F491466
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1191 | 569 | 1097 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300048903|Ga0496100_0076123|Ga0496100_0076123_1359_1799 |
| Length | 146 |
| Sequence | LTHVSILTYGPSCQITDTNPKEAIVPVTGPDFISLQATDLDASRAFYEQYLGLVRSQAGPPHAIVFETTPIAFALRDVVTGTDLASAAQPGIGAAIWLHATDVQAIHDALAADGHTIVSAPIDGPFGRTFTFADPDGYHVTLHDRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 2 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 3 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 4 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 5 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 6 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 7 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 8 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 9 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 10 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 11 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 12 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 13 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 14 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 15 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 16 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 17 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 18 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 19 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 20 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 21 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 22 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 23 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 24 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 25 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 26 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 27 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 28 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 29 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 30 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 31 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 32 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 33 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 34 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 35 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 36 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 37 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 38 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 39 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 40 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 41 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 42 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 43 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 44 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 45 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 46 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 47 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 48 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 49 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 50 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 51 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 52 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 53 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 54 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 55 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 56 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 57 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 58 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 59 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 60 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 61 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 62 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 63 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 64 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 65 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 66 | 2938649242 | Paenibacillus helianthi P26E | Isolate | Rhizosphere |
| 67 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 68 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 69 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 70 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 71 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 72 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 73 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 74 | 2968558590 | Paenibacillus sp. P3E | Isolate | Rhizosphere |
| 75 | 2971403814 | Paenibacillus tritici LMG 29502 | Isolate | Unclassified |
| 76 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 77 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 78 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 79 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 80 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 81 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 82 | 2988225383 | Paenibacillus sp. P46E | Isolate | Rhizosphere |
| 83 | 2996632988 | Paenibacillus sp. P32E | Isolate | Rhizosphere |
| 84 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 85 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 86 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 87 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 88 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 89 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 90 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 91 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 92 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 93 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 94 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 95 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 96 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 97 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 98 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 103 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 104 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 106 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 108 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 117 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 122 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 123 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 124 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 127 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 128 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 129 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 130 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 132 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 133 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 134 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 140 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 141 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 142 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 144 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 145 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 146 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 147 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 148 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 149 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 150 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 151 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 152 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 153 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 154 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 155 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 156 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 157 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 158 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 159 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 160 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 161 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 162 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 163 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 164 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 165 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 167 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 168 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 169 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 170 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 171 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 172 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 173 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 175 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 176 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 177 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 192 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 195 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 196 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 197 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 212 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 214 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 215 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 216 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 217 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 218 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 219 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 220 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 222 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 233 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 295 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 296 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 297 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 301 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 302 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 303 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 304 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 306 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 307 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 308 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 309 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 310 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 311 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 312 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 313 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 314 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 315 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 316 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 317 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 318 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 319 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 320 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 321 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 322 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 323 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 324 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 325 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 326 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 327 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 328 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 329 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 330 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 331 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 332 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 333 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 334 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 335 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 336 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 337 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 338 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 339 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 340 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 341 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 342 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 343 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 344 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 345 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 346 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 347 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 348 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 349 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 350 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 351 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 352 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 353 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 354 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 355 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 356 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 357 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 358 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 359 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 360 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 361 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 362 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 363 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 364 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 365 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 366 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 367 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 368 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 369 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 370 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 371 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 372 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 373 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 374 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 375 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 376 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 377 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 378 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 379 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 380 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 381 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 382 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 383 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 384 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 385 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 386 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 387 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 388 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 464 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 465 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 466 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 467 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 468 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 469 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 470 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 471 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 472 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 473 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 474 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 475 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 476 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 477 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 478 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 479 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 480 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 481 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 482 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 483 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 484 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 485 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 486 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 487 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 488 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 489 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 490 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 497 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 501 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 502 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 503 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 504 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 505 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 507 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 508 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 509 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 510 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 511 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 513 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 514 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 515 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 516 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 517 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 518 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 519 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 520 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 521 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 522 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 523 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 524 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 525 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 526 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 527 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 528 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 529 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 530 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 531 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 534 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 535 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 538 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 539 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 540 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 541 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 542 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 543 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 544 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 545 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 546 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 547 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 548 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 549 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 550 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 551 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 552 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 553 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 554 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 555 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 556 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 557 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 558 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 559 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 560 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 561 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 562 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 563 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 564 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 565 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 566 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 567 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
| 568 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 569 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.51 |
| Metatranscriptomes | 1.51 |
| Isolates | 7.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.17 |
| Bulb | 0 |
| Endosphere | 12.01 |
| Nodule | 0.08 |
| Rhizoplane | 8.98 |
| Rhizosphere | 62.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1010536 | 3300001976 | Bacteria | 1205 |
| 2 | JGI24735J21928_10048869 | 3300002067 | Bacteria | 1223 |
| 3 | rootL2_10219826 | 3300003322 | Bacteria | 1981 |
| 4 | rootH1_10035436 | 3300003316 | Bacteria | 3249 |
| 5 | rootH1_10035436 | 3300003323 | Bacteria | 1923 |
| 6 | rootH1_10186625 | 3300003323 | Bacteria | 1754 |
| 7 | Ga0006562J51391_1027142 | 3300003578 | Bacteria | 5900 |
| 8 | Ga0006562J51391_1083918 | 3300003578 | Bacteria | 2811 |
| 9 | Ga0055539_1003713 | 3300003752 | Bacteria | 2088 |
| 10 | Ga0055533_1000002 | 3300003756 | Bacteria | 1196393 |
| 11 | Ga0055532_1006111 | 3300003758 | Bacteria | 1632 |
| 12 | Ga0055525_1000022 | 3300003759 | Bacteria | 368755 |
| 13 | Ga0055527_1000003 | 3300003760 | Bacteria | 705001 |
| 14 | Ga0055542_1000005 | 3300003762 | Bacteria | 550280 |
| 15 | Ga0055529_1000006 | 3300003763 | Bacteria | 416978 |
| 16 | Ga0055540_1001685 | 3300003792 | Bacteria | 12748 |
| 17 | Ga0055540_1012590 | 3300003792 | Bacteria | 2644 |
| 18 | Ga0055541_1001766 | 3300003841 | Bacteria | 4534 |
| 19 | JGI25405J52794_10013514 | 3300003911 | Bacteria | 1584 |
| 20 | Ga0070658_10069021 | 3300005327 | Bacteria | 2891 |
| 21 | Ga0070658_10155907 | 3300005327 | Bacteria | 1914 |
| 22 | Ga0070683_100831485 | 3300005329 | Bacteria | 885 |
| 23 | Ga0070670_100267040 | 3300005331 | Bacteria | 1492 |
| 24 | Ga0070670_100768960 | 3300005331 | Bacteria | 869 |
| 25 | Ga0068869_100093729 | 3300005334 | Bacteria | 2263 |
| 26 | Ga0068869_100199627 | 3300005334 | Bacteria | 1576 |
| 27 | Ga0068869_100348330 | 3300005334 | Bacteria | 1207 |
| 28 | Ga0068869_100593625 | 3300005334 | Bacteria | 935 |
| 29 | Ga0070680_100014073 | 3300005336 | Bacteria | 6247 |
| 30 | Ga0070682_100050528 | 3300005337 | Bacteria | 2596 |
| 31 | Ga0070682_100089350 | 3300005337 | Bacteria | 2012 |
| 32 | Ga0070682_100119829 | 3300005337 | Bacteria | 1765 |
| 33 | Ga0070682_100330123 | 3300005337 | Bacteria | 1130 |
| 34 | Ga0070682_100719045 | 3300005337 | Bacteria | 803 |
| 35 | Ga0068868_100207661 | 3300005338 | Bacteria | 1635 |
| 36 | Ga0068868_100278091 | 3300005338 | Bacteria | 1416 |
| 37 | Ga0068868_101021408 | 3300005338 | Bacteria | 757 |
| 38 | Ga0070660_100184357 | 3300005339 | Bacteria | 1690 |
| 39 | Ga0070660_101876016 | 3300005339 | Bacteria | 511 |
| 40 | Ga0070689_100281940 | 3300005340 | Bacteria | 1379 |
| 41 | Ga0070691_10048526 | 3300005341 | Bacteria | 2021 |
| 42 | Ga0070661_100064464 | 3300005344 | Bacteria | 2692 |
| 43 | Ga0070692_10023689 | 3300005345 | Bacteria | 3010 |
| 44 | Ga0070692_10221566 | 3300005345 | Bacteria | 1118 |
| 45 | Ga0070668_100003885 | 3300005347 | Bacteria | 11032 |
| 46 | Ga0070668_100021409 | 3300005347 | Bacteria | 4884 |
| 47 | Ga0070668_100022785 | 3300005347 | Bacteria | 4734 |
| 48 | Ga0070668_100783834 | 3300005347 | Bacteria | 846 |
| 49 | Ga0070668_101783442 | 3300005347 | Bacteria | 566 |
| 50 | Ga0070675_100055477 | 3300005354 | Bacteria | 3262 |
| 51 | Ga0070675_100173026 | 3300005354 | Bacteria | 1863 |
| 52 | Ga0070671_100005155 | 3300005355 | Bacteria | 10401 |
| 53 | Ga0070671_100016974 | 3300005355 | Bacteria | 5887 |
| 54 | Ga0070674_100370167 | 3300005356 | Bacteria | 1163 |
| 55 | Ga0070674_100489125 | 3300005356 | Bacteria | 1023 |
| 56 | Ga0070673_100197383 | 3300005364 | Bacteria | 1732 |
| 57 | Ga0070688_100860365 | 3300005365 | Bacteria | 713 |
| 58 | Ga0070659_100187444 | 3300005366 | Bacteria | 1699 |
| 59 | Ga0070667_100277600 | 3300005367 | Bacteria | 1504 |
| 60 | Ga0070709_10208941 | 3300005434 | Bacteria | 1387 |
| 61 | Ga0070714_100000844 | 3300005435 | Bacteria | 21724 |
| 62 | Ga0070714_100008410 | 3300005435 | Bacteria | 8055 |
| 63 | Ga0070714_100144784 | 3300005435 | Bacteria | 2136 |
| 64 | Ga0070714_100483152 | 3300005435 | Bacteria | 1179 |
| 65 | Ga0070714_100518302 | 3300005435 | Bacteria | 1138 |
| 66 | Ga0070713_100554308 | 3300005436 | Bacteria | 1089 |
| 67 | Ga0070710_10000233 | 3300005437 | Bacteria | 25969 |
| 68 | Ga0070710_10758533 | 3300005437 | Bacteria | 690 |
| 69 | Ga0070701_10142430 | 3300005438 | Bacteria | 1373 |
| 70 | Ga0070663_100003232 | 3300005455 | Bacteria | 9369 |
| 71 | Ga0070663_100040305 | 3300005455 | Bacteria | 3269 |
| 72 | Ga0070663_100236500 | 3300005455 | Bacteria | 1440 |
| 73 | Ga0070663_100796930 | 3300005455 | Bacteria | 810 |
| 74 | Ga0070663_101421462 | 3300005455 | Bacteria | 615 |
| 75 | Ga0070663_101441029 | 3300005455 | Bacteria | 611 |
| 76 | Ga0070678_100049155 | 3300005456 | Bacteria | 3042 |
| 77 | Ga0070678_100346766 | 3300005456 | Bacteria | 1275 |
| 78 | Ga0070678_100921968 | 3300005456 | Bacteria | 800 |
| 79 | Ga0070681_10143224 | 3300005458 | Bacteria | 2319 |
| 80 | Ga0070681_11762978 | 3300005458 | Bacteria | 546 |
| 81 | Ga0068867_100044791 | 3300005459 | Bacteria | 3242 |
| 82 | Ga0068867_100905698 | 3300005459 | Bacteria | 794 |
| 83 | Ga0070685_10785618 | 3300005466 | Bacteria | 701 |
| 84 | Ga0070706_101378621 | 3300005467 | Bacteria | 646 |
| 85 | Ga0070699_101091550 | 3300005518 | Bacteria | 732 |
| 86 | Ga0070679_100063441 | 3300005530 | Bacteria | 3682 |
| 87 | Ga0070679_100275266 | 3300005530 | Bacteria | 1636 |
| 88 | Ga0070679_101586491 | 3300005530 | Bacteria | 602 |
| 89 | Ga0070679_101734524 | 3300005530 | Bacteria | 573 |
| 90 | Ga0070684_100051065 | 3300005535 | Bacteria | 3592 |
| 91 | Ga0068853_100586664 | 3300005539 | Bacteria | 1058 |
| 92 | Ga0068853_101426743 | 3300005539 | Bacteria | 670 |
| 93 | Ga0070672_100126901 | 3300005543 | Bacteria | 2093 |
| 94 | Ga0070672_100328130 | 3300005543 | Bacteria | 1302 |
| 95 | Ga0070672_100439339 | 3300005543 | Bacteria | 1123 |
| 96 | Ga0070696_100646810 | 3300005546 | Bacteria | 857 |
| 97 | Ga0070693_100020573 | 3300005547 | Bacteria | 3482 |
| 98 | Ga0070665_100001588 | 3300005548 | Bacteria | 26177 |
| 99 | Ga0070665_100367292 | 3300005548 | Bacteria | 1446 |
| 100 | Ga0070665_101537980 | 3300005548 | Bacteria | 674 |
| 101 | Ga0070664_100346996 | 3300005564 | Bacteria | 1349 |
| 102 | Ga0068857_100000219 | 3300005577 | Bacteria | 37769 |
| 103 | Ga0068857_100266513 | 3300005577 | Bacteria | 1573 |
| 104 | Ga0068854_100351327 | 3300005578 | Bacteria | 1207 |
| 105 | Ga0068854_100635870 | 3300005578 | Bacteria | 915 |
| 106 | Ga0068854_101491514 | 3300005578 | Bacteria | 614 |
| 107 | Ga0068856_100268053 | 3300005614 | Bacteria | 1723 |
| 108 | Ga0068856_100338758 | 3300005614 | Bacteria | 1522 |
| 109 | Ga0068856_101343796 | 3300005614 | Bacteria | 729 |
| 110 | Ga0070702_100040249 | 3300005615 | Bacteria | 2614 |
| 111 | Ga0070702_100049029 | 3300005615 | Bacteria | 2406 |
| 112 | Ga0070702_100560366 | 3300005615 | Bacteria | 850 |
| 113 | Ga0068852_100231788 | 3300005616 | Bacteria | 1760 |
| 114 | Ga0068852_100426429 | 3300005616 | Bacteria | 1309 |
| 115 | Ga0068852_100939471 | 3300005616 | Bacteria | 883 |
| 116 | Ga0068852_101205920 | 3300005616 | Bacteria | 778 |
| 117 | Ga0068859_100026048 | 3300005617 | Bacteria | 5868 |
| 118 | Ga0068864_100572740 | 3300005618 | Bacteria | 1093 |
| 119 | Ga0068866_10591238 | 3300005718 | Bacteria | 748 |
| 120 | Ga0068861_100236197 | 3300005719 | Bacteria | 1553 |
| 121 | Ga0068861_100395029 | 3300005719 | Bacteria | 1226 |
| 122 | Ga0068851_10014251 | 3300005834 | Bacteria | 3773 |
| 123 | Ga0068870_10018071 | 3300005840 | Bacteria | 3398 |
| 124 | Ga0068870_10437243 | 3300005840 | Bacteria | 860 |
| 125 | Ga0068870_10670152 | 3300005840 | Bacteria | 713 |
| 126 | Ga0068863_100063922 | 3300005841 | Bacteria | 3480 |
| 127 | Ga0068863_100293918 | 3300005841 | Bacteria | 1575 |
| 128 | Ga0068858_100001421 | 3300005842 | Bacteria | 24630 |
| 129 | Ga0068858_100246436 | 3300005842 | Bacteria | 1696 |
| 130 | Ga0068860_100059898 | 3300005843 | Bacteria | 3619 |
| 131 | Ga0068860_100481054 | 3300005843 | Bacteria | 1238 |
| 132 | Ga0068860_100711073 | 3300005843 | Bacteria | 1015 |
| 133 | Ga0068862_100893611 | 3300005844 | Bacteria | 873 |
| 134 | Ga0068862_101063908 | 3300005844 | Bacteria | 803 |
| 135 | Ga0068862_101416235 | 3300005844 | Bacteria | 699 |
| 136 | Ga0081455_10000483 | 3300005937 | Bacteria | 51674 |
| 137 | Ga0081539_10071622 | 3300005985 | Bacteria | 1855 |
| 138 | Ga0081539_10192406 | 3300005985 | Bacteria | 948 |
| 139 | Ga0075365_10000731 | 3300006038 | Bacteria | 13278 |
| 140 | Ga0075365_10031922 | 3300006038 | Bacteria | 3382 |
| 141 | Ga0075365_10039802 | 3300006038 | Bacteria | 3063 |
| 142 | Ga0075365_10060232 | 3300006038 | Bacteria | 2532 |
| 143 | Ga0075365_10154275 | 3300006038 | Bacteria | 1598 |
| 144 | Ga0075365_10177935 | 3300006038 | Bacteria | 1486 |
| 145 | Ga0075365_10236714 | 3300006038 | Bacteria | 1282 |
| 146 | Ga0075365_10270631 | 3300006038 | Bacteria | 1195 |
| 147 | Ga0075365_10278935 | 3300006038 | Bacteria | 1176 |
| 148 | Ga0075365_10285571 | 3300006038 | Bacteria | 1161 |
| 149 | Ga0075365_10383656 | 3300006038 | Bacteria | 991 |
| 150 | Ga0075365_10686158 | 3300006038 | Bacteria | 724 |
| 151 | Ga0075365_11131960 | 3300006038 | Bacteria | 551 |
| 152 | Ga0075368_10008004 | 3300006042 | Bacteria | 3748 |
| 153 | Ga0075368_10178749 | 3300006042 | Bacteria | 894 |
| 154 | Ga0075363_100007181 | 3300006048 | Bacteria | 5102 |
| 155 | Ga0075363_100187031 | 3300006048 | Bacteria | 1180 |
| 156 | Ga0075364_10005118 | 3300006051 | Bacteria | 7599 |
| 157 | Ga0075364_10016785 | 3300006051 | Bacteria | 4561 |
| 158 | Ga0075364_10023072 | 3300006051 | Bacteria | 3937 |
| 159 | Ga0075364_10051767 | 3300006051 | Bacteria | 2682 |
| 160 | Ga0075364_10173877 | 3300006051 | Bacteria | 1456 |
| 161 | Ga0075364_10208586 | 3300006051 | Bacteria | 1325 |
| 162 | Ga0075364_10238670 | 3300006051 | Bacteria | 1234 |
| 163 | Ga0075364_10272332 | 3300006051 | Bacteria | 1152 |
| 164 | Ga0075364_10327572 | 3300006051 | Bacteria | 1043 |
| 165 | Ga0075364_10330049 | 3300006051 | Bacteria | 1039 |
| 166 | Ga0075364_10349401 | 3300006051 | Bacteria | 1008 |
| 167 | Ga0075364_10484534 | 3300006051 | Bacteria | 845 |
| 168 | Ga0075364_10616472 | 3300006051 | Bacteria | 741 |
| 169 | Ga0075432_10044504 | 3300006058 | Bacteria | 1556 |
| 170 | Ga0070716_100558415 | 3300006173 | Bacteria | 855 |
| 171 | Ga0075362_10339103 | 3300006177 | Bacteria | 751 |
| 172 | Ga0075367_10000964 | 3300006178 | Bacteria | 11746 |
| 173 | Ga0075367_10087900 | 3300006178 | Bacteria | 1888 |
| 174 | Ga0075367_10108529 | 3300006178 | Bacteria | 1702 |
| 175 | Ga0075367_10709031 | 3300006178 | Bacteria | 640 |
| 176 | Ga0075369_10006285 | 3300006186 | Bacteria | 4487 |
| 177 | Ga0075369_10015288 | 3300006186 | Bacteria | 3079 |
| 178 | Ga0075369_10040628 | 3300006186 | Bacteria | 1989 |
| 179 | Ga0097621_100163311 | 3300006237 | Bacteria | 1916 |
| 180 | Ga0075370_10008827 | 3300006353 | Bacteria | 5204 |
| 181 | Ga0075370_10113285 | 3300006353 | Bacteria | 1576 |
| 182 | Ga0075370_10182640 | 3300006353 | Bacteria | 1235 |
| 183 | Ga0068871_100169990 | 3300006358 | Bacteria | 1868 |
| 184 | Ga0075431_101077486 | 3300006847 | Bacteria | 769 |
| 185 | Ga0075433_10385350 | 3300006852 | Bacteria | 1237 |
| 186 | Ga0075434_100310396 | 3300006871 | Bacteria | 1597 |
| 187 | Ga0068865_101025395 | 3300006881 | Bacteria | 724 |
| 188 | Ga0068865_101873214 | 3300006881 | Bacteria | 543 |
| 189 | Ga0075436_100035970 | 3300006914 | Bacteria | 3416 |
| 190 | Ga0097620_100026048 | 3300006931 | Bacteria | 5868 |
| 191 | Ga0099826_10340863 | 3300006948 | Bacteria | 749 |
| 192 | Ga0075435_100043739 | 3300007076 | Bacteria | 3586 |
| 193 | Ga0099795_10128415 | 3300007788 | Bacteria | 1020 |
| 194 | Ga0105251_10065735 | 3300009011 | Bacteria | 1697 |
| 195 | Ga0105244_10016522 | 3300009036 | Bacteria | 4202 |
| 196 | Ga0105244_10017359 | 3300009036 | Bacteria | 4068 |
| 197 | Ga0105244_10019572 | 3300009036 | Bacteria | 3775 |
| 198 | Ga0105244_10054498 | 3300009036 | Bacteria | 2028 |
| 199 | Ga0105244_10194218 | 3300009036 | Bacteria | 959 |
| 200 | Ga0105244_10382996 | 3300009036 | Bacteria | 647 |
| 201 | Ga0105240_10090033 | 3300009093 | Bacteria | 3751 |
| 202 | Ga0105240_10620532 | 3300009093 | Bacteria | 1188 |
| 203 | Ga0105240_11978664 | 3300009093 | Bacteria | 606 |
| 204 | Ga0111539_10051853 | 3300009094 | Bacteria | 4885 |
| 205 | Ga0105245_10231936 | 3300009098 | Bacteria | 1786 |
| 206 | Ga0105245_10566266 | 3300009098 | Bacteria | 1159 |
| 207 | Ga0105247_10153706 | 3300009101 | Bacteria | 1518 |
| 208 | Ga0105247_10569714 | 3300009101 | Bacteria | 835 |
| 209 | Ga0114129_11105562 | 3300009147 | Bacteria | 992 |
| 210 | Ga0105243_10003992 | 3300009148 | Bacteria | 11754 |
| 211 | Ga0105243_10005136 | 3300009148 | Bacteria | 10258 |
| 212 | Ga0105243_10131058 | 3300009148 | Bacteria | 2127 |
| 213 | Ga0105243_10355725 | 3300009148 | Bacteria | 1346 |
| 214 | Ga0105243_10751527 | 3300009148 | Bacteria | 956 |
| 215 | Ga0105243_10975037 | 3300009148 | Bacteria | 848 |
| 216 | Ga0105243_12167731 | 3300009148 | Bacteria | 592 |
| 217 | Ga0105241_10040904 | 3300009174 | Bacteria | 3501 |
| 218 | Ga0105242_12435950 | 3300009176 | Bacteria | 571 |
| 219 | Ga0105248_10001035 | 3300009177 | Bacteria | 30787 |
| 220 | Ga0105248_10269060 | 3300009177 | Bacteria | 1919 |
| 221 | Ga0105248_11639086 | 3300009177 | Bacteria | 729 |
| 222 | Ga0105237_10333189 | 3300009545 | Bacteria | 1522 |
| 223 | Ga0105237_10367662 | 3300009545 | Bacteria | 1443 |
| 224 | Ga0105238_10218806 | 3300009551 | Bacteria | 1880 |
| 225 | Ga0105238_10273108 | 3300009551 | Bacteria | 1671 |
| 226 | Ga0105238_10385670 | 3300009551 | Bacteria | 1393 |
| 227 | Ga0105238_10394620 | 3300009551 | Bacteria | 1376 |
| 228 | Ga0105249_10507688 | 3300009553 | Bacteria | 1252 |
| 229 | Ga0099796_10300559 | 3300010159 | Bacteria | 680 |
| 230 | Ga0105239_10010822 | 3300010375 | Bacteria | 10194 |
| 231 | Ga0105239_10449641 | 3300010375 | Bacteria | 1461 |
| 232 | Ga0105239_10656549 | 3300010375 | Bacteria | 1198 |
| 233 | Ga0105239_12602529 | 3300010375 | Bacteria | 590 |
| 234 | Ga0105246_10000044 | 3300011119 | Bacteria | 47668 |
| 235 | Ga0105246_10043650 | 3300011119 | Bacteria | 3043 |
| 236 | Ga0105246_11032581 | 3300011119 | Bacteria | 746 |
| 237 | Ga0105246_11120916 | 3300011119 | Bacteria | 720 |
| 238 | Ga0105246_11725969 | 3300011119 | Bacteria | 596 |
| 239 | Ga0157342_1013526 | 3300012507 | Bacteria | 873 |
| 240 | Ga0157327_1043020 | 3300012512 | Bacteria | 615 |
| 241 | Ga0157338_1079959 | 3300012515 | Bacteria | 527 |
| 242 | Ga0157373_10197183 | 3300013100 | Bacteria | 1419 |
| 243 | Ga0157371_10102271 | 3300013102 | Bacteria | 2033 |
| 244 | Ga0157371_11640155 | 3300013102 | Bacteria | 504 |
| 245 | Ga0157370_10111705 | 3300013104 | Bacteria | 2554 |
| 246 | Ga0157370_10159688 | 3300013104 | Bacteria | 2098 |
| 247 | Ga0157370_11438004 | 3300013104 | Bacteria | 620 |
| 248 | Ga0157369_10029320 | 3300013105 | Bacteria | 6082 |
| 249 | Ga0157369_10070492 | 3300013105 | Bacteria | 3755 |
| 250 | Ga0157369_10192999 | 3300013105 | Bacteria | 2139 |
| 251 | Ga0157369_10283932 | 3300013105 | Bacteria | 1724 |
| 252 | Ga0157369_10419368 | 3300013105 | Bacteria | 1388 |
| 253 | Ga0157369_11292593 | 3300013105 | Bacteria | 744 |
| 254 | Ga0157369_12244627 | 3300013105 | Bacteria | 553 |
| 255 | Ga0157374_10059174 | 3300013296 | Bacteria | 3581 |
| 256 | Ga0157374_11941248 | 3300013296 | Bacteria | 615 |
| 257 | Ga0157378_10585023 | 3300013297 | Bacteria | 1126 |
| 258 | Ga0157378_11445838 | 3300013297 | Bacteria | 731 |
| 259 | Ga0157378_12300611 | 3300013297 | Bacteria | 590 |
| 260 | Ga0163162_10580219 | 3300013306 | Bacteria | 1248 |
| 261 | Ga0163162_11018708 | 3300013306 | Bacteria | 936 |
| 262 | Ga0157372_10099931 | 3300013307 | Bacteria | 3310 |
| 263 | Ga0157372_10365947 | 3300013307 | Bacteria | 1680 |
| 264 | Ga0157372_10751174 | 3300013307 | Bacteria | 1134 |
| 265 | Ga0157372_10905491 | 3300013307 | Bacteria | 1023 |
| 266 | Ga0157372_11216273 | 3300013307 | Bacteria | 870 |
| 267 | Ga0157372_12143934 | 3300013307 | Bacteria | 642 |
| 268 | Ga0157372_12306724 | 3300013307 | Bacteria | 618 |
| 269 | Ga0157375_10248371 | 3300013308 | Bacteria | 1940 |
| 270 | Ga0157375_10496971 | 3300013308 | Bacteria | 1384 |
| 271 | Ga0157375_10683779 | 3300013308 | Bacteria | 1180 |
| 272 | Ga0157375_12145089 | 3300013308 | Bacteria | 665 |
| 273 | Ga0163163_10107231 | 3300014325 | Bacteria | 2820 |
| 274 | Ga0163163_11710802 | 3300014325 | Bacteria | 690 |
| 275 | Ga0157380_10018061 | 3300014326 | Bacteria | 5231 |
| 276 | Ga0157380_10829662 | 3300014326 | Bacteria | 944 |
| 277 | Ga0157380_11070181 | 3300014326 | Bacteria | 844 |
| 278 | Ga0157380_13064422 | 3300014326 | Bacteria | 533 |
| 279 | Ga0157377_10043815 | 3300014745 | Bacteria | 2492 |
| 280 | Ga0157377_10209474 | 3300014745 | Bacteria | 1242 |
| 281 | Ga0157377_11123691 | 3300014745 | Bacteria | 603 |
| 282 | Ga0157379_10131373 | 3300014968 | Bacteria | 2254 |
| 283 | Ga0157376_10273378 | 3300014969 | Bacteria | 1588 |
| 284 | Ga0183367_1004 | 3300015688 | Bacteria | 716880 |
| 285 | Ga0163161_10032074 | 3300017792 | Bacteria | 3748 |
| 286 | Ga0163161_10121019 | 3300017792 | Bacteria | 1967 |
| 287 | Ga0163161_10730264 | 3300017792 | Bacteria | 827 |
| 288 | Ga0163161_11954360 | 3300017792 | Bacteria | 522 |
| 289 | Ga0197907_11039976 | 3300020069 | Bacteria | 974 |
| 290 | Ga0197907_11497675 | 3300020069 | Bacteria | 925 |
| 291 | Ga0206356_10230095 | 3300020070 | Bacteria | 668 |
| 292 | Ga0206356_11269870 | 3300020070 | Bacteria | 539 |
| 293 | Ga0206349_1124982 | 3300020075 | Bacteria | 834 |
| 294 | Ga0206351_10641595 | 3300020077 | Bacteria | 907 |
| 295 | Ga0206350_11557265 | 3300020080 | Bacteria | 785 |
| 296 | Ga0206354_10195925 | 3300020081 | Bacteria | 888 |
| 297 | Ga0206353_10846297 | 3300020082 | Bacteria | 3817 |
| 298 | Ga0206353_12056045 | 3300020082 | Bacteria | 1699 |
| 299 | Ga0154015_1392376 | 3300020610 | Bacteria | 965 |
| 300 | Ga0154015_1424168 | 3300020610 | Bacteria | 1582 |
| 301 | Ga0224712_10023372 | 3300022467 | Bacteria | 2146 |
| 302 | Ga0209566_100032 | 3300025225 | Bacteria | 338313 |
| 303 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 304 | Ga0209672_100003 | 3300025228 | Bacteria | 1560476 |
| 305 | Ga0209672_109945 | 3300025228 | Bacteria | 1311 |
| 306 | Ga0209147_100551 | 3300025229 | Bacteria | 21239 |
| 307 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 308 | Ga0209437_100662 | 3300025233 | Bacteria | 19091 |
| 309 | Ga0209258_108829 | 3300025242 | Bacteria | 1387 |
| 310 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 311 | Ga0209677_101476 | 3300025253 | Bacteria | 10116 |
| 312 | Ga0209148_1000004 | 3300025254 | Bacteria | 1844481 |
| 313 | Ga0209455_1000091 | 3300025272 | Bacteria | 223115 |
| 314 | Ga0209455_1000975 | 3300025272 | Bacteria | 14462 |
| 315 | Ga0209673_1019300 | 3300025273 | Bacteria | 2451 |
| 316 | Ga0209025_1077803 | 3300025294 | Bacteria | 1141 |
| 317 | Ga0209051_1005852 | 3300025303 | Bacteria | 7072 |
| 318 | Ga0209051_1008594 | 3300025303 | Bacteria | 5385 |
| 319 | Ga0209051_1018280 | 3300025303 | Bacteria | 3105 |
| 320 | Ga0209051_1026798 | 3300025303 | Bacteria | 2313 |
| 321 | Ga0207656_10075654 | 3300025321 | Bacteria | 1504 |
| 322 | Ga0207655_1002175 | 3300025728 | Bacteria | 16307 |
| 323 | Ga0207655_1019753 | 3300025728 | Bacteria | 3502 |
| 324 | Ga0207655_1090282 | 3300025728 | Bacteria | 1080 |
| 325 | Ga0207682_10266515 | 3300025893 | Bacteria | 799 |
| 326 | Ga0207692_10010715 | 3300025898 | Bacteria | 3876 |
| 327 | Ga0207642_10952538 | 3300025899 | Bacteria | 551 |
| 328 | Ga0207710_10065927 | 3300025900 | Bacteria | 1651 |
| 329 | Ga0207688_10207301 | 3300025901 | Bacteria | 1177 |
| 330 | Ga0207647_10360937 | 3300025904 | Bacteria | 822 |
| 331 | Ga0207699_10728986 | 3300025906 | Bacteria | 726 |
| 332 | Ga0207643_10022279 | 3300025908 | Bacteria | 3486 |
| 333 | Ga0207643_10567461 | 3300025908 | Bacteria | 729 |
| 334 | Ga0207705_10038350 | 3300025909 | Bacteria | 3430 |
| 335 | Ga0207705_10057363 | 3300025909 | Bacteria | 2808 |
| 336 | Ga0207705_10863799 | 3300025909 | Bacteria | 701 |
| 337 | Ga0207654_10103715 | 3300025911 | Bacteria | 1757 |
| 338 | Ga0207707_10134437 | 3300025912 | Bacteria | 2162 |
| 339 | Ga0207695_10074454 | 3300025913 | Bacteria | 3457 |
| 340 | Ga0207695_10666180 | 3300025913 | Bacteria | 921 |
| 341 | Ga0207671_10225677 | 3300025914 | Bacteria | 1468 |
| 342 | Ga0207671_10244640 | 3300025914 | Bacteria | 1409 |
| 343 | Ga0207671_10711107 | 3300025914 | Bacteria | 799 |
| 344 | Ga0207693_10269273 | 3300025915 | Bacteria | 1335 |
| 345 | Ga0207663_10396367 | 3300025916 | Bacteria | 1055 |
| 346 | Ga0207660_10430509 | 3300025917 | Bacteria | 1065 |
| 347 | Ga0207657_10160115 | 3300025919 | Bacteria | 1829 |
| 348 | Ga0207649_10100375 | 3300025920 | Bacteria | 1914 |
| 349 | Ga0207652_10027978 | 3300025921 | Bacteria | 4701 |
| 350 | Ga0207652_11212895 | 3300025921 | Bacteria | 656 |
| 351 | Ga0207681_11832645 | 3300025923 | Bacteria | 506 |
| 352 | Ga0207694_10300894 | 3300025924 | Bacteria | 1321 |
| 353 | Ga0207694_10505264 | 3300025924 | Bacteria | 1012 |
| 354 | Ga0207650_10097869 | 3300025925 | Bacteria | 2253 |
| 355 | Ga0207650_10543289 | 3300025925 | Bacteria | 974 |
| 356 | Ga0207659_10456912 | 3300025926 | Bacteria | 1076 |
| 357 | Ga0207659_10901267 | 3300025926 | Bacteria | 760 |
| 358 | Ga0207687_10301113 | 3300025927 | Bacteria | 1292 |
| 359 | Ga0207687_11946913 | 3300025927 | Bacteria | 502 |
| 360 | Ga0207664_10045644 | 3300025929 | Bacteria | 3437 |
| 361 | Ga0207664_10368313 | 3300025929 | Bacteria | 1274 |
| 362 | Ga0207644_10026063 | 3300025931 | Bacteria | 4025 |
| 363 | Ga0207644_10051697 | 3300025931 | Bacteria | 2950 |
| 364 | Ga0207644_11370363 | 3300025931 | Bacteria | 594 |
| 365 | Ga0207690_10125531 | 3300025932 | Bacteria | 1870 |
| 366 | Ga0207706_10134108 | 3300025933 | Bacteria | 2178 |
| 367 | Ga0207709_10006092 | 3300025935 | Bacteria | 6795 |
| 368 | Ga0207709_10065896 | 3300025935 | Bacteria | 2279 |
| 369 | Ga0207709_10108400 | 3300025935 | Bacteria | 1852 |
| 370 | Ga0207709_11180590 | 3300025935 | Bacteria | 630 |
| 371 | Ga0207670_10173692 | 3300025936 | Bacteria | 1618 |
| 372 | Ga0207669_10371062 | 3300025937 | Bacteria | 1112 |
| 373 | Ga0207704_10849835 | 3300025938 | Bacteria | 765 |
| 374 | Ga0207665_10219242 | 3300025939 | Bacteria | 1393 |
| 375 | Ga0207691_10122681 | 3300025940 | Bacteria | 2301 |
| 376 | Ga0207691_10232112 | 3300025940 | Bacteria | 1597 |
| 377 | Ga0207691_10322967 | 3300025940 | Bacteria | 1323 |
| 378 | Ga0207691_11063913 | 3300025940 | Bacteria | 674 |
| 379 | Ga0207711_10000519 | 3300025941 | Bacteria | 39605 |
| 380 | Ga0207711_11091875 | 3300025941 | Bacteria | 739 |
| 381 | Ga0207689_10051546 | 3300025942 | Bacteria | 3392 |
| 382 | Ga0207689_10404260 | 3300025942 | Bacteria | 1138 |
| 383 | Ga0207689_10963367 | 3300025942 | Bacteria | 720 |
| 384 | Ga0207661_10190292 | 3300025944 | Bacteria | 1798 |
| 385 | Ga0207661_11162946 | 3300025944 | Bacteria | 710 |
| 386 | Ga0207679_10335069 | 3300025945 | Bacteria | 1314 |
| 387 | Ga0207667_10021672 | 3300025949 | Bacteria | 7118 |
| 388 | Ga0207667_10366642 | 3300025949 | Bacteria | 1469 |
| 389 | Ga0207651_10582200 | 3300025960 | Bacteria | 976 |
| 390 | Ga0207668_10006122 | 3300025972 | Bacteria | 7097 |
| 391 | Ga0207668_10028517 | 3300025972 | Bacteria | 3650 |
| 392 | Ga0207668_10096609 | 3300025972 | Bacteria | 2184 |
| 393 | Ga0207668_11317763 | 3300025972 | Bacteria | 650 |
| 394 | Ga0207640_10070755 | 3300025981 | Bacteria | 2348 |
| 395 | Ga0207658_10255904 | 3300025986 | Bacteria | 1490 |
| 396 | Ga0207658_10340981 | 3300025986 | Bacteria | 1302 |
| 397 | Ga0207677_10173622 | 3300026023 | Bacteria | 1688 |
| 398 | Ga0207677_10902634 | 3300026023 | Bacteria | 797 |
| 399 | Ga0207703_10001728 | 3300026035 | Bacteria | 19637 |
| 400 | Ga0207639_10226101 | 3300026041 | Bacteria | 1619 |
| 401 | Ga0207678_10000523 | 3300026067 | Bacteria | 34843 |
| 402 | Ga0207678_10114218 | 3300026067 | Bacteria | 2304 |
| 403 | Ga0207678_10197485 | 3300026067 | Bacteria | 1719 |
| 404 | Ga0207678_10218475 | 3300026067 | Bacteria | 1631 |
| 405 | Ga0207678_10992075 | 3300026067 | Bacteria | 743 |
| 406 | Ga0207708_10116776 | 3300026075 | Bacteria | 2076 |
| 407 | Ga0207702_10003794 | 3300026078 | Bacteria | 13641 |
| 408 | Ga0207702_10767265 | 3300026078 | Bacteria | 952 |
| 409 | Ga0207641_10189307 | 3300026088 | Bacteria | 1890 |
| 410 | Ga0207641_10262913 | 3300026088 | Bacteria | 1616 |
| 411 | Ga0207641_10322650 | 3300026088 | Bacteria | 1465 |
| 412 | Ga0207648_10379223 | 3300026089 | Bacteria | 1278 |
| 413 | Ga0207676_10277319 | 3300026095 | Bacteria | 1520 |
| 414 | Ga0207676_12271600 | 3300026095 | Bacteria | 540 |
| 415 | Ga0207674_10004533 | 3300026116 | Bacteria | 16682 |
| 416 | Ga0207674_10225383 | 3300026116 | Bacteria | 1823 |
| 417 | Ga0207675_100509749 | 3300026118 | Bacteria | 1198 |
| 418 | Ga0207683_10063441 | 3300026121 | Bacteria | 3255 |
| 419 | Ga0207683_10671955 | 3300026121 | Bacteria | 960 |
| 420 | Ga0207698_10301324 | 3300026142 | Bacteria | 1492 |
| 421 | Ga0207698_10309087 | 3300026142 | Bacteria | 1475 |
| 422 | Ga0207698_11715878 | 3300026142 | Bacteria | 643 |
| 423 | Ga0209371_1026907 | 3300027312 | Bacteria | 1301 |
| 424 | Ga0209813_10039242 | 3300027866 | Bacteria | 1435 |
| 425 | Ga0209813_10162578 | 3300027866 | Bacteria | 806 |
| 426 | Ga0207428_10055196 | 3300027907 | Bacteria | 3160 |
| 427 | Ga0265356_1012565 | 3300028017 | Bacteria | 929 |
| 428 | Ga0268266_10262357 | 3300028379 | Bacteria | 1601 |
| 429 | Ga0268266_10270079 | 3300028379 | Bacteria | 1578 |
| 430 | Ga0268266_10317821 | 3300028379 | Bacteria | 1457 |
| 431 | Ga0268266_11683963 | 3300028379 | Bacteria | 609 |
| 432 | Ga0268265_10064135 | 3300028380 | Bacteria | 2829 |
| 433 | Ga0268265_10167741 | 3300028380 | Bacteria | 1873 |
| 434 | Ga0268265_11507675 | 3300028380 | Bacteria | 676 |
| 435 | Ga0268264_10068251 | 3300028381 | Bacteria | 3004 |
| 436 | Ga0268264_10458365 | 3300028381 | Bacteria | 1236 |
| 437 | Ga0268264_10680120 | 3300028381 | Bacteria | 1021 |
| 438 | Ga0268264_11915145 | 3300028381 | Bacteria | 602 |
| 439 | Ga0307517_10527502 | 3300028786 | Bacteria | 595 |
| 440 | Ga0307517_10628325 | 3300028786 | Bacteria | 525 |
| 441 | Ga0307515_10000476 | 3300028794 | Bacteria | 95453 |
| 442 | Ga0307515_10006481 | 3300028794 | Bacteria | 23417 |
| 443 | Ga0307515_10027722 | 3300028794 | Bacteria | 9664 |
| 444 | Ga0307515_10147113 | 3300028794 | Bacteria | 2488 |
| 445 | Ga0307515_10150139 | 3300028794 | Bacteria | 2441 |
| 446 | Ga0307515_10347340 | 3300028794 | Bacteria | 1132 |
| 447 | Ga0307511_10143414 | 3300030521 | Bacteria | 1395 |
| 448 | Ga0307512_10016370 | 3300030522 | Bacteria | 6846 |
| 449 | Ga0307512_10077703 | 3300030522 | Bacteria | 2410 |
| 450 | Ga0265760_10061215 | 3300031090 | Unclassified | 1144 |
| 451 | Ga0265340_10000636 | 3300031247 | Bacteria | 19656 |
| 452 | Ga0265327_10000019 | 3300031251 | Bacteria | 427653 |
| 453 | Ga0265327_10000071 | 3300031251 | Bacteria | 215502 |
| 454 | Ga0307513_10000123 | 3300031456 | Bacteria | 108854 |
| 455 | Ga0307513_10011893 | 3300031456 | Bacteria | 10781 |
| 456 | Ga0307513_10195295 | 3300031456 | Bacteria | 1870 |
| 457 | Ga0307513_10222619 | 3300031456 | Bacteria | 1706 |
| 458 | Ga0307513_10366606 | 3300031456 | Bacteria | 1184 |
| 459 | Ga0307513_10887487 | 3300031456 | Bacteria | 599 |
| 460 | Ga0307408_100571890 | 3300031548 | Bacteria | 1000 |
| 461 | Ga0307508_10105434 | 3300031616 | Bacteria | 2417 |
| 462 | Ga0307514_10032573 | 3300031649 | Bacteria | 4169 |
| 463 | Ga0307514_10041798 | 3300031649 | Bacteria | 3608 |
| 464 | Ga0307514_10108662 | 3300031649 | Bacteria | 1971 |
| 465 | Ga0307514_10118788 | 3300031649 | Bacteria | 1851 |
| 466 | Ga0307516_10001960 | 3300031730 | Bacteria | 28187 |
| 467 | Ga0307516_10037037 | 3300031730 | Bacteria | 4878 |
| 468 | Ga0307516_10159378 | 3300031730 | Bacteria | 2008 |
| 469 | Ga0307516_10889491 | 3300031730 | Bacteria | 556 |
| 470 | Ga0307413_10176423 | 3300031824 | Bacteria | 1519 |
| 471 | Ga0307413_11585064 | 3300031824 | Bacteria | 581 |
| 472 | Ga0307413_11677767 | 3300031824 | Bacteria | 566 |
| 473 | Ga0307518_10001506 | 3300031838 | Bacteria | 17266 |
| 474 | Ga0307518_10016128 | 3300031838 | Bacteria | 5351 |
| 475 | Ga0307518_10095620 | 3300031838 | Bacteria | 2133 |
| 476 | Ga0307518_10413369 | 3300031838 | Bacteria | 745 |
| 477 | Ga0307410_10061901 | 3300031852 | Bacteria | 2562 |
| 478 | Ga0307410_10509644 | 3300031852 | Bacteria | 991 |
| 479 | Ga0307406_10284363 | 3300031901 | Bacteria | 1263 |
| 480 | Ga0307406_11641234 | 3300031901 | Bacteria | 569 |
| 481 | Ga0307407_10611108 | 3300031903 | Bacteria | 813 |
| 482 | Ga0307407_10738820 | 3300031903 | Bacteria | 744 |
| 483 | Ga0307412_10028693 | 3300031911 | Bacteria | 3485 |
| 484 | Ga0307412_11417523 | 3300031911 | Bacteria | 629 |
| 485 | Ga0307409_100126389 | 3300031995 | Bacteria | 2176 |
| 486 | Ga0307409_100224941 | 3300031995 | Bacteria | 1697 |
| 487 | Ga0307409_102768669 | 3300031995 | Bacteria | 518 |
| 488 | Ga0307416_100348795 | 3300032002 | Bacteria | 1497 |
| 489 | Ga0307416_101237705 | 3300032002 | Bacteria | 852 |
| 490 | Ga0307414_10141732 | 3300032004 | Bacteria | 1883 |
| 491 | Ga0307414_11051467 | 3300032004 | Bacteria | 751 |
| 492 | Ga0307414_11481923 | 3300032004 | Bacteria | 631 |
| 493 | Ga0307414_12287257 | 3300032004 | Bacteria | 505 |
| 494 | Ga0307411_11335360 | 3300032005 | Bacteria | 654 |
| 495 | Ga0307415_100103128 | 3300032126 | Bacteria | 2098 |
| 496 | Ga0307415_100631784 | 3300032126 | Bacteria | 957 |
| 497 | Ga0307415_100744800 | 3300032126 | Bacteria | 889 |
| 498 | Ga0307415_101069387 | 3300032126 | Bacteria | 754 |
| 499 | Ga0307415_101840240 | 3300032126 | Bacteria | 587 |
| 500 | Ga0307507_10052583 | 3300033179 | Bacteria | 3902 |
| 501 | Ga0307507_10075955 | 3300033179 | Bacteria | 3001 |
| 502 | Ga0307510_10038499 | 3300033180 | Bacteria | 5287 |
| 503 | Ga0316214_1007998 | 3300033545 | Bacteria | 1419 |
| 504 | Ga0316212_1036648 | 3300033547 | Bacteria | 691 |
| 505 | Ga0373948_0064811 | 3300034817 | Bacteria | 809 |
| 506 | Ga0373938_0025982 | 3300034957 | Bacteria | 1222 |
| 507 | Ga0373940_0168083 | 3300035088 | Bacteria | 707 |
| 508 | Ga0373944_0309178 | 3300035089 | Bacteria | 595 |
| 509 | Ga0373951_0000075 | 3300035091 | Bacteria | 39283 |
| 510 | Ga0373952_0249473 | 3300035092 | Bacteria | 537 |
| 511 | Ga0373939_0370450 | 3300035114 | Bacteria | 587 |
| 512 | Ga0373945_0156024 | 3300035116 | Bacteria | 928 |
| 513 | Ga0373943_0771462 | 3300035170 | Bacteria | 571 |
| 514 | Ga0373942_0002622 | 3300035207 | Bacteria | 4326 |
| 515 | Ga0373961_0293823 | 3300035241 | Bacteria | 599 |
| 516 | Ga0373962_0067115 | 3300035242 | Bacteria | 1064 |
| 517 | Ga0373931_0145114 | 3300035691 | Bacteria | 1379 |
| 518 | Ga0373935_0845373 | 3300035692 | Bacteria | 677 |
| 519 | Ga0373947_0353874 | 3300035725 | Bacteria | 986 |
| 520 | Ga0372808_031836 | 3300036459 | Bacteria | 756 |
| 521 | Ga0372808_051894 | 3300036459 | Bacteria | 587 |
| 522 | Ga0373925_0000954 | 3300037068 | Bacteria | 26314 |
| 523 | Ga0395899_0002933 | 3300037312 | Bacteria | 13691 |
| 524 | Ga0395899_0026682 | 3300037312 | Bacteria | 4358 |
| 525 | Ga0395900_0002361 | 3300037418 | Bacteria | 20877 |
| 526 | Ga0395900_0592148 | 3300037418 | Bacteria | 1050 |
| 527 | Ga0395898_0000321 | 3300037466 | Bacteria | 110293 |
| 528 | Ga0395898_1417179 | 3300037466 | Bacteria | 622 |
| 529 | Ga0436364_1195756 | 3300037853 | Bacteria | 3845 |
| 530 | Ga0451787_032442 | 3300041441 | Bacteria | 736 |
| 531 | Ga0451789_0213093 | 3300041443 | Bacteria | 620 |
| 532 | Ga0451789_0854918 | 3300041443 | Bacteria | 1980 |
| 533 | Ga0451791_0259315 | 3300041451 | Bacteria | 1676 |
| 534 | Ga0451791_0533426 | 3300041451 | Bacteria | 12768 |
| 535 | Ga0451791_1568974 | 3300041451 | Bacteria | 829 |
| 536 | Ga0451793_0945660 | 3300041452 | Bacteria | 4545 |
| 537 | Ga0451797_0223534 | 3300041453 | Bacteria | 3311 |
| 538 | Ga0451797_0260210 | 3300041453 | Bacteria | 770 |
| 539 | Ga0451797_1010462 | 3300041453 | Bacteria | 713 |
| 540 | Ga0451797_1326552 | 3300041453 | Bacteria | 512 |
| 541 | Ga0451797_1447719 | 3300041453 | Bacteria | 513 |
| 542 | Ga0451795_0232793 | 3300041456 | Bacteria | 1747 |
| 543 | Ga0451795_1243454 | 3300041456 | Bacteria | 677 |
| 544 | Ga0451798_1164732 | 3300041458 | Bacteria | 684 |
| 545 | Ga0451800_0611837 | 3300041459 | Bacteria | 1905 |
| 546 | Ga0451800_1547848 | 3300041459 | Bacteria | 541 |
| 547 | Ga0451802_1237693 | 3300041460 | Bacteria | 660 |
| 548 | Ga0451807_1812773 | 3300041486 | Bacteria | 1302 |
| 549 | Ga0451807_2448106 | 3300041486 | Bacteria | 691 |
| 550 | Ga0451833_0593006 | 3300041491 | Bacteria | 998 |
| 551 | Ga0451835_0715652 | 3300041492 | Bacteria | 632 |
| 552 | Ga0451837_0160372 | 3300041494 | Bacteria | 715 |
| 553 | Ga0451837_0260143 | 3300041494 | Bacteria | 1511 |
| 554 | Ga0451837_0336078 | 3300041494 | Bacteria | 2293 |
| 555 | Ga0451837_0663881 | 3300041494 | Bacteria | 2095 |
| 556 | Ga0451839_0040102 | 3300041496 | Bacteria | 808 |
| 557 | Ga0451841_0838650 | 3300041498 | Bacteria | 902 |
| 558 | Ga0451841_1169559 | 3300041498 | Bacteria | 635 |
| 559 | Ga0451849_0568500 | 3300041505 | Bacteria | 1395 |
| 560 | Ga0451849_0617852 | 3300041505 | Bacteria | 782 |
| 561 | Ga0451851_0764749 | 3300041507 | Bacteria | 613 |
| 562 | Ga0451843_0405326 | 3300041509 | Bacteria | 1376 |
| 563 | Ga0451855_1955659 | 3300041511 | Bacteria | 609 |
| 564 | Ga0451853_0678185 | 3300041512 | Bacteria | 2590 |
| 565 | Ga0451853_1645114 | 3300041512 | Bacteria | 516 |
| 566 | Ga0451853_1865336 | 3300041512 | Bacteria | 1892 |
| 567 | Ga0451853_2013961 | 3300041512 | Bacteria | 713 |
| 568 | Ga0451853_3422223 | 3300041512 | Bacteria | 1350 |
| 569 | Ga0439448_0006511 | 3300042005 | Bacteria | 3363 |
| 570 | Ga0439450_055731 | 3300042008 | Bacteria | 947 |
| 571 | Ga0439455_0020868 | 3300042012 | Bacteria | 1556 |
| 572 | Ga0450903_000098 | 3300042138 | Bacteria | 18290 |
| 573 | Ga0439458_0004682 | 3300042157 | Bacteria | 3119 |
| 574 | Ga0439458_0142526 | 3300042157 | Bacteria | 639 |
| 575 | Ga0466969_0431474 | 3300044656 | Bacteria | 599 |
| 576 | Ga0466972_0001226 | 3300044658 | Bacteria | 12366 |
| 577 | Ga0466972_0053157 | 3300044658 | Bacteria | 1951 |
| 578 | Ga0466972_0067717 | 3300044658 | Bacteria | 1705 |
| 579 | Ga0466972_0228617 | 3300044658 | Bacteria | 870 |
| 580 | Ga0466972_0472748 | 3300044658 | Bacteria | 589 |
| 581 | Ga0466965_0000017 | 3300044683 | Bacteria | 72634 |
| 582 | Ga0466965_0000816 | 3300044683 | Bacteria | 11748 |
| 583 | Ga0466965_0003732 | 3300044683 | Bacteria | 6720 |
| 584 | Ga0466965_0065005 | 3300044683 | Bacteria | 1827 |
| 585 | Ga0466965_0091930 | 3300044683 | Bacteria | 1545 |
| 586 | Ga0466965_0236732 | 3300044683 | Bacteria | 976 |
| 587 | Ga0466965_0412316 | 3300044683 | Bacteria | 748 |
| 588 | Ga0466966_0038933 | 3300044684 | Bacteria | 3062 |
| 589 | Ga0466961_0058089 | 3300044693 | Bacteria | 2461 |
| 590 | Ga0466961_0400771 | 3300044693 | Bacteria | 833 |
| 591 | Ga0466963_0003809 | 3300044694 | Bacteria | 8699 |
| 592 | Ga0466963_0718766 | 3300044694 | Bacteria | 705 |
| 593 | Ga0466963_0909669 | 3300044694 | Bacteria | 620 |
| 594 | Ga0466964_0244160 | 3300044706 | Bacteria | 882 |
| 595 | Ga0466964_0501336 | 3300044706 | Bacteria | 652 |
| 596 | Ga0466971_0251759 | 3300044719 | Bacteria | 842 |
| 597 | Ga0466971_0404362 | 3300044719 | Bacteria | 666 |
| 598 | Ga0466968_0049755 | 3300044735 | Bacteria | 1786 |
| 599 | Ga0466968_0185830 | 3300044735 | Bacteria | 968 |
| 600 | Ga0466968_0209818 | 3300044735 | Bacteria | 915 |
| 601 | Ga0466970_0030921 | 3300044765 | Bacteria | 2825 |
| 602 | Ga0466970_0068558 | 3300044765 | Bacteria | 1905 |
| 603 | Ga0466970_0075918 | 3300044765 | Bacteria | 1810 |
| 604 | Ga0466970_0181213 | 3300044765 | Bacteria | 1169 |
| 605 | Ga0466970_0702820 | 3300044765 | Bacteria | 589 |
| 606 | Ga0466957_0040034 | 3300044842 | Bacteria | 2829 |
| 607 | Ga0466957_0332365 | 3300044842 | Bacteria | 1027 |
| 608 | Ga0466957_0947076 | 3300044842 | Bacteria | 617 |
| 609 | Ga0466957_1077109 | 3300044842 | Bacteria | 579 |
| 610 | Ga0466960_0009553 | 3300044901 | Bacteria | 4002 |
| 611 | Ga0466960_0034536 | 3300044901 | Bacteria | 2357 |
| 612 | Ga0466960_0052319 | 3300044901 | Bacteria | 1975 |
| 613 | Ga0466960_0102313 | 3300044901 | Bacteria | 1477 |
| 614 | Ga0466960_0156450 | 3300044901 | Bacteria | 1221 |
| 615 | Ga0466960_0696971 | 3300044901 | Bacteria | 609 |
| 616 | Ga0466959_0031024 | 3300045049 | Bacteria | 3956 |
| 617 | Ga0466959_0181327 | 3300045049 | Bacteria | 1472 |
| 618 | Ga0466959_0199166 | 3300045049 | Bacteria | 1395 |
| 619 | Ga0466958_0181039 | 3300045836 | Bacteria | 1337 |
| 620 | Ga0466967_0005714 | 3300045976 | Bacteria | 8675 |
| 621 | Ga0466967_0053877 | 3300045976 | Bacteria | 3538 |
| 622 | Ga0466967_0189953 | 3300045976 | Bacteria | 1941 |
| 623 | Ga0466967_0251319 | 3300045976 | Bacteria | 1689 |
| 624 | Ga0495617_085387 | 3300046452 | Bacteria | 1032 |
| 625 | Ga0495627_102149 | 3300046453 | Bacteria | 818 |
| 626 | Ga0495592_0023504 | 3300046454 | Bacteria | 4687 |
| 627 | Ga0495592_0108135 | 3300046454 | Bacteria | 1971 |
| 628 | Ga0495603_0029051 | 3300046455 | Bacteria | 3335 |
| 629 | Ga0495603_0894576 | 3300046455 | Bacteria | 504 |
| 630 | Ga0495591_036353 | 3300046458 | Bacteria | 1434 |
| 631 | Ga0495629_0000982 | 3300046459 | Bacteria | 22889 |
| 632 | Ga0495629_0112678 | 3300046459 | Bacteria | 1896 |
| 633 | Ga0495638_0028057 | 3300046460 | Bacteria | 3638 |
| 634 | Ga0495638_0088264 | 3300046460 | Bacteria | 1872 |
| 635 | Ga0495653_0151184 | 3300046463 | Bacteria | 1622 |
| 636 | Ga0495653_0817920 | 3300046463 | Bacteria | 559 |
| 637 | Ga0495582_0081190 | 3300046473 | Bacteria | 1800 |
| 638 | Ga0495605_0008148 | 3300046474 | Bacteria | 5925 |
| 639 | Ga0495639_0455835 | 3300046475 | Bacteria | 650 |
| 640 | Ga0495662_0014479 | 3300046476 | Bacteria | 3834 |
| 641 | Ga0495664_0139994 | 3300046477 | Bacteria | 1467 |
| 642 | Ga0495664_0732035 | 3300046477 | Bacteria | 583 |
| 643 | Ga0495584_0453336 | 3300046491 | Bacteria | 652 |
| 644 | Ga0495585_0076551 | 3300046492 | Bacteria | 1817 |
| 645 | Ga0495594_0020582 | 3300046499 | Bacteria | 3514 |
| 646 | Ga0495596_0064718 | 3300046500 | Bacteria | 1422 |
| 647 | Ga0495583_0016760 | 3300046506 | Bacteria | 3921 |
| 648 | Ga0495606_0018741 | 3300046507 | Bacteria | 5178 |
| 649 | Ga0495606_0527280 | 3300046507 | Bacteria | 592 |
| 650 | Ga0495610_0180783 | 3300046512 | Bacteria | 877 |
| 651 | Ga0495618_0425420 | 3300046514 | Bacteria | 809 |
| 652 | Ga0495620_0007132 | 3300046515 | Bacteria | 6091 |
| 653 | Ga0495628_0025087 | 3300046516 | Bacteria | 4873 |
| 654 | Ga0495628_0138616 | 3300046516 | Bacteria | 1857 |
| 655 | Ga0495630_0081587 | 3300046517 | Bacteria | 2440 |
| 656 | Ga0495631_0050312 | 3300046518 | Bacteria | 1823 |
| 657 | Ga0495632_0383370 | 3300046519 | Bacteria | 615 |
| 658 | Ga0495632_0492680 | 3300046519 | Bacteria | 529 |
| 659 | Ga0495643_0001930 | 3300046522 | Bacteria | 17469 |
| 660 | Ga0495644_0108656 | 3300046523 | Bacteria | 1052 |
| 661 | Ga0495648_0027291 | 3300046524 | Bacteria | 3825 |
| 662 | Ga0495666_0002237 | 3300046526 | Bacteria | 9631 |
| 663 | Ga0495666_0228632 | 3300046526 | Bacteria | 850 |
| 664 | Ga0495652_0172925 | 3300046529 | Bacteria | 1665 |
| 665 | Ga0495652_0229077 | 3300046529 | Bacteria | 1391 |
| 666 | Ga0495654_0176224 | 3300046530 | Bacteria | 929 |
| 667 | Ga0495640_0006860 | 3300046533 | Bacteria | 8970 |
| 668 | Ga0495586_0137735 | 3300046535 | Bacteria | 1369 |
| 669 | Ga0495586_0365108 | 3300046535 | Bacteria | 830 |
| 670 | Ga0495586_0646462 | 3300046535 | Bacteria | 611 |
| 671 | Ga0495587_0013767 | 3300046536 | Bacteria | 5082 |
| 672 | Ga0495598_0361293 | 3300046537 | Bacteria | 561 |
| 673 | Ga0495609_0035339 | 3300046538 | Bacteria | 2262 |
| 674 | Ga0495609_0179317 | 3300046538 | Bacteria | 892 |
| 675 | Ga0495597_0050030 | 3300046542 | Bacteria | 1846 |
| 676 | Ga0495645_0050631 | 3300046543 | Bacteria | 3023 |
| 677 | Ga0495645_0062011 | 3300046543 | Bacteria | 2709 |
| 678 | Ga0495622_0053476 | 3300046557 | Bacteria | 1873 |
| 679 | Ga0495633_0100709 | 3300046558 | Bacteria | 1341 |
| 680 | Ga0495668_0029608 | 3300046616 | Bacteria | 3092 |
| 681 | Ga0495668_0106124 | 3300046616 | Bacteria | 1536 |
| 682 | Ga0495634_0071466 | 3300046642 | Bacteria | 2284 |
| 683 | Ga0495634_0333959 | 3300046642 | Bacteria | 910 |
| 684 | Ga0495611_0090190 | 3300046648 | Bacteria | 1416 |
| 685 | Ga0495625_0049407 | 3300046660 | Bacteria | 3024 |
| 686 | Ga0495625_0241546 | 3300046660 | Bacteria | 1175 |
| 687 | Ga0495625_0606882 | 3300046660 | Bacteria | 656 |
| 688 | Ga0495635_0061084 | 3300046663 | Bacteria | 2588 |
| 689 | Ga0495588_0049151 | 3300046674 | Bacteria | 2168 |
| 690 | Ga0495588_0276904 | 3300046674 | Bacteria | 884 |
| 691 | Ga0495657_0030531 | 3300046675 | Bacteria | 3773 |
| 692 | Ga0495599_0110964 | 3300046678 | Bacteria | 1708 |
| 693 | Ga0495623_0120130 | 3300046679 | Bacteria | 1582 |
| 694 | Ga0495646_0025052 | 3300046680 | Bacteria | 3753 |
| 695 | Ga0495646_0037069 | 3300046680 | Bacteria | 3018 |
| 696 | Ga0495658_0477619 | 3300046683 | Bacteria | 797 |
| 697 | Ga0495613_0001044 | 3300046689 | Bacteria | 21114 |
| 698 | Ga0495613_0001732 | 3300046689 | Bacteria | 16603 |
| 699 | Ga0495613_0525494 | 3300046689 | Bacteria | 794 |
| 700 | Ga0495624_0159730 | 3300046690 | Bacteria | 1377 |
| 701 | Ga0495624_0277363 | 3300046690 | Bacteria | 1012 |
| 702 | Ga0495670_0345942 | 3300046691 | Bacteria | 800 |
| 703 | Ga0495649_0098405 | 3300046694 | Bacteria | 1556 |
| 704 | Ga0495589_0129097 | 3300046794 | Bacteria | 1214 |
| 705 | Ga0495600_0288390 | 3300046809 | Bacteria | 1037 |
| 706 | Ga0495600_0494724 | 3300046809 | Bacteria | 752 |
| 707 | Ga0495581_0088708 | 3300047315 | Bacteria | 1793 |
| 708 | Ga0495581_0278477 | 3300047315 | Bacteria | 978 |
| 709 | Ga0495604_0017135 | 3300047317 | Bacteria | 5794 |
| 710 | Ga0495604_0037319 | 3300047317 | Bacteria | 3828 |
| 711 | Ga0495674_0141314 | 3300047319 | Bacteria | 2023 |
| 712 | Ga0495674_0707342 | 3300047319 | Bacteria | 790 |
| 713 | Ga0495672_0094304 | 3300047320 | Bacteria | 1637 |
| 714 | Ga0495676_0138621 | 3300047321 | Bacteria | 1745 |
| 715 | Ga0495680_0010041 | 3300047322 | Bacteria | 8465 |
| 716 | Ga0495683_0201837 | 3300047323 | Bacteria | 896 |
| 717 | Ga0495687_026764 | 3300047443 | Bacteria | 2709 |
| 718 | Ga0495677_0028704 | 3300047445 | Bacteria | 2022 |
| 719 | Ga0495685_055018 | 3300047447 | Bacteria | 1346 |
| 720 | Ga0495684_0123862 | 3300047471 | Bacteria | 1945 |
| 721 | Ga0495686_0230372 | 3300047472 | Bacteria | 1049 |
| 722 | Ga0495593_0306077 | 3300047673 | Bacteria | 795 |
| 723 | Ga0495602_0026806 | 3300048088 | Bacteria | 5551 |
| 724 | Ga0495602_0764262 | 3300048088 | Bacteria | 651 |
| 725 | Ga0495614_0029193 | 3300048089 | Bacteria | 2374 |
| 726 | Ga0495614_0150332 | 3300048089 | Bacteria | 1038 |
| 727 | Ga0495615_0121537 | 3300048090 | Bacteria | 756 |
| 728 | Ga0495626_0091416 | 3300048091 | Bacteria | 1338 |
| 729 | Ga0496100_0033625 | 3300048903 | Bacteria | 3210 |
| 730 | Ga0496100_0076123 | 3300048903 | Bacteria | 2252 |
| 731 | Ga0496100_0151959 | 3300048903 | Bacteria | 1652 |
| 732 | Ga0496100_0215462 | 3300048903 | Bacteria | 1407 |
| 733 | Ga0496100_0583050 | 3300048903 | Bacteria | 867 |
| 734 | Ga0496100_0596082 | 3300048903 | Bacteria | 858 |
| 735 | Ga0496100_0750467 | 3300048903 | Bacteria | 763 |
| 736 | Ga0496100_1006038 | 3300048903 | Bacteria | 656 |
| 737 | Ga0496100_1066840 | 3300048903 | Bacteria | 636 |
| 738 | Ga0496101_0028715 | 3300048904 | Bacteria | 3886 |
| 739 | Ga0496101_0036006 | 3300048904 | Bacteria | 3503 |
| 740 | Ga0496101_0379726 | 3300048904 | Bacteria | 1112 |
| 741 | Ga0496101_0911821 | 3300048904 | Bacteria | 692 |
| 742 | Ga0496102_0000382 | 3300048905 | Bacteria | 52442 |
| 743 | Ga0496102_0001329 | 3300048905 | Bacteria | 22197 |
| 744 | Ga0496102_0007191 | 3300048905 | Bacteria | 9506 |
| 745 | Ga0496102_0012230 | 3300048905 | Bacteria | 7422 |
| 746 | Ga0496102_0130420 | 3300048905 | Bacteria | 2352 |
| 747 | Ga0496102_0169657 | 3300048905 | Bacteria | 2054 |
| 748 | Ga0496102_0398092 | 3300048905 | Bacteria | 1295 |
| 749 | Ga0496102_1516976 | 3300048905 | Bacteria | 589 |
| 750 | Ga0496103_0009301 | 3300048906 | Bacteria | 5822 |
| 751 | Ga0496103_0170983 | 3300048906 | Bacteria | 1395 |
| 752 | Ga0496103_0185528 | 3300048906 | Bacteria | 1337 |
| 753 | Ga0496103_0268020 | 3300048906 | Bacteria | 1098 |
| 754 | Ga0496104_0009817 | 3300048907 | Bacteria | 8534 |
| 755 | Ga0496104_0023016 | 3300048907 | Bacteria | 5725 |
| 756 | Ga0496104_0084182 | 3300048907 | Bacteria | 3034 |
| 757 | Ga0496104_0412535 | 3300048907 | Bacteria | 1263 |
| 758 | Ga0496104_0422852 | 3300048907 | Bacteria | 1244 |
| 759 | Ga0496104_1811517 | 3300048907 | Bacteria | 512 |
| 760 | Ga0496105_0002836 | 3300048908 | Bacteria | 12681 |
| 761 | Ga0496105_0004398 | 3300048908 | Bacteria | 10607 |
| 762 | Ga0496105_0057755 | 3300048908 | Bacteria | 3203 |
| 763 | Ga0496105_0060212 | 3300048908 | Bacteria | 3133 |
| 764 | Ga0496105_0178064 | 3300048908 | Bacteria | 1741 |
| 765 | Ga0496105_0243058 | 3300048908 | Bacteria | 1460 |
| 766 | Ga0496105_0257325 | 3300048908 | Bacteria | 1413 |
| 767 | Ga0496105_0263754 | 3300048908 | Bacteria | 1392 |
| 768 | Ga0496105_0753365 | 3300048908 | Bacteria | 744 |
| 769 | Ga0496106_0173611 | 3300048909 | Bacteria | 1709 |
| 770 | Ga0496106_1076483 | 3300048909 | Bacteria | 630 |
| 771 | Ga0496107_0118918 | 3300048910 | Bacteria | 1946 |
| 772 | Ga0496107_0178105 | 3300048910 | Bacteria | 1578 |
| 773 | Ga0496107_0488870 | 3300048910 | Bacteria | 913 |
| 774 | Ga0496108_0000056 | 3300048911 | Bacteria | 124850 |
| 775 | Ga0496108_0006907 | 3300048911 | Bacteria | 9188 |
| 776 | Ga0496108_0019641 | 3300048911 | Bacteria | 5549 |
| 777 | Ga0496108_0052557 | 3300048911 | Bacteria | 3415 |
| 778 | Ga0496108_0121424 | 3300048911 | Bacteria | 2241 |
| 779 | Ga0496109_0038374 | 3300048912 | Bacteria | 4330 |
| 780 | Ga0496109_0082889 | 3300048912 | Bacteria | 2956 |
| 781 | Ga0496109_0423227 | 3300048912 | Bacteria | 1258 |
| 782 | Ga0496109_1864014 | 3300048912 | Bacteria | 534 |
| 783 | Ga0496110_0000297 | 3300048913 | Bacteria | 32605 |
| 784 | Ga0496110_0316915 | 3300048913 | Bacteria | 1420 |
| 785 | Ga0496110_0328060 | 3300048913 | Bacteria | 1394 |
| 786 | Ga0496110_0614509 | 3300048913 | Bacteria | 985 |
| 787 | Ga0496110_0936383 | 3300048913 | Bacteria | 773 |
| 788 | Ga0496110_1112012 | 3300048913 | Bacteria | 698 |
| 789 | Ga0496111_0139449 | 3300048914 | Bacteria | 1796 |
| 790 | Ga0496112_0032466 | 3300048915 | Bacteria | 5070 |
| 791 | Ga0496112_0178346 | 3300048915 | Bacteria | 2088 |
| 792 | Ga0496112_1213446 | 3300048915 | Bacteria | 671 |
| 793 | Ga0496113_0127960 | 3300048916 | Bacteria | 1990 |
| 794 | Ga0496113_0946576 | 3300048916 | Bacteria | 680 |
| 795 | Ga0496113_1109382 | 3300048916 | Bacteria | 620 |
| 796 | Ga0496114_0003141 | 3300048917 | Bacteria | 12678 |
| 797 | Ga0496114_0038863 | 3300048917 | Bacteria | 3938 |
| 798 | Ga0496114_0063167 | 3300048917 | Bacteria | 3100 |
| 799 | Ga0496114_0076810 | 3300048917 | Bacteria | 2815 |
| 800 | Ga0496114_0095403 | 3300048917 | Bacteria | 2531 |
| 801 | Ga0496114_0100515 | 3300048917 | Bacteria | 2468 |
| 802 | Ga0496114_0123409 | 3300048917 | Bacteria | 2230 |
| 803 | Ga0496114_0194230 | 3300048917 | Bacteria | 1776 |
| 804 | Ga0496114_0499473 | 3300048917 | Bacteria | 1076 |
| 805 | Ga0496114_0560226 | 3300048917 | Bacteria | 1009 |
| 806 | Ga0496114_0629878 | 3300048917 | Bacteria | 944 |
| 807 | Ga0496114_0861464 | 3300048917 | Bacteria | 786 |
| 808 | Ga0496114_0878038 | 3300048917 | Bacteria | 777 |
| 809 | Ga0496114_1156328 | 3300048917 | Bacteria | 659 |
| 810 | Ga0496114_1530310 | 3300048917 | Bacteria | 555 |
| 811 | Ga0496115_0054361 | 3300048918 | Bacteria | 3215 |
| 812 | Ga0496115_0090964 | 3300048918 | Bacteria | 2493 |
| 813 | Ga0496115_0103985 | 3300048918 | Bacteria | 2330 |
| 814 | Ga0496115_1350687 | 3300048918 | Bacteria | 528 |
| 815 | Ga0496116_0004331 | 3300048919 | Bacteria | 13577 |
| 816 | Ga0496116_0302593 | 3300048919 | Bacteria | 760 |
| 817 | Ga0496117_0000455 | 3300048920 | Bacteria | 68272 |
| 818 | Ga0496117_0009489 | 3300048920 | Bacteria | 9044 |
| 819 | Ga0496117_0037996 | 3300048920 | Bacteria | 3578 |
| 820 | Ga0496117_0066401 | 3300048920 | Bacteria | 2447 |
| 821 | Ga0496117_0153245 | 3300048920 | Bacteria | 1361 |
| 822 | Ga0496117_0289589 | 3300048920 | Bacteria | 872 |
| 823 | Ga0496117_0336917 | 3300048920 | Bacteria | 784 |
| 824 | Ga0496118_0000447 | 3300048921 | Bacteria | 68342 |
| 825 | Ga0496118_0006679 | 3300048921 | Bacteria | 12584 |
| 826 | Ga0496118_0103571 | 3300048921 | Bacteria | 1913 |
| 827 | Ga0496118_0152983 | 3300048921 | Bacteria | 1441 |
| 828 | Ga0496118_0210158 | 3300048921 | Bacteria | 1143 |
| 829 | Ga0496118_0215274 | 3300048921 | Bacteria | 1123 |
| 830 | Ga0496118_0454149 | 3300048921 | Bacteria | 650 |
| 831 | Ga0496119_0000762 | 3300048922 | Bacteria | 43203 |
| 832 | Ga0496119_0004415 | 3300048922 | Bacteria | 14018 |
| 833 | Ga0496119_0005312 | 3300048922 | Bacteria | 12394 |
| 834 | Ga0496119_0007168 | 3300048922 | Bacteria | 10107 |
| 835 | Ga0496119_0037325 | 3300048922 | Bacteria | 3158 |
| 836 | Ga0496119_0042229 | 3300048922 | Bacteria | 2894 |
| 837 | Ga0496119_0080893 | 3300048922 | Bacteria | 1873 |
| 838 | Ga0496119_0106053 | 3300048922 | Bacteria | 1569 |
| 839 | Ga0496119_0132222 | 3300048922 | Bacteria | 1358 |
| 840 | Ga0496119_0366410 | 3300048922 | Bacteria | 694 |
| 841 | Ga0496119_0476902 | 3300048922 | Bacteria | 584 |
| 842 | Ga0496119_0520971 | 3300048922 | Bacteria | 550 |
| 843 | Ga0496119_0587701 | 3300048922 | Bacteria | 508 |
| 844 | Ga0496120_0000500 | 3300048923 | Bacteria | 61218 |
| 845 | Ga0496120_0002282 | 3300048923 | Bacteria | 19894 |
| 846 | Ga0496120_0034809 | 3300048923 | Bacteria | 3014 |
| 847 | Ga0496120_0041657 | 3300048923 | Bacteria | 2688 |
| 848 | Ga0496120_0059050 | 3300048923 | Bacteria | 2151 |
| 849 | Ga0496120_0080326 | 3300048923 | Bacteria | 1768 |
| 850 | Ga0496120_0088877 | 3300048923 | Bacteria | 1655 |
| 851 | Ga0496120_0173300 | 3300048923 | Bacteria | 1065 |
| 852 | Ga0496120_0250554 | 3300048923 | Bacteria | 831 |
| 853 | Ga0496121_0000098 | 3300048924 | Bacteria | 200516 |
| 854 | Ga0496121_0381746 | 3300048924 | Bacteria | 929 |
| 855 | Ga0496121_0533513 | 3300048924 | Bacteria | 738 |
| 856 | Ga0496121_0593715 | 3300048924 | Bacteria | 685 |
| 857 | Ga0496122_0000705 | 3300048925 | Bacteria | 65974 |
| 858 | Ga0496122_0000978 | 3300048925 | Bacteria | 51309 |
| 859 | Ga0496122_0008896 | 3300048925 | Bacteria | 10701 |
| 860 | Ga0496122_0033847 | 3300048925 | Bacteria | 4194 |
| 861 | Ga0496122_0036228 | 3300048925 | Bacteria | 3995 |
| 862 | Ga0496122_0189516 | 3300048925 | Bacteria | 1216 |
| 863 | Ga0496122_0348285 | 3300048925 | Bacteria | 775 |
| 864 | Ga0496122_0443693 | 3300048925 | Bacteria | 646 |
| 865 | Ga0496123_0000304 | 3300048926 | Bacteria | 95535 |
| 866 | Ga0496123_0006643 | 3300048926 | Bacteria | 11158 |
| 867 | Ga0496123_0030985 | 3300048926 | Bacteria | 3901 |
| 868 | Ga0496123_0220459 | 3300048926 | Bacteria | 957 |
| 869 | Ga0496123_0285735 | 3300048926 | Bacteria | 795 |
| 870 | Ga0496123_0305148 | 3300048926 | Bacteria | 758 |
| 871 | Ga0496123_0486224 | 3300048926 | Bacteria | 542 |
| 872 | Ga0496124_0005987 | 3300048927 | Bacteria | 13423 |
| 873 | Ga0496124_0032523 | 3300048927 | Bacteria | 4604 |
| 874 | Ga0496124_0039999 | 3300048927 | Bacteria | 4059 |
| 875 | Ga0496124_0136429 | 3300048927 | Bacteria | 1942 |
| 876 | Ga0496124_0235448 | 3300048927 | Bacteria | 1365 |
| 877 | Ga0496124_0265439 | 3300048927 | Bacteria | 1260 |
| 878 | Ga0496124_0296299 | 3300048927 | Bacteria | 1171 |
| 879 | Ga0496124_0437708 | 3300048927 | Bacteria | 896 |
| 880 | Ga0496124_0547271 | 3300048927 | Bacteria | 765 |
| 881 | Ga0496124_0967117 | 3300048927 | Bacteria | 510 |
| 882 | Ga0496125_0000069 | 3300048928 | Bacteria | 246981 |
| 883 | Ga0496125_0000626 | 3300048928 | Bacteria | 59339 |
| 884 | Ga0496125_0001892 | 3300048928 | Bacteria | 28717 |
| 885 | Ga0496125_0013813 | 3300048928 | Bacteria | 7909 |
| 886 | Ga0496126_0001101 | 3300048929 | Bacteria | 45352 |
| 887 | Ga0496126_0005987 | 3300048929 | Bacteria | 13665 |
| 888 | Ga0496126_0007418 | 3300048929 | Bacteria | 12031 |
| 889 | Ga0496126_0007949 | 3300048929 | Bacteria | 11525 |
| 890 | Ga0496126_0014170 | 3300048929 | Bacteria | 8071 |
| 891 | Ga0496126_0056376 | 3300048929 | Bacteria | 3552 |
| 892 | Ga0496126_0068908 | 3300048929 | Bacteria | 3157 |
| 893 | Ga0496126_0198042 | 3300048929 | Bacteria | 1698 |
| 894 | Ga0496126_0670698 | 3300048929 | Bacteria | 809 |
| 895 | Ga0496126_1298154 | 3300048929 | Bacteria | 530 |
| 896 | Ga0495678_028339 | 3300049459 | Bacteria | 2364 |
| 897 | Ga0495682_0103322 | 3300049460 | Bacteria | 1022 |
| 898 | Ga0501031_0003477 | 3300049568 | Bacteria | 10109 |
| 899 | Ga0501031_0005744 | 3300049568 | Bacteria | 8084 |
| 900 | Ga0501031_0023746 | 3300049568 | Bacteria | 3997 |
| 901 | Ga0501031_0150341 | 3300049568 | Bacteria | 1521 |
| 902 | Ga0501032_0005320 | 3300049569 | Bacteria | 9575 |
| 903 | Ga0501032_0044843 | 3300049569 | Bacteria | 2992 |
| 904 | Ga0501032_0161473 | 3300049569 | Bacteria | 1471 |
| 905 | Ga0501032_0228315 | 3300049569 | Bacteria | 1210 |
| 906 | Ga0501032_0235220 | 3300049569 | Bacteria | 1191 |
| 907 | Ga0501033_0003891 | 3300049570 | Bacteria | 12138 |
| 908 | Ga0501033_0004594 | 3300049570 | Bacteria | 11063 |
| 909 | Ga0501033_0106473 | 3300049570 | Bacteria | 2043 |
| 910 | Ga0501033_0178364 | 3300049570 | Bacteria | 1523 |
| 911 | Ga0501033_0223532 | 3300049570 | Bacteria | 1339 |
| 912 | Ga0501033_0227459 | 3300049570 | Bacteria | 1326 |
| 913 | Ga0501034_0054720 | 3300049571 | Bacteria | 4017 |
| 914 | Ga0501034_0151536 | 3300049571 | Bacteria | 2294 |
| 915 | Ga0501034_0157244 | 3300049571 | Bacteria | 2246 |
| 916 | Ga0501034_0168883 | 3300049571 | Bacteria | 2155 |
| 917 | Ga0501034_0179134 | 3300049571 | Bacteria | 2085 |
| 918 | Ga0501034_0250415 | 3300049571 | Bacteria | 1716 |
| 919 | Ga0501034_0250636 | 3300049571 | Bacteria | 1715 |
| 920 | Ga0501034_0720880 | 3300049571 | Bacteria | 894 |
| 921 | Ga0501034_1436740 | 3300049571 | Bacteria | 564 |
| 922 | Ga0501036_0015125 | 3300049572 | Bacteria | 6443 |
| 923 | Ga0501036_0025236 | 3300049572 | Bacteria | 5015 |
| 924 | Ga0501036_0028243 | 3300049572 | Bacteria | 4742 |
| 925 | Ga0501036_0063061 | 3300049572 | Bacteria | 3139 |
| 926 | Ga0501036_0066493 | 3300049572 | Bacteria | 3050 |
| 927 | Ga0501036_0949412 | 3300049572 | Bacteria | 705 |
| 928 | Ga0501036_1007711 | 3300049572 | Bacteria | 682 |
| 929 | Ga0501037_0009033 | 3300049573 | Bacteria | 7304 |
| 930 | Ga0501037_0075874 | 3300049573 | Bacteria | 2441 |
| 931 | Ga0501037_0080134 | 3300049573 | Bacteria | 2369 |
| 932 | Ga0501037_0133057 | 3300049573 | Bacteria | 1782 |
| 933 | Ga0501037_0219868 | 3300049573 | Bacteria | 1337 |
| 934 | Ga0501037_0277462 | 3300049573 | Bacteria | 1168 |
| 935 | Ga0501038_0013350 | 3300049574 | Bacteria | 7490 |
| 936 | Ga0501038_0014325 | 3300049574 | Bacteria | 7224 |
| 937 | Ga0501038_0026637 | 3300049574 | Bacteria | 5148 |
| 938 | Ga0501038_0031984 | 3300049574 | Bacteria | 4646 |
| 939 | Ga0501038_0113488 | 3300049574 | Bacteria | 2242 |
| 940 | Ga0501038_0327847 | 3300049574 | Bacteria | 1196 |
| 941 | Ga0501039_0013460 | 3300049575 | Bacteria | 6257 |
| 942 | Ga0501039_0018121 | 3300049575 | Bacteria | 5404 |
| 943 | Ga0501039_0130770 | 3300049575 | Bacteria | 1970 |
| 944 | Ga0501039_0620398 | 3300049575 | Bacteria | 847 |
| 945 | Ga0501042_0007367 | 3300049578 | Bacteria | 7206 |
| 946 | Ga0501042_0008101 | 3300049578 | Bacteria | 6917 |
| 947 | Ga0501042_0020230 | 3300049578 | Bacteria | 4631 |
| 948 | Ga0501043_0016876 | 3300049579 | Bacteria | 5723 |
| 949 | Ga0501043_0023448 | 3300049579 | Bacteria | 4840 |
| 950 | Ga0501043_0025840 | 3300049579 | Bacteria | 4606 |
| 951 | Ga0501043_0040998 | 3300049579 | Bacteria | 3638 |
| 952 | Ga0501043_0144375 | 3300049579 | Bacteria | 1863 |
| 953 | Ga0501043_0148363 | 3300049579 | Bacteria | 1836 |
| 954 | Ga0501043_0411657 | 3300049579 | Bacteria | 1020 |
| 955 | Ga0501046_0006076 | 3300049580 | Bacteria | 10744 |
| 956 | Ga0501046_0020284 | 3300049580 | Bacteria | 5500 |
| 957 | Ga0501046_0052539 | 3300049580 | Bacteria | 3211 |
| 958 | Ga0501046_0745556 | 3300049580 | Bacteria | 688 |
| 959 | Ga0501047_0002353 | 3300049581 | Bacteria | 18076 |
| 960 | Ga0501047_0021705 | 3300049581 | Bacteria | 6164 |
| 961 | Ga0501047_0023560 | 3300049581 | Bacteria | 5908 |
| 962 | Ga0501047_0025365 | 3300049581 | Bacteria | 5698 |
| 963 | Ga0501047_0100854 | 3300049581 | Bacteria | 2766 |
| 964 | Ga0501047_0124851 | 3300049581 | Bacteria | 2454 |
| 965 | Ga0501047_0180517 | 3300049581 | Bacteria | 1977 |
| 966 | Ga0501047_0239537 | 3300049581 | Bacteria | 1665 |
| 967 | Ga0501048_0065848 | 3300049582 | Bacteria | 2561 |
| 968 | Ga0501048_0074058 | 3300049582 | Bacteria | 2402 |
| 969 | Ga0501067_0426769 | 3300049583 | Bacteria | 740 |
| 970 | Ga0501068_0431234 | 3300049584 | Bacteria | 852 |
| 971 | Ga0501069_0112891 | 3300049585 | Bacteria | 1549 |
| 972 | Ga0501069_0533225 | 3300049585 | Bacteria | 702 |
| 973 | Ga0501070_0000515 | 3300049586 | Bacteria | 35467 |
| 974 | Ga0501070_0079626 | 3300049586 | Bacteria | 2711 |
| 975 | Ga0501070_0110360 | 3300049586 | Bacteria | 2273 |
| 976 | Ga0501070_0944339 | 3300049586 | Bacteria | 671 |
| 977 | Ga0501070_1041536 | 3300049586 | Bacteria | 633 |
| 978 | Ga0501072_0275753 | 3300049588 | Bacteria | 1338 |
| 979 | Ga0501072_1081479 | 3300049588 | Bacteria | 624 |
| 980 | Ga0501073_0008299 | 3300049589 | Bacteria | 7704 |
| 981 | Ga0501073_0060531 | 3300049589 | Bacteria | 2642 |
| 982 | Ga0501073_0352223 | 3300049589 | Bacteria | 1017 |
| 983 | Ga0501074_0021577 | 3300049590 | Bacteria | 4676 |
| 984 | Ga0501074_0039574 | 3300049590 | Bacteria | 3415 |
| 985 | Ga0501074_0051476 | 3300049590 | Bacteria | 2972 |
| 986 | Ga0501080_0142711 | 3300049742 | Bacteria | 2214 |
| 987 | Ga0501080_0520407 | 3300049742 | Bacteria | 1061 |
| 988 | Ga0501080_0641595 | 3300049742 | Bacteria | 940 |
| 989 | Ga0501080_1311669 | 3300049742 | Bacteria | 620 |
| 990 | Ga0501080_1473844 | 3300049742 | Bacteria | 579 |
| 991 | Ga0501080_1503254 | 3300049742 | Bacteria | 572 |
| 992 | Ga0501083_0132689 | 3300049744 | Bacteria | 1633 |
| 993 | Ga0501083_0278158 | 3300049744 | Bacteria | 1089 |
| 994 | Ga0501035_0001713 | 3300049822 | Bacteria | 22159 |
| 995 | Ga0501035_0031721 | 3300049822 | Bacteria | 4812 |
| 996 | Ga0501035_0055081 | 3300049822 | Bacteria | 3551 |
| 997 | Ga0501035_0113823 | 3300049822 | Bacteria | 2369 |
| 998 | Ga0501035_0233552 | 3300049822 | Bacteria | 1566 |
| 999 | Ga0501035_0742237 | 3300049822 | Bacteria | 788 |
| 1000 | Ga0501035_1174919 | 3300049822 | Bacteria | 596 |
| 1001 | Ga0501044_0005944 | 3300049823 | Bacteria | 13510 |
| 1002 | Ga0501044_0042700 | 3300049823 | Bacteria | 4714 |
| 1003 | Ga0501044_0044738 | 3300049823 | Bacteria | 4591 |
| 1004 | Ga0501044_0049479 | 3300049823 | Bacteria | 4338 |
| 1005 | Ga0501044_0073064 | 3300049823 | Bacteria | 3486 |
| 1006 | Ga0501044_0079162 | 3300049823 | Bacteria | 3330 |
| 1007 | Ga0501044_0183058 | 3300049823 | Bacteria | 2061 |
| 1008 | Ga0501044_0190558 | 3300049823 | Bacteria | 2013 |
| 1009 | Ga0501044_0781069 | 3300049823 | Bacteria | 835 |
| 1010 | Ga0501044_1519825 | 3300049823 | Bacteria | 534 |
| 1011 | Ga0501045_0258409 | 3300049824 | Bacteria | 1296 |
| 1012 | Ga0501045_0374978 | 3300049824 | Bacteria | 1059 |
| 1013 | Ga0501045_1428778 | 3300049824 | Bacteria | 502 |
| 1014 | nmdc:mga03n38_19199_c1 | 3300050490 | Bacteria | 2712 |
| 1015 | nmdc:mga03n38_728110_c1 | 3300050490 | Bacteria | 573 |
| 1016 | nmdc:mga00v17_108997_c1 | 3300050491 | Bacteria | 1755 |
| 1017 | nmdc:mga00v17_13901_c1 | 3300050491 | Bacteria | 4479 |
| 1018 | nmdc:mga00v17_171559_c1 | 3300050491 | Bacteria | 1399 |
| 1019 | nmdc:mga00v17_181797_c1 | 3300050491 | Bacteria | 1357 |
| 1020 | nmdc:mga00v17_291348_c1 | 3300050491 | Bacteria | 1060 |
| 1021 | nmdc:mga00v17_430484_c1 | 3300050491 | Bacteria | 857 |
| 1022 | nmdc:mga00v17_4782_c1 | 3300050491 | Bacteria | 7087 |
| 1023 | nmdc:mga00v17_6583_c1 | 3300050491 | Bacteria | 6169 |
| 1024 | nmdc:mga00v17_749696_c1 | 3300050491 | Bacteria | 624 |
| 1025 | nmdc:mga00v17_97382_c1 | 3300050491 | Bacteria | 1854 |
| 1026 | nmdc:mga0yw44_101984_c1 | 3300050492 | Bacteria | 1829 |
| 1027 | nmdc:mga0yw44_113595_c1 | 3300050492 | Bacteria | 1738 |
| 1028 | nmdc:mga0yw44_122613_c1 | 3300050492 | Bacteria | 1675 |
| 1029 | nmdc:mga0yw44_173869_c1 | 3300050492 | Bacteria | 1415 |
| 1030 | nmdc:mga0yw44_194469_c1 | 3300050492 | Bacteria | 1338 |
| 1031 | nmdc:mga0yw44_208487_c1 | 3300050492 | Bacteria | 1292 |
| 1032 | nmdc:mga0yw44_215398_c1 | 3300050492 | Bacteria | 1271 |
| 1033 | nmdc:mga0yw44_232946_c1 | 3300050492 | Bacteria | 1223 |
| 1034 | nmdc:mga0yw44_74100_c1 | 3300050492 | Bacteria | 2120 |
| 1035 | nmdc:mga0yw44_78093_c1 | 3300050492 | Bacteria | 2070 |
| 1036 | nmdc:mga0yw44_81627_c1 | 3300050492 | Bacteria | 2027 |
| 1037 | nmdc:mga0yw44_915380_c1 | 3300050492 | Bacteria | 595 |
| 1038 | nmdc:mga0yw44_925585_c1 | 3300050492 | Bacteria | 591 |
| 1039 | nmdc:mga0k408_394032_c1 | 3300050493 | Bacteria | 824 |
| 1040 | nmdc:mga0k408_885809_c1 | 3300050493 | Bacteria | 518 |
| 1041 | nmdc:mga06z11_386675_c1 | 3300050494 | Bacteria | 841 |
| 1042 | nmdc:mga06z11_49909_c1 | 3300050494 | Bacteria | 2137 |
| 1043 | nmdc:mga06z11_63871_c1 | 3300050494 | Bacteria | 1928 |
| 1044 | nmdc:mga04h51_188287_c1 | 3300050495 | Bacteria | 806 |
| 1045 | nmdc:mga04h51_6044_c1 | 3300050495 | Bacteria | 3118 |
| 1046 | nmdc:mga07m45_19564_c1 | 3300050496 | Bacteria | 3669 |
| 1047 | nmdc:mga07m45_493206_c1 | 3300050496 | Bacteria | 709 |
| 1048 | nmdc:mga06r32_824203_c1 | 3300050510 | Bacteria | 887 |
| 1049 | nmdc:mga08y16_66782_c1 | 3300050511 | Bacteria | 3754 |
| 1050 | nmdc:mga0n895_340654_c1 | 3300050512 | Bacteria | 1519 |
| 1051 | nmdc:mga0rr50_33750_c1 | 3300050513 | Bacteria | 3659 |
| 1052 | nmdc:mga08x19_142796_c1 | 3300050514 | Bacteria | 1618 |
| 1053 | nmdc:mga0a205_96969_c1 | 3300050515 | Bacteria | 2848 |
| 1054 | nmdc:mga0sz30_11515_c1 | 3300050516 | Bacteria | 3417 |
| 1055 | nmdc:mga0sz30_266832_c1 | 3300050516 | Bacteria | 762 |
| 1056 | nmdc:mga0sz30_49386_c1 | 3300050516 | Bacteria | 1782 |
| 1057 | nmdc:mga0sz30_57472_c1 | 3300050516 | Bacteria | 1658 |
| 1058 | Ga0495601_0047478 | 3300053077 | Bacteria | 2703 |
| 1059 | Ga0495612_0258817 | 3300053078 | Bacteria | 775 |
| 1060 | Ga0500610_0343925 | 3300053079 | Bacteria | 635 |
| 1061 | Ga0500635_0000067 | 3300053080 | Bacteria | 69061 |
| 1062 | Ga0495595_0019616 | 3300053084 | Bacteria | 2936 |
| 1063 | Ga0495619_0095178 | 3300053085 | Bacteria | 2021 |
| 1064 | Ga0500644_0315564 | 3300053088 | Bacteria | 671 |
| 1065 | Ga0500646_0000795 | 3300053090 | Bacteria | 8763 |
| 1066 | Ga0500583_0259962 | 3300053092 | Bacteria | 856 |
| 1067 | Ga0500651_0000194 | 3300053093 | Bacteria | 38826 |
| 1068 | Ga0500556_0000095 | 3300053104 | Bacteria | 82300 |
| 1069 | Ga0500556_0001225 | 3300053104 | Bacteria | 11963 |
| 1070 | Ga0500556_0421944 | 3300053104 | Bacteria | 510 |
| 1071 | Ga0500562_009929 | 3300053108 | Bacteria | 2407 |
| 1072 | Ga0500562_011098 | 3300053108 | Bacteria | 2286 |
| 1073 | Ga0500593_001106 | 3300053117 | Bacteria | 9714 |
| 1074 | Ga0500652_395241 | 3300053131 | Bacteria | 513 |
| 1075 | Ga0500559_0000753 | 3300053136 | Bacteria | 21265 |
| 1076 | Ga0500559_0160491 | 3300053136 | Bacteria | 1056 |
| 1077 | Ga0500568_0000223 | 3300053139 | Bacteria | 48626 |
| 1078 | Ga0500573_0002012 | 3300053140 | Bacteria | 9962 |
| 1079 | Ga0500573_0279293 | 3300053140 | Bacteria | 846 |
| 1080 | Ga0500577_0306280 | 3300053142 | Bacteria | 694 |
| 1081 | Ga0500588_0291405 | 3300053146 | Bacteria | 617 |
| 1082 | Ga0500600_0162141 | 3300053149 | Bacteria | 1098 |
| 1083 | Ga0500600_0206847 | 3300053149 | Bacteria | 919 |
| 1084 | Ga0500604_0202978 | 3300053151 | Bacteria | 682 |
| 1085 | Ga0500616_0000233 | 3300053153 | Bacteria | 87378 |
| 1086 | Ga0500616_0000257 | 3300053153 | Bacteria | 82013 |
| 1087 | Ga0500616_0009623 | 3300053153 | Bacteria | 5861 |
| 1088 | Ga0500616_0033874 | 3300053153 | Bacteria | 2786 |
| 1089 | Ga0500616_0127346 | 3300053153 | Bacteria | 1207 |
| 1090 | Ga0500620_004744 | 3300053155 | Bacteria | 3071 |
| 1091 | Ga0500620_122537 | 3300053155 | Bacteria | 911 |
| 1092 | Ga0500627_0394095 | 3300053158 | Bacteria | 591 |
| 1093 | Ga0500634_0298827 | 3300053161 | Bacteria | 640 |
| 1094 | Ga0500645_008303 | 3300053730 | Bacteria | 3555 |
| 1095 | Ga0501084_0193537 | 3300054114 | Bacteria | 1716 |
| 1096 | Ga0466962_0032349 | 3300061719 | Bacteria | 2504 |
| 1097 | Ga0466962_0091666 | 3300061719 | Bacteria | 1456 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2891395885 | 2891404307 | 117 |
| 2 | iso_pu_bacteria | 8056037122 | 8056040021 | 117 |
| 3 | iso_pu_bacteria | 2551306166 | 2552113740 | 118 |
| 4 | iso_pu_bacteria | 2582581313 | 2585311102 | 118 |
| 5 | iso_pu_bacteria | 2585427649 | 2586063085 | 118 |
| 6 | iso_pu_bacteria | 2643221553 | 2643786633 | 118 |
| 7 | iso_pu_bacteria | 2643221572 | 2643876112 | 118 |
| 8 | iso_pu_bacteria | 2643221616 | 2644097937 | 118 |
| 9 | iso_pu_bacteria | 2643221647 | 2644265596 | 118 |
| 10 | iso_pu_bacteria | 2643221669 | 2644383167 | 118 |
| 11 | iso_pu_bacteria | 2643221678 | 2644438949 | 118 |
| 12 | iso_pu_bacteria | 2643221681 | 2644455316 | 118 |
| 13 | iso_pu_bacteria | 2643221687 | 2644486835 | 118 |
| 14 | iso_pu_bacteria | 2643221694 | 2644527741 | 118 |
| 15 | iso_pu_bacteria | 2643221697 | 2644536297 | 118 |
| 16 | iso_pu_bacteria | 2643221711 | 2644608128 | 118 |
| 17 | iso_pu_bacteria | 2643221724 | 2644681314 | 118 |
| 18 | iso_pu_bacteria | 2739367898 | 2740166164 | 118 |
| 19 | iso_pu_bacteria | 2747842429 | 2747954619 | 118 |
| 20 | iso_pu_bacteria | 2751185788 | 2753303902 | 118 |
| 21 | iso_pu_bacteria | 2757320536 | 2758224644 | 118 |
| 22 | iso_pu_bacteria | 2758568522 | 2760307053 | 118 |
| 23 | iso_pu_bacteria | 2784132148 | 2784585569 | 118 |
| 24 | iso_pu_bacteria | 2784746763 | 2785343260 | 118 |
| 25 | iso_pu_bacteria | 2784746768 | 2785366427 | 118 |
| 26 | iso_pu_bacteria | 2786546132 | 2786666870 | 118 |
| 27 | iso_pu_bacteria | 2791355406 | 2793977220 | 118 |
| 28 | iso_pu_bacteria | 2808606359 | 2808849175 | 118 |
| 29 | iso_pu_bacteria | 2808606394 | 2809026390 | 118 |
| 30 | iso_pu_bacteria | 2808606448 | 2809229049 | 118 |
| 31 | iso_pu_bacteria | 2811994880 | 2812362333 | 118 |
| 32 | iso_pu_bacteria | 2818991318 | 2819424816 | 118 |
| 33 | iso_pu_bacteria | 2844841374 | 2844843180 | 118 |
| 34 | iso_pu_bacteria | 2852663356 | 2852666497 | 118 |
| 35 | iso_pu_bacteria | 2856741275 | 2856742240 | 118 |
| 36 | iso_pu_bacteria | 2856741275 | 2856742435 | 118 |
| 37 | iso_pu_bacteria | 2857481737 | 2857484874 | 118 |
| 38 | iso_pu_bacteria | 2857723135 | 2857725661 | 118 |
| 39 | iso_pu_bacteria | 2857729791 | 2857731179 | 118 |
| 40 | iso_pu_bacteria | 2861520306 | 2861524295 | 118 |
| 41 | iso_pu_bacteria | 2866612099 | 2866617681 | 118 |
| 42 | iso_pu_bacteria | 2873314349 | 2873320392 | 118 |
| 43 | iso_pu_bacteria | 2877676314 | 2877684106 | 118 |
| 44 | iso_pu_bacteria | 2884693830 | 2884698719 | 118 |
| 45 | iso_pu_bacteria | 2889042446 | 2889042909 | 118 |
| 46 | iso_pu_bacteria | 2891562705 | 2891563722 | 118 |
| 47 | iso_pu_bacteria | 2891968417 | 2891970898 | 118 |
| 48 | iso_pu_bacteria | 2895442618 | 2895451301 | 118 |
| 49 | iso_pu_bacteria | 2895660088 | 2895660321 | 118 |
| 50 | iso_pu_bacteria | 2899359706 | 2899366550 | 118 |
| 51 | iso_pu_bacteria | 2902837492 | 2902841834 | 118 |
| 52 | iso_pu_bacteria | 2904430863 | 2904431821 | 118 |
| 53 | iso_pu_bacteria | 2904490793 | 2904495864 | 118 |
| 54 | iso_pu_bacteria | 2904509784 | 2904510263 | 118 |
| 55 | iso_pu_bacteria | 2904776348 | 2904777073 | 118 |
| 56 | iso_pu_bacteria | 2910809715 | 2910812187 | 118 |
| 57 | iso_pu_bacteria | 2917736166 | 2917740233 | 118 |
| 58 | iso_pu_bacteria | 2919042368 | 2919044481 | 118 |
| 59 | iso_pu_bacteria | 2919055335 | 2919058667 | 118 |
| 60 | iso_pu_bacteria | 2919523602 | 2919525544 | 118 |
| 61 | iso_pu_bacteria | 2928104781 | 2928107933 | 118 |
| 62 | iso_pu_bacteria | 2928121344 | 2928122260 | 118 |
| 63 | iso_pu_bacteria | 2928153084 | 2928153315 | 118 |
| 64 | iso_pu_bacteria | 2931384279 | 2931386335 | 118 |
| 65 | iso_pu_bacteria | 2932398195 | 2932400052 | 118 |
| 66 | iso_pu_bacteria | 2938649242 | 2938651091 | 118 |
| 67 | iso_pu_bacteria | 2939657138 | 2939660335 | 118 |
| 68 | iso_pu_bacteria | 2946003308 | 2946004606 | 118 |
| 69 | iso_pu_bacteria | 2946080515 | 2946082621 | 118 |
| 70 | iso_pu_bacteria | 2954380949 | 2954381150 | 118 |
| 71 | iso_pu_bacteria | 2954673503 | 2954681956 | 118 |
| 72 | iso_pu_bacteria | 2954682443 | 2954690969 | 118 |
| 73 | iso_pu_bacteria | 2966921586 | 2966924324 | 118 |
| 74 | iso_pu_bacteria | 2968558590 | 2968562653 | 118 |
| 75 | iso_pu_bacteria | 2971403814 | 2971405017 | 118 |
| 76 | iso_pu_bacteria | 2977228692 | 2977230416 | 118 |
| 77 | iso_pu_bacteria | 2977236895 | 2977239218 | 118 |
| 78 | iso_pu_bacteria | 2977251589 | 2977252805 | 118 |
| 79 | iso_pu_bacteria | 2977264416 | 2977265659 | 118 |
| 80 | iso_pu_bacteria | 2984542743 | 2984542998 | 118 |
| 81 | iso_pu_bacteria | 2984551494 | 2984552176 | 118 |
| 82 | iso_pu_bacteria | 2988225383 | 2988230307 | 118 |
| 83 | iso_pu_bacteria | 2996632988 | 2996634523 | 118 |
| 84 | iso_pu_bacteria | 8004021418 | 8004023931 | 118 |
| 85 | iso_pu_bacteria | 8016254467 | 8016254959 | 118 |
| 86 | iso_pu_bacteria | 8023623736 | 8023625255 | 118 |
| 87 | iso_pu_bacteria | 8047893842 | 8047902013 | 118 |
| 88 | iso_pu_bacteria | 8048356638 | 8048366077 | 118 |
| 89 | iso_pu_bacteria | 8048369669 | 8048369809 | 118 |
| 90 | iso_pu_bacteria | 8048379754 | 8048389534 | 118 |
| 91 | iso_pu_bacteria | 8053945823 | 8053953866 | 118 |
| 92 | iso_pu_bacteria | 8055037949 | 8055039616 | 118 |
| 93 | iso_pu_bacteria | 8057345674 | 8057346950 | 118 |
| 94 | 3300006038 | Ga0075365_10000731 | Ga0075365_1000073113 | 119 |
| 95 | 3300006051 | Ga0075364_10005118 | Ga0075364_100051185 | 119 |
| 96 | 3300046492 | Ga0495585_0076551 | Ga0495585_0076551_10_414 | 119 |
| 97 | 3300050491 | nmdc:mga00v17_6583_c1 | nmdc:mga00v17_6583_c1_2569_2928 | 119 |
| 98 | 3300050492 | nmdc:mga0yw44_101984_c1 | nmdc:mga0yw44_101984_c1_344_703 | 119 |
| 99 | iso_pu_bacteria | 2839986021 | 2839988536 | 119 |
| 100 | iso_pu_bacteria | 2919713450 | 2919716419 | 119 |
| 101 | 3300005327 | Ga0070658_10069021 | Ga0070658_100690213 | 120 |
| 102 | 3300005577 | Ga0068857_100000219 | Ga0068857_10000021914 | 120 |
| 103 | 3300005614 | Ga0068856_101343796 | Ga0068856_1013437961 | 120 |
| 104 | 3300025909 | Ga0207705_10038350 | Ga0207705_100383504 | 120 |
| 105 | 3300026116 | Ga0207674_10004533 | Ga0207674_1000453317 | 120 |
| 106 | 3300044693 | Ga0466961_0400771 | Ga0466961_0400771_421_783 | 120 |
| 107 | 3300046535 | Ga0495586_0646462 | Ga0495586_0646462_89_451 | 120 |
| 108 | 3300053084 | Ga0495595_0019616 | Ga0495595_0019616_766_1152 | 120 |
| 109 | 3300009101 | Ga0105247_10569714 | Ga0105247_105697142 | 121 |
| 110 | 3300032004 | Ga0307414_11051467 | Ga0307414_110514672 | 121 |
| 111 | 3300041443 | Ga0451789_0854918 | Ga0451789_0854918_1351_1716 | 121 |
| 112 | 3300041453 | Ga0451797_1326552 | Ga0451797_1326552_47_412 | 121 |
| 113 | 3300044658 | Ga0466972_0001226 | Ga0466972_0001226_8790_9155 | 121 |
| 114 | 3300044765 | Ga0466970_0181213 | Ga0466970_0181213_318_683 | 121 |
| 115 | 3300044901 | Ga0466960_0102313 | Ga0466960_0102313_587_952 | 121 |
| 116 | 3300048907 | Ga0496104_0412535 | Ga0496104_0412535_109_474 | 121 |
| 117 | 3300053140 | Ga0500573_0002012 | Ga0500573_0002012_6776_7162 | 121 |
| 118 | 3300053140 | Ga0500573_0279293 | Ga0500573_0279293_48_413 | 121 |
| 119 | 3300053153 | Ga0500616_0000233 | Ga0500616_0000233_77490_77855 | 121 |
| 120 | 3300001976 | JGI24752J21851_1010536 | JGI24752J21851_10105362 | 122 |
| 121 | 3300002067 | JGI24735J21928_10048869 | JGI24735J21928_100488692 | 122 |
| 122 | 3300003322 | rootL2_10219826 | rootL2_102198262 | 122 |
| 123 | 3300003323 | rootH1_10035436 | rootH1_100354363 | 122 |
| 124 | 3300003323 | rootH1_10186625 | rootH1_101866252 | 122 |
| 125 | 3300003578 | Ga0006562J51391_1027142 | Ga0006562J51391_10271428 | 122 |
| 126 | 3300003578 | Ga0006562J51391_1083918 | Ga0006562J51391_10839184 | 122 |
| 127 | 3300003752 | Ga0055539_1003713 | Ga0055539_10037132 | 122 |
| 128 | 3300003756 | Ga0055533_1000002 | Ga0055533_1000002213 | 122 |
| 129 | 3300003758 | Ga0055532_1006111 | Ga0055532_10061113 | 122 |
| 130 | 3300003759 | Ga0055525_1000022 | Ga0055525_10000228 | 122 |
| 131 | 3300003760 | Ga0055527_1000003 | Ga0055527_1000003333 | 122 |
| 132 | 3300003762 | Ga0055542_1000005 | Ga0055542_1000005197 | 122 |
| 133 | 3300003763 | Ga0055529_1000006 | Ga0055529_1000006333 | 122 |
| 134 | 3300003792 | Ga0055540_1001685 | Ga0055540_100168514 | 122 |
| 135 | 3300003792 | Ga0055540_1012590 | Ga0055540_10125903 | 122 |
| 136 | 3300003841 | Ga0055541_1001766 | Ga0055541_10017664 | 122 |
| 137 | 3300003911 | JGI25405J52794_10013514 | JGI25405J52794_100135143 | 122 |
| 138 | 3300005327 | Ga0070658_10155907 | Ga0070658_101559073 | 122 |
| 139 | 3300005329 | Ga0070683_100831485 | Ga0070683_1008314852 | 122 |
| 140 | 3300005331 | Ga0070670_100267040 | Ga0070670_1002670403 | 122 |
| 141 | 3300005331 | Ga0070670_100768960 | Ga0070670_1007689602 | 122 |
| 142 | 3300005334 | Ga0068869_100093729 | Ga0068869_1000937291 | 122 |
| 143 | 3300005334 | Ga0068869_100199627 | Ga0068869_1001996271 | 122 |
| 144 | 3300005334 | Ga0068869_100348330 | Ga0068869_1003483301 | 122 |
| 145 | 3300005334 | Ga0068869_100593625 | Ga0068869_1005936252 | 122 |
| 146 | 3300005336 | Ga0070680_100014073 | Ga0070680_1000140736 | 122 |
| 147 | 3300005337 | Ga0070682_100050528 | Ga0070682_1000505284 | 122 |
| 148 | 3300005337 | Ga0070682_100089350 | Ga0070682_1000893502 | 122 |
| 149 | 3300005337 | Ga0070682_100119829 | Ga0070682_1001198292 | 122 |
| 150 | 3300005337 | Ga0070682_100330123 | Ga0070682_1003301232 | 122 |
| 151 | 3300005337 | Ga0070682_100719045 | Ga0070682_1007190451 | 122 |
| 152 | 3300005338 | Ga0068868_100207661 | Ga0068868_1002076613 | 122 |
| 153 | 3300005338 | Ga0068868_100278091 | Ga0068868_1002780912 | 122 |
| 154 | 3300005338 | Ga0068868_101021408 | Ga0068868_1010214082 | 122 |
| 155 | 3300005339 | Ga0070660_100184357 | Ga0070660_1001843573 | 122 |
| 156 | 3300005339 | Ga0070660_101876016 | Ga0070660_1018760161 | 122 |
| 157 | 3300005340 | Ga0070689_100281940 | Ga0070689_1002819403 | 122 |
| 158 | 3300005341 | Ga0070691_10048526 | Ga0070691_100485263 | 122 |
| 159 | 3300005344 | Ga0070661_100064464 | Ga0070661_1000644644 | 122 |
| 160 | 3300005345 | Ga0070692_10023689 | Ga0070692_100236892 | 122 |
| 161 | 3300005345 | Ga0070692_10221566 | Ga0070692_102215661 | 122 |
| 162 | 3300005347 | Ga0070668_100003885 | Ga0070668_1000038859 | 122 |
| 163 | 3300005347 | Ga0070668_100021409 | Ga0070668_1000214095 | 122 |
| 164 | 3300005347 | Ga0070668_100022785 | Ga0070668_1000227853 | 122 |
| 165 | 3300005347 | Ga0070668_100783834 | Ga0070668_1007838341 | 122 |
| 166 | 3300005347 | Ga0070668_101783442 | Ga0070668_1017834421 | 122 |
| 167 | 3300005354 | Ga0070675_100055477 | Ga0070675_1000554774 | 122 |
| 168 | 3300005354 | Ga0070675_100173026 | Ga0070675_1001730261 | 122 |
| 169 | 3300005355 | Ga0070671_100005155 | Ga0070671_10000515510 | 122 |
| 170 | 3300005355 | Ga0070671_100016974 | Ga0070671_1000169747 | 122 |
| 171 | 3300005356 | Ga0070674_100370167 | Ga0070674_1003701673 | 122 |
| 172 | 3300005356 | Ga0070674_100489125 | Ga0070674_1004891252 | 122 |
| 173 | 3300005364 | Ga0070673_100197383 | Ga0070673_1001973832 | 122 |
| 174 | 3300005365 | Ga0070688_100860365 | Ga0070688_1008603651 | 122 |
| 175 | 3300005366 | Ga0070659_100187444 | Ga0070659_1001874442 | 122 |
| 176 | 3300005367 | Ga0070667_100277600 | Ga0070667_1002776003 | 122 |
| 177 | 3300005434 | Ga0070709_10208941 | Ga0070709_102089412 | 122 |
| 178 | 3300005435 | Ga0070714_100000844 | Ga0070714_10000084412 | 122 |
| 179 | 3300005435 | Ga0070714_100008410 | Ga0070714_1000084101 | 122 |
| 180 | 3300005435 | Ga0070714_100144784 | Ga0070714_1001447843 | 122 |
| 181 | 3300005435 | Ga0070714_100483152 | Ga0070714_1004831521 | 122 |
| 182 | 3300005435 | Ga0070714_100518302 | Ga0070714_1005183021 | 122 |
| 183 | 3300005436 | Ga0070713_100554308 | Ga0070713_1005543082 | 122 |
| 184 | 3300005437 | Ga0070710_10000233 | Ga0070710_100002334 | 122 |
| 185 | 3300005437 | Ga0070710_10758533 | Ga0070710_107585331 | 122 |
| 186 | 3300005438 | Ga0070701_10142430 | Ga0070701_101424302 | 122 |
| 187 | 3300005455 | Ga0070663_100003232 | Ga0070663_1000032324 | 122 |
| 188 | 3300005455 | Ga0070663_100040305 | Ga0070663_1000403052 | 122 |
| 189 | 3300005455 | Ga0070663_100236500 | Ga0070663_1002365001 | 122 |
| 190 | 3300005455 | Ga0070663_100796930 | Ga0070663_1007969301 | 122 |
| 191 | 3300005455 | Ga0070663_101421462 | Ga0070663_1014214621 | 122 |
| 192 | 3300005455 | Ga0070663_101441029 | Ga0070663_1014410291 | 122 |
| 193 | 3300005456 | Ga0070678_100049155 | Ga0070678_1000491554 | 122 |
| 194 | 3300005456 | Ga0070678_100346766 | Ga0070678_1003467662 | 122 |
| 195 | 3300005456 | Ga0070678_100921968 | Ga0070678_1009219682 | 122 |
| 196 | 3300005458 | Ga0070681_10143224 | Ga0070681_101432244 | 122 |
| 197 | 3300005458 | Ga0070681_11762978 | Ga0070681_117629781 | 122 |
| 198 | 3300005459 | Ga0068867_100044791 | Ga0068867_1000447913 | 122 |
| 199 | 3300005459 | Ga0068867_100905698 | Ga0068867_1009056982 | 122 |
| 200 | 3300005466 | Ga0070685_10785618 | Ga0070685_107856181 | 122 |
| 201 | 3300005467 | Ga0070706_101378621 | Ga0070706_1013786211 | 122 |
| 202 | 3300005518 | Ga0070699_101091550 | Ga0070699_1010915501 | 122 |
| 203 | 3300005530 | Ga0070679_100063441 | Ga0070679_1000634414 | 122 |
| 204 | 3300005530 | Ga0070679_100275266 | Ga0070679_1002752662 | 122 |
| 205 | 3300005530 | Ga0070679_101586491 | Ga0070679_1015864911 | 122 |
| 206 | 3300005530 | Ga0070679_101734524 | Ga0070679_1017345241 | 122 |
| 207 | 3300005535 | Ga0070684_100051065 | Ga0070684_1000510653 | 122 |
| 208 | 3300005539 | Ga0068853_100586664 | Ga0068853_1005866643 | 122 |
| 209 | 3300005539 | Ga0068853_101426743 | Ga0068853_1014267431 | 122 |
| 210 | 3300005543 | Ga0070672_100126901 | Ga0070672_1001269014 | 122 |
| 211 | 3300005543 | Ga0070672_100328130 | Ga0070672_1003281302 | 122 |
| 212 | 3300005543 | Ga0070672_100439339 | Ga0070672_1004393392 | 122 |
| 213 | 3300005546 | Ga0070696_100646810 | Ga0070696_1006468102 | 122 |
| 214 | 3300005547 | Ga0070693_100020573 | Ga0070693_1000205733 | 122 |
| 215 | 3300005548 | Ga0070665_100001588 | Ga0070665_10000158811 | 122 |
| 216 | 3300005548 | Ga0070665_100367292 | Ga0070665_1003672922 | 122 |
| 217 | 3300005548 | Ga0070665_101537980 | Ga0070665_1015379802 | 122 |
| 218 | 3300005564 | Ga0070664_100346996 | Ga0070664_1003469963 | 122 |
| 219 | 3300005577 | Ga0068857_100266513 | Ga0068857_1002665132 | 122 |
| 220 | 3300005578 | Ga0068854_100351327 | Ga0068854_1003513272 | 122 |
| 221 | 3300005578 | Ga0068854_100635870 | Ga0068854_1006358702 | 122 |
| 222 | 3300005578 | Ga0068854_101491514 | Ga0068854_1014915142 | 122 |
| 223 | 3300005614 | Ga0068856_100268053 | Ga0068856_1002680533 | 122 |
| 224 | 3300005614 | Ga0068856_100338758 | Ga0068856_1003387582 | 122 |
| 225 | 3300005615 | Ga0070702_100040249 | Ga0070702_1000402494 | 122 |
| 226 | 3300005615 | Ga0070702_100049029 | Ga0070702_1000490293 | 122 |
| 227 | 3300005615 | Ga0070702_100560366 | Ga0070702_1005603662 | 122 |
| 228 | 3300005616 | Ga0068852_100231788 | Ga0068852_1002317883 | 122 |
| 229 | 3300005616 | Ga0068852_100426429 | Ga0068852_1004264292 | 122 |
| 230 | 3300005616 | Ga0068852_100939471 | Ga0068852_1009394712 | 122 |
| 231 | 3300005616 | Ga0068852_101205920 | Ga0068852_1012059202 | 122 |
| 232 | 3300005617 | Ga0068859_100026048 | Ga0068859_1000260484 | 122 |
| 233 | 3300005618 | Ga0068864_100572740 | Ga0068864_1005727401 | 122 |
| 234 | 3300005718 | Ga0068866_10591238 | Ga0068866_105912381 | 122 |
| 235 | 3300005719 | Ga0068861_100236197 | Ga0068861_1002361972 | 122 |
| 236 | 3300005719 | Ga0068861_100395029 | Ga0068861_1003950292 | 122 |
| 237 | 3300005834 | Ga0068851_10014251 | Ga0068851_100142514 | 122 |
| 238 | 3300005840 | Ga0068870_10018071 | Ga0068870_100180714 | 122 |
| 239 | 3300005840 | Ga0068870_10437243 | Ga0068870_104372432 | 122 |
| 240 | 3300005840 | Ga0068870_10670152 | Ga0068870_106701522 | 122 |
| 241 | 3300005841 | Ga0068863_100063922 | Ga0068863_1000639224 | 122 |
| 242 | 3300005841 | Ga0068863_100293918 | Ga0068863_1002939182 | 122 |
| 243 | 3300005842 | Ga0068858_100001421 | Ga0068858_10000142132 | 122 |
| 244 | 3300005842 | Ga0068858_100246436 | Ga0068858_1002464362 | 122 |
| 245 | 3300005843 | Ga0068860_100059898 | Ga0068860_1000598983 | 122 |
| 246 | 3300005843 | Ga0068860_100481054 | Ga0068860_1004810542 | 122 |
| 247 | 3300005843 | Ga0068860_100711073 | Ga0068860_1007110731 | 122 |
| 248 | 3300005844 | Ga0068862_100893611 | Ga0068862_1008936112 | 122 |
| 249 | 3300005844 | Ga0068862_101063908 | Ga0068862_1010639082 | 122 |
| 250 | 3300005844 | Ga0068862_101416235 | Ga0068862_1014162351 | 122 |
| 251 | 3300005937 | Ga0081455_10000483 | Ga0081455_1000048341 | 122 |
| 252 | 3300005985 | Ga0081539_10071622 | Ga0081539_100716221 | 122 |
| 253 | 3300005985 | Ga0081539_10192406 | Ga0081539_101924062 | 122 |
| 254 | 3300006038 | Ga0075365_10031922 | Ga0075365_100319224 | 122 |
| 255 | 3300006038 | Ga0075365_10039802 | Ga0075365_100398023 | 122 |
| 256 | 3300006038 | Ga0075365_10060232 | Ga0075365_100602324 | 122 |
| 257 | 3300006038 | Ga0075365_10154275 | Ga0075365_101542753 | 122 |
| 258 | 3300006038 | Ga0075365_10177935 | Ga0075365_101779352 | 122 |
| 259 | 3300006038 | Ga0075365_10236714 | Ga0075365_102367141 | 122 |
| 260 | 3300006038 | Ga0075365_10270631 | Ga0075365_102706312 | 122 |
| 261 | 3300006038 | Ga0075365_10278935 | Ga0075365_102789351 | 122 |
| 262 | 3300006038 | Ga0075365_10285571 | Ga0075365_102855712 | 122 |
| 263 | 3300006038 | Ga0075365_10383656 | Ga0075365_103836562 | 122 |
| 264 | 3300006038 | Ga0075365_10686158 | Ga0075365_106861582 | 122 |
| 265 | 3300006038 | Ga0075365_11131960 | Ga0075365_111319601 | 122 |
| 266 | 3300006042 | Ga0075368_10008004 | Ga0075368_100080047 | 122 |
| 267 | 3300006042 | Ga0075368_10178749 | Ga0075368_101787492 | 122 |
| 268 | 3300006048 | Ga0075363_100007181 | Ga0075363_1000071812 | 122 |
| 269 | 3300006048 | Ga0075363_100187031 | Ga0075363_1001870311 | 122 |
| 270 | 3300006051 | Ga0075364_10016785 | Ga0075364_100167851 | 122 |
| 271 | 3300006051 | Ga0075364_10023072 | Ga0075364_100230723 | 122 |
| 272 | 3300006051 | Ga0075364_10051767 | Ga0075364_100517673 | 122 |
| 273 | 3300006051 | Ga0075364_10173877 | Ga0075364_101738772 | 122 |
| 274 | 3300006051 | Ga0075364_10208586 | Ga0075364_102085862 | 122 |
| 275 | 3300006051 | Ga0075364_10238670 | Ga0075364_102386702 | 122 |
| 276 | 3300006051 | Ga0075364_10272332 | Ga0075364_102723322 | 122 |
| 277 | 3300006051 | Ga0075364_10327572 | Ga0075364_103275722 | 122 |
| 278 | 3300006051 | Ga0075364_10330049 | Ga0075364_103300491 | 122 |
| 279 | 3300006051 | Ga0075364_10349401 | Ga0075364_103494012 | 122 |
| 280 | 3300006051 | Ga0075364_10484534 | Ga0075364_104845342 | 122 |
| 281 | 3300006051 | Ga0075364_10616472 | Ga0075364_106164721 | 122 |
| 282 | 3300006058 | Ga0075432_10044504 | Ga0075432_100445042 | 122 |
| 283 | 3300006173 | Ga0070716_100558415 | Ga0070716_1005584152 | 122 |
| 284 | 3300006177 | Ga0075362_10339103 | Ga0075362_103391031 | 122 |
| 285 | 3300006178 | Ga0075367_10000964 | Ga0075367_1000096410 | 122 |
| 286 | 3300006178 | Ga0075367_10087900 | Ga0075367_100879002 | 122 |
| 287 | 3300006178 | Ga0075367_10108529 | Ga0075367_101085293 | 122 |
| 288 | 3300006178 | Ga0075367_10709031 | Ga0075367_107090312 | 122 |
| 289 | 3300006186 | Ga0075369_10006285 | Ga0075369_100062855 | 122 |
| 290 | 3300006186 | Ga0075369_10015288 | Ga0075369_100152882 | 122 |
| 291 | 3300006186 | Ga0075369_10040628 | Ga0075369_100406284 | 122 |
| 292 | 3300006237 | Ga0097621_100163311 | Ga0097621_1001633112 | 122 |
| 293 | 3300006353 | Ga0075370_10008827 | Ga0075370_100088276 | 122 |
| 294 | 3300006353 | Ga0075370_10113285 | Ga0075370_101132851 | 122 |
| 295 | 3300006353 | Ga0075370_10182640 | Ga0075370_101826403 | 122 |
| 296 | 3300006358 | Ga0068871_100169990 | Ga0068871_1001699903 | 122 |
| 297 | 3300006847 | Ga0075431_101077486 | Ga0075431_1010774862 | 122 |
| 298 | 3300006852 | Ga0075433_10385350 | Ga0075433_103853501 | 122 |
| 299 | 3300006871 | Ga0075434_100310396 | Ga0075434_1003103961 | 122 |
| 300 | 3300006881 | Ga0068865_101025395 | Ga0068865_1010253952 | 122 |
| 301 | 3300006881 | Ga0068865_101873214 | Ga0068865_1018732141 | 122 |
| 302 | 3300006914 | Ga0075436_100035970 | Ga0075436_1000359703 | 122 |
| 303 | 3300006931 | Ga0097620_100026048 | Ga0097620_1000260484 | 122 |
| 304 | 3300006948 | Ga0099826_10340863 | Ga0099826_103408632 | 122 |
| 305 | 3300007076 | Ga0075435_100043739 | Ga0075435_1000437394 | 122 |
| 306 | 3300007788 | Ga0099795_10128415 | Ga0099795_101284151 | 122 |
| 307 | 3300009011 | Ga0105251_10065735 | Ga0105251_100657353 | 122 |
| 308 | 3300009036 | Ga0105244_10016522 | Ga0105244_100165224 | 122 |
| 309 | 3300009036 | Ga0105244_10017359 | Ga0105244_100173593 | 122 |
| 310 | 3300009036 | Ga0105244_10019572 | Ga0105244_100195724 | 122 |
| 311 | 3300009036 | Ga0105244_10054498 | Ga0105244_100544982 | 122 |
| 312 | 3300009036 | Ga0105244_10194218 | Ga0105244_101942182 | 122 |
| 313 | 3300009036 | Ga0105244_10382996 | Ga0105244_103829961 | 122 |
| 314 | 3300009093 | Ga0105240_10090033 | Ga0105240_100900336 | 122 |
| 315 | 3300009093 | Ga0105240_10620532 | Ga0105240_106205321 | 122 |
| 316 | 3300009093 | Ga0105240_11978664 | Ga0105240_119786641 | 122 |
| 317 | 3300009094 | Ga0111539_10051853 | Ga0111539_100518533 | 122 |
| 318 | 3300009098 | Ga0105245_10231936 | Ga0105245_102319363 | 122 |
| 319 | 3300009098 | Ga0105245_10566266 | Ga0105245_105662662 | 122 |
| 320 | 3300009101 | Ga0105247_10153706 | Ga0105247_101537063 | 122 |
| 321 | 3300009147 | Ga0114129_11105562 | Ga0114129_111055622 | 122 |
| 322 | 3300009148 | Ga0105243_10003992 | Ga0105243_100039925 | 122 |
| 323 | 3300009148 | Ga0105243_10005136 | Ga0105243_100051363 | 122 |
| 324 | 3300009148 | Ga0105243_10131058 | Ga0105243_101310583 | 122 |
| 325 | 3300009148 | Ga0105243_10355725 | Ga0105243_103557253 | 122 |
| 326 | 3300009148 | Ga0105243_10751527 | Ga0105243_107515272 | 122 |
| 327 | 3300009148 | Ga0105243_10975037 | Ga0105243_109750372 | 122 |
| 328 | 3300009148 | Ga0105243_12167731 | Ga0105243_121677312 | 122 |
| 329 | 3300009174 | Ga0105241_10040904 | Ga0105241_100409043 | 122 |
| 330 | 3300009176 | Ga0105242_12435950 | Ga0105242_124359501 | 122 |
| 331 | 3300009177 | Ga0105248_10001035 | Ga0105248_1000103518 | 122 |
| 332 | 3300009177 | Ga0105248_10269060 | Ga0105248_102690603 | 122 |
| 333 | 3300009177 | Ga0105248_11639086 | Ga0105248_116390861 | 122 |
| 334 | 3300009545 | Ga0105237_10333189 | Ga0105237_103331892 | 122 |
| 335 | 3300009545 | Ga0105237_10367662 | Ga0105237_103676623 | 122 |
| 336 | 3300009551 | Ga0105238_10218806 | Ga0105238_102188062 | 122 |
| 337 | 3300009551 | Ga0105238_10273108 | Ga0105238_102731083 | 122 |
| 338 | 3300009551 | Ga0105238_10385670 | Ga0105238_103856702 | 122 |
| 339 | 3300009551 | Ga0105238_10394620 | Ga0105238_103946202 | 122 |
| 340 | 3300009553 | Ga0105249_10507688 | Ga0105249_105076882 | 122 |
| 341 | 3300010159 | Ga0099796_10300559 | Ga0099796_103005591 | 122 |
| 342 | 3300010375 | Ga0105239_10010822 | Ga0105239_1001082210 | 122 |
| 343 | 3300010375 | Ga0105239_10449641 | Ga0105239_104496412 | 122 |
| 344 | 3300010375 | Ga0105239_10656549 | Ga0105239_106565492 | 122 |
| 345 | 3300010375 | Ga0105239_12602529 | Ga0105239_126025292 | 122 |
| 346 | 3300011119 | Ga0105246_10000044 | Ga0105246_1000004412 | 122 |
| 347 | 3300011119 | Ga0105246_10043650 | Ga0105246_100436501 | 122 |
| 348 | 3300011119 | Ga0105246_11032581 | Ga0105246_110325811 | 122 |
| 349 | 3300011119 | Ga0105246_11120916 | Ga0105246_111209161 | 122 |
| 350 | 3300011119 | Ga0105246_11725969 | Ga0105246_117259691 | 122 |
| 351 | 3300012507 | Ga0157342_1013526 | Ga0157342_10135262 | 122 |
| 352 | 3300012512 | Ga0157327_1043020 | Ga0157327_10430201 | 122 |
| 353 | 3300012515 | Ga0157338_1079959 | Ga0157338_10799591 | 122 |
| 354 | 3300013100 | Ga0157373_10197183 | Ga0157373_101971832 | 122 |
| 355 | 3300013102 | Ga0157371_10102271 | Ga0157371_101022713 | 122 |
| 356 | 3300013102 | Ga0157371_11640155 | Ga0157371_116401551 | 122 |
| 357 | 3300013104 | Ga0157370_10111705 | Ga0157370_101117054 | 122 |
| 358 | 3300013104 | Ga0157370_10159688 | Ga0157370_101596882 | 122 |
| 359 | 3300013104 | Ga0157370_11438004 | Ga0157370_114380041 | 122 |
| 360 | 3300013105 | Ga0157369_10029320 | Ga0157369_100293205 | 122 |
| 361 | 3300013105 | Ga0157369_10070492 | Ga0157369_100704925 | 122 |
| 362 | 3300013105 | Ga0157369_10192999 | Ga0157369_101929992 | 122 |
| 363 | 3300013105 | Ga0157369_10283932 | Ga0157369_102839323 | 122 |
| 364 | 3300013105 | Ga0157369_10419368 | Ga0157369_104193681 | 122 |
| 365 | 3300013105 | Ga0157369_11292593 | Ga0157369_112925932 | 122 |
| 366 | 3300013105 | Ga0157369_12244627 | Ga0157369_122446272 | 122 |
| 367 | 3300013296 | Ga0157374_10059174 | Ga0157374_100591744 | 122 |
| 368 | 3300013296 | Ga0157374_11941248 | Ga0157374_119412482 | 122 |
| 369 | 3300013297 | Ga0157378_10585023 | Ga0157378_105850232 | 122 |
| 370 | 3300013297 | Ga0157378_11445838 | Ga0157378_114458381 | 122 |
| 371 | 3300013297 | Ga0157378_12300611 | Ga0157378_123006112 | 122 |
| 372 | 3300013306 | Ga0163162_10580219 | Ga0163162_105802192 | 122 |
| 373 | 3300013306 | Ga0163162_11018708 | Ga0163162_110187082 | 122 |
| 374 | 3300013307 | Ga0157372_10099931 | Ga0157372_100999314 | 122 |
| 375 | 3300013307 | Ga0157372_10365947 | Ga0157372_103659472 | 122 |
| 376 | 3300013307 | Ga0157372_10751174 | Ga0157372_107511743 | 122 |
| 377 | 3300013307 | Ga0157372_10905491 | Ga0157372_109054911 | 122 |
| 378 | 3300013307 | Ga0157372_11216273 | Ga0157372_112162732 | 122 |
| 379 | 3300013307 | Ga0157372_12143934 | Ga0157372_121439342 | 122 |
| 380 | 3300013307 | Ga0157372_12306724 | Ga0157372_123067241 | 122 |
| 381 | 3300013308 | Ga0157375_10248371 | Ga0157375_102483712 | 122 |
| 382 | 3300013308 | Ga0157375_10496971 | Ga0157375_104969713 | 122 |
| 383 | 3300013308 | Ga0157375_10683779 | Ga0157375_106837793 | 122 |
| 384 | 3300013308 | Ga0157375_12145089 | Ga0157375_121450891 | 122 |
| 385 | 3300014325 | Ga0163163_10107231 | Ga0163163_101072313 | 122 |
| 386 | 3300014325 | Ga0163163_11710802 | Ga0163163_117108022 | 122 |
| 387 | 3300014326 | Ga0157380_10018061 | Ga0157380_100180612 | 122 |
| 388 | 3300014326 | Ga0157380_10829662 | Ga0157380_108296621 | 122 |
| 389 | 3300014326 | Ga0157380_11070181 | Ga0157380_110701812 | 122 |
| 390 | 3300014326 | Ga0157380_13064422 | Ga0157380_130644221 | 122 |
| 391 | 3300014745 | Ga0157377_10043815 | Ga0157377_100438153 | 122 |
| 392 | 3300014745 | Ga0157377_10209474 | Ga0157377_102094742 | 122 |
| 393 | 3300014745 | Ga0157377_11123691 | Ga0157377_111236911 | 122 |
| 394 | 3300014968 | Ga0157379_10131373 | Ga0157379_101313732 | 122 |
| 395 | 3300014969 | Ga0157376_10273378 | Ga0157376_102733783 | 122 |
| 396 | 3300015688 | Ga0183367_1004 | Ga0183367_1004392 | 122 |
| 397 | 3300017792 | Ga0163161_10032074 | Ga0163161_100320743 | 122 |
| 398 | 3300017792 | Ga0163161_10121019 | Ga0163161_101210192 | 122 |
| 399 | 3300017792 | Ga0163161_10730264 | Ga0163161_107302642 | 122 |
| 400 | 3300017792 | Ga0163161_11954360 | Ga0163161_119543601 | 122 |
| 401 | 3300020069 | Ga0197907_11039976 | Ga0197907_110399761 | 122 |
| 402 | 3300020069 | Ga0197907_11497675 | Ga0197907_114976751 | 122 |
| 403 | 3300020070 | Ga0206356_10230095 | Ga0206356_102300952 | 122 |
| 404 | 3300020070 | Ga0206356_11269870 | Ga0206356_112698701 | 122 |
| 405 | 3300020075 | Ga0206349_1124982 | Ga0206349_11249822 | 122 |
| 406 | 3300020077 | Ga0206351_10641595 | Ga0206351_106415953 | 122 |
| 407 | 3300020080 | Ga0206350_11557265 | Ga0206350_115572652 | 122 |
| 408 | 3300020081 | Ga0206354_10195925 | Ga0206354_101959252 | 122 |
| 409 | 3300020082 | Ga0206353_10846297 | Ga0206353_108462973 | 122 |
| 410 | 3300020082 | Ga0206353_12056045 | Ga0206353_120560453 | 122 |
| 411 | 3300020610 | Ga0154015_1392376 | Ga0154015_13923762 | 122 |
| 412 | 3300020610 | Ga0154015_1424168 | Ga0154015_14241682 | 122 |
| 413 | 3300022467 | Ga0224712_10023372 | Ga0224712_100233723 | 122 |
| 414 | 3300025225 | Ga0209566_100032 | Ga0209566_100032214 | 122 |
| 415 | 3300025226 | Ga0209674_100001 | Ga0209674_1000013350 | 122 |
| 416 | 3300025228 | Ga0209672_100003 | Ga0209672_1000031172 | 122 |
| 417 | 3300025228 | Ga0209672_109945 | Ga0209672_1099453 | 122 |
| 418 | 3300025229 | Ga0209147_100551 | Ga0209147_1005517 | 122 |
| 419 | 3300025230 | Ga0209563_100001 | Ga0209563_1000013350 | 122 |
| 420 | 3300025233 | Ga0209437_100662 | Ga0209437_10066217 | 122 |
| 421 | 3300025242 | Ga0209258_108829 | Ga0209258_1088292 | 122 |
| 422 | 3300025253 | Ga0209677_100001 | Ga0209677_1000013350 | 122 |
| 423 | 3300025253 | Ga0209677_101476 | Ga0209677_1014767 | 122 |
| 424 | 3300025254 | Ga0209148_1000004 | Ga0209148_10000041467 | 122 |
| 425 | 3300025272 | Ga0209455_1000091 | Ga0209455_1000091138 | 122 |
| 426 | 3300025272 | Ga0209455_1000975 | Ga0209455_100097515 | 122 |
| 427 | 3300025273 | Ga0209673_1019300 | Ga0209673_10193002 | 122 |
| 428 | 3300025294 | Ga0209025_1077803 | Ga0209025_10778032 | 122 |
| 429 | 3300025303 | Ga0209051_1005852 | Ga0209051_10058524 | 122 |
| 430 | 3300025303 | Ga0209051_1008594 | Ga0209051_10085945 | 122 |
| 431 | 3300025303 | Ga0209051_1018280 | Ga0209051_10182803 | 122 |
| 432 | 3300025303 | Ga0209051_1026798 | Ga0209051_10267983 | 122 |
| 433 | 3300025321 | Ga0207656_10075654 | Ga0207656_100756541 | 122 |
| 434 | 3300025728 | Ga0207655_1002175 | Ga0207655_10021755 | 122 |
| 435 | 3300025728 | Ga0207655_1019753 | Ga0207655_10197532 | 122 |
| 436 | 3300025728 | Ga0207655_1090282 | Ga0207655_10902822 | 122 |
| 437 | 3300025893 | Ga0207682_10266515 | Ga0207682_102665152 | 122 |
| 438 | 3300025898 | Ga0207692_10010715 | Ga0207692_100107154 | 122 |
| 439 | 3300025899 | Ga0207642_10952538 | Ga0207642_109525381 | 122 |
| 440 | 3300025900 | Ga0207710_10065927 | Ga0207710_100659273 | 122 |
| 441 | 3300025901 | Ga0207688_10207301 | Ga0207688_102073012 | 122 |
| 442 | 3300025904 | Ga0207647_10360937 | Ga0207647_103609372 | 122 |
| 443 | 3300025906 | Ga0207699_10728986 | Ga0207699_107289861 | 122 |
| 444 | 3300025908 | Ga0207643_10022279 | Ga0207643_100222794 | 122 |
| 445 | 3300025908 | Ga0207643_10567461 | Ga0207643_105674612 | 122 |
| 446 | 3300025909 | Ga0207705_10057363 | Ga0207705_100573631 | 122 |
| 447 | 3300025909 | Ga0207705_10863799 | Ga0207705_108637992 | 122 |
| 448 | 3300025911 | Ga0207654_10103715 | Ga0207654_101037152 | 122 |
| 449 | 3300025912 | Ga0207707_10134437 | Ga0207707_101344374 | 122 |
| 450 | 3300025913 | Ga0207695_10074454 | Ga0207695_100744545 | 122 |
| 451 | 3300025913 | Ga0207695_10666180 | Ga0207695_106661801 | 122 |
| 452 | 3300025914 | Ga0207671_10225677 | Ga0207671_102256772 | 122 |
| 453 | 3300025914 | Ga0207671_10244640 | Ga0207671_102446402 | 122 |
| 454 | 3300025914 | Ga0207671_10711107 | Ga0207671_107111071 | 122 |
| 455 | 3300025915 | Ga0207693_10269273 | Ga0207693_102692732 | 122 |
| 456 | 3300025916 | Ga0207663_10396367 | Ga0207663_103963672 | 122 |
| 457 | 3300025917 | Ga0207660_10430509 | Ga0207660_104305091 | 122 |
| 458 | 3300025919 | Ga0207657_10160115 | Ga0207657_101601153 | 122 |
| 459 | 3300025920 | Ga0207649_10100375 | Ga0207649_101003753 | 122 |
| 460 | 3300025921 | Ga0207652_10027978 | Ga0207652_100279786 | 122 |
| 461 | 3300025921 | Ga0207652_11212895 | Ga0207652_112128951 | 122 |
| 462 | 3300025923 | Ga0207681_11832645 | Ga0207681_118326451 | 122 |
| 463 | 3300025924 | Ga0207694_10300894 | Ga0207694_103008942 | 122 |
| 464 | 3300025924 | Ga0207694_10505264 | Ga0207694_105052642 | 122 |
| 465 | 3300025925 | Ga0207650_10097869 | Ga0207650_100978693 | 122 |
| 466 | 3300025925 | Ga0207650_10543289 | Ga0207650_105432892 | 122 |
| 467 | 3300025926 | Ga0207659_10456912 | Ga0207659_104569121 | 122 |
| 468 | 3300025926 | Ga0207659_10901267 | Ga0207659_109012672 | 122 |
| 469 | 3300025927 | Ga0207687_10301113 | Ga0207687_103011133 | 122 |
| 470 | 3300025927 | Ga0207687_11946913 | Ga0207687_119469131 | 122 |
| 471 | 3300025929 | Ga0207664_10045644 | Ga0207664_100456445 | 122 |
| 472 | 3300025929 | Ga0207664_10368313 | Ga0207664_103683132 | 122 |
| 473 | 3300025931 | Ga0207644_10026063 | Ga0207644_100260633 | 122 |
| 474 | 3300025931 | Ga0207644_10051697 | Ga0207644_100516971 | 122 |
| 475 | 3300025931 | Ga0207644_11370363 | Ga0207644_113703632 | 122 |
| 476 | 3300025932 | Ga0207690_10125531 | Ga0207690_101255312 | 122 |
| 477 | 3300025933 | Ga0207706_10134108 | Ga0207706_101341082 | 122 |
| 478 | 3300025935 | Ga0207709_10006092 | Ga0207709_100060923 | 122 |
| 479 | 3300025935 | Ga0207709_10065896 | Ga0207709_100658963 | 122 |
| 480 | 3300025935 | Ga0207709_10108400 | Ga0207709_101084001 | 122 |
| 481 | 3300025935 | Ga0207709_11180590 | Ga0207709_111805902 | 122 |
| 482 | 3300025936 | Ga0207670_10173692 | Ga0207670_101736923 | 122 |
| 483 | 3300025937 | Ga0207669_10371062 | Ga0207669_103710622 | 122 |
| 484 | 3300025938 | Ga0207704_10849835 | Ga0207704_108498351 | 122 |
| 485 | 3300025939 | Ga0207665_10219242 | Ga0207665_102192422 | 122 |
| 486 | 3300025940 | Ga0207691_10122681 | Ga0207691_101226814 | 122 |
| 487 | 3300025940 | Ga0207691_10232112 | Ga0207691_102321122 | 122 |
| 488 | 3300025940 | Ga0207691_10322967 | Ga0207691_103229673 | 122 |
| 489 | 3300025940 | Ga0207691_11063913 | Ga0207691_110639131 | 122 |
| 490 | 3300025941 | Ga0207711_10000519 | Ga0207711_1000051926 | 122 |
| 491 | 3300025941 | Ga0207711_11091875 | Ga0207711_110918751 | 122 |
| 492 | 3300025942 | Ga0207689_10051546 | Ga0207689_100515464 | 122 |
| 493 | 3300025942 | Ga0207689_10404260 | Ga0207689_104042601 | 122 |
| 494 | 3300025942 | Ga0207689_10963367 | Ga0207689_109633672 | 122 |
| 495 | 3300025944 | Ga0207661_10190292 | Ga0207661_101902923 | 122 |
| 496 | 3300025944 | Ga0207661_11162946 | Ga0207661_111629461 | 122 |
| 497 | 3300025945 | Ga0207679_10335069 | Ga0207679_103350692 | 122 |
| 498 | 3300025949 | Ga0207667_10021672 | Ga0207667_1002167210 | 122 |
| 499 | 3300025949 | Ga0207667_10366642 | Ga0207667_103666423 | 122 |
| 500 | 3300025960 | Ga0207651_10582200 | Ga0207651_105822002 | 122 |
| 501 | 3300025972 | Ga0207668_10006122 | Ga0207668_100061224 | 122 |
| 502 | 3300025972 | Ga0207668_10028517 | Ga0207668_100285173 | 122 |
| 503 | 3300025972 | Ga0207668_10096609 | Ga0207668_100966092 | 122 |
| 504 | 3300025972 | Ga0207668_11317763 | Ga0207668_113177631 | 122 |
| 505 | 3300025981 | Ga0207640_10070755 | Ga0207640_100707552 | 122 |
| 506 | 3300025986 | Ga0207658_10255904 | Ga0207658_102559042 | 122 |
| 507 | 3300025986 | Ga0207658_10340981 | Ga0207658_103409813 | 122 |
| 508 | 3300026023 | Ga0207677_10173622 | Ga0207677_101736221 | 122 |
| 509 | 3300026023 | Ga0207677_10902634 | Ga0207677_109026341 | 122 |
| 510 | 3300026035 | Ga0207703_10001728 | Ga0207703_100017281 | 122 |
| 511 | 3300026041 | Ga0207639_10226101 | Ga0207639_102261012 | 122 |
| 512 | 3300026067 | Ga0207678_10000523 | Ga0207678_1000052318 | 122 |
| 513 | 3300026067 | Ga0207678_10114218 | Ga0207678_101142182 | 122 |
| 514 | 3300026067 | Ga0207678_10197485 | Ga0207678_101974853 | 122 |
| 515 | 3300026067 | Ga0207678_10218475 | Ga0207678_102184753 | 122 |
| 516 | 3300026067 | Ga0207678_10992075 | Ga0207678_109920751 | 122 |
| 517 | 3300026075 | Ga0207708_10116776 | Ga0207708_101167763 | 122 |
| 518 | 3300026078 | Ga0207702_10003794 | Ga0207702_100037944 | 122 |
| 519 | 3300026078 | Ga0207702_10767265 | Ga0207702_107672652 | 122 |
| 520 | 3300026088 | Ga0207641_10189307 | Ga0207641_101893074 | 122 |
| 521 | 3300026088 | Ga0207641_10262913 | Ga0207641_102629133 | 122 |
| 522 | 3300026088 | Ga0207641_10322650 | Ga0207641_103226502 | 122 |
| 523 | 3300026089 | Ga0207648_10379223 | Ga0207648_103792232 | 122 |
| 524 | 3300026095 | Ga0207676_10277319 | Ga0207676_102773192 | 122 |
| 525 | 3300026095 | Ga0207676_12271600 | Ga0207676_122716002 | 122 |
| 526 | 3300026116 | Ga0207674_10225383 | Ga0207674_102253833 | 122 |
| 527 | 3300026118 | Ga0207675_100509749 | Ga0207675_1005097492 | 122 |
| 528 | 3300026121 | Ga0207683_10063441 | Ga0207683_100634412 | 122 |
| 529 | 3300026121 | Ga0207683_10671955 | Ga0207683_106719552 | 122 |
| 530 | 3300026142 | Ga0207698_10301324 | Ga0207698_103013242 | 122 |
| 531 | 3300026142 | Ga0207698_10309087 | Ga0207698_103090873 | 122 |
| 532 | 3300026142 | Ga0207698_11715878 | Ga0207698_117158781 | 122 |
| 533 | 3300027312 | Ga0209371_1026907 | Ga0209371_10269072 | 122 |
| 534 | 3300027866 | Ga0209813_10039242 | Ga0209813_100392422 | 122 |
| 535 | 3300027866 | Ga0209813_10162578 | Ga0209813_101625781 | 122 |
| 536 | 3300027907 | Ga0207428_10055196 | Ga0207428_100551964 | 122 |
| 537 | 3300028017 | Ga0265356_1012565 | Ga0265356_10125651 | 122 |
| 538 | 3300028379 | Ga0268266_10262357 | Ga0268266_102623573 | 122 |
| 539 | 3300028379 | Ga0268266_10270079 | Ga0268266_102700793 | 122 |
| 540 | 3300028379 | Ga0268266_10317821 | Ga0268266_103178212 | 122 |
| 541 | 3300028379 | Ga0268266_11683963 | Ga0268266_116839631 | 122 |
| 542 | 3300028380 | Ga0268265_10064135 | Ga0268265_100641355 | 122 |
| 543 | 3300028380 | Ga0268265_10167741 | Ga0268265_101677412 | 122 |
| 544 | 3300028380 | Ga0268265_11507675 | Ga0268265_115076752 | 122 |
| 545 | 3300028381 | Ga0268264_10068251 | Ga0268264_100682512 | 122 |
| 546 | 3300028381 | Ga0268264_10458365 | Ga0268264_104583652 | 122 |
| 547 | 3300028381 | Ga0268264_10680120 | Ga0268264_106801201 | 122 |
| 548 | 3300028381 | Ga0268264_11915145 | Ga0268264_119151452 | 122 |
| 549 | 3300028786 | Ga0307517_10527502 | Ga0307517_105275021 | 122 |
| 550 | 3300028786 | Ga0307517_10628325 | Ga0307517_106283252 | 122 |
| 551 | 3300028794 | Ga0307515_10000476 | Ga0307515_1000047614 | 122 |
| 552 | 3300028794 | Ga0307515_10006481 | Ga0307515_100064816 | 122 |
| 553 | 3300028794 | Ga0307515_10027722 | Ga0307515_100277222 | 122 |
| 554 | 3300028794 | Ga0307515_10147113 | Ga0307515_101471131 | 122 |
| 555 | 3300028794 | Ga0307515_10150139 | Ga0307515_101501393 | 122 |
| 556 | 3300028794 | Ga0307515_10347340 | Ga0307515_103473401 | 122 |
| 557 | 3300030521 | Ga0307511_10143414 | Ga0307511_101434143 | 122 |
| 558 | 3300030522 | Ga0307512_10016370 | Ga0307512_100163701 | 122 |
| 559 | 3300030522 | Ga0307512_10077703 | Ga0307512_100777034 | 122 |
| 560 | 3300031090 | Ga0265760_10061215 | Ga0265760_100612151 | 122 |
| 561 | 3300031247 | Ga0265340_10000636 | Ga0265340_100006364 | 122 |
| 562 | 3300031251 | Ga0265327_10000019 | Ga0265327_10000019297 | 122 |
| 563 | 3300031251 | Ga0265327_10000071 | Ga0265327_1000007116 | 122 |
| 564 | 3300031456 | Ga0307513_10000123 | Ga0307513_1000012317 | 122 |
| 565 | 3300031456 | Ga0307513_10011893 | Ga0307513_100118933 | 122 |
| 566 | 3300031456 | Ga0307513_10195295 | Ga0307513_101952953 | 122 |
| 567 | 3300031456 | Ga0307513_10222619 | Ga0307513_102226193 | 122 |
| 568 | 3300031456 | Ga0307513_10366606 | Ga0307513_103666061 | 122 |
| 569 | 3300031456 | Ga0307513_10887487 | Ga0307513_108874872 | 122 |
| 570 | 3300031548 | Ga0307408_100571890 | Ga0307408_1005718901 | 122 |
| 571 | 3300031616 | Ga0307508_10105434 | Ga0307508_101054343 | 122 |
| 572 | 3300031649 | Ga0307514_10032573 | Ga0307514_100325735 | 122 |
| 573 | 3300031649 | Ga0307514_10041798 | Ga0307514_100417985 | 122 |
| 574 | 3300031649 | Ga0307514_10108662 | Ga0307514_101086623 | 122 |
| 575 | 3300031649 | Ga0307514_10118788 | Ga0307514_101187883 | 122 |
| 576 | 3300031730 | Ga0307516_10001960 | Ga0307516_1000196021 | 122 |
| 577 | 3300031730 | Ga0307516_10037037 | Ga0307516_100370374 | 122 |
| 578 | 3300031730 | Ga0307516_10159378 | Ga0307516_101593782 | 122 |
| 579 | 3300031730 | Ga0307516_10889491 | Ga0307516_108894911 | 122 |
| 580 | 3300031824 | Ga0307413_10176423 | Ga0307413_101764231 | 122 |
| 581 | 3300031824 | Ga0307413_11585064 | Ga0307413_115850641 | 122 |
| 582 | 3300031824 | Ga0307413_11677767 | Ga0307413_116777671 | 122 |
| 583 | 3300031838 | Ga0307518_10001506 | Ga0307518_100015068 | 122 |
| 584 | 3300031838 | Ga0307518_10016128 | Ga0307518_100161283 | 122 |
| 585 | 3300031838 | Ga0307518_10095620 | Ga0307518_100956204 | 122 |
| 586 | 3300031838 | Ga0307518_10413369 | Ga0307518_104133692 | 122 |
| 587 | 3300031852 | Ga0307410_10061901 | Ga0307410_100619014 | 122 |
| 588 | 3300031852 | Ga0307410_10509644 | Ga0307410_105096441 | 122 |
| 589 | 3300031901 | Ga0307406_10284363 | Ga0307406_102843631 | 122 |
| 590 | 3300031901 | Ga0307406_11641234 | Ga0307406_116412342 | 122 |
| 591 | 3300031903 | Ga0307407_10611108 | Ga0307407_106111081 | 122 |
| 592 | 3300031903 | Ga0307407_10738820 | Ga0307407_107388201 | 122 |
| 593 | 3300031911 | Ga0307412_10028693 | Ga0307412_100286931 | 122 |
| 594 | 3300031911 | Ga0307412_11417523 | Ga0307412_114175231 | 122 |
| 595 | 3300031995 | Ga0307409_100126389 | Ga0307409_1001263893 | 122 |
| 596 | 3300031995 | Ga0307409_100224941 | Ga0307409_1002249412 | 122 |
| 597 | 3300031995 | Ga0307409_102768669 | Ga0307409_1027686691 | 122 |
| 598 | 3300032002 | Ga0307416_100348795 | Ga0307416_1003487952 | 122 |
| 599 | 3300032002 | Ga0307416_101237705 | Ga0307416_1012377051 | 122 |
| 600 | 3300032004 | Ga0307414_10141732 | Ga0307414_101417323 | 122 |
| 601 | 3300032004 | Ga0307414_11481923 | Ga0307414_114819232 | 122 |
| 602 | 3300032004 | Ga0307414_12287257 | Ga0307414_122872571 | 122 |
| 603 | 3300032005 | Ga0307411_11335360 | Ga0307411_113353602 | 122 |
| 604 | 3300032126 | Ga0307415_100103128 | Ga0307415_1001031282 | 122 |
| 605 | 3300032126 | Ga0307415_100631784 | Ga0307415_1006317842 | 122 |
| 606 | 3300032126 | Ga0307415_100744800 | Ga0307415_1007448002 | 122 |
| 607 | 3300032126 | Ga0307415_101069387 | Ga0307415_1010693871 | 122 |
| 608 | 3300032126 | Ga0307415_101840240 | Ga0307415_1018402401 | 122 |
| 609 | 3300033179 | Ga0307507_10052583 | Ga0307507_100525832 | 122 |
| 610 | 3300033179 | Ga0307507_10075955 | Ga0307507_100759552 | 122 |
| 611 | 3300033180 | Ga0307510_10038499 | Ga0307510_100384994 | 122 |
| 612 | 3300033545 | Ga0316214_1007998 | Ga0316214_10079982 | 122 |
| 613 | 3300033547 | Ga0316212_1036648 | Ga0316212_10366482 | 122 |
| 614 | 3300034817 | Ga0373948_0064811 | Ga0373948_0064811_416_784 | 122 |
| 615 | 3300034957 | Ga0373938_0025982 | Ga0373938_0025982_736_1125 | 122 |
| 616 | 3300035088 | Ga0373940_0168083 | Ga0373940_0168083_283_672 | 122 |
| 617 | 3300035089 | Ga0373944_0309178 | Ga0373944_0309178_197_565 | 122 |
| 618 | 3300035091 | Ga0373951_0000075 | Ga0373951_0000075_17048_17416 | 122 |
| 619 | 3300035092 | Ga0373952_0249473 | Ga0373952_0249473_46_414 | 122 |
| 620 | 3300035114 | Ga0373939_0370450 | Ga0373939_0370450_128_517 | 122 |
| 621 | 3300035116 | Ga0373945_0156024 | Ga0373945_0156024_114_482 | 122 |
| 622 | 3300035170 | Ga0373943_0771462 | Ga0373943_0771462_35_403 | 122 |
| 623 | 3300035207 | Ga0373942_0002622 | Ga0373942_0002622_528_917 | 122 |
| 624 | 3300035241 | Ga0373961_0293823 | Ga0373961_0293823_201_569 | 122 |
| 625 | 3300035242 | Ga0373962_0067115 | Ga0373962_0067115_300_668 | 122 |
| 626 | 3300035691 | Ga0373931_0145114 | Ga0373931_0145114_591_959 | 122 |
| 627 | 3300035692 | Ga0373935_0845373 | Ga0373935_0845373_246_614 | 122 |
| 628 | 3300035725 | Ga0373947_0353874 | Ga0373947_0353874_331_699 | 122 |
| 629 | 3300036459 | Ga0372808_031836 | Ga0372808_031836_22_390 | 122 |
| 630 | 3300036459 | Ga0372808_051894 | Ga0372808_051894_94_462 | 122 |
| 631 | 3300037068 | Ga0373925_0000954 | Ga0373925_0000954_4514_4882 | 122 |
| 632 | 3300037312 | Ga0395899_0002933 | Ga0395899_0002933_5432_5800 | 122 |
| 633 | 3300037312 | Ga0395899_0026682 | Ga0395899_0026682_758_1126 | 122 |
| 634 | 3300037418 | Ga0395900_0002361 | Ga0395900_0002361_9281_9649 | 122 |
| 635 | 3300037418 | Ga0395900_0592148 | Ga0395900_0592148_345_713 | 122 |
| 636 | 3300037466 | Ga0395898_0000321 | Ga0395898_0000321_41467_41835 | 122 |
| 637 | 3300037466 | Ga0395898_1417179 | Ga0395898_1417179_105_473 | 122 |
| 638 | 3300037853 | Ga0436364_1195756 | Ga0436364_1195756_1936_2304 | 122 |
| 639 | 3300041441 | Ga0451787_032442 | Ga0451787_032442_356_724 | 122 |
| 640 | 3300041443 | Ga0451789_0213093 | Ga0451789_0213093_62_430 | 122 |
| 641 | 3300041451 | Ga0451791_0259315 | Ga0451791_0259315_738_1148 | 122 |
| 642 | 3300041451 | Ga0451791_0533426 | Ga0451791_0533426_6807_7175 | 122 |
| 643 | 3300041451 | Ga0451791_1568974 | Ga0451791_1568974_16_384 | 122 |
| 644 | 3300041452 | Ga0451793_0945660 | Ga0451793_0945660_1614_2024 | 122 |
| 645 | 3300041453 | Ga0451797_0223534 | Ga0451797_0223534_1607_1975 | 122 |
| 646 | 3300041453 | Ga0451797_0260210 | Ga0451797_0260210_311_679 | 122 |
| 647 | 3300041453 | Ga0451797_1010462 | Ga0451797_1010462_193_561 | 122 |
| 648 | 3300041453 | Ga0451797_1447719 | Ga0451797_1447719_63_431 | 122 |
| 649 | 3300041456 | Ga0451795_0232793 | Ga0451795_0232793_53_421 | 122 |
| 650 | 3300041456 | Ga0451795_1243454 | Ga0451795_1243454_234_617 | 122 |
| 651 | 3300041458 | Ga0451798_1164732 | Ga0451798_1164732_150_518 | 122 |
| 652 | 3300041459 | Ga0451800_0611837 | Ga0451800_0611837_228_596 | 122 |
| 653 | 3300041459 | Ga0451800_1547848 | Ga0451800_1547848_130_498 | 122 |
| 654 | 3300041460 | Ga0451802_1237693 | Ga0451802_1237693_232_600 | 122 |
| 655 | 3300041486 | Ga0451807_1812773 | Ga0451807_1812773_801_1169 | 122 |
| 656 | 3300041486 | Ga0451807_2448106 | Ga0451807_2448106_133_501 | 122 |
| 657 | 3300041491 | Ga0451833_0593006 | Ga0451833_0593006_80_448 | 122 |
| 658 | 3300041492 | Ga0451835_0715652 | Ga0451835_0715652_207_590 | 122 |
| 659 | 3300041494 | Ga0451837_0160372 | Ga0451837_0160372_68_436 | 122 |
| 660 | 3300041494 | Ga0451837_0260143 | Ga0451837_0260143_350_718 | 122 |
| 661 | 3300041494 | Ga0451837_0336078 | Ga0451837_0336078_1272_1640 | 122 |
| 662 | 3300041494 | Ga0451837_0663881 | Ga0451837_0663881_1588_1956 | 122 |
| 663 | 3300041496 | Ga0451839_0040102 | Ga0451839_0040102_19_387 | 122 |
| 664 | 3300041498 | Ga0451841_0838650 | Ga0451841_0838650_124_492 | 122 |
| 665 | 3300041498 | Ga0451841_1169559 | Ga0451841_1169559_153_521 | 122 |
| 666 | 3300041505 | Ga0451849_0568500 | Ga0451849_0568500_466_834 | 122 |
| 667 | 3300041505 | Ga0451849_0617852 | Ga0451849_0617852_372_740 | 122 |
| 668 | 3300041507 | Ga0451851_0764749 | Ga0451851_0764749_145_534 | 122 |
| 669 | 3300041509 | Ga0451843_0405326 | Ga0451843_0405326_702_1070 | 122 |
| 670 | 3300041511 | Ga0451855_1955659 | Ga0451855_1955659_153_521 | 122 |
| 671 | 3300041512 | Ga0451853_0678185 | Ga0451853_0678185_469_837 | 122 |
| 672 | 3300041512 | Ga0451853_1645114 | Ga0451853_1645114_31_399 | 122 |
| 673 | 3300041512 | Ga0451853_1865336 | Ga0451853_1865336_207_617 | 122 |
| 674 | 3300041512 | Ga0451853_2013961 | Ga0451853_2013961_106_525 | 122 |
| 675 | 3300041512 | Ga0451853_3422223 | Ga0451853_3422223_700_1068 | 122 |
| 676 | 3300042005 | Ga0439448_0006511 | Ga0439448_0006511_2230_2598 | 122 |
| 677 | 3300042008 | Ga0439450_055731 | Ga0439450_055731_509_877 | 122 |
| 678 | 3300042012 | Ga0439455_0020868 | Ga0439455_0020868_1159_1527 | 122 |
| 679 | 3300042138 | Ga0450903_000098 | Ga0450903_000098_2943_3311 | 122 |
| 680 | 3300042157 | Ga0439458_0004682 | Ga0439458_0004682_1073_1441 | 122 |
| 681 | 3300042157 | Ga0439458_0142526 | Ga0439458_0142526_58_426 | 122 |
| 682 | 3300044656 | Ga0466969_0431474 | Ga0466969_0431474_137_505 | 122 |
| 683 | 3300044658 | Ga0466972_0053157 | Ga0466972_0053157_812_1180 | 122 |
| 684 | 3300044658 | Ga0466972_0067717 | Ga0466972_0067717_834_1202 | 122 |
| 685 | 3300044658 | Ga0466972_0228617 | Ga0466972_0228617_248_637 | 122 |
| 686 | 3300044658 | Ga0466972_0472748 | Ga0466972_0472748_34_402 | 122 |
| 687 | 3300044683 | Ga0466965_0000017 | Ga0466965_0000017_55122_55490 | 122 |
| 688 | 3300044683 | Ga0466965_0000816 | Ga0466965_0000816_6963_7331 | 122 |
| 689 | 3300044683 | Ga0466965_0003732 | Ga0466965_0003732_3194_3583 | 122 |
| 690 | 3300044683 | Ga0466965_0065005 | Ga0466965_0065005_29_397 | 122 |
| 691 | 3300044683 | Ga0466965_0091930 | Ga0466965_0091930_983_1351 | 122 |
| 692 | 3300044683 | Ga0466965_0236732 | Ga0466965_0236732_525_893 | 122 |
| 693 | 3300044683 | Ga0466965_0412316 | Ga0466965_0412316_157_525 | 122 |
| 694 | 3300044684 | Ga0466966_0038933 | Ga0466966_0038933_106_495 | 122 |
| 695 | 3300044693 | Ga0466961_0058089 | Ga0466961_0058089_235_624 | 122 |
| 696 | 3300044694 | Ga0466963_0003809 | Ga0466963_0003809_1762_2130 | 122 |
| 697 | 3300044694 | Ga0466963_0718766 | Ga0466963_0718766_168_536 | 122 |
| 698 | 3300044694 | Ga0466963_0909669 | Ga0466963_0909669_28_417 | 122 |
| 699 | 3300044706 | Ga0466964_0244160 | Ga0466964_0244160_233_601 | 122 |
| 700 | 3300044706 | Ga0466964_0501336 | Ga0466964_0501336_105_473 | 122 |
| 701 | 3300044719 | Ga0466971_0251759 | Ga0466971_0251759_38_406 | 122 |
| 702 | 3300044719 | Ga0466971_0404362 | Ga0466971_0404362_225_593 | 122 |
| 703 | 3300044735 | Ga0466968_0049755 | Ga0466968_0049755_1095_1463 | 122 |
| 704 | 3300044735 | Ga0466968_0185830 | Ga0466968_0185830_103_471 | 122 |
| 705 | 3300044735 | Ga0466968_0209818 | Ga0466968_0209818_99_467 | 122 |
| 706 | 3300044765 | Ga0466970_0030921 | Ga0466970_0030921_290_658 | 122 |
| 707 | 3300044765 | Ga0466970_0068558 | Ga0466970_0068558_807_1196 | 122 |
| 708 | 3300044765 | Ga0466970_0075918 | Ga0466970_0075918_90_458 | 122 |
| 709 | 3300044765 | Ga0466970_0702820 | Ga0466970_0702820_54_422 | 122 |
| 710 | 3300044842 | Ga0466957_0040034 | Ga0466957_0040034_937_1305 | 122 |
| 711 | 3300044842 | Ga0466957_0332365 | Ga0466957_0332365_286_675 | 122 |
| 712 | 3300044842 | Ga0466957_0947076 | Ga0466957_0947076_220_588 | 122 |
| 713 | 3300044842 | Ga0466957_1077109 | Ga0466957_1077109_46_414 | 122 |
| 714 | 3300044901 | Ga0466960_0009553 | Ga0466960_0009553_1178_1546 | 122 |
| 715 | 3300044901 | Ga0466960_0034536 | Ga0466960_0034536_966_1355 | 122 |
| 716 | 3300044901 | Ga0466960_0052319 | Ga0466960_0052319_166_534 | 122 |
| 717 | 3300044901 | Ga0466960_0156450 | Ga0466960_0156450_772_1140 | 122 |
| 718 | 3300044901 | Ga0466960_0696971 | Ga0466960_0696971_172_540 | 122 |
| 719 | 3300045049 | Ga0466959_0031024 | Ga0466959_0031024_801_1169 | 122 |
| 720 | 3300045049 | Ga0466959_0181327 | Ga0466959_0181327_367_756 | 122 |
| 721 | 3300045049 | Ga0466959_0199166 | Ga0466959_0199166_141_509 | 122 |
| 722 | 3300045836 | Ga0466958_0181039 | Ga0466958_0181039_715_1104 | 122 |
| 723 | 3300045976 | Ga0466967_0005714 | Ga0466967_0005714_4349_4717 | 122 |
| 724 | 3300045976 | Ga0466967_0053877 | Ga0466967_0053877_1111_1479 | 122 |
| 725 | 3300045976 | Ga0466967_0189953 | Ga0466967_0189953_1426_1794 | 122 |
| 726 | 3300045976 | Ga0466967_0251319 | Ga0466967_0251319_511_885 | 122 |
| 727 | 3300046452 | Ga0495617_085387 | Ga0495617_085387_648_1016 | 122 |
| 728 | 3300046453 | Ga0495627_102149 | Ga0495627_102149_199_567 | 122 |
| 729 | 3300046454 | Ga0495592_0023504 | Ga0495592_0023504_1175_1543 | 122 |
| 730 | 3300046454 | Ga0495592_0108135 | Ga0495592_0108135_628_996 | 122 |
| 731 | 3300046455 | Ga0495603_0029051 | Ga0495603_0029051_836_1204 | 122 |
| 732 | 3300046455 | Ga0495603_0894576 | Ga0495603_0894576_56_424 | 122 |
| 733 | 3300046458 | Ga0495591_036353 | Ga0495591_036353_975_1343 | 122 |
| 734 | 3300046459 | Ga0495629_0000982 | Ga0495629_0000982_584_952 | 122 |
| 735 | 3300046459 | Ga0495629_0112678 | Ga0495629_0112678_1154_1522 | 122 |
| 736 | 3300046460 | Ga0495638_0028057 | Ga0495638_0028057_2709_3080 | 122 |
| 737 | 3300046460 | Ga0495638_0088264 | Ga0495638_0088264_140_508 | 122 |
| 738 | 3300046463 | Ga0495653_0151184 | Ga0495653_0151184_1241_1612 | 122 |
| 739 | 3300046463 | Ga0495653_0817920 | Ga0495653_0817920_104_472 | 122 |
| 740 | 3300046473 | Ga0495582_0081190 | Ga0495582_0081190_677_1045 | 122 |
| 741 | 3300046474 | Ga0495605_0008148 | Ga0495605_0008148_5243_5611 | 122 |
| 742 | 3300046475 | Ga0495639_0455835 | Ga0495639_0455835_42_410 | 122 |
| 743 | 3300046476 | Ga0495662_0014479 | Ga0495662_0014479_714_1082 | 122 |
| 744 | 3300046477 | Ga0495664_0139994 | Ga0495664_0139994_845_1213 | 122 |
| 745 | 3300046477 | Ga0495664_0732035 | Ga0495664_0732035_165_533 | 122 |
| 746 | 3300046491 | Ga0495584_0453336 | Ga0495584_0453336_254_622 | 122 |
| 747 | 3300046499 | Ga0495594_0020582 | Ga0495594_0020582_3112_3480 | 122 |
| 748 | 3300046500 | Ga0495596_0064718 | Ga0495596_0064718_41_409 | 122 |
| 749 | 3300046506 | Ga0495583_0016760 | Ga0495583_0016760_3298_3666 | 122 |
| 750 | 3300046507 | Ga0495606_0018741 | Ga0495606_0018741_3492_3860 | 122 |
| 751 | 3300046507 | Ga0495606_0527280 | Ga0495606_0527280_111_479 | 122 |
| 752 | 3300046512 | Ga0495610_0180783 | Ga0495610_0180783_124_492 | 122 |
| 753 | 3300046514 | Ga0495618_0425420 | Ga0495618_0425420_73_441 | 122 |
| 754 | 3300046515 | Ga0495620_0007132 | Ga0495620_0007132_472_840 | 122 |
| 755 | 3300046516 | Ga0495628_0025087 | Ga0495628_0025087_2642_3010 | 122 |
| 756 | 3300046516 | Ga0495628_0138616 | Ga0495628_0138616_806_1174 | 122 |
| 757 | 3300046517 | Ga0495630_0081587 | Ga0495630_0081587_51_419 | 122 |
| 758 | 3300046518 | Ga0495631_0050312 | Ga0495631_0050312_126_494 | 122 |
| 759 | 3300046519 | Ga0495632_0383370 | Ga0495632_0383370_52_423 | 122 |
| 760 | 3300046519 | Ga0495632_0492680 | Ga0495632_0492680_62_430 | 122 |
| 761 | 3300046522 | Ga0495643_0001930 | Ga0495643_0001930_4357_4725 | 122 |
| 762 | 3300046523 | Ga0495644_0108656 | Ga0495644_0108656_504_872 | 122 |
| 763 | 3300046524 | Ga0495648_0027291 | Ga0495648_0027291_1938_2306 | 122 |
| 764 | 3300046526 | Ga0495666_0002237 | Ga0495666_0002237_401_769 | 122 |
| 765 | 3300046526 | Ga0495666_0228632 | Ga0495666_0228632_232_600 | 122 |
| 766 | 3300046529 | Ga0495652_0172925 | Ga0495652_0172925_169_537 | 122 |
| 767 | 3300046529 | Ga0495652_0229077 | Ga0495652_0229077_322_690 | 122 |
| 768 | 3300046530 | Ga0495654_0176224 | Ga0495654_0176224_129_497 | 122 |
| 769 | 3300046533 | Ga0495640_0006860 | Ga0495640_0006860_7429_7797 | 122 |
| 770 | 3300046535 | Ga0495586_0137735 | Ga0495586_0137735_22_390 | 122 |
| 771 | 3300046535 | Ga0495586_0365108 | Ga0495586_0365108_209_592 | 122 |
| 772 | 3300046536 | Ga0495587_0013767 | Ga0495587_0013767_3672_4040 | 122 |
| 773 | 3300046537 | Ga0495598_0361293 | Ga0495598_0361293_60_428 | 122 |
| 774 | 3300046538 | Ga0495609_0035339 | Ga0495609_0035339_1391_1759 | 122 |
| 775 | 3300046538 | Ga0495609_0179317 | Ga0495609_0179317_256_624 | 122 |
| 776 | 3300046542 | Ga0495597_0050030 | Ga0495597_0050030_991_1359 | 122 |
| 777 | 3300046543 | Ga0495645_0050631 | Ga0495645_0050631_1971_2339 | 122 |
| 778 | 3300046543 | Ga0495645_0062011 | Ga0495645_0062011_1071_1439 | 122 |
| 779 | 3300046557 | Ga0495622_0053476 | Ga0495622_0053476_28_396 | 122 |
| 780 | 3300046558 | Ga0495633_0100709 | Ga0495633_0100709_129_497 | 122 |
| 781 | 3300046616 | Ga0495668_0029608 | Ga0495668_0029608_2513_2881 | 122 |
| 782 | 3300046616 | Ga0495668_0106124 | Ga0495668_0106124_255_623 | 122 |
| 783 | 3300046642 | Ga0495634_0071466 | Ga0495634_0071466_692_1060 | 122 |
| 784 | 3300046642 | Ga0495634_0333959 | Ga0495634_0333959_236_604 | 122 |
| 785 | 3300046648 | Ga0495611_0090190 | Ga0495611_0090190_264_632 | 122 |
| 786 | 3300046660 | Ga0495625_0049407 | Ga0495625_0049407_2317_2685 | 122 |
| 787 | 3300046660 | Ga0495625_0241546 | Ga0495625_0241546_58_426 | 122 |
| 788 | 3300046660 | Ga0495625_0606882 | Ga0495625_0606882_139_507 | 122 |
| 789 | 3300046663 | Ga0495635_0061084 | Ga0495635_0061084_1178_1546 | 122 |
| 790 | 3300046674 | Ga0495588_0049151 | Ga0495588_0049151_646_1014 | 122 |
| 791 | 3300046674 | Ga0495588_0276904 | Ga0495588_0276904_150_518 | 122 |
| 792 | 3300046675 | Ga0495657_0030531 | Ga0495657_0030531_601_969 | 122 |
| 793 | 3300046678 | Ga0495599_0110964 | Ga0495599_0110964_1175_1543 | 122 |
| 794 | 3300046679 | Ga0495623_0120130 | Ga0495623_0120130_40_408 | 122 |
| 795 | 3300046680 | Ga0495646_0025052 | Ga0495646_0025052_3342_3710 | 122 |
| 796 | 3300046680 | Ga0495646_0037069 | Ga0495646_0037069_568_936 | 122 |
| 797 | 3300046683 | Ga0495658_0477619 | Ga0495658_0477619_181_549 | 122 |
| 798 | 3300046689 | Ga0495613_0001044 | Ga0495613_0001044_662_1030 | 122 |
| 799 | 3300046689 | Ga0495613_0001732 | Ga0495613_0001732_15553_15921 | 122 |
| 800 | 3300046689 | Ga0495613_0525494 | Ga0495613_0525494_71_439 | 122 |
| 801 | 3300046690 | Ga0495624_0159730 | Ga0495624_0159730_855_1223 | 122 |
| 802 | 3300046690 | Ga0495624_0277363 | Ga0495624_0277363_285_653 | 122 |
| 803 | 3300046691 | Ga0495670_0345942 | Ga0495670_0345942_210_578 | 122 |
| 804 | 3300046694 | Ga0495649_0098405 | Ga0495649_0098405_843_1211 | 122 |
| 805 | 3300046794 | Ga0495589_0129097 | Ga0495589_0129097_136_504 | 122 |
| 806 | 3300046809 | Ga0495600_0288390 | Ga0495600_0288390_51_419 | 122 |
| 807 | 3300046809 | Ga0495600_0494724 | Ga0495600_0494724_360_728 | 122 |
| 808 | 3300047315 | Ga0495581_0088708 | Ga0495581_0088708_732_1100 | 122 |
| 809 | 3300047315 | Ga0495581_0278477 | Ga0495581_0278477_173_541 | 122 |
| 810 | 3300047317 | Ga0495604_0017135 | Ga0495604_0017135_2096_2464 | 122 |
| 811 | 3300047317 | Ga0495604_0037319 | Ga0495604_0037319_198_566 | 122 |
| 812 | 3300047319 | Ga0495674_0141314 | Ga0495674_0141314_452_820 | 122 |
| 813 | 3300047319 | Ga0495674_0707342 | Ga0495674_0707342_281_649 | 122 |
| 814 | 3300047320 | Ga0495672_0094304 | Ga0495672_0094304_420_788 | 122 |
| 815 | 3300047321 | Ga0495676_0138621 | Ga0495676_0138621_28_396 | 122 |
| 816 | 3300047322 | Ga0495680_0010041 | Ga0495680_0010041_7799_8167 | 122 |
| 817 | 3300047323 | Ga0495683_0201837 | Ga0495683_0201837_169_537 | 122 |
| 818 | 3300047443 | Ga0495687_026764 | Ga0495687_026764_343_711 | 122 |
| 819 | 3300047445 | Ga0495677_0028704 | Ga0495677_0028704_983_1351 | 122 |
| 820 | 3300047447 | Ga0495685_055018 | Ga0495685_055018_937_1305 | 122 |
| 821 | 3300047471 | Ga0495684_0123862 | Ga0495684_0123862_128_496 | 122 |
| 822 | 3300047472 | Ga0495686_0230372 | Ga0495686_0230372_356_724 | 122 |
| 823 | 3300047673 | Ga0495593_0306077 | Ga0495593_0306077_172_540 | 122 |
| 824 | 3300048088 | Ga0495602_0026806 | Ga0495602_0026806_3994_4362 | 122 |
| 825 | 3300048088 | Ga0495602_0764262 | Ga0495602_0764262_78_446 | 122 |
| 826 | 3300048089 | Ga0495614_0029193 | Ga0495614_0029193_454_822 | 122 |
| 827 | 3300048089 | Ga0495614_0150332 | Ga0495614_0150332_153_521 | 122 |
| 828 | 3300048090 | Ga0495615_0121537 | Ga0495615_0121537_286_654 | 122 |
| 829 | 3300048091 | Ga0495626_0091416 | Ga0495626_0091416_25_393 | 122 |
| 830 | 3300048903 | Ga0496100_0033625 | Ga0496100_0033625_1971_2339 | 122 |
| 831 | 3300048903 | Ga0496100_0076123 | Ga0496100_0076123_1359_1799 | 122 |
| 832 | 3300048903 | Ga0496100_0151959 | Ga0496100_0151959_1249_1617 | 122 |
| 833 | 3300048903 | Ga0496100_0215462 | Ga0496100_0215462_384_752 | 122 |
| 834 | 3300048903 | Ga0496100_0583050 | Ga0496100_0583050_350_718 | 122 |
| 835 | 3300048903 | Ga0496100_0596082 | Ga0496100_0596082_423_833 | 122 |
| 836 | 3300048903 | Ga0496100_0750467 | Ga0496100_0750467_383_751 | 122 |
| 837 | 3300048903 | Ga0496100_1006038 | Ga0496100_1006038_103_471 | 122 |
| 838 | 3300048903 | Ga0496100_1066840 | Ga0496100_1066840_224_592 | 122 |
| 839 | 3300048904 | Ga0496101_0028715 | Ga0496101_0028715_2656_3024 | 122 |
| 840 | 3300048904 | Ga0496101_0036006 | Ga0496101_0036006_1726_2166 | 122 |
| 841 | 3300048904 | Ga0496101_0379726 | Ga0496101_0379726_16_384 | 122 |
| 842 | 3300048904 | Ga0496101_0911821 | Ga0496101_0911821_265_633 | 122 |
| 843 | 3300048905 | Ga0496102_0000382 | Ga0496102_0000382_45920_46288 | 122 |
| 844 | 3300048905 | Ga0496102_0001329 | Ga0496102_0001329_768_1136 | 122 |
| 845 | 3300048905 | Ga0496102_0007191 | Ga0496102_0007191_8940_9380 | 122 |
| 846 | 3300048905 | Ga0496102_0012230 | Ga0496102_0012230_4768_5136 | 122 |
| 847 | 3300048905 | Ga0496102_0130420 | Ga0496102_0130420_30_398 | 122 |
| 848 | 3300048905 | Ga0496102_0169657 | Ga0496102_0169657_926_1294 | 122 |
| 849 | 3300048905 | Ga0496102_0398092 | Ga0496102_0398092_334_702 | 122 |
| 850 | 3300048905 | Ga0496102_1516976 | Ga0496102_1516976_142_510 | 122 |
| 851 | 3300048906 | Ga0496103_0009301 | Ga0496103_0009301_5078_5518 | 122 |
| 852 | 3300048906 | Ga0496103_0170983 | Ga0496103_0170983_244_612 | 122 |
| 853 | 3300048906 | Ga0496103_0185528 | Ga0496103_0185528_192_560 | 122 |
| 854 | 3300048906 | Ga0496103_0268020 | Ga0496103_0268020_517_885 | 122 |
| 855 | 3300048907 | Ga0496104_0009817 | Ga0496104_0009817_99_467 | 122 |
| 856 | 3300048907 | Ga0496104_0023016 | Ga0496104_0023016_2782_3222 | 122 |
| 857 | 3300048907 | Ga0496104_0084182 | Ga0496104_0084182_1757_2125 | 122 |
| 858 | 3300048907 | Ga0496104_0422852 | Ga0496104_0422852_260_628 | 122 |
| 859 | 3300048907 | Ga0496104_1811517 | Ga0496104_1811517_48_419 | 122 |
| 860 | 3300048908 | Ga0496105_0002836 | Ga0496105_0002836_9456_9896 | 122 |
| 861 | 3300048908 | Ga0496105_0004398 | Ga0496105_0004398_7818_8186 | 122 |
| 862 | 3300048908 | Ga0496105_0057755 | Ga0496105_0057755_347_715 | 122 |
| 863 | 3300048908 | Ga0496105_0060212 | Ga0496105_0060212_2221_2589 | 122 |
| 864 | 3300048908 | Ga0496105_0178064 | Ga0496105_0178064_143_511 | 122 |
| 865 | 3300048908 | Ga0496105_0243058 | Ga0496105_0243058_375_746 | 122 |
| 866 | 3300048908 | Ga0496105_0257325 | Ga0496105_0257325_515_883 | 122 |
| 867 | 3300048908 | Ga0496105_0263754 | Ga0496105_0263754_877_1245 | 122 |
| 868 | 3300048908 | Ga0496105_0753365 | Ga0496105_0753365_268_645 | 122 |
| 869 | 3300048909 | Ga0496106_0173611 | Ga0496106_0173611_581_949 | 122 |
| 870 | 3300048909 | Ga0496106_1076483 | Ga0496106_1076483_173_541 | 122 |
| 871 | 3300048910 | Ga0496107_0118918 | Ga0496107_0118918_447_815 | 122 |
| 872 | 3300048910 | Ga0496107_0178105 | Ga0496107_0178105_768_1136 | 122 |
| 873 | 3300048910 | Ga0496107_0488870 | Ga0496107_0488870_399_767 | 122 |
| 874 | 3300048911 | Ga0496108_0000056 | Ga0496108_0000056_13267_13635 | 122 |
| 875 | 3300048911 | Ga0496108_0006907 | Ga0496108_0006907_6714_7082 | 122 |
| 876 | 3300048911 | Ga0496108_0019641 | Ga0496108_0019641_4555_4923 | 122 |
| 877 | 3300048911 | Ga0496108_0052557 | Ga0496108_0052557_2241_2609 | 122 |
| 878 | 3300048911 | Ga0496108_0121424 | Ga0496108_0121424_1677_2045 | 122 |
| 879 | 3300048912 | Ga0496109_0038374 | Ga0496109_0038374_2254_2622 | 122 |
| 880 | 3300048912 | Ga0496109_0082889 | Ga0496109_0082889_2511_2879 | 122 |
| 881 | 3300048912 | Ga0496109_0423227 | Ga0496109_0423227_737_1105 | 122 |
| 882 | 3300048912 | Ga0496109_1864014 | Ga0496109_1864014_109_516 | 122 |
| 883 | 3300048913 | Ga0496110_0000297 | Ga0496110_0000297_31355_31723 | 122 |
| 884 | 3300048913 | Ga0496110_0316915 | Ga0496110_0316915_576_944 | 122 |
| 885 | 3300048913 | Ga0496110_0328060 | Ga0496110_0328060_765_1133 | 122 |
| 886 | 3300048913 | Ga0496110_0614509 | Ga0496110_0614509_229_597 | 122 |
| 887 | 3300048913 | Ga0496110_0936383 | Ga0496110_0936383_373_741 | 122 |
| 888 | 3300048913 | Ga0496110_1112012 | Ga0496110_1112012_163_603 | 122 |
| 889 | 3300048914 | Ga0496111_0139449 | Ga0496111_0139449_617_985 | 122 |
| 890 | 3300048915 | Ga0496112_0032466 | Ga0496112_0032466_4585_4995 | 122 |
| 891 | 3300048915 | Ga0496112_0178346 | Ga0496112_0178346_706_1074 | 122 |
| 892 | 3300048915 | Ga0496112_1213446 | Ga0496112_1213446_174_614 | 122 |
| 893 | 3300048916 | Ga0496113_0127960 | Ga0496113_0127960_569_937 | 122 |
| 894 | 3300048916 | Ga0496113_0946576 | Ga0496113_0946576_211_579 | 122 |
| 895 | 3300048916 | Ga0496113_1109382 | Ga0496113_1109382_56_424 | 122 |
| 896 | 3300048917 | Ga0496114_0003141 | Ga0496114_0003141_11442_11882 | 122 |
| 897 | 3300048917 | Ga0496114_0038863 | Ga0496114_0038863_1582_1950 | 122 |
| 898 | 3300048917 | Ga0496114_0063167 | Ga0496114_0063167_2417_2785 | 122 |
| 899 | 3300048917 | Ga0496114_0076810 | Ga0496114_0076810_2411_2779 | 122 |
| 900 | 3300048917 | Ga0496114_0095403 | Ga0496114_0095403_501_869 | 122 |
| 901 | 3300048917 | Ga0496114_0100515 | Ga0496114_0100515_1861_2229 | 122 |
| 902 | 3300048917 | Ga0496114_0123409 | Ga0496114_0123409_1757_2125 | 122 |
| 903 | 3300048917 | Ga0496114_0194230 | Ga0496114_0194230_1075_1443 | 122 |
| 904 | 3300048917 | Ga0496114_0499473 | Ga0496114_0499473_642_1010 | 122 |
| 905 | 3300048917 | Ga0496114_0560226 | Ga0496114_0560226_419_787 | 122 |
| 906 | 3300048917 | Ga0496114_0629878 | Ga0496114_0629878_513_881 | 122 |
| 907 | 3300048917 | Ga0496114_0861464 | Ga0496114_0861464_42_410 | 122 |
| 908 | 3300048917 | Ga0496114_0878038 | Ga0496114_0878038_371_739 | 122 |
| 909 | 3300048917 | Ga0496114_1156328 | Ga0496114_1156328_89_457 | 122 |
| 910 | 3300048917 | Ga0496114_1530310 | Ga0496114_1530310_150_518 | 122 |
| 911 | 3300048918 | Ga0496115_0054361 | Ga0496115_0054361_678_1046 | 122 |
| 912 | 3300048918 | Ga0496115_0090964 | Ga0496115_0090964_1613_1981 | 122 |
| 913 | 3300048918 | Ga0496115_0103985 | Ga0496115_0103985_130_498 | 122 |
| 914 | 3300048918 | Ga0496115_1350687 | Ga0496115_1350687_110_478 | 122 |
| 915 | 3300048919 | Ga0496116_0004331 | Ga0496116_0004331_10378_10746 | 122 |
| 916 | 3300048919 | Ga0496116_0302593 | Ga0496116_0302593_166_534 | 122 |
| 917 | 3300048920 | Ga0496117_0000455 | Ga0496117_0000455_7177_7545 | 122 |
| 918 | 3300048920 | Ga0496117_0009489 | Ga0496117_0009489_8122_8490 | 122 |
| 919 | 3300048920 | Ga0496117_0037996 | Ga0496117_0037996_1906_2274 | 122 |
| 920 | 3300048920 | Ga0496117_0066401 | Ga0496117_0066401_832_1200 | 122 |
| 921 | 3300048920 | Ga0496117_0153245 | Ga0496117_0153245_371_739 | 122 |
| 922 | 3300048920 | Ga0496117_0289589 | Ga0496117_0289589_176_544 | 122 |
| 923 | 3300048920 | Ga0496117_0336917 | Ga0496117_0336917_216_584 | 122 |
| 924 | 3300048921 | Ga0496118_0000447 | Ga0496118_0000447_7178_7546 | 122 |
| 925 | 3300048921 | Ga0496118_0006679 | Ga0496118_0006679_9012_9380 | 122 |
| 926 | 3300048921 | Ga0496118_0103571 | Ga0496118_0103571_1368_1736 | 122 |
| 927 | 3300048921 | Ga0496118_0152983 | Ga0496118_0152983_463_837 | 122 |
| 928 | 3300048921 | Ga0496118_0210158 | Ga0496118_0210158_475_915 | 122 |
| 929 | 3300048921 | Ga0496118_0215274 | Ga0496118_0215274_498_866 | 122 |
| 930 | 3300048921 | Ga0496118_0454149 | Ga0496118_0454149_215_583 | 122 |
| 931 | 3300048922 | Ga0496119_0000762 | Ga0496119_0000762_31087_31455 | 122 |
| 932 | 3300048922 | Ga0496119_0004415 | Ga0496119_0004415_1598_1966 | 122 |
| 933 | 3300048922 | Ga0496119_0005312 | Ga0496119_0005312_8750_9118 | 122 |
| 934 | 3300048922 | Ga0496119_0007168 | Ga0496119_0007168_1059_1427 | 122 |
| 935 | 3300048922 | Ga0496119_0037325 | Ga0496119_0037325_2654_3022 | 122 |
| 936 | 3300048922 | Ga0496119_0042229 | Ga0496119_0042229_1891_2331 | 122 |
| 937 | 3300048922 | Ga0496119_0080893 | Ga0496119_0080893_143_511 | 122 |
| 938 | 3300048922 | Ga0496119_0106053 | Ga0496119_0106053_1140_1550 | 122 |
| 939 | 3300048922 | Ga0496119_0132222 | Ga0496119_0132222_896_1264 | 122 |
| 940 | 3300048922 | Ga0496119_0366410 | Ga0496119_0366410_139_507 | 122 |
| 941 | 3300048922 | Ga0496119_0476902 | Ga0496119_0476902_97_465 | 122 |
| 942 | 3300048922 | Ga0496119_0520971 | Ga0496119_0520971_117_485 | 122 |
| 943 | 3300048922 | Ga0496119_0587701 | Ga0496119_0587701_126_494 | 122 |
| 944 | 3300048923 | Ga0496120_0000500 | Ga0496120_0000500_5570_5938 | 122 |
| 945 | 3300048923 | Ga0496120_0002282 | Ga0496120_0002282_10522_10890 | 122 |
| 946 | 3300048923 | Ga0496120_0034809 | Ga0496120_0034809_1945_2313 | 122 |
| 947 | 3300048923 | Ga0496120_0041657 | Ga0496120_0041657_1520_1888 | 122 |
| 948 | 3300048923 | Ga0496120_0059050 | Ga0496120_0059050_541_909 | 122 |
| 949 | 3300048923 | Ga0496120_0080326 | Ga0496120_0080326_303_713 | 122 |
| 950 | 3300048923 | Ga0496120_0088877 | Ga0496120_0088877_762_1130 | 122 |
| 951 | 3300048923 | Ga0496120_0173300 | Ga0496120_0173300_256_624 | 122 |
| 952 | 3300048923 | Ga0496120_0250554 | Ga0496120_0250554_421_789 | 122 |
| 953 | 3300048924 | Ga0496121_0000098 | Ga0496121_0000098_174398_174766 | 122 |
| 954 | 3300048924 | Ga0496121_0381746 | Ga0496121_0381746_521_889 | 122 |
| 955 | 3300048924 | Ga0496121_0533513 | Ga0496121_0533513_336_704 | 122 |
| 956 | 3300048924 | Ga0496121_0593715 | Ga0496121_0593715_230_598 | 122 |
| 957 | 3300048925 | Ga0496122_0000705 | Ga0496122_0000705_42554_42994 | 122 |
| 958 | 3300048925 | Ga0496122_0000978 | Ga0496122_0000978_23259_23633 | 122 |
| 959 | 3300048925 | Ga0496122_0008896 | Ga0496122_0008896_4038_4406 | 122 |
| 960 | 3300048925 | Ga0496122_0033847 | Ga0496122_0033847_1309_1719 | 122 |
| 961 | 3300048925 | Ga0496122_0036228 | Ga0496122_0036228_1815_2183 | 122 |
| 962 | 3300048925 | Ga0496122_0189516 | Ga0496122_0189516_787_1155 | 122 |
| 963 | 3300048925 | Ga0496122_0348285 | Ga0496122_0348285_378_746 | 122 |
| 964 | 3300048925 | Ga0496122_0443693 | Ga0496122_0443693_204_572 | 122 |
| 965 | 3300048926 | Ga0496123_0000304 | Ga0496123_0000304_40144_40518 | 122 |
| 966 | 3300048926 | Ga0496123_0006643 | Ga0496123_0006643_1584_2012 | 122 |
| 967 | 3300048926 | Ga0496123_0030985 | Ga0496123_0030985_953_1363 | 122 |
| 968 | 3300048926 | Ga0496123_0220459 | Ga0496123_0220459_315_683 | 122 |
| 969 | 3300048926 | Ga0496123_0285735 | Ga0496123_0285735_389_757 | 122 |
| 970 | 3300048926 | Ga0496123_0305148 | Ga0496123_0305148_362_730 | 122 |
| 971 | 3300048926 | Ga0496123_0486224 | Ga0496123_0486224_152_520 | 122 |
| 972 | 3300048927 | Ga0496124_0005987 | Ga0496124_0005987_6710_7078 | 122 |
| 973 | 3300048927 | Ga0496124_0032523 | Ga0496124_0032523_1185_1553 | 122 |
| 974 | 3300048927 | Ga0496124_0039999 | Ga0496124_0039999_2581_2949 | 122 |
| 975 | 3300048927 | Ga0496124_0136429 | Ga0496124_0136429_166_534 | 122 |
| 976 | 3300048927 | Ga0496124_0235448 | Ga0496124_0235448_972_1340 | 122 |
| 977 | 3300048927 | Ga0496124_0265439 | Ga0496124_0265439_704_1072 | 122 |
| 978 | 3300048927 | Ga0496124_0296299 | Ga0496124_0296299_440_808 | 122 |
| 979 | 3300048927 | Ga0496124_0437708 | Ga0496124_0437708_204_581 | 122 |
| 980 | 3300048927 | Ga0496124_0547271 | Ga0496124_0547271_267_635 | 122 |
| 981 | 3300048927 | Ga0496124_0967117 | Ga0496124_0967117_64_432 | 122 |
| 982 | 3300048928 | Ga0496125_0000069 | Ga0496125_0000069_196566_196934 | 122 |
| 983 | 3300048928 | Ga0496125_0000626 | Ga0496125_0000626_30491_30865 | 122 |
| 984 | 3300048928 | Ga0496125_0001892 | Ga0496125_0001892_25827_26195 | 122 |
| 985 | 3300048928 | Ga0496125_0013813 | Ga0496125_0013813_1904_2272 | 122 |
| 986 | 3300048929 | Ga0496126_0001101 | Ga0496126_0001101_37296_37664 | 122 |
| 987 | 3300048929 | Ga0496126_0005987 | Ga0496126_0005987_425_793 | 122 |
| 988 | 3300048929 | Ga0496126_0007418 | Ga0496126_0007418_7068_7436 | 122 |
| 989 | 3300048929 | Ga0496126_0007949 | Ga0496126_0007949_420_788 | 122 |
| 990 | 3300048929 | Ga0496126_0014170 | Ga0496126_0014170_4918_5337 | 122 |
| 991 | 3300048929 | Ga0496126_0056376 | Ga0496126_0056376_2215_2583 | 122 |
| 992 | 3300048929 | Ga0496126_0068908 | Ga0496126_0068908_2736_3104 | 122 |
| 993 | 3300048929 | Ga0496126_0198042 | Ga0496126_0198042_513_881 | 122 |
| 994 | 3300048929 | Ga0496126_0670698 | Ga0496126_0670698_421_789 | 122 |
| 995 | 3300048929 | Ga0496126_1298154 | Ga0496126_1298154_15_383 | 122 |
| 996 | 3300049459 | Ga0495678_028339 | Ga0495678_028339_119_487 | 122 |
| 997 | 3300049460 | Ga0495682_0103322 | Ga0495682_0103322_474_842 | 122 |
| 998 | 3300049568 | Ga0501031_0003477 | Ga0501031_0003477_8713_9081 | 122 |
| 999 | 3300049568 | Ga0501031_0005744 | Ga0501031_0005744_249_617 | 122 |
| 1000 | 3300049568 | Ga0501031_0023746 | Ga0501031_0023746_2685_3053 | 122 |
| 1001 | 3300049568 | Ga0501031_0150341 | Ga0501031_0150341_90_458 | 122 |
| 1002 | 3300049569 | Ga0501032_0005320 | Ga0501032_0005320_3664_4032 | 122 |
| 1003 | 3300049569 | Ga0501032_0044843 | Ga0501032_0044843_2252_2620 | 122 |
| 1004 | 3300049569 | Ga0501032_0161473 | Ga0501032_0161473_82_450 | 122 |
| 1005 | 3300049569 | Ga0501032_0228315 | Ga0501032_0228315_463_831 | 122 |
| 1006 | 3300049569 | Ga0501032_0235220 | Ga0501032_0235220_130_498 | 122 |
| 1007 | 3300049570 | Ga0501033_0003891 | Ga0501033_0003891_7643_8011 | 122 |
| 1008 | 3300049570 | Ga0501033_0004594 | Ga0501033_0004594_10055_10423 | 122 |
| 1009 | 3300049570 | Ga0501033_0106473 | Ga0501033_0106473_867_1235 | 122 |
| 1010 | 3300049570 | Ga0501033_0178364 | Ga0501033_0178364_704_1072 | 122 |
| 1011 | 3300049570 | Ga0501033_0223532 | Ga0501033_0223532_543_911 | 122 |
| 1012 | 3300049570 | Ga0501033_0227459 | Ga0501033_0227459_861_1229 | 122 |
| 1013 | 3300049571 | Ga0501034_0054720 | Ga0501034_0054720_30_398 | 122 |
| 1014 | 3300049571 | Ga0501034_0151536 | Ga0501034_0151536_1068_1436 | 122 |
| 1015 | 3300049571 | Ga0501034_0157244 | Ga0501034_0157244_1053_1421 | 122 |
| 1016 | 3300049571 | Ga0501034_0168883 | Ga0501034_0168883_1030_1398 | 122 |
| 1017 | 3300049571 | Ga0501034_0179134 | Ga0501034_0179134_1195_1563 | 122 |
| 1018 | 3300049571 | Ga0501034_0250415 | Ga0501034_0250415_120_488 | 122 |
| 1019 | 3300049571 | Ga0501034_0250636 | Ga0501034_0250636_1026_1394 | 122 |
| 1020 | 3300049571 | Ga0501034_0720880 | Ga0501034_0720880_378_746 | 122 |
| 1021 | 3300049571 | Ga0501034_1436740 | Ga0501034_1436740_172_540 | 122 |
| 1022 | 3300049572 | Ga0501036_0015125 | Ga0501036_0015125_245_613 | 122 |
| 1023 | 3300049572 | Ga0501036_0025236 | Ga0501036_0025236_2838_3206 | 122 |
| 1024 | 3300049572 | Ga0501036_0028243 | Ga0501036_0028243_4117_4485 | 122 |
| 1025 | 3300049572 | Ga0501036_0063061 | Ga0501036_0063061_359_727 | 122 |
| 1026 | 3300049572 | Ga0501036_0066493 | Ga0501036_0066493_2597_2965 | 122 |
| 1027 | 3300049572 | Ga0501036_0949412 | Ga0501036_0949412_289_657 | 122 |
| 1028 | 3300049572 | Ga0501036_1007711 | Ga0501036_1007711_94_462 | 122 |
| 1029 | 3300049573 | Ga0501037_0009033 | Ga0501037_0009033_542_910 | 122 |
| 1030 | 3300049573 | Ga0501037_0075874 | Ga0501037_0075874_1549_1917 | 122 |
| 1031 | 3300049573 | Ga0501037_0080134 | Ga0501037_0080134_604_972 | 122 |
| 1032 | 3300049573 | Ga0501037_0133057 | Ga0501037_0133057_932_1300 | 122 |
| 1033 | 3300049573 | Ga0501037_0219868 | Ga0501037_0219868_953_1321 | 122 |
| 1034 | 3300049573 | Ga0501037_0277462 | Ga0501037_0277462_279_647 | 122 |
| 1035 | 3300049574 | Ga0501038_0013350 | Ga0501038_0013350_197_565 | 122 |
| 1036 | 3300049574 | Ga0501038_0014325 | Ga0501038_0014325_1380_1748 | 122 |
| 1037 | 3300049574 | Ga0501038_0026637 | Ga0501038_0026637_3671_4039 | 122 |
| 1038 | 3300049574 | Ga0501038_0031984 | Ga0501038_0031984_630_998 | 122 |
| 1039 | 3300049574 | Ga0501038_0113488 | Ga0501038_0113488_1319_1687 | 122 |
| 1040 | 3300049574 | Ga0501038_0327847 | Ga0501038_0327847_214_582 | 122 |
| 1041 | 3300049575 | Ga0501039_0013460 | Ga0501039_0013460_5856_6224 | 122 |
| 1042 | 3300049575 | Ga0501039_0018121 | Ga0501039_0018121_364_732 | 122 |
| 1043 | 3300049575 | Ga0501039_0130770 | Ga0501039_0130770_758_1126 | 122 |
| 1044 | 3300049575 | Ga0501039_0620398 | Ga0501039_0620398_355_723 | 122 |
| 1045 | 3300049578 | Ga0501042_0007367 | Ga0501042_0007367_27_395 | 122 |
| 1046 | 3300049578 | Ga0501042_0008101 | Ga0501042_0008101_2673_3041 | 122 |
| 1047 | 3300049578 | Ga0501042_0020230 | Ga0501042_0020230_3680_4048 | 122 |
| 1048 | 3300049579 | Ga0501043_0016876 | Ga0501043_0016876_365_733 | 122 |
| 1049 | 3300049579 | Ga0501043_0023448 | Ga0501043_0023448_1709_2077 | 122 |
| 1050 | 3300049579 | Ga0501043_0025840 | Ga0501043_0025840_3389_3757 | 122 |
| 1051 | 3300049579 | Ga0501043_0040998 | Ga0501043_0040998_551_919 | 122 |
| 1052 | 3300049579 | Ga0501043_0144375 | Ga0501043_0144375_1270_1638 | 122 |
| 1053 | 3300049579 | Ga0501043_0148363 | Ga0501043_0148363_996_1364 | 122 |
| 1054 | 3300049579 | Ga0501043_0411657 | Ga0501043_0411657_314_682 | 122 |
| 1055 | 3300049580 | Ga0501046_0006076 | Ga0501046_0006076_799_1167 | 122 |
| 1056 | 3300049580 | Ga0501046_0020284 | Ga0501046_0020284_3555_3923 | 122 |
| 1057 | 3300049580 | Ga0501046_0052539 | Ga0501046_0052539_820_1188 | 122 |
| 1058 | 3300049580 | Ga0501046_0745556 | Ga0501046_0745556_155_523 | 122 |
| 1059 | 3300049581 | Ga0501047_0002353 | Ga0501047_0002353_17147_17515 | 122 |
| 1060 | 3300049581 | Ga0501047_0021705 | Ga0501047_0021705_629_997 | 122 |
| 1061 | 3300049581 | Ga0501047_0023560 | Ga0501047_0023560_3475_3843 | 122 |
| 1062 | 3300049581 | Ga0501047_0025365 | Ga0501047_0025365_1003_1371 | 122 |
| 1063 | 3300049581 | Ga0501047_0100854 | Ga0501047_0100854_2161_2529 | 122 |
| 1064 | 3300049581 | Ga0501047_0124851 | Ga0501047_0124851_559_927 | 122 |
| 1065 | 3300049581 | Ga0501047_0180517 | Ga0501047_0180517_914_1282 | 122 |
| 1066 | 3300049581 | Ga0501047_0239537 | Ga0501047_0239537_1269_1637 | 122 |
| 1067 | 3300049582 | Ga0501048_0065848 | Ga0501048_0065848_510_878 | 122 |
| 1068 | 3300049582 | Ga0501048_0074058 | Ga0501048_0074058_758_1126 | 122 |
| 1069 | 3300049583 | Ga0501067_0426769 | Ga0501067_0426769_147_515 | 122 |
| 1070 | 3300049584 | Ga0501068_0431234 | Ga0501068_0431234_363_731 | 122 |
| 1071 | 3300049585 | Ga0501069_0112891 | Ga0501069_0112891_176_544 | 122 |
| 1072 | 3300049585 | Ga0501069_0533225 | Ga0501069_0533225_40_408 | 122 |
| 1073 | 3300049586 | Ga0501070_0000515 | Ga0501070_0000515_30616_30984 | 122 |
| 1074 | 3300049586 | Ga0501070_0079626 | Ga0501070_0079626_2158_2526 | 122 |
| 1075 | 3300049586 | Ga0501070_0110360 | Ga0501070_0110360_261_629 | 122 |
| 1076 | 3300049586 | Ga0501070_0944339 | Ga0501070_0944339_291_659 | 122 |
| 1077 | 3300049586 | Ga0501070_1041536 | Ga0501070_1041536_178_546 | 122 |
| 1078 | 3300049588 | Ga0501072_0275753 | Ga0501072_0275753_506_874 | 122 |
| 1079 | 3300049588 | Ga0501072_1081479 | Ga0501072_1081479_110_478 | 122 |
| 1080 | 3300049589 | Ga0501073_0008299 | Ga0501073_0008299_5949_6317 | 122 |
| 1081 | 3300049589 | Ga0501073_0060531 | Ga0501073_0060531_900_1268 | 122 |
| 1082 | 3300049589 | Ga0501073_0352223 | Ga0501073_0352223_66_434 | 122 |
| 1083 | 3300049590 | Ga0501074_0021577 | Ga0501074_0021577_3229_3597 | 122 |
| 1084 | 3300049590 | Ga0501074_0039574 | Ga0501074_0039574_1778_2146 | 122 |
| 1085 | 3300049590 | Ga0501074_0051476 | Ga0501074_0051476_2524_2892 | 122 |
| 1086 | 3300049742 | Ga0501080_0142711 | Ga0501080_0142711_50_418 | 122 |
| 1087 | 3300049742 | Ga0501080_0520407 | Ga0501080_0520407_157_525 | 122 |
| 1088 | 3300049742 | Ga0501080_0641595 | Ga0501080_0641595_529_897 | 122 |
| 1089 | 3300049742 | Ga0501080_1311669 | Ga0501080_1311669_133_501 | 122 |
| 1090 | 3300049742 | Ga0501080_1473844 | Ga0501080_1473844_85_453 | 122 |
| 1091 | 3300049742 | Ga0501080_1503254 | Ga0501080_1503254_92_460 | 122 |
| 1092 | 3300049744 | Ga0501083_0132689 | Ga0501083_0132689_371_739 | 122 |
| 1093 | 3300049744 | Ga0501083_0278158 | Ga0501083_0278158_623_991 | 122 |
| 1094 | 3300049822 | Ga0501035_0001713 | Ga0501035_0001713_9676_10044 | 122 |
| 1095 | 3300049822 | Ga0501035_0031721 | Ga0501035_0031721_2668_3036 | 122 |
| 1096 | 3300049822 | Ga0501035_0055081 | Ga0501035_0055081_2987_3355 | 122 |
| 1097 | 3300049822 | Ga0501035_0113823 | Ga0501035_0113823_1398_1766 | 122 |
| 1098 | 3300049822 | Ga0501035_0233552 | Ga0501035_0233552_953_1321 | 122 |
| 1099 | 3300049822 | Ga0501035_0742237 | Ga0501035_0742237_172_540 | 122 |
| 1100 | 3300049822 | Ga0501035_1174919 | Ga0501035_1174919_159_527 | 122 |
| 1101 | 3300049823 | Ga0501044_0005944 | Ga0501044_0005944_11715_12083 | 122 |
| 1102 | 3300049823 | Ga0501044_0042700 | Ga0501044_0042700_758_1126 | 122 |
| 1103 | 3300049823 | Ga0501044_0044738 | Ga0501044_0044738_3901_4269 | 122 |
| 1104 | 3300049823 | Ga0501044_0049479 | Ga0501044_0049479_2356_2724 | 122 |
| 1105 | 3300049823 | Ga0501044_0073064 | Ga0501044_0073064_2913_3281 | 122 |
| 1106 | 3300049823 | Ga0501044_0079162 | Ga0501044_0079162_2581_2949 | 122 |
| 1107 | 3300049823 | Ga0501044_0183058 | Ga0501044_0183058_700_1068 | 122 |
| 1108 | 3300049823 | Ga0501044_0190558 | Ga0501044_0190558_400_768 | 122 |
| 1109 | 3300049823 | Ga0501044_0781069 | Ga0501044_0781069_314_682 | 122 |
| 1110 | 3300049823 | Ga0501044_1519825 | Ga0501044_1519825_52_420 | 122 |
| 1111 | 3300049824 | Ga0501045_0258409 | Ga0501045_0258409_209_577 | 122 |
| 1112 | 3300049824 | Ga0501045_0374978 | Ga0501045_0374978_97_465 | 122 |
| 1113 | 3300049824 | Ga0501045_1428778 | Ga0501045_1428778_45_413 | 122 |
| 1114 | 3300050490 | nmdc:mga03n38_19199_c1 | nmdc:mga03n38_19199_c1_2310_2678 | 122 |
| 1115 | 3300050490 | nmdc:mga03n38_728110_c1 | nmdc:mga03n38_728110_c1_25_393 | 122 |
| 1116 | 3300050491 | nmdc:mga00v17_108997_c1 | nmdc:mga00v17_108997_c1_224_592 | 122 |
| 1117 | 3300050491 | nmdc:mga00v17_13901_c1 | nmdc:mga00v17_13901_c1_2693_3097 | 122 |
| 1118 | 3300050491 | nmdc:mga00v17_171559_c1 | nmdc:mga00v17_171559_c1_675_1043 | 122 |
| 1119 | 3300050491 | nmdc:mga00v17_181797_c1 | nmdc:mga00v17_181797_c1_935_1303 | 122 |
| 1120 | 3300050491 | nmdc:mga00v17_291348_c1 | nmdc:mga00v17_291348_c1_469_837 | 122 |
| 1121 | 3300050491 | nmdc:mga00v17_430484_c1 | nmdc:mga00v17_430484_c1_375_743 | 122 |
| 1122 | 3300050491 | nmdc:mga00v17_4782_c1 | nmdc:mga00v17_4782_c1_3551_3919 | 122 |
| 1123 | 3300050491 | nmdc:mga00v17_749696_c1 | nmdc:mga00v17_749696_c1_203_571 | 122 |
| 1124 | 3300050491 | nmdc:mga00v17_97382_c1 | nmdc:mga00v17_97382_c1_712_1080 | 122 |
| 1125 | 3300050492 | nmdc:mga0yw44_113595_c1 | nmdc:mga0yw44_113595_c1_189_557 | 122 |
| 1126 | 3300050492 | nmdc:mga0yw44_122613_c1 | nmdc:mga0yw44_122613_c1_630_998 | 122 |
| 1127 | 3300050492 | nmdc:mga0yw44_173869_c1 | nmdc:mga0yw44_173869_c1_750_1118 | 122 |
| 1128 | 3300050492 | nmdc:mga0yw44_194469_c1 | nmdc:mga0yw44_194469_c1_512_880 | 122 |
| 1129 | 3300050492 | nmdc:mga0yw44_208487_c1 | nmdc:mga0yw44_208487_c1_317_685 | 122 |
| 1130 | 3300050492 | nmdc:mga0yw44_215398_c1 | nmdc:mga0yw44_215398_c1_335_703 | 122 |
| 1131 | 3300050492 | nmdc:mga0yw44_232946_c1 | nmdc:mga0yw44_232946_c1_666_1034 | 122 |
| 1132 | 3300050492 | nmdc:mga0yw44_74100_c1 | nmdc:mga0yw44_74100_c1_517_885 | 122 |
| 1133 | 3300050492 | nmdc:mga0yw44_78093_c1 | nmdc:mga0yw44_78093_c1_1350_1718 | 122 |
| 1134 | 3300050492 | nmdc:mga0yw44_81627_c1 | nmdc:mga0yw44_81627_c1_394_762 | 122 |
| 1135 | 3300050492 | nmdc:mga0yw44_915380_c1 | nmdc:mga0yw44_915380_c1_62_430 | 122 |
| 1136 | 3300050492 | nmdc:mga0yw44_925585_c1 | nmdc:mga0yw44_925585_c1_144_512 | 122 |
| 1137 | 3300050493 | nmdc:mga0k408_394032_c1 | nmdc:mga0k408_394032_c1_149_517 | 122 |
| 1138 | 3300050493 | nmdc:mga0k408_885809_c1 | nmdc:mga0k408_885809_c1_64_432 | 122 |
| 1139 | 3300050494 | nmdc:mga06z11_386675_c1 | nmdc:mga06z11_386675_c1_367_771 | 122 |
| 1140 | 3300050494 | nmdc:mga06z11_49909_c1 | nmdc:mga06z11_49909_c1_1671_2039 | 122 |
| 1141 | 3300050494 | nmdc:mga06z11_63871_c1 | nmdc:mga06z11_63871_c1_942_1310 | 122 |
| 1142 | 3300050495 | nmdc:mga04h51_188287_c1 | nmdc:mga04h51_188287_c1_187_555 | 122 |
| 1143 | 3300050495 | nmdc:mga04h51_6044_c1 | nmdc:mga04h51_6044_c1_942_1310 | 122 |
| 1144 | 3300050496 | nmdc:mga07m45_19564_c1 | nmdc:mga07m45_19564_c1_1514_1882 | 122 |
| 1145 | 3300050496 | nmdc:mga07m45_493206_c1 | nmdc:mga07m45_493206_c1_231_599 | 122 |
| 1146 | 3300050510 | nmdc:mga06r32_824203_c1 | nmdc:mga06r32_824203_c1_471_839 | 122 |
| 1147 | 3300050511 | nmdc:mga08y16_66782_c1 | nmdc:mga08y16_66782_c1_720_1088 | 122 |
| 1148 | 3300050512 | nmdc:mga0n895_340654_c1 | nmdc:mga0n895_340654_c1_601_969 | 122 |
| 1149 | 3300050513 | nmdc:mga0rr50_33750_c1 | nmdc:mga0rr50_33750_c1_751_1119 | 122 |
| 1150 | 3300050514 | nmdc:mga08x19_142796_c1 | nmdc:mga08x19_142796_c1_555_923 | 122 |
| 1151 | 3300050515 | nmdc:mga0a205_96969_c1 | nmdc:mga0a205_96969_c1_2421_2789 | 122 |
| 1152 | 3300050516 | nmdc:mga0sz30_11515_c1 | nmdc:mga0sz30_11515_c1_941_1309 | 122 |
| 1153 | 3300050516 | nmdc:mga0sz30_266832_c1 | nmdc:mga0sz30_266832_c1_293_661 | 122 |
| 1154 | 3300050516 | nmdc:mga0sz30_49386_c1 | nmdc:mga0sz30_49386_c1_991_1359 | 122 |
| 1155 | 3300050516 | nmdc:mga0sz30_57472_c1 | nmdc:mga0sz30_57472_c1_1255_1623 | 122 |
| 1156 | 3300053077 | Ga0495601_0047478 | Ga0495601_0047478_97_465 | 122 |
| 1157 | 3300053078 | Ga0495612_0258817 | Ga0495612_0258817_128_496 | 122 |
| 1158 | 3300053079 | Ga0500610_0343925 | Ga0500610_0343925_73_441 | 122 |
| 1159 | 3300053080 | Ga0500635_0000067 | Ga0500635_0000067_55594_55962 | 122 |
| 1160 | 3300053085 | Ga0495619_0095178 | Ga0495619_0095178_450_821 | 122 |
| 1161 | 3300053088 | Ga0500644_0315564 | Ga0500644_0315564_275_646 | 122 |
| 1162 | 3300053090 | Ga0500646_0000795 | Ga0500646_0000795_5429_5797 | 122 |
| 1163 | 3300053092 | Ga0500583_0259962 | Ga0500583_0259962_269_637 | 122 |
| 1164 | 3300053093 | Ga0500651_0000194 | Ga0500651_0000194_10276_10644 | 122 |
| 1165 | 3300053104 | Ga0500556_0000095 | Ga0500556_0000095_7059_7427 | 122 |
| 1166 | 3300053104 | Ga0500556_0001225 | Ga0500556_0001225_10951_11319 | 122 |
| 1167 | 3300053104 | Ga0500556_0421944 | Ga0500556_0421944_21_389 | 122 |
| 1168 | 3300053108 | Ga0500562_009929 | Ga0500562_009929_141_509 | 122 |
| 1169 | 3300053108 | Ga0500562_011098 | Ga0500562_011098_1041_1409 | 122 |
| 1170 | 3300053117 | Ga0500593_001106 | Ga0500593_001106_6142_6510 | 122 |
| 1171 | 3300053131 | Ga0500652_395241 | Ga0500652_395241_79_447 | 122 |
| 1172 | 3300053136 | Ga0500559_0000753 | Ga0500559_0000753_9648_10016 | 122 |
| 1173 | 3300053136 | Ga0500559_0160491 | Ga0500559_0160491_90_458 | 122 |
| 1174 | 3300053139 | Ga0500568_0000223 | Ga0500568_0000223_30483_30851 | 122 |
| 1175 | 3300053142 | Ga0500577_0306280 | Ga0500577_0306280_171_539 | 122 |
| 1176 | 3300053146 | Ga0500588_0291405 | Ga0500588_0291405_53_421 | 122 |
| 1177 | 3300053149 | Ga0500600_0162141 | Ga0500600_0162141_394_762 | 122 |
| 1178 | 3300053149 | Ga0500600_0206847 | Ga0500600_0206847_197_565 | 122 |
| 1179 | 3300053151 | Ga0500604_0202978 | Ga0500604_0202978_252_623 | 122 |
| 1180 | 3300053153 | Ga0500616_0000257 | Ga0500616_0000257_70127_70495 | 122 |
| 1181 | 3300053153 | Ga0500616_0009623 | Ga0500616_0009623_2377_2745 | 122 |
| 1182 | 3300053153 | Ga0500616_0033874 | Ga0500616_0033874_1912_2280 | 122 |
| 1183 | 3300053153 | Ga0500616_0127346 | Ga0500616_0127346_58_429 | 122 |
| 1184 | 3300053155 | Ga0500620_004744 | Ga0500620_004744_1102_1470 | 122 |
| 1185 | 3300053155 | Ga0500620_122537 | Ga0500620_122537_161_529 | 122 |
| 1186 | 3300053158 | Ga0500627_0394095 | Ga0500627_0394095_161_529 | 122 |
| 1187 | 3300053161 | Ga0500634_0298827 | Ga0500634_0298827_232_600 | 122 |
| 1188 | 3300053730 | Ga0500645_008303 | Ga0500645_008303_2586_2954 | 122 |
| 1189 | 3300054114 | Ga0501084_0193537 | Ga0501084_0193537_308_676 | 122 |
| 1190 | 3300061719 | Ga0466962_0032349 | Ga0466962_0032349_331_699 | 122 |
| 1191 | 3300061719 | Ga0466962_0091666 | Ga0466962_0091666_826_1215 | 122 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3kol-assembly1.cif.gz_A-2 | crystal structure of a glyoxalase/dioxygenase from nostoc punctiforme | 0.78 | 4 | 122 |
| 4nvs-assembly1.cif.gz_A | crystal structure of the q18cp6_clod6 protein from glyoxalase family. northeast structural genomics consortium target cfr3 | 0.778 | 4 | 120 |
| 4nb2-assembly1.cif.gz_A | crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure | 0.7767 | 1 | 122 |
| 4qb5-assembly1.cif.gz_C | crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 | 0.776 | 7 | 122 |
| 3e5d-assembly1.cif.gz_A-2 | crystal structure of a putative glyoxalase i (lmof2365_0426) from listeria monocytogenes str. 4b f2365 at 2.70 a resolution | 0.7694 | 7 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8965 | 71 | 120 | 3.30.720.110 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8769 | 71 | 122 | 3.30.720.110 |
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.849 | 71 | 120 | 3.30.720.110 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8072 | 71 | 122 | 3.30.720.110 |
| af_Q5VMX8_15_124_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7957 | 9 | 122 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K0ES97-F1-model_v4 | Glyoxalase/bleomycin resistance protein/dioxygenase | 0.9927 | 1 | 122 |
GO:0051213
|
| AF-A0A7R7HYG8-F1-model_v4 | Glyoxalase | 0.9926 | 1 | 122 |
|
| AF-A0A2U8NIV6-F1-model_v4 | deleted | 0.9921 | 1 | 122 |
|
| AF-A0A181Z885-F1-model_v4 | VOC domain-containing protein | 0.9919 | 1 | 122 |
|
| AF-A0A7G9R1L4-F1-model_v4 | VOC family protein | 0.9918 | 1 | 122 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar