0075365_101542753 122
258 3300006038 Ga0075365_10177935 Ga0075365_101779352 122
259 3300006038 Ga0075365_10236714 Ga0075365_102367141 122
260 3300006038 Ga0075365_10270631 Ga0075365_102706312 122
261 3300006038 Ga0075365_10278935 Ga0075365_102789351 122
262 3300006038 Ga0075365_10285571 Ga0075365_102855712 122
263 3300006038 Ga0075365_10383656 Ga0075365_103836562 122
264 3300006038 Ga0075365_10686158 Ga0075365_106861582 122
265 3300006038 Ga0075365_11131960 Ga0075365_111319601 122
266 3300006042 Ga0075368_10008004 Ga0075368_100080047 122
267 3300006042 Ga0075368_10178749 Ga0075368_101787492 122
268 3300006048 Ga0075363_100007181 Ga0075363_1000071812 122
269 3300006048 Ga0075363_100187031 Ga0075363_1001870311 122
270 3300006051 Ga0075364_10016785 Ga0075364_100167851 122
271 3300006051 Ga0075364_10023072 Ga0075364_100230723 122
272 3300006051 Ga0075364_10051767 Ga0075364_100517673 122
273 3300006051 Ga0075364_10173877 Ga0075364_101738772 122
274 3300006051 Ga0075364_10208586 Ga0075364_102085862 122
275 3300006051 Ga0075364_10238670 Ga0075364_102386702 122
276 3300006051 Ga0075364_10272332 Ga0075364_102723322 122
277 3300006051 Ga0075364_10327572 Ga0075364_103275722 122
278 3300006051 Ga0075364_10330049 Ga0075364_103300491 122
279 3300006051 Ga0075364_10349401 Ga0075364_103494012 122
280 3300006051 Ga0075364_10484534 Ga0075364_104845342 122
281 3300006051 Ga0075364_10616472 Ga0075364_106164721 122
282 3300006058 Ga0075432_10044504 Ga0075432_100445042 122
283 3300006173 Ga0070716_100558415 Ga0070716_1005584152 122
284 3300006177 Ga0075362_10339103 Ga0075362_103391031 122
285 3300006178 Ga0075367_10000964 Ga0075367_1000096410 122
286 3300006178 Ga0075367_10087900 Ga0075367_100879002 122
287 3300006178 Ga0075367_10108529 Ga0075367_101085293 122
288 3300006178 Ga0075367_10709031 Ga0075367_107090312 122
289 3300006186 Ga0075369_10006285 Ga0075369_100062855 122
290 3300006186 Ga0075369_10015288 Ga0075369_100152882 122
291 3300006186 Ga0075369_10040628 Ga0075369_100406284 122
292 3300006237 Ga0097621_100163311 Ga0097621_1001633112 122
293 3300006353 Ga0075370_10008827 Ga0075370_100088276 122
294 3300006353 Ga0075370_10113285 Ga0075370_101132851 122
295 3300006353 Ga0075370_10182640 Ga0075370_101826403 122
296 3300006358 Ga0068871_100169990 Ga0068871_1001699903 122
297 3300006847 Ga0075431_101077486 Ga0075431_1010774862 122
298 3300006852 Ga0075433_10385350 Ga0075433_103853501 122
299 3300006871 Ga0075434_100310396 Ga0075434_1003103961 122
300 3300006881 Ga0068865_101025395 Ga0068865_1010253952 122
301 3300006881 Ga0068865_101873214 Ga0068865_1018732141 122
302 3300006914 Ga0075436_100035970 Ga0075436_1000359703 122
303 3300006931 Ga0097620_100026048 Ga0097620_1000260484 122
304 3300006948 Ga0099826_10340863 Ga0099826_103408632 122
305 3300007076 Ga0075435_100043739 Ga0075435_1000437394 122
306 3300007788 Ga0099795_10128415 Ga0099795_101284151 122
307 3300009011 Ga0105251_10065735 Ga0105251_100657353 122
308 3300009036 Ga0105244_10016522 Ga0105244_100165224 122
309 3300009036 Ga0105244_10017359 Ga0105244_100173593 122
310 3300009036 Ga0105244_10019572 Ga0105244_100195724 122
311 3300009036 Ga0105244_10054498 Ga0105244_100544982 122
312 3300009036 Ga0105244_10194218 Ga0105244_101942182 122
313 3300009036 Ga0105244_10382996 Ga0105244_103829961 122
314 3300009093 Ga0105240_10090033 Ga0105240_100900336 122
315 3300009093 Ga0105240_10620532 Ga0105240_106205321 122
316 3300009093 Ga0105240_11978664 Ga0105240_119786641 122
317 3300009094 Ga0111539_10051853 Ga0111539_100518533 122
318 3300009098 Ga0105245_10231936 Ga0105245_102319363 122
319 3300009098 Ga0105245_10566266 Ga0105245_105662662 122
320 3300009101 Ga0105247_10153706 Ga0105247_101537063 122
321 3300009147 Ga0114129_11105562 Ga0114129_111055622 122
322 3300009148 Ga0105243_10003992 Ga0105243_100039925 122
323 3300009148 Ga0105243_10005136 Ga0105243_100051363 122
324 3300009148 Ga0105243_10131058 Ga0105243_101310583 122
325 3300009148 Ga0105243_10355725 Ga0105243_103557253 122
326 3300009148 Ga0105243_10751527 Ga0105243_107515272 122
327 3300009148 Ga0105243_10975037 Ga0105243_109750372 122
328 3300009148 Ga0105243_12167731 Ga0105243_121677312 122
329 3300009174 Ga0105241_10040904 Ga0105241_100409043 122
330 3300009176 Ga0105242_12435950 Ga0105242_124359501 122
331 3300009177 Ga0105248_10001035 Ga0105248_1000103518 122
332 3300009177 Ga0105248_10269060 Ga0105248_102690603 122
333 3300009177 Ga0105248_11639086 Ga0105248_116390861 122
334 3300009545 Ga0105237_10333189 Ga0105237_103331892 122
335 3300009545 Ga0105237_10367662 Ga0105237_103676623 122
336 3300009551 Ga0105238_10218806 Ga0105238_102188062 122
337 3300009551 Ga0105238_10273108 Ga0105238_102731083 122
338 3300009551 Ga0105238_10385670 Ga0105238_103856702 122
339 3300009551 Ga0105238_10394620 Ga0105238_103946202 122
340 3300009553 Ga0105249_10507688 Ga0105249_105076882 122
341 3300010159 Ga0099796_10300559 Ga0099796_103005591 122
342 3300010375 Ga0105239_10010822 Ga0105239_1001082210 122
343 3300010375 Ga0105239_10449641 Ga0105239_104496412 122
344 3300010375 Ga0105239_10656549 Ga0105239_106565492 122
345 3300010375 Ga0105239_12602529 Ga0105239_126025292 122
346 3300011119 Ga0105246_10000044 Ga0105246_1000004412 122
347 3300011119 Ga0105246_10043650 Ga0105246_100436501 122
348 3300011119 Ga0105246_11032581 Ga0105246_110325811 122
349 3300011119 Ga0105246_11120916 Ga0105246_111209161 122
350 3300011119 Ga0105246_11725969 Ga0105246_117259691 122
351 3300012507 Ga0157342_1013526 Ga0157342_10135262 122
352 3300012512 Ga0157327_1043020 Ga0157327_10430201 122
353 3300012515 Ga0157338_1079959 Ga0157338_10799591 122
354 3300013100 Ga0157373_10197183 Ga0157373_101971832 122
355 3300013102 Ga0157371_10102271 Ga0157371_101022713 122
356 3300013102 Ga0157371_11640155 Ga0157371_116401551 122
357 3300013104 Ga0157370_10111705 Ga0157370_101117054 122
358 3300013104 Ga0157370_10159688 Ga0157370_101596882 122
359 3300013104 Ga0157370_11438004 Ga0157370_114380041 122
360 3300013105 Ga0157369_10029320 Ga0157369_100293205 122
361 3300013105 Ga0157369_10070492 Ga0157369_100704925 122
362 3300013105 Ga0157369_10192999 Ga0157369_101929992 122
363 3300013105 Ga0157369_10283932 Ga0157369_102839323 122
364 3300013105 Ga0157369_10419368 Ga0157369_104193681 122
365 3300013105 Ga0157369_11292593 Ga0157369_112925932 122
366 3300013105 Ga0157369_12244627 Ga0157369_122446272 122
367 3300013296 Ga0157374_10059174 Ga0157374_100591744 122
368 3300013296 Ga0157374_11941248 Ga0157374_119412482 122
369 3300013297 Ga0157378_10585023 Ga0157378_105850232 122
370 3300013297 Ga0157378_11445838 Ga0157378_114458381 122
371 3300013297 Ga0157378_12300611 Ga0157378_123006112 122
372 3300013306 Ga0163162_10580219 Ga0163162_105802192 122
373 3300013306 Ga0163162_11018708 Ga0163162_110187082 122
374 3300013307 Ga0157372_10099931 Ga0157372_100999314 122
375 3300013307 Ga0157372_10365947 Ga0157372_103659472 122
376 3300013307 Ga0157372_10751174 Ga0157372_107511743 122
377 3300013307 Ga0157372_10905491 Ga0157372_109054911 122
378 3300013307 Ga0157372_11216273 Ga0157372_112162732 122
379 3300013307 Ga0157372_12143934 Ga0157372_121439342 122
380 3300013307 Ga0157372_12306724 Ga0157372_123067241 122
381 3300013308 Ga0157375_10248371 Ga0157375_102483712 122
382 3300013308 Ga0157375_10496971 Ga0157375_104969713 122
383 3300013308 Ga0157375_10683779 Ga0157375_106837793 122
384 3300013308 Ga0157375_12145089 Ga0157375_121450891 122
385 3300014325 Ga0163163_10107231 Ga0163163_101072313 122
386 3300014325 Ga0163163_11710802 Ga0163163_117108022 122
387 3300014326 Ga0157380_10018061 Ga0157380_100180612 122
388 3300014326 Ga0157380_10829662 Ga0157380_108296621 122
389 3300014326 Ga0157380_11070181 Ga0157380_110701812 122
390 3300014326 Ga0157380_13064422 Ga0157380_130644221 122
391 3300014745 Ga0157377_10043815 Ga0157377_100438153 122
392 3300014745 Ga0157377_10209474 Ga0157377_102094742 122
393 3300014745 Ga0157377_11123691 Ga0157377_111236911 122
394 3300014968 Ga0157379_10131373 Ga0157379_101313732 122
395 3300014969 Ga0157376_10273378 Ga0157376_102733783 122
396 3300015688 Ga0183367_1004 Ga0183367_1004392 122
397 3300017792 Ga0163161_10032074 Ga0163161_100320743 122
398 3300017792 Ga0163161_10121019 Ga0163161_101210192 122
399 3300017792 Ga0163161_10730264 Ga0163161_107302642 122
400 3300017792 Ga0163161_11954360 Ga0163161_119543601 122
401 3300020069 Ga0197907_11039976 Ga0197907_110399761 122
402 3300020069 Ga0197907_11497675 Ga0197907_114976751 122
403 3300020070 Ga0206356_10230095 Ga0206356_102300952 122
404 3300020070 Ga0206356_11269870 Ga0206356_112698701 122
405 3300020075 Ga0206349_1124982 Ga0206349_11249822 122
406 3300020077 Ga0206351_10641595 Ga0206351_106415953 122
407 3300020080 Ga0206350_11557265 Ga0206350_115572652 122
408 3300020081 Ga0206354_10195925 Ga0206354_101959252 122
409 3300020082 Ga0206353_10846297 Ga0206353_108462973 122
410 3300020082 Ga0206353_12056045 Ga0206353_120560453 122
411 3300020610 Ga0154015_1392376 Ga0154015_13923762 122
412 3300020610 Ga0154015_1424168 Ga0154015_14241682 122
413 3300022467 Ga0224712_10023372 Ga0224712_100233723 122
414 3300025225 Ga0209566_100032 Ga0209566_100032214 122
415 3300025226 Ga0209674_100001 Ga0209674_1000013350 122
416 3300025228 Ga0209672_100003 Ga0209672_1000031172 122
417 3300025228 Ga0209672_109945 Ga0209672_1099453 122
418 3300025229 Ga0209147_100551 Ga0209147_1005517 122
419 3300025230 Ga0209563_100001 Ga0209563_1000013350 122
420 3300025233 Ga0209437_100662 Ga0209437_10066217 122
421 3300025242 Ga0209258_108829 Ga0209258_1088292 122
422 3300025253 Ga0209677_100001 Ga0209677_1000013350 122
423 3300025253 Ga0209677_101476 Ga0209677_1014767 122
424 3300025254 Ga0209148_1000004 Ga0209148_10000041467 122
425 3300025272 Ga0209455_1000091 Ga0209455_1000091138 122
426 3300025272 Ga0209455_1000975 Ga0209455_100097515 122
427 3300025273 Ga0209673_1019300 Ga0209673_10193002 122
428 3300025294 Ga0209025_1077803 Ga0209025_10778032 122
429 3300025303 Ga0209051_1005852 Ga0209051_10058524 122
430 3300025303 Ga0209051_1008594 Ga0209051_10085945 122
431 3300025303 Ga0209051_1018280 Ga0209051_10182803 122
432 3300025303 Ga0209051_1026798 Ga0209051_10267983 122
433 3300025321 Ga0207656_10075654 Ga0207656_100756541 122
434 3300025728 Ga0207655_1002175 Ga0207655_10021755 122
435 3300025728 Ga0207655_1019753 Ga0207655_10197532 122
436 3300025728 Ga0207655_1090282 Ga0207655_10902822 122
437 3300025893 Ga0207682_10266515 Ga0207682_102665152 122
438 3300025898 Ga0207692_10010715 Ga0207692_100107154 122
439 3300025899 Ga0207642_10952538 Ga0207642_109525381 122
440 3300025900 Ga0207710_10065927 Ga0207710_100659273 122
441 3300025901 Ga0207688_10207301 Ga0207688_102073012 122
442 3300025904 Ga0207647_10360937 Ga0207647_103609372 122
443 3300025906 Ga0207699_10728986 Ga0207699_107289861 122
444 3300025908 Ga0207643_10022279 Ga0207643_100222794 122
445 3300025908 Ga0207643_10567461 Ga0207643_105674612 122
446 3300025909 Ga0207705_10057363 Ga0207705_100573631 122
447 3300025909 Ga0207705_10863799 Ga0207705_108637992 122
448 3300025911 Ga0207654_10103715 Ga0207654_101037152 122
449 3300025912 Ga0207707_10134437 Ga0207707_101344374 122
450 3300025913 Ga0207695_10074454 Ga0207695_100744545 122
451 3300025913 Ga0207695_10666180 Ga0207695_106661801 122
452 3300025914 Ga0207671_10225677 Ga0207671_102256772 122
453 3300025914 Ga0207671_10244640 Ga0207671_102446402 122
454 3300025914 Ga0207671_10711107 Ga0207671_107111071 122
455 3300025915 Ga0207693_10269273 Ga0207693_102692732 122
456 3300025916 Ga0207663_10396367 Ga0207663_103963672 122
457 3300025917 Ga0207660_10430509 Ga0207660_104305091 122
458 3300025919 Ga0207657_10160115 Ga0207657_101601153 122
459 3300025920 Ga0207649_10100375 Ga0207649_101003753 122
460 3300025921 Ga0207652_10027978 Ga0207652_100279786 122
461 3300025921 Ga0207652_11212895 Ga0207652_112128951 122
462 3300025923 Ga0207681_11832645 Ga0207681_118326451 122
463 3300025924 Ga0207694_10300894 Ga0207694_103008942 122
464 3300025924 Ga0207694_10505264 Ga0207694_105052642 122
465 3300025925 Ga0207650_10097869 Ga0207650_100978693 122
466 3300025925 Ga0207650_10543289 Ga0207650_105432892 122
467 3300025926 Ga0207659_10456912 Ga0207659_104569121 122
468 3300025926 Ga0207659_10901267 Ga0207659_109012672 122
469 3300025927 Ga0207687_10301113 Ga0207687_103011133 122
470 3300025927 Ga0207687_11946913 Ga0207687_119469131 122
471 3300025929 Ga0207664_10045644 Ga0207664_100456445 122
472 3300025929 Ga0207664_10368313 Ga0207664_103683132 122
473 3300025931 Ga0207644_10026063 Ga0207644_100260633 122
474 3300025931 Ga0207644_10051697 Ga0207644_100516971 122
475 3300025931 Ga0207644_11370363 Ga0207644_113703632 122
476 3300025932 Ga0207690_10125531 Ga0207690_101255312 122
477 3300025933 Ga0207706_10134108 Ga0207706_101341082 122
478 3300025935 Ga0207709_10006092 Ga0207709_100060923 122
479 3300025935 Ga0207709_10065896 Ga0207709_100658963 122
480 3300025935 Ga0207709_10108400 Ga0207709_101084001 122
481 3300025935 Ga0207709_11180590 Ga0207709_111805902 122
482 3300025936 Ga0207670_10173692 Ga0207670_101736923 122
483 3300025937 Ga0207669_10371062 Ga0207669_103710622 122
484 3300025938 Ga0207704_10849835 Ga0207704_108498351 122
485 3300025939 Ga0207665_10219242 Ga0207665_102192422 122
486 3300025940 Ga0207691_10122681 Ga0207691_101226814 122
487 3300025940 Ga0207691_10232112 Ga0207691_102321122 122
488 3300025940 Ga0207691_10322967 Ga0207691_103229673 122
489 3300025940 Ga0207691_11063913 Ga0207691_110639131 122
490 3300025941 Ga0207711_10000519 Ga0207711_1000051926 122
491 3300025941 Ga0207711_11091875 Ga0207711_110918751 122
492 3300025942 Ga0207689_10051546 Ga0207689_100515464 122
493 3300025942 Ga0207689_10404260 Ga0207689_104042601 122
494 3300025942 Ga0207689_10963367 Ga0207689_109633672 122
495 3300025944 Ga0207661_10190292 Ga0207661_101902923 122
496 3300025944 Ga0207661_11162946 Ga0207661_111629461 122
497 3300025945 Ga0207679_10335069 Ga0207679_103350692 122
498 3300025949 Ga0207667_10021672 Ga0207667_1002167210 122
499 3300025949 Ga0207667_10366642 Ga0207667_103666423 122
500 3300025960 Ga0207651_10582200 Ga0207651_105822002 122
501 3300025972 Ga0207668_10006122 Ga0207668_100061224 122
502 3300025972 Ga0207668_10028517 Ga0207668_100285173 122
503 3300025972 Ga0207668_10096609 Ga0207668_100966092 122
504 3300025972 Ga0207668_11317763 Ga0207668_113177631 122
505 3300025981 Ga0207640_10070755 Ga0207640_100707552 122
506 3300025986 Ga0207658_10255904 Ga0207658_102559042 122
507 3300025986 Ga0207658_10340981 Ga0207658_103409813 122
508 3300026023 Ga0207677_10173622 Ga0207677_101736221 122
509 3300026023 Ga0207677_10902634 Ga0207677_109026341 122
510 3300026035 Ga0207703_10001728 Ga0207703_100017281 122
511 3300026041 Ga0207639_10226101 Ga0207639_102261012 122
512 3300026067 Ga0207678_10000523 Ga0207678_1000052318 122
513 3300026067 Ga0207678_10114218 Ga0207678_101142182 122
514 3300026067 Ga0207678_10197485 Ga0207678_101974853 122
515 3300026067 Ga0207678_10218475 Ga0207678_102184753 122
516 3300026067 Ga0207678_10992075 Ga0207678_109920751 122
517 3300026075 Ga0207708_10116776 Ga0207708_101167763 122
518 3300026078 Ga0207702_10003794 Ga0207702_100037944 122
519 3300026078 Ga0207702_10767265 Ga0207702_107672652 122
520 3300026088 Ga0207641_10189307 Ga0207641_101893074 122
521 3300026088 Ga0207641_10262913 Ga0207641_102629133 122
522 3300026088 Ga0207641_10322650 Ga0207641_103226502 122
523 3300026089 Ga0207648_10379223 Ga0207648_103792232 122
524 3300026095 Ga0207676_10277319 Ga0207676_102773192 122
525 3300026095 Ga0207676_12271600 Ga0207676_122716002 122
526 3300026116 Ga0207674_10225383 Ga0207674_102253833 122
527 3300026118 Ga0207675_100509749 Ga0207675_1005097492 122
528 3300026121 Ga0207683_10063441 Ga0207683_100634412 122
529 3300026121 Ga0207683_10671955 Ga0207683_106719552 122
530 3300026142 Ga0207698_10301324 Ga0207698_103013242 122
531 3300026142 Ga0207698_10309087 Ga0207698_103090873 122
532 3300026142 Ga0207698_11715878 Ga0207698_117158781 122
533 3300027312 Ga0209371_1026907 Ga0209371_10269072 122
534 3300027866 Ga0209813_10039242 Ga0209813_100392422 122
535 3300027866 Ga0209813_10162578 Ga0209813_101625781 122
536 3300027907 Ga0207428_10055196 Ga0207428_100551964 122
537 3300028017 Ga0265356_1012565 Ga0265356_10125651 122
538 3300028379 Ga0268266_10262357 Ga0268266_102623573 122
539 3300028379 Ga0268266_10270079 Ga0268266_102700793 122
540 3300028379 Ga0268266_10317821 Ga0268266_103178212 122
541 3300028379 Ga0268266_11683963 Ga0268266_116839631 122
542 3300028380 Ga0268265_10064135 Ga0268265_100641355 122
543 3300028380 Ga0268265_10167741 Ga0268265_101677412 122
544 3300028380 Ga0268265_11507675 Ga0268265_115076752 122
545 3300028381 Ga0268264_10068251 Ga0268264_100682512 122
546 3300028381 Ga0268264_10458365 Ga0268264_104583652 122
547 3300028381 Ga0268264_10680120 Ga0268264_106801201 122
548 3300028381 Ga0268264_11915145 Ga0268264_119151452 122
549 3300028786 Ga0307517_10527502 Ga0307517_105275021 122
550 3300028786 Ga0307517_10628325 Ga0307517_106283252 122
551 3300028794 Ga0307515_10000476 Ga0307515_1000047614 122
552 3300028794 Ga0307515_10006481 Ga0307515_100064816 122
553 3300028794 Ga0307515_10027722 Ga0307515_100277222 122
554 3300028794 Ga0307515_10147113 Ga0307515_101471131 122
555 3300028794 Ga0307515_10150139 Ga0307515_101501393 122
556 3300028794 Ga0307515_10347340 Ga0307515_103473401 122
557 3300030521 Ga0307511_10143414 Ga0307511_101434143 122
558 3300030522 Ga0307512_10016370 Ga0307512_100163701 122
559 3300030522 Ga0307512_10077703 Ga0307512_100777034 122
560 3300031090 Ga0265760_10061215 Ga0265760_100612151 122
561 3300031247 Ga0265340_10000636 Ga0265340_100006364 122
562 3300031251 Ga0265327_10000019 Ga0265327_10000019297 122
563 3300031251 Ga0265327_10000071 Ga0265327_1000007116 122
564 3300031456 Ga0307513_10000123 Ga0307513_1000012317 122
565 3300031456 Ga0307513_10011893 Ga0307513_100118933 122
566 3300031456 Ga0307513_10195295 Ga0307513_101952953 122
567 3300031456 Ga0307513_10222619 Ga0307513_102226193 122
568 3300031456 Ga0307513_10366606 Ga0307513_103666061 122
569 3300031456 Ga0307513_10887487 Ga0307513_108874872 122
570 3300031548 Ga0307408_100571890 Ga0307408_1005718901 122
571 3300031616 Ga0307508_10105434 Ga0307508_101054343 122
572 3300031649 Ga0307514_10032573 Ga0307514_100325735 122
573 3300031649 Ga0307514_10041798 Ga0307514_100417985 122
574 3300031649 Ga0307514_10108662 Ga0307514_101086623 122
575 3300031649 Ga0307514_10118788 Ga0307514_101187883 122
576 3300031730 Ga0307516_10001960 Ga0307516_1000196021 122
577 3300031730 Ga0307516_10037037 Ga0307516_100370374 122
578 3300031730 Ga0307516_10159378 Ga0307516_101593782 122
579 3300031730 Ga0307516_10889491 Ga0307516_108894911 122
580 3300031824 Ga0307413_10176423 Ga0307413_101764231 122
581 3300031824 Ga0307413_11585064 Ga0307413_115850641 122
582 3300031824 Ga0307413_11677767 Ga0307413_116777671 122
583 3300031838 Ga0307518_10001506 Ga0307518_100015068 122
584 3300031838 Ga0307518_10016128 Ga0307518_100161283 122
585 3300031838 Ga0307518_10095620 Ga0307518_100956204 122
586 3300031838 Ga0307518_10413369 Ga0307518_104133692 122
587 3300031852 Ga0307410_10061901 Ga0307410_100619014 122
588 3300031852 Ga0307410_10509644 Ga0307410_105096441 122
589 3300031901 Ga0307406_10284363 Ga0307406_102843631 122
590 3300031901 Ga0307406_11641234 Ga0307406_116412342 122
591 3300031903 Ga0307407_10611108 Ga0307407_106111081 122
592 3300031903 Ga0307407_10738820 Ga0307407_107388201 122
593 3300031911 Ga0307412_10028693 Ga0307412_100286931 122
594 3300031911 Ga0307412_11417523 Ga0307412_114175231 122
595 3300031995 Ga0307409_100126389 Ga0307409_1001263893 122
596 3300031995 Ga0307409_100224941 Ga0307409_1002249412 122
597 3300031995 Ga0307409_102768669 Ga0307409_1027686691 122
598 3300032002 Ga0307416_100348795 Ga0307416_1003487952 122
599 3300032002 Ga0307416_101237705 Ga0307416_1012377051 122
600 3300032004 Ga0307414_10141732 Ga0307414_101417323 122
601 3300032004 Ga0307414_11481923 Ga0307414_114819232 122
602 3300032004 Ga0307414_12287257 Ga0307414_122872571 122
603 3300032005 Ga0307411_11335360 Ga0307411_113353602 122
604 3300032126 Ga0307415_100103128 Ga0307415_1001031282 122
605 3300032126 Ga0307415_100631784 Ga0307415_1006317842 122
606 3300032126 Ga0307415_100744800 Ga0307415_1007448002 122
607 3300032126 Ga0307415_101069387 Ga0307415_1010693871 122
608 3300032126 Ga0307415_101840240 Ga0307415_1018402401 122
609 3300033179 Ga0307507_10052583 Ga0307507_100525832 122
610 3300033179 Ga0307507_10075955 Ga0307507_100759552 122
611 3300033180 Ga0307510_10038499 Ga0307510_100384994 122
612 3300033545 Ga0316214_1007998 Ga0316214_10079982 122
613 3300033547 Ga0316212_1036648 Ga0316212_10366482 122
614 3300034817 Ga0373948_0064811 Ga0373948_0064811_416_784 122
615 3300034957 Ga0373938_0025982 Ga0373938_0025982_736_1125 122
616 3300035088 Ga0373940_0168083 Ga0373940_0168083_283_672 122
617 3300035089 Ga0373944_0309178 Ga0373944_0309178_197_565 122
618 3300035091 Ga0373951_0000075 Ga0373951_0000075_17048_17416 122
619 3300035092 Ga0373952_0249473 Ga0373952_0249473_46_414 122
620 3300035114 Ga0373939_0370450 Ga0373939_0370450_128_517 122
621 3300035116 Ga0373945_0156024 Ga0373945_0156024_114_482 122
622 3300035170 Ga0373943_0771462 Ga0373943_0771462_35_403 122
623 3300035207 Ga0373942_0002622 Ga0373942_0002622_528_917 122
624 3300035241 Ga0373961_0293823 Ga0373961_0293823_201_569 122
625 3300035242 Ga0373962_0067115 Ga0373962_0067115_300_668 122
626 3300035691 Ga0373931_0145114 Ga0373931_0145114_591_959 122
627 3300035692 Ga0373935_0845373 Ga0373935_0845373_246_614 122
628 3300035725 Ga0373947_0353874 Ga0373947_0353874_331_699 122
629 3300036459 Ga0372808_031836 Ga0372808_031836_22_390 122
630 3300036459 Ga0372808_051894 Ga0372808_051894_94_462 122
631 3300037068 Ga0373925_0000954 Ga0373925_0000954_4514_4882 122
632 3300037312 Ga0395899_0002933 Ga0395899_0002933_5432_5800 122
633 3300037312 Ga0395899_0026682 Ga0395899_0026682_758_1126 122
634 3300037418 Ga0395900_0002361 Ga0395900_0002361_9281_9649 122
635 3300037418 Ga0395900_0592148 Ga0395900_0592148_345_713 122
636 3300037466 Ga0395898_0000321 Ga0395898_0000321_41467_41835 122
637 3300037466 Ga0395898_1417179 Ga0395898_1417179_105_473 122
638 3300037853 Ga0436364_1195756 Ga0436364_1195756_1936_2304 122
639 3300041441 Ga0451787_032442 Ga0451787_032442_356_724 122
640 3300041443 Ga0451789_0213093 Ga0451789_0213093_62_430 122
641 3300041451 Ga0451791_0259315 Ga0451791_0259315_738_1148 122
642 3300041451 Ga0451791_0533426 Ga0451791_0533426_6807_7175 122
643 3300041451 Ga0451791_1568974 Ga0451791_1568974_16_384 122
644 3300041452 Ga0451793_0945660 Ga0451793_0945660_1614_2024 122
645 3300041453 Ga0451797_0223534 Ga0451797_0223534_1607_1975 122
646 3300041453 Ga0451797_0260210 Ga0451797_0260210_311_679 122
647 3300041453 Ga0451797_1010462 Ga0451797_1010462_193_561 122
648 3300041453 Ga0451797_1447719 Ga0451797_1447719_63_431 122
649 3300041456 Ga0451795_0232793 Ga0451795_0232793_53_421 122
650 3300041456 Ga0451795_1243454 Ga0451795_1243454_234_617 122
651 3300041458 Ga0451798_1164732 Ga0451798_1164732_150_518 122
652 3300041459 Ga0451800_0611837 Ga0451800_0611837_228_596 122
653 3300041459 Ga0451800_1547848 Ga0451800_1547848_130_498 122
654 3300041460 Ga0451802_1237693 Ga0451802_1237693_232_600 122
655 3300041486 Ga0451807_1812773 Ga0451807_1812773_801_1169 122
656 3300041486 Ga0451807_2448106 Ga0451807_2448106_133_501 122
657 3300041491 Ga0451833_0593006 Ga0451833_0593006_80_448 122
658 3300041492 Ga0451835_0715652 Ga0451835_0715652_207_590 122
659 3300041494 Ga0451837_0160372 Ga0451837_0160372_68_436 122
660 3300041494 Ga0451837_0260143 Ga0451837_0260143_350_718 122
661 3300041494 Ga0451837_0336078 Ga0451837_0336078_1272_1640 122
662 3300041494 Ga0451837_0663881 Ga0451837_0663881_1588_1956 122
663 3300041496 Ga0451839_0040102 Ga0451839_0040102_19_387 122
664 3300041498 Ga0451841_0838650 Ga0451841_0838650_124_492 122
665 3300041498 Ga0451841_1169559 Ga0451841_1169559_153_521 122
666 3300041505 Ga0451849_0568500 Ga0451849_0568500_466_834 122
667 3300041505 Ga0451849_0617852 Ga0451849_0617852_372_740 122
668 3300041507 Ga0451851_0764749 Ga0451851_0764749_145_534 122
669 3300041509 Ga0451843_0405326 Ga0451843_0405326_702_1070 122
670 3300041511 Ga0451855_1955659 Ga0451855_1955659_153_521 122
671 3300041512 Ga0451853_0678185 Ga0451853_0678185_469_837 122
672 3300041512 Ga0451853_1645114 Ga0451853_1645114_31_399 122
673 3300041512 Ga0451853_1865336 Ga0451853_1865336_207_617 122
674 3300041512 Ga0451853_2013961 Ga0451853_2013961_106_525 122
675 3300041512 Ga0451853_3422223 Ga0451853_3422223_700_1068 122
676 3300042005 Ga0439448_0006511 Ga0439448_0006511_2230_2598 122
677 3300042008 Ga0439450_055731 Ga0439450_055731_509_877 122
678 3300042012 Ga0439455_0020868 Ga0439455_0020868_1159_1527 122
679 3300042138 Ga0450903_000098 Ga0450903_000098_2943_3311 122
680 3300042157 Ga0439458_0004682 Ga0439458_0004682_1073_1441 122
681 3300042157 Ga0439458_0142526 Ga0439458_0142526_58_426 122
682 3300044656 Ga0466969_0431474 Ga0466969_0431474_137_505 122
683 3300044658 Ga0466972_0053157 Ga0466972_0053157_812_1180 122
684 3300044658 Ga0466972_0067717 Ga0466972_0067717_834_1202 122
685 3300044658 Ga0466972_0228617 Ga0466972_0228617_248_637 122
686 3300044658 Ga0466972_0472748 Ga0466972_0472748_34_402 122
687 3300044683 Ga0466965_0000017 Ga0466965_0000017_55122_55490 122
688 3300044683 Ga0466965_0000816 Ga0466965_0000816_6963_7331 122
689 3300044683 Ga0466965_0003732 Ga0466965_0003732_3194_3583 122
690 3300044683 Ga0466965_0065005 Ga0466965_0065005_29_397 122
691 3300044683 Ga0466965_0091930 Ga0466965_0091930_983_1351 122
692 3300044683 Ga0466965_0236732 Ga0466965_0236732_525_893 122
693 3300044683 Ga0466965_0412316 Ga0466965_0412316_157_525 122
694 3300044684 Ga0466966_0038933 Ga0466966_0038933_106_495 122
695 3300044693 Ga0466961_0058089 Ga0466961_0058089_235_624 122
696 3300044694 Ga0466963_0003809 Ga0466963_0003809_1762_2130 122
697 3300044694 Ga0466963_0718766 Ga0466963_0718766_168_536 122
698 3300044694 Ga0466963_0909669 Ga0466963_0909669_28_417 122
699 3300044706 Ga0466964_0244160 Ga0466964_0244160_233_601 122
700 3300044706 Ga0466964_0501336 Ga0466964_0501336_105_473 122
701 3300044719 Ga0466971_0251759 Ga0466971_0251759_38_406 122
702 3300044719 Ga0466971_0404362 Ga0466971_0404362_225_593 122
703 3300044735 Ga0466968_0049755 Ga0466968_0049755_1095_1463 122
704 3300044735 Ga0466968_0185830 Ga0466968_0185830_103_471 122
705 3300044735 Ga0466968_0209818 Ga0466968_0209818_99_467 122
706 3300044765 Ga0466970_0030921 Ga0466970_0030921_290_658 122
707 3300044765 Ga0466970_0068558 Ga0466970_0068558_807_1196 122
708 3300044765 Ga0466970_0075918 Ga0466970_0075918_90_458 122
709 3300044765 Ga0466970_0702820 Ga0466970_0702820_54_422 122
710 3300044842 Ga0466957_0040034 Ga0466957_0040034_937_1305 122
711 3300044842 Ga0466957_0332365 Ga0466957_0332365_286_675 122
712 3300044842 Ga0466957_0947076 Ga0466957_0947076_220_588 122
713 3300044842 Ga0466957_1077109 Ga0466957_1077109_46_414 122
714 3300044901 Ga0466960_0009553 Ga0466960_0009553_1178_1546 122
715 3300044901 Ga0466960_0034536 Ga0466960_0034536_966_1355 122
716 3300044901 Ga0466960_0052319 Ga0466960_0052319_166_534 122
717 3300044901 Ga0466960_0156450 Ga0466960_0156450_772_1140 122
718 3300044901 Ga0466960_0696971 Ga0466960_0696971_172_540 122
719 3300045049 Ga0466959_0031024 Ga0466959_0031024_801_1169 122
720 3300045049 Ga0466959_0181327 Ga0466959_0181327_367_756 122
721 3300045049 Ga0466959_0199166 Ga0466959_0199166_141_509 122
722 3300045836 Ga0466958_0181039 Ga0466958_0181039_715_1104 122
723 3300045976 Ga0466967_0005714 Ga0466967_0005714_4349_4717 122
724 3300045976 Ga0466967_0053877 Ga0466967_0053877_1111_1479 122
725 3300045976 Ga0466967_0189953 Ga0466967_0189953_1426_1794 122
726 3300045976 Ga0466967_0251319 Ga0466967_0251319_511_885 122
727 3300046452 Ga0495617_085387 Ga0495617_085387_648_1016 122
728 3300046453 Ga0495627_102149 Ga0495627_102149_199_567 122
729 3300046454 Ga0495592_0023504 Ga0495592_0023504_1175_1543 122
730 3300046454 Ga0495592_0108135 Ga0495592_0108135_628_996 122
731 3300046455 Ga0495603_0029051 Ga0495603_0029051_836_1204 122
732 3300046455 Ga0495603_0894576 Ga0495603_0894576_56_424 122
733 3300046458 Ga0495591_036353 Ga0495591_036353_975_1343 122
734 3300046459 Ga0495629_0000982 Ga0495629_0000982_584_952 122
735 3300046459 Ga0495629_0112678 Ga0495629_0112678_1154_1522 122
736 3300046460 Ga0495638_0028057 Ga0495638_0028057_2709_3080 122
737 3300046460 Ga0495638_0088264 Ga0495638_0088264_140_508 122
738 3300046463 Ga0495653_0151184 Ga0495653_0151184_1241_1612 122
739 3300046463 Ga0495653_0817920 Ga0495653_0817920_104_472 122
740 3300046473 Ga0495582_0081190 Ga0495582_0081190_677_1045 122
741 3300046474 Ga0495605_0008148 Ga0495605_0008148_5243_5611 122
742 3300046475 Ga0495639_0455835 Ga0495639_0455835_42_410 122
743 3300046476 Ga0495662_0014479 Ga0495662_0014479_714_1082 122
744 3300046477 Ga0495664_0139994 Ga0495664_0139994_845_1213 122
745 3300046477 Ga0495664_0732035 Ga0495664_0732035_165_533 122
746 3300046491 Ga0495584_0453336 Ga0495584_0453336_254_622 122
747 3300046499 Ga0495594_0020582 Ga0495594_0020582_3112_3480 122
748 3300046500 Ga0495596_0064718 Ga0495596_0064718_41_409 122
749 3300046506 Ga0495583_0016760 Ga0495583_0016760_3298_3666 122
750 3300046507 Ga0495606_0018741 Ga0495606_0018741_3492_3860 122
751 3300046507 Ga0495606_0527280 Ga0495606_0527280_111_479 122
752 3300046512 Ga0495610_0180783 Ga0495610_0180783_124_492 122
753 3300046514 Ga0495618_0425420 Ga0495618_0425420_73_441 122
754 3300046515 Ga0495620_0007132 Ga0495620_0007132_472_840 122
755 3300046516 Ga0495628_0025087 Ga0495628_0025087_2642_3010 122
756 3300046516 Ga0495628_0138616 Ga0495628_0138616_806_1174 122
757 3300046517 Ga0495630_0081587 Ga0495630_0081587_51_419 122
758 3300046518 Ga0495631_0050312 Ga0495631_0050312_126_494 122
759 3300046519 Ga0495632_0383370 Ga0495632_0383370_52_423 122
760 3300046519 Ga0495632_0492680 Ga0495632_0492680_62_430 122
761 3300046522 Ga0495643_0001930 Ga0495643_0001930_4357_4725 122
762 3300046523 Ga0495644_0108656 Ga0495644_0108656_504_872 122
763 3300046524 Ga0495648_0027291 Ga0495648_0027291_1938_2306 122
764 3300046526 Ga0495666_0002237 Ga0495666_0002237_401_769 122
765 3300046526 Ga0495666_0228632 Ga0495666_0228632_232_600 122
766 3300046529 Ga0495652_0172925 Ga0495652_0172925_169_537 122
767 3300046529 Ga0495652_0229077 Ga0495652_0229077_322_690 122
768 3300046530 Ga0495654_0176224 Ga0495654_0176224_129_497 122
769 3300046533 Ga0495640_0006860 Ga0495640_0006860_7429_7797 122
770 3300046535 Ga0495586_0137735 Ga0495586_0137735_22_390 122
771 3300046535 Ga0495586_0365108 Ga0495586_0365108_209_592 122
772 3300046536 Ga0495587_0013767 Ga0495587_0013767_3672_4040 122
773 3300046537 Ga0495598_0361293 Ga0495598_0361293_60_428 122
774 3300046538 Ga0495609_0035339 Ga0495609_0035339_1391_1759 122
775 3300046538 Ga0495609_0179317 Ga0495609_0179317_256_624 122
776 3300046542 Ga0495597_0050030 Ga0495597_0050030_991_1359 122
777 3300046543 Ga0495645_0050631 Ga0495645_0050631_1971_2339 122
778 3300046543 Ga0495645_0062011 Ga0495645_0062011_1071_1439 122
779 3300046557 Ga0495622_0053476 Ga0495622_0053476_28_396 122
780 3300046558 Ga0495633_0100709 Ga0495633_0100709_129_497 122
781 3300046616 Ga0495668_0029608 Ga0495668_0029608_2513_2881 122
782 3300046616 Ga0495668_0106124 Ga0495668_0106124_255_623 122
783 3300046642 Ga0495634_0071466 Ga0495634_0071466_692_1060 122
784 3300046642 Ga0495634_0333959 Ga0495634_0333959_236_604 122
785 3300046648 Ga0495611_0090190 Ga0495611_0090190_264_632 122
786 3300046660 Ga0495625_0049407 Ga0495625_0049407_2317_2685 122
787 3300046660 Ga0495625_0241546 Ga0495625_0241546_58_426 122
788 3300046660 Ga0495625_0606882 Ga0495625_0606882_139_507 122
789 3300046663 Ga0495635_0061084 Ga0495635_0061084_1178_1546 122
790 3300046674 Ga0495588_0049151 Ga0495588_0049151_646_1014 122
791 3300046674 Ga0495588_0276904 Ga0495588_0276904_150_518 122
792 3300046675 Ga0495657_0030531 Ga0495657_0030531_601_969 122
793 3300046678 Ga0495599_0110964 Ga0495599_0110964_1175_1543 122
794 3300046679 Ga0495623_0120130 Ga0495623_0120130_40_408 122
795 3300046680 Ga0495646_0025052 Ga0495646_0025052_3342_3710 122
796 3300046680 Ga0495646_0037069 Ga0495646_0037069_568_936 122
797 3300046683 Ga0495658_0477619 Ga0495658_0477619_181_549 122
798 3300046689 Ga0495613_0001044 Ga0495613_0001044_662_1030 122
799 3300046689 Ga0495613_0001732 Ga0495613_0001732_15553_15921 122
800 3300046689 Ga0495613_0525494 Ga0495613_0525494_71_439 122
801 3300046690 Ga0495624_0159730 Ga0495624_0159730_855_1223 122
802 3300046690 Ga0495624_0277363 Ga0495624_0277363_285_653 122
803 3300046691 Ga0495670_0345942 Ga0495670_0345942_210_578 122
804 3300046694 Ga0495649_0098405 Ga0495649_0098405_843_1211 122
805 3300046794 Ga0495589_0129097 Ga0495589_0129097_136_504 122
806 3300046809 Ga0495600_0288390 Ga0495600_0288390_51_419 122
807 3300046809 Ga0495600_0494724 Ga0495600_0494724_360_728 122
808 3300047315 Ga0495581_0088708 Ga0495581_0088708_732_1100 122
809 3300047315 Ga0495581_0278477 Ga0495581_0278477_173_541 122
810 3300047317 Ga0495604_0017135 Ga0495604_0017135_2096_2464 122
811 3300047317 Ga0495604_0037319 Ga0495604_0037319_198_566 122
812 3300047319 Ga0495674_0141314 Ga0495674_0141314_452_820 122
813 3300047319 Ga0495674_0707342 Ga0495674_0707342_281_649 122
814 3300047320 Ga0495672_0094304 Ga0495672_0094304_420_788 122
815 3300047321 Ga0495676_0138621 Ga0495676_0138621_28_396 122
816 3300047322 Ga0495680_0010041 Ga0495680_0010041_7799_8167 122
817 3300047323 Ga0495683_0201837 Ga0495683_0201837_169_537 122
818 3300047443 Ga0495687_026764 Ga0495687_026764_343_711 122
819 3300047445 Ga0495677_0028704 Ga0495677_0028704_983_1351 122
820 3300047447 Ga0495685_055018 Ga0495685_055018_937_1305 122
821 3300047471 Ga0495684_0123862 Ga0495684_0123862_128_496 122
822 3300047472 Ga0495686_0230372 Ga0495686_0230372_356_724 122
823 3300047673 Ga0495593_0306077 Ga0495593_0306077_172_540 122
824 3300048088 Ga0495602_0026806 Ga0495602_0026806_3994_4362 122
825 3300048088 Ga0495602_0764262 Ga0495602_0764262_78_446 122
826 3300048089 Ga0495614_0029193 Ga0495614_0029193_454_822 122
827 3300048089 Ga0495614_0150332 Ga0495614_0150332_153_521 122
828 3300048090 Ga0495615_0121537 Ga0495615_0121537_286_654 122
829 3300048091 Ga0495626_0091416 Ga0495626_0091416_25_393 122
830 3300048903 Ga0496100_0033625 Ga0496100_0033625_1971_2339 122
831 3300048903 Ga0496100_0076123 Ga0496100_0076123_1359_1799 122
832 3300048903 Ga0496100_0151959 Ga0496100_0151959_1249_1617 122
833 3300048903 Ga0496100_0215462 Ga0496100_0215462_384_752 122
834 3300048903 Ga0496100_0583050 Ga0496100_0583050_350_718 122
835 3300048903 Ga0496100_0596082 Ga0496100_0596082_423_833 122
836 3300048903 Ga0496100_0750467 Ga0496100_0750467_383_751 122
837 3300048903 Ga0496100_1006038 Ga0496100_1006038_103_471 122
838 3300048903 Ga0496100_1066840 Ga0496100_1066840_224_592 122
839 3300048904 Ga0496101_0028715 Ga0496101_0028715_2656_3024 122
840 3300048904 Ga0496101_0036006 Ga0496101_0036006_1726_2166 122
841 3300048904 Ga0496101_0379726 Ga0496101_0379726_16_384 122
842 3300048904 Ga0496101_0911821 Ga0496101_0911821_265_633 122
843 3300048905 Ga0496102_0000382 Ga0496102_0000382_45920_46288 122
844 3300048905 Ga0496102_0001329 Ga0496102_0001329_768_1136 122
845 3300048905 Ga0496102_0007191 Ga0496102_0007191_8940_9380 122
846 3300048905 Ga0496102_0012230 Ga0496102_0012230_4768_5136 122
847 3300048905 Ga0496102_0130420 Ga0496102_0130420_30_398 122
848 3300048905 Ga0496102_0169657 Ga0496102_0169657_926_1294 122
849 3300048905 Ga0496102_0398092 Ga0496102_0398092_334_702 122
850 3300048905 Ga0496102_1516976 Ga0496102_1516976_142_510 122
851 3300048906 Ga0496103_0009301 Ga0496103_0009301_5078_5518 122
852 3300048906 Ga0496103_0170983 Ga0496103_0170983_244_612 122
853 3300048906 Ga0496103_0185528 Ga0496103_0185528_192_560 122
854 3300048906 Ga0496103_0268020 Ga0496103_0268020_517_885 122
855 3300048907 Ga0496104_0009817 Ga0496104_0009817_99_467 122
856 3300048907 Ga0496104_0023016 Ga0496104_0023016_2782_3222 122
857 3300048907 Ga0496104_0084182 Ga0496104_0084182_1757_2125 122
858 3300048907 Ga0496104_0422852 Ga0496104_0422852_260_628 122
859 3300048907 Ga0496104_1811517 Ga0496104_1811517_48_419 122
860 3300048908 Ga0496105_0002836 Ga0496105_0002836_9456_9896 122
861 3300048908 Ga0496105_0004398 Ga0496105_0004398_7818_8186 122
862 3300048908 Ga0496105_0057755 Ga0496105_0057755_347_715 122
863 3300048908 Ga0496105_0060212 Ga0496105_0060212_2221_2589 122
864 3300048908 Ga0496105_0178064 Ga0496105_0178064_143_511 122
865 3300048908 Ga0496105_0243058 Ga0496105_0243058_375_746 122
866 3300048908 Ga0496105_0257325 Ga0496105_0257325_515_883 122
867 3300048908 Ga0496105_0263754 Ga0496105_0263754_877_1245 122
868 3300048908 Ga0496105_0753365 Ga0496105_0753365_268_645 122
869 3300048909 Ga0496106_0173611 Ga0496106_0173611_581_949 122
870 3300048909 Ga0496106_1076483 Ga0496106_1076483_173_541 122
871 3300048910 Ga0496107_0118918 Ga0496107_0118918_447_815 122
872 3300048910 Ga0496107_0178105 Ga0496107_0178105_768_1136 122
873 3300048910 Ga0496107_0488870 Ga0496107_0488870_399_767 122
874 3300048911 Ga0496108_0000056 Ga0496108_0000056_13267_13635 122
875 3300048911 Ga0496108_0006907 Ga0496108_0006907_6714_7082 122
876 3300048911 Ga0496108_0019641 Ga0496108_0019641_4555_4923 122
877 3300048911 Ga0496108_0052557 Ga0496108_0052557_2241_2609 122
878 3300048911 Ga0496108_0121424 Ga0496108_0121424_1677_2045 122
879 3300048912 Ga0496109_0038374 Ga0496109_0038374_2254_2622 122
880 3300048912 Ga0496109_0082889 Ga0496109_0082889_2511_2879 122
881 3300048912 Ga0496109_0423227 Ga0496109_0423227_737_1105 122
882 3300048912 Ga0496109_1864014 Ga0496109_1864014_109_516 122
883 3300048913 Ga0496110_0000297 Ga0496110_0000297_31355_31723 122
884 3300048913 Ga0496110_0316915 Ga0496110_0316915_576_944 122
885 3300048913 Ga0496110_0328060 Ga0496110_0328060_765_1133 122
886 3300048913 Ga0496110_0614509 Ga0496110_0614509_229_597 122
887 3300048913 Ga0496110_0936383 Ga0496110_0936383_373_741 122
888 3300048913 Ga0496110_1112012 Ga0496110_1112012_163_603 122
889 3300048914 Ga0496111_0139449 Ga0496111_0139449_617_985 122
890 3300048915 Ga0496112_0032466 Ga0496112_0032466_4585_4995 122
891 3300048915 Ga0496112_0178346 Ga0496112_0178346_706_1074 122
892 3300048915 Ga0496112_1213446 Ga0496112_1213446_174_614 122
893 3300048916 Ga0496113_0127960 Ga0496113_0127960_569_937 122
894 3300048916 Ga0496113_0946576 Ga0496113_0946576_211_579 122
895 3300048916 Ga0496113_1109382 Ga0496113_1109382_56_424 122
896 3300048917 Ga0496114_0003141 Ga0496114_0003141_11442_11882 122
897 3300048917 Ga0496114_0038863 Ga0496114_0038863_1582_1950 122
898 3300048917 Ga0496114_0063167 Ga0496114_0063167_2417_2785 122
899 3300048917 Ga0496114_0076810 Ga0496114_0076810_2411_2779 122
900 3300048917 Ga0496114_0095403 Ga0496114_0095403_501_869 122
901 3300048917 Ga0496114_0100515 Ga0496114_0100515_1861_2229 122
902 3300048917 Ga0496114_0123409 Ga0496114_0123409_1757_2125 122
903 3300048917 Ga0496114_0194230 Ga0496114_0194230_1075_1443 122
904 3300048917 Ga0496114_0499473 Ga0496114_0499473_642_1010 122
905 3300048917 Ga0496114_0560226 Ga0496114_0560226_419_787 122
906 3300048917 Ga0496114_0629878 Ga0496114_0629878_513_881 122
907 3300048917 Ga0496114_0861464 Ga0496114_0861464_42_410 122
908 3300048917 Ga0496114_0878038 Ga0496114_0878038_371_739 122
909 3300048917 Ga0496114_1156328 Ga0496114_1156328_89_457 122
910 3300048917 Ga0496114_1530310 Ga0496114_1530310_150_518 122
911 3300048918 Ga0496115_0054361 Ga0496115_0054361_678_1046 122
912 3300048918 Ga0496115_0090964 Ga0496115_0090964_1613_1981 122
913 3300048918 Ga0496115_0103985 Ga0496115_0103985_130_498 122
914 3300048918 Ga0496115_1350687 Ga0496115_1350687_110_478 122
915 3300048919 Ga0496116_0004331 Ga0496116_0004331_10378_10746 122
916 3300048919 Ga0496116_0302593 Ga0496116_0302593_166_534 122
917 3300048920 Ga0496117_0000455 Ga0496117_0000455_7177_7545 122
918 3300048920 Ga0496117_0009489 Ga0496117_0009489_8122_8490 122
919 3300048920 Ga0496117_0037996 Ga0496117_0037996_1906_2274 122
920 3300048920 Ga0496117_0066401 Ga0496117_0066401_832_1200 122
921 3300048920 Ga0496117_0153245 Ga0496117_0153245_371_739 122
922 3300048920 Ga0496117_0289589 Ga0496117_0289589_176_544 122
923 3300048920 Ga0496117_0336917 Ga0496117_0336917_216_584 122
924 3300048921 Ga0496118_0000447 Ga0496118_0000447_7178_7546 122
925 3300048921 Ga0496118_0006679 Ga0496118_0006679_9012_9380 122
926 3300048921 Ga0496118_0103571 Ga0496118_0103571_1368_1736 122
927 3300048921 Ga0496118_0152983 Ga0496118_0152983_463_837 122
928 3300048921 Ga0496118_0210158 Ga0496118_0210158_475_915 122
929 3300048921 Ga0496118_0215274 Ga0496118_0215274_498_866 122
930 3300048921 Ga0496118_0454149 Ga0496118_0454149_215_583 122
931 3300048922 Ga0496119_0000762 Ga0496119_0000762_31087_31455 122
932 3300048922 Ga0496119_0004415 Ga0496119_0004415_1598_1966 122
933 3300048922 Ga0496119_0005312 Ga0496119_0005312_8750_9118 122
934 3300048922 Ga0496119_0007168 Ga0496119_0007168_1059_1427 122
935 3300048922 Ga0496119_0037325 Ga0496119_0037325_2654_3022 122
936 3300048922 Ga0496119_0042229 Ga0496119_0042229_1891_2331 122
937 3300048922 Ga0496119_0080893 Ga0496119_0080893_143_511 122
938 3300048922 Ga0496119_0106053 Ga0496119_0106053_1140_1550 122
939 3300048922 Ga0496119_0132222 Ga0496119_0132222_896_1264 122
940 3300048922 Ga0496119_0366410 Ga0496119_0366410_139_507 122
941 3300048922 Ga0496119_0476902 Ga0496119_0476902_97_465 122
942 3300048922 Ga0496119_0520971 Ga0496119_0520971_117_485 122
943 3300048922 Ga0496119_0587701 Ga0496119_0587701_126_494 122
944 3300048923 Ga0496120_0000500 Ga0496120_0000500_5570_5938 122
945 3300048923 Ga0496120_0002282 Ga0496120_0002282_10522_10890 122
946 3300048923 Ga0496120_0034809 Ga0496120_0034809_1945_2313 122
947 3300048923 Ga0496120_0041657 Ga0496120_0041657_1520_1888 122
948 3300048923 Ga0496120_0059050 Ga0496120_0059050_541_909 122
949 3300048923 Ga0496120_0080326 Ga0496120_0080326_303_713 122
950 3300048923 Ga0496120_0088877 Ga0496120_0088877_762_1130 122
951 3300048923 Ga0496120_0173300 Ga0496120_0173300_256_624 122
952 3300048923 Ga0496120_0250554 Ga0496120_0250554_421_789 122
953 3300048924 Ga0496121_0000098 Ga0496121_0000098_174398_174766 122
954 3300048924 Ga0496121_0381746 Ga0496121_0381746_521_889 122
955 3300048924 Ga0496121_0533513 Ga0496121_0533513_336_704 122
956 3300048924 Ga0496121_0593715 Ga0496121_0593715_230_598 122
957 3300048925 Ga0496122_0000705 Ga0496122_0000705_42554_42994 122
958 3300048925 Ga0496122_0000978 Ga0496122_0000978_23259_23633 122
959 3300048925 Ga0496122_0008896 Ga0496122_0008896_4038_4406 122
960 3300048925 Ga0496122_0033847 Ga0496122_0033847_1309_1719 122
961 3300048925 Ga0496122_0036228 Ga0496122_0036228_1815_2183 122
962 3300048925 Ga0496122_0189516 Ga0496122_0189516_787_1155 122
963 3300048925 Ga0496122_0348285 Ga0496122_0348285_378_746 122
964 3300048925 Ga0496122_0443693 Ga0496122_0443693_204_572 122
965 3300048926 Ga0496123_0000304 Ga0496123_0000304_40144_40518 122
966 3300048926 Ga0496123_0006643 Ga0496123_0006643_1584_2012 122
967 3300048926 Ga0496123_0030985 Ga0496123_0030985_953_1363 122
968 3300048926 Ga0496123_0220459 Ga0496123_0220459_315_683 122
969 3300048926 Ga0496123_0285735 Ga0496123_0285735_389_757 122
970 3300048926 Ga0496123_0305148 Ga0496123_0305148_362_730 122
971 3300048926 Ga0496123_0486224 Ga0496123_0486224_152_520 122
972 3300048927 Ga0496124_0005987 Ga0496124_0005987_6710_7078 122
973 3300048927 Ga0496124_0032523 Ga0496124_0032523_1185_1553 122
974 3300048927 Ga0496124_0039999 Ga0496124_0039999_2581_2949 122
975 3300048927 Ga0496124_0136429 Ga0496124_0136429_166_534 122
976 3300048927 Ga0496124_0235448 Ga0496124_0235448_972_1340 122
977 3300048927 Ga0496124_0265439 Ga0496124_0265439_704_1072 122
978 3300048927 Ga0496124_0296299 Ga0496124_0296299_440_808 122
979 3300048927 Ga0496124_0437708 Ga0496124_0437708_204_581 122
980 3300048927 Ga0496124_0547271 Ga0496124_0547271_267_635 122
981 3300048927 Ga0496124_0967117 Ga0496124_0967117_64_432 122
982 3300048928 Ga0496125_0000069 Ga0496125_0000069_196566_196934 122
983 3300048928 Ga0496125_0000626 Ga0496125_0000626_30491_30865 122
984 3300048928 Ga0496125_0001892 Ga0496125_0001892_25827_26195 122
985 3300048928 Ga0496125_0013813 Ga0496125_0013813_1904_2272 122
986 3300048929 Ga0496126_0001101 Ga0496126_0001101_37296_37664 122
987 3300048929 Ga0496126_0005987 Ga0496126_0005987_425_793 122
988 3300048929 Ga0496126_0007418 Ga0496126_0007418_7068_7436 122
989 3300048929 Ga0496126_0007949 Ga0496126_0007949_420_788 122
990 3300048929 Ga0496126_0014170 Ga0496126_0014170_4918_5337 122
991 3300048929 Ga0496126_0056376 Ga0496126_0056376_2215_2583 122
992 3300048929 Ga0496126_0068908 Ga0496126_0068908_2736_3104 122
993 3300048929 Ga0496126_0198042 Ga0496126_0198042_513_881 122
994 3300048929 Ga0496126_0670698 Ga0496126_0670698_421_789 122
995 3300048929 Ga0496126_1298154 Ga0496126_1298154_15_383 122
996 3300049459 Ga0495678_028339 Ga0495678_028339_119_487 122
997 3300049460 Ga0495682_0103322 Ga0495682_0103322_474_842 122
998 3300049568 Ga0501031_0003477 Ga0501031_0003477_8713_9081 122
999 3300049568 Ga0501031_0005744 Ga0501031_0005744_249_617 122
1000 3300049568 Ga0501031_0023746 Ga0501031_0023746_2685_3053 122
1001 3300049568 Ga0501031_0150341 Ga0501031_0150341_90_458 122
1002 3300049569 Ga0501032_0005320 Ga0501032_0005320_3664_4032 122
1003 3300049569 Ga0501032_0044843 Ga0501032_0044843_2252_2620 122
1004 3300049569 Ga0501032_0161473 Ga0501032_0161473_82_450 122
1005 3300049569 Ga0501032_0228315 Ga0501032_0228315_463_831 122
1006 3300049569 Ga0501032_0235220 Ga0501032_0235220_130_498 122
1007 3300049570 Ga0501033_0003891 Ga0501033_0003891_7643_8011 122
1008 3300049570 Ga0501033_0004594 Ga0501033_0004594_10055_10423 122
1009 3300049570 Ga0501033_0106473 Ga0501033_0106473_867_1235 122
1010 3300049570 Ga0501033_0178364 Ga0501033_0178364_704_1072 122
1011 3300049570 Ga0501033_0223532 Ga0501033_0223532_543_911 122
1012 3300049570 Ga0501033_0227459 Ga0501033_0227459_861_1229 122
1013 3300049571 Ga0501034_0054720 Ga0501034_0054720_30_398 122
1014 3300049571 Ga0501034_0151536 Ga0501034_0151536_1068_1436 122
1015 3300049571 Ga0501034_0157244 Ga0501034_0157244_1053_1421 122
1016 3300049571 Ga0501034_0168883 Ga0501034_0168883_1030_1398 122
1017 3300049571 Ga0501034_0179134 Ga0501034_0179134_1195_1563 122
1018 3300049571 Ga0501034_0250415 Ga0501034_0250415_120_488 122
1019 3300049571 Ga0501034_0250636 Ga0501034_0250636_1026_1394 122
1020 3300049571 Ga0501034_0720880 Ga0501034_0720880_378_746 122
1021 3300049571 Ga0501034_1436740 Ga0501034_1436740_172_540 122
1022 3300049572 Ga0501036_0015125 Ga0501036_0015125_245_613 122
1023 3300049572 Ga0501036_0025236 Ga0501036_0025236_2838_3206 122
1024 3300049572 Ga0501036_0028243 Ga0501036_0028243_4117_4485 122
1025 3300049572 Ga0501036_0063061 Ga0501036_0063061_359_727 122
1026 3300049572 Ga0501036_0066493 Ga0501036_0066493_2597_2965 122
1027 3300049572 Ga0501036_0949412 Ga0501036_0949412_289_657 122
1028 3300049572 Ga0501036_1007711 Ga0501036_1007711_94_462 122
1029 3300049573 Ga0501037_0009033 Ga0501037_0009033_542_910 122
1030 3300049573 Ga0501037_0075874 Ga0501037_0075874_1549_1917 122
1031 3300049573 Ga0501037_0080134 Ga0501037_0080134_604_972 122
1032 3300049573 Ga0501037_0133057 Ga0501037_0133057_932_1300 122
1033 3300049573 Ga0501037_0219868 Ga0501037_0219868_953_1321 122
1034 3300049573 Ga0501037_0277462 Ga0501037_0277462_279_647 122
1035 3300049574 Ga0501038_0013350 Ga0501038_0013350_197_565 122
1036 3300049574 Ga0501038_0014325 Ga0501038_0014325_1380_1748 122
1037 3300049574 Ga0501038_0026637 Ga0501038_0026637_3671_4039 122
1038 3300049574 Ga0501038_0031984 Ga0501038_0031984_630_998 122
1039 3300049574 Ga0501038_0113488 Ga0501038_0113488_1319_1687 122
1040 3300049574 Ga0501038_0327847 Ga0501038_0327847_214_582 122
1041 3300049575 Ga0501039_0013460 Ga0501039_0013460_5856_6224 122
1042 3300049575 Ga0501039_0018121 Ga0501039_0018121_364_732 122
1043 3300049575 Ga0501039_0130770 Ga0501039_0130770_758_1126 122
1044 3300049575 Ga0501039_0620398 Ga0501039_0620398_355_723 122
1045 3300049578 Ga0501042_0007367 Ga0501042_0007367_27_395 122
1046 3300049578 Ga0501042_0008101 Ga0501042_0008101_2673_3041 122
1047 3300049578 Ga0501042_0020230 Ga0501042_0020230_3680_4048 122
1048 3300049579 Ga0501043_0016876 Ga0501043_0016876_365_733 122
1049 3300049579 Ga0501043_0023448 Ga0501043_0023448_1709_2077 122
1050 3300049579 Ga0501043_0025840 Ga0501043_0025840_3389_3757 122
1051 3300049579 Ga0501043_0040998 Ga0501043_0040998_551_919 122
1052 3300049579 Ga0501043_0144375 Ga0501043_0144375_1270_1638 122
1053 3300049579 Ga0501043_0148363 Ga0501043_0148363_996_1364 122
1054 3300049579 Ga0501043_0411657 Ga0501043_0411657_314_682 122
1055 3300049580 Ga0501046_0006076 Ga0501046_0006076_799_1167 122
1056 3300049580 Ga0501046_0020284 Ga0501046_0020284_3555_3923 122
1057 3300049580 Ga0501046_0052539 Ga0501046_0052539_820_1188 122
1058 3300049580 Ga0501046_0745556 Ga0501046_0745556_155_523 122
1059 3300049581 Ga0501047_0002353 Ga0501047_0002353_17147_17515 122
1060 3300049581 Ga0501047_0021705 Ga0501047_0021705_629_997 122
1061 3300049581 Ga0501047_0023560 Ga0501047_0023560_3475_3843 122
1062 3300049581 Ga0501047_0025365 Ga0501047_0025365_1003_1371 122
1063 3300049581 Ga0501047_0100854 Ga0501047_0100854_2161_2529 122
1064 3300049581 Ga0501047_0124851 Ga0501047_0124851_559_927 122
1065 3300049581 Ga0501047_0180517 Ga0501047_0180517_914_1282 122
1066 3300049581 Ga0501047_0239537 Ga0501047_0239537_1269_1637 122
1067 3300049582 Ga0501048_0065848 Ga0501048_0065848_510_878 122
1068 3300049582 Ga0501048_0074058 Ga0501048_0074058_758_1126 122
1069 3300049583 Ga0501067_0426769 Ga0501067_0426769_147_515 122
1070 3300049584 Ga0501068_0431234 Ga0501068_0431234_363_731 122
1071 3300049585 Ga0501069_0112891 Ga0501069_0112891_176_544 122
1072 3300049585 Ga0501069_0533225 Ga0501069_0533225_40_408 122
1073 3300049586 Ga0501070_0000515 Ga0501070_0000515_30616_30984 122
1074 3300049586 Ga0501070_0079626 Ga0501070_0079626_2158_2526 122
1075 3300049586 Ga0501070_0110360 Ga0501070_0110360_261_629 122
1076 3300049586 Ga0501070_0944339 Ga0501070_0944339_291_659 122
1077 3300049586 Ga0501070_1041536 Ga0501070_1041536_178_546 122
1078 3300049588 Ga0501072_0275753 Ga0501072_0275753_506_874 122
1079 3300049588 Ga0501072_1081479 Ga0501072_1081479_110_478 122
1080 3300049589 Ga0501073_0008299 Ga0501073_0008299_5949_6317 122
1081 3300049589 Ga0501073_0060531 Ga0501073_0060531_900_1268 122
1082 3300049589 Ga0501073_0352223 Ga0501073_0352223_66_434 122
1083 3300049590 Ga0501074_0021577 Ga0501074_0021577_3229_3597 122
1084 3300049590 Ga0501074_0039574 Ga0501074_0039574_1778_2146 122
1085 3300049590 Ga0501074_0051476 Ga0501074_0051476_2524_2892 122
1086 3300049742 Ga0501080_0142711 Ga0501080_0142711_50_418 122
1087 3300049742 Ga0501080_0520407 Ga0501080_0520407_157_525 122
1088 3300049742 Ga0501080_0641595 Ga0501080_0641595_529_897 122
1089 3300049742 Ga0501080_1311669 Ga0501080_1311669_133_501 122
1090 3300049742 Ga0501080_1473844 Ga0501080_1473844_85_453 122
1091 3300049742 Ga0501080_1503254 Ga0501080_1503254_92_460 122
1092 3300049744 Ga0501083_0132689 Ga0501083_0132689_371_739 122
1093 3300049744 Ga0501083_0278158 Ga0501083_0278158_623_991 122
1094 3300049822 Ga0501035_0001713 Ga0501035_0001713_9676_10044 122
1095 3300049822 Ga0501035_0031721 Ga0501035_0031721_2668_3036 122
1096 3300049822 Ga0501035_0055081 Ga0501035_0055081_2987_3355 122
1097 3300049822 Ga0501035_0113823 Ga0501035_0113823_1398_1766 122
1098 3300049822 Ga0501035_0233552 Ga0501035_0233552_953_1321 122
1099 3300049822 Ga0501035_0742237 Ga0501035_0742237_172_540 122
1100 3300049822 Ga0501035_1174919 Ga0501035_1174919_159_527 122
1101 3300049823 Ga0501044_0005944 Ga0501044_0005944_11715_12083 122
1102 3300049823 Ga0501044_0042700 Ga0501044_0042700_758_1126 122
1103 3300049823 Ga0501044_0044738 Ga0501044_0044738_3901_4269 122
1104 3300049823 Ga0501044_0049479 Ga0501044_0049479_2356_2724 122
1105 3300049823 Ga0501044_0073064 Ga0501044_0073064_2913_3281 122
1106 3300049823 Ga0501044_0079162 Ga0501044_0079162_2581_2949 122
1107 3300049823 Ga0501044_0183058 Ga0501044_0183058_700_1068 122
1108 3300049823 Ga0501044_0190558 Ga0501044_0190558_400_768 122
1109 3300049823 Ga0501044_0781069 Ga0501044_0781069_314_682 122
1110 3300049823 Ga0501044_1519825 Ga0501044_1519825_52_420 122
1111 3300049824 Ga0501045_0258409 Ga0501045_0258409_209_577 122
1112 3300049824 Ga0501045_0374978 Ga0501045_0374978_97_465 122
1113 3300049824 Ga0501045_1428778 Ga0501045_1428778_45_413 122
1114 3300050490 nmdc:mga03n38_19199_c1 nmdc:mga03n38_19199_c1_2310_2678 122
1115 3300050490 nmdc:mga03n38_728110_c1 nmdc:mga03n38_728110_c1_25_393 122
1116 3300050491 nmdc:mga00v17_108997_c1 nmdc:mga00v17_108997_c1_224_592 122
1117 3300050491 nmdc:mga00v17_13901_c1 nmdc:mga00v17_13901_c1_2693_3097 122
1118 3300050491 nmdc:mga00v17_171559_c1 nmdc:mga00v17_171559_c1_675_1043 122
1119 3300050491 nmdc:mga00v17_181797_c1 nmdc:mga00v17_181797_c1_935_1303 122
1120 3300050491 nmdc:mga00v17_291348_c1 nmdc:mga00v17_291348_c1_469_837 122
1121 3300050491 nmdc:mga00v17_430484_c1 nmdc:mga00v17_430484_c1_375_743 122
1122 3300050491 nmdc:mga00v17_4782_c1 nmdc:mga00v17_4782_c1_3551_3919 122
1123 3300050491 nmdc:mga00v17_749696_c1 nmdc:mga00v17_749696_c1_203_571 122
1124 3300050491 nmdc:mga00v17_97382_c1 nmdc:mga00v17_97382_c1_712_1080 122
1125 3300050492 nmdc:mga0yw44_113595_c1 nmdc:mga0yw44_113595_c1_189_557 122
1126 3300050492 nmdc:mga0yw44_122613_c1 nmdc:mga0yw44_122613_c1_630_998 122
1127 3300050492 nmdc:mga0yw44_173869_c1 nmdc:mga0yw44_173869_c1_750_1118 122
1128 3300050492 nmdc:mga0yw44_194469_c1 nmdc:mga0yw44_194469_c1_512_880 122
1129 3300050492 nmdc:mga0yw44_208487_c1 nmdc:mga0yw44_208487_c1_317_685 122
1130 3300050492 nmdc:mga0yw44_215398_c1 nmdc:mga0yw44_215398_c1_335_703 122
1131 3300050492 nmdc:mga0yw44_232946_c1 nmdc:mga0yw44_232946_c1_666_1034 122
1132 3300050492 nmdc:mga0yw44_74100_c1 nmdc:mga0yw44_74100_c1_517_885 122
1133 3300050492 nmdc:mga0yw44_78093_c1 nmdc:mga0yw44_78093_c1_1350_1718 122
1134 3300050492 nmdc:mga0yw44_81627_c1 nmdc:mga0yw44_81627_c1_394_762 122
1135 3300050492 nmdc:mga0yw44_915380_c1 nmdc:mga0yw44_915380_c1_62_430 122
1136 3300050492 nmdc:mga0yw44_925585_c1 nmdc:mga0yw44_925585_c1_144_512 122
1137 3300050493 nmdc:mga0k408_394032_c1 nmdc:mga0k408_394032_c1_149_517 122
1138 3300050493 nmdc:mga0k408_885809_c1 nmdc:mga0k408_885809_c1_64_432 122
1139 3300050494 nmdc:mga06z11_386675_c1 nmdc:mga06z11_386675_c1_367_771 122
1140 3300050494 nmdc:mga06z11_49909_c1 nmdc:mga06z11_49909_c1_1671_2039 122
1141 3300050494 nmdc:mga06z11_63871_c1 nmdc:mga06z11_63871_c1_942_1310 122
1142 3300050495 nmdc:mga04h51_188287_c1 nmdc:mga04h51_188287_c1_187_555 122
1143 3300050495 nmdc:mga04h51_6044_c1 nmdc:mga04h51_6044_c1_942_1310 122
1144 3300050496 nmdc:mga07m45_19564_c1 nmdc:mga07m45_19564_c1_1514_1882 122
1145 3300050496 nmdc:mga07m45_493206_c1 nmdc:mga07m45_493206_c1_231_599 122
1146 3300050510 nmdc:mga06r32_824203_c1 nmdc:mga06r32_824203_c1_471_839 122
1147 3300050511 nmdc:mga08y16_66782_c1 nmdc:mga08y16_66782_c1_720_1088 122
1148 3300050512 nmdc:mga0n895_340654_c1 nmdc:mga0n895_340654_c1_601_969 122
1149 3300050513 nmdc:mga0rr50_33750_c1 nmdc:mga0rr50_33750_c1_751_1119 122
1150 3300050514 nmdc:mga08x19_142796_c1 nmdc:mga08x19_142796_c1_555_923 122
1151 3300050515 nmdc:mga0a205_96969_c1 nmdc:mga0a205_96969_c1_2421_2789 122
1152 3300050516 nmdc:mga0sz30_11515_c1 nmdc:mga0sz30_11515_c1_941_1309 122
1153 3300050516 nmdc:mga0sz30_266832_c1 nmdc:mga0sz30_266832_c1_293_661 122
1154 3300050516 nmdc:mga0sz30_49386_c1 nmdc:mga0sz30_49386_c1_991_1359 122
1155 3300050516 nmdc:mga0sz30_57472_c1 nmdc:mga0sz30_57472_c1_1255_1623 122
1156 3300053077 Ga0495601_0047478 Ga0495601_0047478_97_465 122
1157 3300053078 Ga0495612_0258817 Ga0495612_0258817_128_496 122
1158 3300053079 Ga0500610_0343925 Ga0500610_0343925_73_441 122
1159 3300053080 Ga0500635_0000067 Ga0500635_0000067_55594_55962 122
1160 3300053085 Ga0495619_0095178 Ga0495619_0095178_450_821 122
1161 3300053088 Ga0500644_0315564 Ga0500644_0315564_275_646 122
1162 3300053090 Ga0500646_0000795 Ga0500646_0000795_5429_5797 122
1163 3300053092 Ga0500583_0259962 Ga0500583_0259962_269_637 122
1164 3300053093 Ga0500651_0000194 Ga0500651_0000194_10276_10644 122
1165 3300053104 Ga0500556_0000095 Ga0500556_0000095_7059_7427 122
1166 3300053104 Ga0500556_0001225 Ga0500556_0001225_10951_11319 122
1167 3300053104 Ga0500556_0421944 Ga0500556_0421944_21_389 122
1168 3300053108 Ga0500562_009929 Ga0500562_009929_141_509 122
1169 3300053108 Ga0500562_011098 Ga0500562_011098_1041_1409 122
1170 3300053117 Ga0500593_001106 Ga0500593_001106_6142_6510 122
1171 3300053131 Ga0500652_395241 Ga0500652_395241_79_447 122
1172 3300053136 Ga0500559_0000753 Ga0500559_0000753_9648_10016 122
1173 3300053136 Ga0500559_0160491 Ga0500559_0160491_90_458 122
1174 3300053139 Ga0500568_0000223 Ga0500568_0000223_30483_30851 122
1175 3300053142 Ga0500577_0306280 Ga0500577_0306280_171_539 122
1176 3300053146 Ga0500588_0291405 Ga0500588_0291405_53_421 122
1177 3300053149 Ga0500600_0162141 Ga0500600_0162141_394_762 122
1178 3300053149 Ga0500600_0206847 Ga0500600_0206847_197_565 122
1179 3300053151 Ga0500604_0202978 Ga0500604_0202978_252_623 122
1180 3300053153 Ga0500616_0000257 Ga0500616_0000257_70127_70495 122
1181 3300053153 Ga0500616_0009623 Ga0500616_0009623_2377_2745 122
1182 3300053153 Ga0500616_0033874 Ga0500616_0033874_1912_2280 122
1183 3300053153 Ga0500616_0127346 Ga0500616_0127346_58_429 122
1184 3300053155 Ga0500620_004744 Ga0500620_004744_1102_1470 122
1185 3300053155 Ga0500620_122537 Ga0500620_122537_161_529 122
1186 3300053158 Ga0500627_0394095 Ga0500627_0394095_161_529 122
1187 3300053161 Ga0500634_0298827 Ga0500634_0298827_232_600 122
1188 3300053730 Ga0500645_008303 Ga0500645_008303_2586_2954 122
1189 3300054114 Ga0501084_0193537 Ga0501084_0193537_308_676 122
1190 3300061719 Ga0466962_0032349 Ga0466962_0032349_331_699 122
1191 3300061719 Ga0466962_0091666 Ga0466962_0091666_826_1215 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

29

142

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kol-assembly1.cif.gz_A-2 crystal structure of a glyoxalase/dioxygenase from nostoc punctiforme 0.78 4 122
4nvs-assembly1.cif.gz_A crystal structure of the q18cp6_clod6 protein from glyoxalase family. northeast structural genomics consortium target cfr3 0.778 4 120
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.7767 1 122
4qb5-assembly1.cif.gz_C crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.776 7 122
3e5d-assembly1.cif.gz_A-2 crystal structure of a putative glyoxalase i (lmof2365_0426) from listeria monocytogenes str. 4b f2365 at 2.70 a resolution 0.7694 7 119
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8965 71 120 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8769 71 122 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.849 71 120 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8072 71 122 3.30.720.110
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7957 9 122 3.10.180.10
ID Description Score Start End GO Terms
AF-K0ES97-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9927 1 122 GO:0051213
AF-A0A7R7HYG8-F1-model_v4 Glyoxalase 0.9926 1 122
AF-A0A2U8NIV6-F1-model_v4 deleted 0.9921 1 122
AF-A0A181Z885-F1-model_v4 VOC domain-containing protein 0.9919 1 122
AF-A0A7G9R1L4-F1-model_v4 VOC family protein 0.9918 1 122

Feature Viewer

pLDDT pTM Quality
95.17 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map