F491418

General Info

Members Datasets Scaffolds Average Seq Length
1188 282 2376 143

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10133410|Ga0099795_101334102
Length 164
Sequence MAIKVDGSDNGGGGYRIGGTLAEINIIPLVDVTLVLLLIFMLTAPLMYRGIDVNLPKTAGKPTATEELMVLTLSKEQTIYVNEKPVPLGSLEQTLRDLFKNRQDKTLYLRADQALQYGFVVETMDRIRRSGIEKLGMATDRPRARWAPRWRPAAIPWARSPTPV

Samples

Sample ID Description Type Environment
1 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
184 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
185 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
186 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
187 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
188 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
189 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
190 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
193 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
201 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
202 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
203 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
204 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
205 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
206 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
207 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
208 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
209 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
210 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
213 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
220 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
221 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
222 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.92
Metatranscriptomes 0.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.18
Rhizosphere 98.82
Stem 0
Stem Tuber 0
Unclassified 8.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099795_10133410 3300007788 Bacteria 1004
2 JGI25406J46586_10098226 3300003203 Unclassified 876
3 JGI26129J50193_1000543 3300003349 Bacteria 2386
4 Ga0058862_12661207 3300004803 Bacteria 954
5 Ga0065715_10114390 3300005293 Bacteria 2453
6 Ga0065707_10543122 3300005295 Bacteria 726
7 Ga0065707_10593414 3300005295 Bacteria 694
8 Ga0065707_10674513 3300005295 Unclassified 651
9 Ga0065707_10847112 3300005295 Bacteria 583
10 Ga0070676_10000095 3300005328 Bacteria 30952
11 Ga0070676_10311043 3300005328 Bacteria 1071
12 Ga0070676_10984965 3300005328 Bacteria 632
13 Ga0070690_100105606 3300005330 Bacteria 1872
14 Ga0070670_100006064 3300005331 Bacteria 10225
15 Ga0070670_100289903 3300005331 Bacteria 1430
16 Ga0070670_100869820 3300005331 Unclassified 816
17 Ga0070677_10406184 3300005333 Bacteria 719
18 Ga0068869_100006872 3300005334 Bacteria 7237
19 Ga0068869_100007400 3300005334 Bacteria 7013
20 Ga0070666_10064980 3300005335 Bacteria 2475
21 Ga0070680_100008209 3300005336 Bacteria 7981
22 Ga0070680_100010125 3300005336 Bacteria 7269
23 Ga0070680_100334672 3300005336 Bacteria 1286
24 Ga0070680_100357010 3300005336 Bacteria 1243
25 Ga0070682_100000272 3300005337 Bacteria 37290
26 Ga0070660_100006699 3300005339 Bacteria 7993
27 Ga0070660_100695797 3300005339 Bacteria 852
28 Ga0070689_100007039 3300005340 Bacteria 7832
29 Ga0070689_100198324 3300005340 Bacteria 1637
30 Ga0070691_10010392 3300005341 Bacteria 4245
31 Ga0070691_10019069 3300005341 Bacteria 3163
32 Ga0070691_10059673 3300005341 Unclassified 1833
33 Ga0070687_100002250 3300005343 Bacteria 7159
34 Ga0070661_100007569 3300005344 Bacteria 7493
35 Ga0070692_10000126 3300005345 Bacteria 17990
36 Ga0070692_10007349 3300005345 Bacteria 4849
37 Ga0070692_10196366 3300005345 Bacteria 1179
38 Ga0070692_10685175 3300005345 Bacteria 688
39 Ga0070692_10764564 3300005345 Bacteria 656
40 Ga0070668_100039686 3300005347 Bacteria 3600
41 Ga0070668_100995297 3300005347 Bacteria 753
42 Ga0070669_100046620 3300005353 Bacteria 3161
43 Ga0070669_100067140 3300005353 Unclassified 2645
44 Ga0070669_100085128 3300005353 Bacteria 2360
45 Ga0070669_100401644 3300005353 Bacteria 1121
46 Ga0070673_100262549 3300005364 Bacteria 1509
47 Ga0070673_100829267 3300005364 Bacteria 855
48 Ga0070659_100002725 3300005366 Bacteria 12569
49 Ga0070667_101383061 3300005367 Bacteria 660
50 Ga0070703_10043505 3300005406 Bacteria 1409
51 Ga0070703_10215050 3300005406 Bacteria 762
52 Ga0070701_10014758 3300005438 Bacteria 3589
53 Ga0070701_10120870 3300005438 Bacteria 1476
54 Ga0070701_10252398 3300005438 Bacteria 1066
55 Ga0070711_101070743 3300005439 Bacteria 694
56 Ga0070705_100000362 3300005440 Bacteria 26649
57 Ga0070705_100013626 3300005440 Bacteria 4163
58 Ga0070705_100024712 3300005440 Bacteria 3247
59 Ga0070705_100132172 3300005440 Bacteria 1630
60 Ga0070705_100295377 3300005440 Bacteria 1158
61 Ga0070705_100462509 3300005440 Bacteria 954
62 Ga0070700_100088139 3300005441 Bacteria 2019
63 Ga0070700_100095480 3300005441 Bacteria 1949
64 Ga0070700_100217355 3300005441 Bacteria 1352
65 Ga0070700_100368993 3300005441 Bacteria 1070
66 Ga0070694_100002589 3300005444 Bacteria 10693
67 Ga0070694_100009916 3300005444 Bacteria 5853
68 Ga0070694_100018359 3300005444 Bacteria 4439
69 Ga0070694_100018898 3300005444 Bacteria 4379
70 Ga0070694_100035848 3300005444 Bacteria 3282
71 Ga0070694_100061449 3300005444 Bacteria 2564
72 Ga0070694_100080571 3300005444 Bacteria 2263
73 Ga0070694_100553199 3300005444 Bacteria 922
74 Ga0070694_101618955 3300005444 Bacteria 550
75 Ga0070708_100003639 3300005445 Bacteria 12089
76 Ga0070708_100007382 3300005445 Bacteria 8796
77 Ga0070708_100008518 3300005445 Bacteria 8239
78 Ga0070708_100027118 3300005445 Bacteria 4912
79 Ga0070708_100033751 3300005445 Bacteria 4446
80 Ga0070708_100126224 3300005445 Bacteria 2365
81 Ga0070708_100184900 3300005445 Bacteria 1949
82 Ga0070708_100224209 3300005445 Bacteria 1763
83 Ga0070708_100277593 3300005445 Bacteria 1577
84 Ga0070708_100316757 3300005445 Bacteria 1469
85 Ga0070708_100433139 3300005445 Bacteria 1240
86 Ga0070708_100486978 3300005445 Bacteria 1163
87 Ga0070663_100061880 3300005455 Bacteria 2697
88 Ga0070663_100065034 3300005455 Bacteria 2638
89 Ga0070662_100003229 3300005457 Bacteria 10133
90 Ga0070662_100032491 3300005457 Bacteria 3668
91 Ga0070662_100432645 3300005457 Bacteria 1090
92 Ga0070662_100612747 3300005457 Bacteria 916
93 Ga0070662_100677586 3300005457 Bacteria 871
94 Ga0070681_10061586 3300005458 Bacteria 3726
95 Ga0070681_10227234 3300005458 Bacteria 1781
96 Ga0068867_100000551 3300005459 Bacteria 24726
97 Ga0068867_100002221 3300005459 Bacteria 13627
98 Ga0068867_100014494 3300005459 Bacteria 5587
99 Ga0068867_100261569 3300005459 Bacteria 1411
100 Ga0068867_100329459 3300005459 Bacteria 1268
101 Ga0070706_100000956 3300005467 Bacteria 31472
102 Ga0070706_100004277 3300005467 Bacteria 13847
103 Ga0070706_100006502 3300005467 Bacteria 11032
104 Ga0070706_100015246 3300005467 Bacteria 7095
105 Ga0070706_100017147 3300005467 Bacteria 6690
106 Ga0070706_100044078 3300005467 Bacteria 4121
107 Ga0070706_100211321 3300005467 Bacteria 1812
108 Ga0070706_100345850 3300005467 Bacteria 1386
109 Ga0070706_101344911 3300005467 Unclassified 654
110 Ga0070707_100001156 3300005468 Bacteria 25930
111 Ga0070707_100009743 3300005468 Bacteria 8930
112 Ga0070707_100014710 3300005468 Bacteria 7335
113 Ga0070707_100031860 3300005468 Bacteria 5023
114 Ga0070707_100036434 3300005468 Bacteria 4694
115 Ga0070707_100051412 3300005468 Bacteria 3951
116 Ga0070707_100086297 3300005468 Bacteria 3035
117 Ga0070707_100141801 3300005468 Bacteria 2339
118 Ga0070707_100185609 3300005468 Bacteria 2028
119 Ga0070707_100288876 3300005468 Bacteria 1593
120 Ga0070707_100414311 3300005468 Bacteria 1308
121 Ga0070707_100551902 3300005468 Bacteria 1114
122 Ga0070707_101140441 3300005468 Unclassified 746
123 Ga0070698_100008263 3300005471 Bacteria 11252
124 Ga0070698_100009214 3300005471 Bacteria 10594
125 Ga0070698_100013151 3300005471 Bacteria 8758
126 Ga0070698_100097477 3300005471 Bacteria 2916
127 Ga0070698_100119467 3300005471 Bacteria 2596
128 Ga0070698_100348429 3300005471 Bacteria 1412
129 Ga0070698_100401719 3300005471 Bacteria 1303
130 Ga0070698_100666809 3300005471 Unclassified 981
131 Ga0070698_100752469 3300005471 Bacteria 917
132 Ga0070698_101566493 3300005471 Bacteria 611
133 Ga0070699_100003221 3300005518 Bacteria 14430
134 Ga0070699_100004981 3300005518 Bacteria 11713
135 Ga0070699_100005612 3300005518 Bacteria 11005
136 Ga0070699_100016841 3300005518 Bacteria 6274
137 Ga0070699_100019863 3300005518 Bacteria 5792
138 Ga0070699_100055561 3300005518 Unclassified 3428
139 Ga0070699_100069333 3300005518 Bacteria 3064
140 Ga0070699_100275022 3300005518 Bacteria 1508
141 Ga0070699_100473367 3300005518 Bacteria 1136
142 Ga0070699_100961635 3300005518 Bacteria 783
143 Ga0070699_101000463 3300005518 Bacteria 767
144 Ga0070679_100001576 3300005530 Bacteria 20436
145 Ga0070679_100075648 3300005530 Bacteria 3357
146 Ga0070684_100026910 3300005535 Bacteria 4849
147 Ga0070697_100010402 3300005536 Bacteria 7261
148 Ga0070697_100010930 3300005536 Bacteria 7091
149 Ga0070697_100021580 3300005536 Bacteria 5103
150 Ga0070697_100026268 3300005536 Bacteria 4650
151 Ga0070697_100062981 3300005536 Bacteria 3028
152 Ga0070697_100232194 3300005536 Bacteria 1574
153 Ga0070697_100240312 3300005536 Bacteria 1546
154 Ga0070697_100245732 3300005536 Bacteria 1529
155 Ga0070697_100261947 3300005536 Bacteria 1480
156 Ga0070697_100343989 3300005536 Bacteria 1287
157 Ga0070697_100361071 3300005536 Bacteria 1256
158 Ga0070697_100434056 3300005536 Bacteria 1142
159 Ga0070697_100603315 3300005536 Unclassified 965
160 Ga0070697_100749971 3300005536 Unclassified 863
161 Ga0068853_100152224 3300005539 Bacteria 2082
162 Ga0068853_100767678 3300005539 Bacteria 922
163 Ga0068853_101544874 3300005539 Bacteria 643
164 Ga0070672_100004942 3300005543 Bacteria 8778
165 Ga0070672_100035162 3300005543 Bacteria 3807
166 Ga0070686_100064856 3300005544 Bacteria 2371
167 Ga0070686_101223724 3300005544 Bacteria 624
168 Ga0070695_100000614 3300005545 Bacteria 18910
169 Ga0070695_100003609 3300005545 Bacteria 9030
170 Ga0070695_100021573 3300005545 Bacteria 3944
171 Ga0070695_100272091 3300005545 Bacteria 1241
172 Ga0070695_100862712 3300005545 Bacteria 729
173 Ga0070696_100006655 3300005546 Bacteria 7719
174 Ga0070696_100024337 3300005546 Bacteria 4115
175 Ga0070696_100035533 3300005546 Bacteria 3432
176 Ga0070696_100138182 3300005546 Bacteria 1778
177 Ga0070696_100251783 3300005546 Bacteria 1336
178 Ga0070696_100709615 3300005546 Bacteria 821
179 Ga0070696_101069271 3300005546 Bacteria 677
180 Ga0070693_100001010 3300005547 Bacteria 12548
181 Ga0070704_100000183 3300005549 Bacteria 25397
182 Ga0070704_100020619 3300005549 Bacteria 4255
183 Ga0070704_100034763 3300005549 Bacteria 3421
184 Ga0070704_100043177 3300005549 Bacteria 3124
185 Ga0070704_100061775 3300005549 Bacteria 2683
186 Ga0070704_100077669 3300005549 Bacteria 2433
187 Ga0070704_100092028 3300005549 Bacteria 2263
188 Ga0070704_100117110 3300005549 Bacteria 2038
189 Ga0070704_100167786 3300005549 Bacteria 1742
190 Ga0070704_100478635 3300005549 Bacteria 1077
191 Ga0070704_100548529 3300005549 Unclassified 1010
192 Ga0070704_100774474 3300005549 Bacteria 856
193 Ga0070704_100816316 3300005549 Bacteria 834
194 Ga0068857_100015454 3300005577 Bacteria 6668
195 Ga0068857_100048994 3300005577 Bacteria 3748
196 Ga0068857_100242789 3300005577 Bacteria 1649
197 Ga0068854_100883176 3300005578 Bacteria 785
198 Ga0068856_100001317 3300005614 Bacteria 26156
199 Ga0070702_100004128 3300005615 Bacteria 6596
200 Ga0070702_100022700 3300005615 Bacteria 3323
201 Ga0068852_100317140 3300005616 Bacteria 1513
202 Ga0068859_100010873 3300005617 Bacteria 9159
203 Ga0068859_100191962 3300005617 Bacteria 2127
204 Ga0068859_100230803 3300005617 Bacteria 1939
205 Ga0068859_100246468 3300005617 Bacteria 1876
206 Ga0068859_100413327 3300005617 Bacteria 1445
207 Ga0068859_100988589 3300005617 Unclassified 924
208 Ga0068859_101303049 3300005617 Bacteria 800
209 Ga0068864_100007764 3300005618 Bacteria 8840
210 Ga0068866_10172730 3300005718 Bacteria 1270
211 Ga0068866_10264831 3300005718 Bacteria 1058
212 Ga0068866_10320609 3300005718 Archaea 975
213 Ga0068861_100062468 3300005719 Bacteria 2861
214 Ga0068861_100519040 3300005719 Bacteria 1080
215 Ga0068861_100703482 3300005719 Unclassified 939
216 Ga0068861_101412171 3300005719 Bacteria 680
217 Ga0068870_10000253 3300005840 Bacteria 19768
218 Ga0068870_10056873 3300005840 Bacteria 2089
219 Ga0068870_10081275 3300005840 Bacteria 1792
220 Ga0068863_100008693 3300005841 Bacteria 9919
221 Ga0068863_100147099 3300005841 Bacteria 2254
222 Ga0068863_100805748 3300005841 Unclassified 937
223 Ga0068858_100412010 3300005842 Bacteria 1299
224 Ga0068860_100006954 3300005843 Bacteria 11339
225 Ga0068860_100215129 3300005843 Bacteria 1865
226 Ga0068860_100328393 3300005843 Bacteria 1502
227 Ga0068860_100383151 3300005843 Bacteria 1388
228 Ga0068862_100001020 3300005844 Bacteria 26931
229 Ga0068862_100033965 3300005844 Bacteria 4315
230 Ga0068862_100083015 3300005844 Bacteria 2782
231 Ga0068862_100203102 3300005844 Bacteria 1788
232 Ga0081455_10001737 3300005937 Bacteria 26336
233 Ga0081455_10397281 3300005937 Bacteria 958
234 Ga0081538_10042691 3300005981 Bacteria 2858
235 Ga0081540_1062515 3300005983 Bacteria 1767
236 Ga0081539_10000141 3300005985 Bacteria 166050
237 Ga0075432_10280965 3300006058 Bacteria 685
238 Ga0070715_10372346 3300006163 Unclassified 786
239 Ga0070715_10781766 3300006163 Bacteria 578
240 Ga0070716_100184526 3300006173 Bacteria 1373
241 Ga0070716_100549577 3300006173 Unclassified 861
242 Ga0097621_101242842 3300006237 Unclassified 702
243 Ga0068871_101397098 3300006358 Bacteria 660
244 Ga0075428_100004712 3300006844 Bacteria 15090
245 Ga0075428_100007368 3300006844 Bacteria 12197
246 Ga0075428_100045014 3300006844 Bacteria 4849
247 Ga0075428_100079455 3300006844 Bacteria 3580
248 Ga0075428_100133933 3300006844 Bacteria 2695
249 Ga0075428_100378988 3300006844 Bacteria 1517
250 Ga0075428_100394492 3300006844 Bacteria 1483
251 Ga0075428_100495044 3300006844 Bacteria 1308
252 Ga0075428_100695756 3300006844 Bacteria 1083
253 Ga0075428_101412226 3300006844 Bacteria 730
254 Ga0075428_101421049 3300006844 Unclassified 728
255 Ga0075428_102710772 3300006844 Bacteria 505
256 Ga0075430_100000005 3300006846 Bacteria 108528
257 Ga0075430_100000114 3300006846 Bacteria 48642
258 Ga0075430_100004339 3300006846 Bacteria 11980
259 Ga0075430_100037725 3300006846 Bacteria 4096
260 Ga0075430_100228107 3300006846 Bacteria 1544
261 Ga0075430_100245411 3300006846 Bacteria 1484
262 Ga0075430_100395075 3300006846 Unclassified 1141
263 Ga0075430_100536526 3300006846 Bacteria 965
264 Ga0075431_100000087 3300006847 Bacteria 56140
265 Ga0075431_100000188 3300006847 Bacteria 44797
266 Ga0075431_100001543 3300006847 Bacteria 21351
267 Ga0075431_100001745 3300006847 Bacteria 20457
268 Ga0075431_100004641 3300006847 Bacteria 13490
269 Ga0075431_100004760 3300006847 Bacteria 13347
270 Ga0075431_100005035 3300006847 Bacteria 13001
271 Ga0075431_100010317 3300006847 Bacteria 9386
272 Ga0075431_100018328 3300006847 Bacteria 7127
273 Ga0075431_100019316 3300006847 Bacteria 6946
274 Ga0075431_100020403 3300006847 Bacteria 6771
275 Ga0075431_100037040 3300006847 Bacteria 5026
276 Ga0075431_100096322 3300006847 Bacteria 3055
277 Ga0075431_100532801 3300006847 Bacteria 1163
278 Ga0075431_100570070 3300006847 Bacteria 1118
279 Ga0075431_100570343 3300006847 Bacteria 1118
280 Ga0075431_100655798 3300006847 Bacteria 1030
281 Ga0075431_100778359 3300006847 Bacteria 931
282 Ga0075431_100778827 3300006847 Bacteria 931
283 Ga0075433_10001653 3300006852 Bacteria 16577
284 Ga0075433_10003060 3300006852 Bacteria 12853
285 Ga0075433_10004130 3300006852 Bacteria 11261
286 Ga0075433_10004555 3300006852 Bacteria 10813
287 Ga0075433_10005753 3300006852 Bacteria 9755
288 Ga0075433_10008803 3300006852 Bacteria 8055
289 Ga0075433_10010998 3300006852 Bacteria 7276
290 Ga0075433_10016226 3300006852 Bacteria 6127
291 Ga0075433_10017801 3300006852 Bacteria 5894
292 Ga0075433_10026561 3300006852 Bacteria 4903
293 Ga0075433_10178247 3300006852 Bacteria 1891
294 Ga0075433_10198956 3300006852 Bacteria 1782
295 Ga0075433_10331457 3300006852 Bacteria 1346
296 Ga0075433_10830874 3300006852 Bacteria 807
297 Ga0075433_11332274 3300006852 Bacteria 622
298 Ga0075433_11430582 3300006852 Bacteria 598
299 Ga0075434_100001968 3300006871 Bacteria 17819
300 Ga0075434_100015999 3300006871 Bacteria 7208
301 Ga0075434_100016066 3300006871 Bacteria 7192
302 Ga0075434_100023888 3300006871 Bacteria 5966
303 Ga0075434_100040245 3300006871 Bacteria 4629
304 Ga0075434_100068403 3300006871 Bacteria 3538
305 Ga0075434_100068557 3300006871 Bacteria 3534
306 Ga0075434_100104986 3300006871 Bacteria 2835
307 Ga0075434_100315316 3300006871 Bacteria 1584
308 Ga0075434_100354650 3300006871 Unclassified 1488
309 Ga0075434_100373368 3300006871 Bacteria 1447
310 Ga0075434_100564454 3300006871 Bacteria 1158
311 Ga0075434_100620570 3300006871 Bacteria 1100
312 Ga0075434_100964815 3300006871 Bacteria 867
313 Ga0075434_101875498 3300006871 Bacteria 606
314 Ga0075434_102325250 3300006871 Unclassified 539
315 Ga0075429_100000077 3300006880 Bacteria 49812
316 Ga0075429_100001009 3300006880 Bacteria 22420
317 Ga0075429_100003071 3300006880 Bacteria 14154
318 Ga0075429_100003339 3300006880 Bacteria 13676
319 Ga0075429_100005435 3300006880 Bacteria 10973
320 Ga0075429_100005812 3300006880 Bacteria 10643
321 Ga0075429_100008673 3300006880 Bacteria 8844
322 Ga0075429_100010209 3300006880 Bacteria 8131
323 Ga0075429_100123317 3300006880 Bacteria 2265
324 Ga0075429_100397435 3300006880 Bacteria 1207
325 Ga0075429_100469107 3300006880 Bacteria 1103
326 Ga0075429_100936665 3300006880 Bacteria 758
327 Ga0075429_101402407 3300006880 Unclassified 608
328 Ga0075429_101431688 3300006880 Bacteria 602
329 Ga0068865_100071154 3300006881 Bacteria 2466
330 Ga0068865_100228276 3300006881 Bacteria 1459
331 Ga0068865_100411959 3300006881 Bacteria 1109
332 Ga0075436_100015971 3300006914 Bacteria 5140
333 Ga0075436_100048050 3300006914 Bacteria 2945
334 Ga0075436_100070481 3300006914 Bacteria 2417
335 Ga0075436_100164944 3300006914 Bacteria 1563
336 Ga0075436_100409261 3300006914 Bacteria 984
337 Ga0075436_100554986 3300006914 Bacteria 843
338 Ga0075436_100812397 3300006914 Bacteria 697
339 Ga0075436_101022440 3300006914 Bacteria 621
340 Ga0097620_100010873 3300006931 Bacteria 9159
341 Ga0097620_100191956 3300006931 Bacteria 2127
342 Ga0097620_100230809 3300006931 Bacteria 1939
343 Ga0097620_100246461 3300006931 Bacteria 1876
344 Ga0097620_100413325 3300006931 Bacteria 1445
345 Ga0097620_100988495 3300006931 Unclassified 924
346 Ga0097620_101303058 3300006931 Bacteria 800
347 Ga0075435_100005814 3300007076 Bacteria 8669
348 Ga0075435_100015819 3300007076 Bacteria 5678
349 Ga0075435_100057602 3300007076 Bacteria 3144
350 Ga0075435_100090329 3300007076 Bacteria 2526
351 Ga0075435_100256080 3300007076 Bacteria 1490
352 Ga0075435_100275282 3300007076 Bacteria 1436
353 Ga0075435_100334388 3300007076 Bacteria 1297
354 Ga0099794_10003981 3300007265 Bacteria 5737
355 Ga0099794_10038355 3300007265 Bacteria 2270
356 Ga0099794_10052078 3300007265 Bacteria 1973
357 Ga0099794_10545138 3300007265 Unclassified 612
358 Ga0099794_10601302 3300007265 Bacteria 582
359 Ga0099794_10610442 3300007265 Unclassified 578
360 Ga0099794_10685906 3300007265 Bacteria 545
361 Ga0105240_10630869 3300009093 Bacteria 1177
362 Ga0111539_10000182 3300009094 Bacteria 73143
363 Ga0111539_10000225 3300009094 Bacteria 67615
364 Ga0111539_10009233 3300009094 Bacteria 12463
365 Ga0111539_10025822 3300009094 Bacteria 7194
366 Ga0111539_10032194 3300009094 Bacteria 6370
367 Ga0111539_10295467 3300009094 Bacteria 1885
368 Ga0111539_10777329 3300009094 Bacteria 1114
369 Ga0111539_11013545 3300009094 Bacteria 965
370 Ga0111539_11075436 3300009094 Bacteria 935
371 Ga0105245_11739903 3300009098 Unclassified 676
372 Ga0105247_10033607 3300009101 Bacteria 3120
373 Ga0114129_10000129 3300009147 Bacteria 77208
374 Ga0114129_10000144 3300009147 Bacteria 75111
375 Ga0114129_10000167 3300009147 Bacteria 71610
376 Ga0114129_10006909 3300009147 Bacteria 16146
377 Ga0114129_10007616 3300009147 Bacteria 15406
378 Ga0114129_10012980 3300009147 Bacteria 11860
379 Ga0114129_10013686 3300009147 Bacteria 11559
380 Ga0114129_10014506 3300009147 Bacteria 11231
381 Ga0114129_10016073 3300009147 Bacteria 10646
382 Ga0114129_10022488 3300009147 Bacteria 8948
383 Ga0114129_10042140 3300009147 Bacteria 6428
384 Ga0114129_10045803 3300009147 Bacteria 6147
385 Ga0114129_10063138 3300009147 Bacteria 5173
386 Ga0114129_10102908 3300009147 Bacteria 3949
387 Ga0114129_10180984 3300009147 Bacteria 2868
388 Ga0114129_10225091 3300009147 Bacteria 2529
389 Ga0114129_10291437 3300009147 Bacteria 2178
390 Ga0114129_10560898 3300009147 Bacteria 1484
391 Ga0114129_10702793 3300009147 Bacteria 1299
392 Ga0114129_10815945 3300009147 Bacteria 1189
393 Ga0114129_11100425 3300009147 Bacteria 995
394 Ga0114129_11273325 3300009147 Unclassified 912
395 Ga0114129_11555920 3300009147 Bacteria 811
396 Ga0114129_12409227 3300009147 Unclassified 630
397 Ga0114129_12411540 3300009147 Bacteria 630
398 Ga0105243_10214374 3300009148 Archaea 1697
399 Ga0105243_10786240 3300009148 Bacteria 936
400 Ga0105243_11337339 3300009148 Bacteria 735
401 Ga0105243_12910381 3300009148 Unclassified 519
402 Ga0105241_10000598 3300009174 Bacteria 27156
403 Ga0105241_10196421 3300009174 Archaea 1682
404 Ga0105241_10933455 3300009174 Bacteria 808
405 Ga0105242_10777765 3300009176 Bacteria 945
406 Ga0105242_11301538 3300009176 Bacteria 750
407 Ga0105248_10137178 3300009177 Bacteria 2760
408 Ga0105248_10376353 3300009177 Bacteria 1598
409 Ga0105248_10714166 3300009177 Unclassified 1131
410 Ga0105237_10313284 3300009545 Bacteria 1572
411 Ga0105249_10021142 3300009553 Bacteria 5825
412 Ga0105249_10026052 3300009553 Bacteria 5266
413 Ga0105249_10091502 3300009553 Bacteria 2846
414 Ga0105249_10259307 3300009553 Bacteria 1727
415 Ga0105249_10334604 3300009553 Bacteria 1529
416 Ga0105249_10515045 3300009553 Unclassified 1243
417 Ga0105249_11399104 3300009553 Bacteria 771
418 Ga0105249_11788699 3300009553 Unclassified 687
419 Ga0105246_10006924 3300011119 Bacteria 6937
420 Ga0105246_12105108 3300011119 Unclassified 547
421 Ga0157373_10000102 3300013100 Bacteria 67573
422 Ga0157371_10042585 3300013102 Bacteria 3236
423 Ga0157371_10121451 3300013102 Bacteria 1858
424 Ga0157369_10110417 3300013105 Bacteria 2924
425 Ga0157378_10370883 3300013297 Bacteria 1403
426 Ga0157378_10579549 3300013297 Bacteria 1131
427 Ga0157378_10669171 3300013297 Bacteria 1055
428 Ga0157378_11072916 3300013297 Bacteria 842
429 Ga0157378_12536058 3300013297 Unclassified 565
430 Ga0163162_10077285 3300013306 Bacteria 3392
431 Ga0163162_10474042 3300013306 Bacteria 1383
432 Ga0163162_11211310 3300013306 Bacteria 857
433 Ga0157372_10003901 3300013307 Bacteria 16029
434 Ga0157372_10211838 3300013307 Bacteria 2246
435 Ga0157375_10113794 3300013308 Bacteria 2807
436 Ga0157375_11755925 3300013308 Bacteria 735
437 Ga0157375_12206798 3300013308 Bacteria 656
438 Ga0163163_10076599 3300014325 Bacteria 3340
439 Ga0157380_10116240 3300014326 Bacteria 2257
440 Ga0157380_10279991 3300014326 Bacteria 1525
441 Ga0157380_10355513 3300014326 Bacteria 1372
442 Ga0157380_11149443 3300014326 Bacteria 818
443 Ga0182008_10147907 3300014497 Bacteria 1178
444 Ga0157379_10246015 3300014968 Bacteria 1623
445 Ga0182007_10069352 3300015262 Bacteria 1155
446 Ga0163161_10053356 3300017792 Bacteria 2932
447 Ga0207653_10002488 3300025885 Bacteria 5852
448 Ga0207653_10010894 3300025885 Bacteria 2837
449 Ga0207653_10171295 3300025885 Bacteria 808
450 Ga0207642_10025150 3300025899 Bacteria 2404
451 Ga0207642_10091300 3300025899 Bacteria 1505
452 Ga0207688_10033223 3300025901 Bacteria 2853
453 Ga0207647_10541816 3300025904 Bacteria 646
454 Ga0207685_10027870 3300025905 Bacteria 1982
455 Ga0207645_10000033 3300025907 Bacteria 91108
456 Ga0207645_10125172 3300025907 Bacteria 1670
457 Ga0207643_10000057 3300025908 Bacteria 73664
458 Ga0207643_10023330 3300025908 Bacteria 3410
459 Ga0207643_10233245 3300025908 Bacteria 1129
460 Ga0207684_10000290 3300025910 Bacteria 72057
461 Ga0207684_10001361 3300025910 Bacteria 26726
462 Ga0207684_10004663 3300025910 Bacteria 12873
463 Ga0207684_10005034 3300025910 Bacteria 12315
464 Ga0207684_10009704 3300025910 Bacteria 8487
465 Ga0207684_10012824 3300025910 Bacteria 7262
466 Ga0207684_10024710 3300025910 Bacteria 5123
467 Ga0207684_10026439 3300025910 Bacteria 4947
468 Ga0207684_10043571 3300025910 Bacteria 3805
469 Ga0207684_10119760 3300025910 Bacteria 2256
470 Ga0207684_10231156 3300025910 Bacteria 1596
471 Ga0207684_10405729 3300025910 Bacteria 1171
472 Ga0207684_10513086 3300025910 Unclassified 1027
473 Ga0207684_10824453 3300025910 Bacteria 783
474 Ga0207654_10224013 3300025911 Bacteria 1249
475 Ga0207654_10381196 3300025911 Unclassified 977
476 Ga0207707_10000162 3300025912 Bacteria 70164
477 Ga0207707_10191025 3300025912 Bacteria 1787
478 Ga0207695_10977398 3300025913 Unclassified 726
479 Ga0207660_10000298 3300025917 Bacteria 32759
480 Ga0207660_10065639 3300025917 Bacteria 2623
481 Ga0207660_10088120 3300025917 Bacteria 2294
482 Ga0207660_10116643 3300025917 Bacteria 2017
483 Ga0207660_10308101 3300025917 Bacteria 1262
484 Ga0207662_10116143 3300025918 Bacteria 1673
485 Ga0207662_10141243 3300025918 Bacteria 1525
486 Ga0207662_10263103 3300025918 Bacteria 1136
487 Ga0207657_10001228 3300025919 Bacteria 27358
488 Ga0207649_10000499 3300025920 Bacteria 27833
489 Ga0207652_10004938 3300025921 Bacteria 10795
490 Ga0207652_10230311 3300025921 Bacteria 1670
491 Ga0207646_10000203 3300025922 Bacteria 80626
492 Ga0207646_10003319 3300025922 Bacteria 18306
493 Ga0207646_10003381 3300025922 Bacteria 18048
494 Ga0207646_10009320 3300025922 Bacteria 9709
495 Ga0207646_10029566 3300025922 Bacteria 4977
496 Ga0207646_10033438 3300025922 Bacteria 4652
497 Ga0207646_10105688 3300025922 Bacteria 2525
498 Ga0207646_10217941 3300025922 Bacteria 1724
499 Ga0207646_10417598 3300025922 Bacteria 1211
500 Ga0207646_10478109 3300025922 Bacteria 1123
501 Ga0207646_10494493 3300025922 Unclassified 1102
502 Ga0207646_10544901 3300025922 Archaea 1043
503 Ga0207646_11092354 3300025922 Unclassified 702
504 Ga0207681_10032553 3300025923 Bacteria 3414
505 Ga0207681_10044320 3300025923 Bacteria 2981
506 Ga0207681_10326999 3300025923 Bacteria 1221
507 Ga0207681_10376852 3300025923 Bacteria 1141
508 Ga0207681_10436439 3300025923 Archaea 1063
509 Ga0207659_10919623 3300025926 Unclassified 752
510 Ga0207690_10005502 3300025932 Bacteria 7473
511 Ga0207706_10008636 3300025933 Bacteria 9387
512 Ga0207706_10037704 3300025933 Bacteria 4291
513 Ga0207706_10050972 3300025933 Bacteria 3656
514 Ga0207706_10375331 3300025933 Bacteria 1234
515 Ga0207709_10061255 3300025935 Bacteria 2351
516 Ga0207709_10835875 3300025935 Unclassified 745
517 Ga0207709_11596647 3300025935 Bacteria 542
518 Ga0207670_10041398 3300025936 Bacteria 3030
519 Ga0207670_10117535 3300025936 Bacteria 1927
520 Ga0207670_10292613 3300025936 Bacteria 1273
521 Ga0207669_10541728 3300025937 Bacteria 938
522 Ga0207704_10259815 3300025938 Bacteria 1309
523 Ga0207704_10880327 3300025938 Unclassified 752
524 Ga0207665_10004078 3300025939 Bacteria 9758
525 Ga0207665_10595800 3300025939 Unclassified 863
526 Ga0207691_10019489 3300025940 Bacteria 6418
527 Ga0207691_10049387 3300025940 Bacteria 3855
528 Ga0207689_10000435 3300025942 Bacteria 39174
529 Ga0207689_10012462 3300025942 Bacteria 7263
530 Ga0207689_10137430 3300025942 Bacteria 2013
531 Ga0207689_10679114 3300025942 Bacteria 868
532 Ga0207679_10000443 3300025945 Bacteria 29182
533 Ga0207667_10003858 3300025949 Bacteria 18442
534 Ga0207651_10079942 3300025960 Bacteria 2351
535 Ga0207712_10038058 3300025961 Bacteria 3287
536 Ga0207712_10162901 3300025961 Bacteria 1735
537 Ga0207712_10203303 3300025961 Bacteria 1572
538 Ga0207712_10319554 3300025961 Bacteria 1280
539 Ga0207712_10486411 3300025961 Bacteria 1053
540 Ga0207712_10831291 3300025961 Bacteria 813
541 Ga0207712_11306868 3300025961 Unclassified 648
542 Ga0207712_11596592 3300025961 Bacteria 585
543 Ga0207668_10026443 3300025972 Bacteria 3768
544 Ga0207668_10332273 3300025972 Unclassified 1265
545 Ga0207640_10077459 3300025981 Unclassified 2260
546 Ga0207658_10382634 3300025986 Bacteria 1233
547 Ga0207703_10068471 3300026035 Bacteria 2925
548 Ga0207703_10613577 3300026035 Bacteria 1030
549 Ga0207639_10043475 3300026041 Bacteria 3373
550 Ga0207678_10081025 3300026067 Bacteria 2778
551 Ga0207708_10172346 3300026075 Bacteria 1714
552 Ga0207708_10206003 3300026075 Bacteria 1571
553 Ga0207708_10246764 3300026075 Bacteria 1437
554 Ga0207702_10013307 3300026078 Bacteria 6843
555 Ga0207641_10057363 3300026088 Bacteria 3311
556 Ga0207641_10139457 3300026088 Bacteria 2186
557 Ga0207641_10662322 3300026088 Bacteria 1026
558 Ga0207648_10005256 3300026089 Bacteria 13078
559 Ga0207648_10057823 3300026089 Bacteria 3383
560 Ga0207648_10216457 3300026089 Bacteria 1701
561 Ga0207648_10223011 3300026089 Bacteria 1676
562 Ga0207676_10801287 3300026095 Bacteria 919
563 Ga0207676_11031072 3300026095 Unclassified 811
564 Ga0207674_10001197 3300026116 Bacteria 33773
565 Ga0207674_10005197 3300026116 Bacteria 15495
566 Ga0207674_10059079 3300026116 Bacteria 3882
567 Ga0207675_100017304 3300026118 Bacteria 6730
568 Ga0207675_100179859 3300026118 Bacteria 2025
569 Ga0207675_100258726 3300026118 Bacteria 1686
570 Ga0207675_100362446 3300026118 Bacteria 1422
571 Ga0207675_100383036 3300026118 Bacteria 1383
572 Ga0207675_100472192 3300026118 Bacteria 1245
573 Ga0207683_10618688 3300026121 Unclassified 1003
574 Ga0207698_10117601 3300026142 Bacteria 2243
575 Ga0209969_1001678 3300027360 Bacteria 3057
576 Ga0209967_1020494 3300027364 Bacteria 963
577 Ga0209996_1017505 3300027395 Bacteria 990
578 Ga0209984_1001219 3300027424 Bacteria 2768
579 Ga0210000_1009151 3300027462 Bacteria 1456
580 Ga0209995_1006121 3300027471 Bacteria 1934
581 Ga0209999_1012096 3300027543 Bacteria 1561
582 Ga0209982_1019829 3300027552 Bacteria 1031
583 Ga0209983_1001259 3300027665 Bacteria 5631
584 Ga0209588_1007666 3300027671 Bacteria 3183
585 Ga0209588_1014679 3300027671 Bacteria 2401
586 Ga0209588_1115404 3300027671 Bacteria 861
587 Ga0209971_1000006 3300027682 Bacteria 107602
588 Ga0209971_1012860 3300027682 Bacteria 1983
589 Ga0209971_1056035 3300027682 Bacteria 953
590 Ga0209966_1000018 3300027695 Bacteria 71100
591 Ga0209966_1004738 3300027695 Bacteria 2317
592 Ga0209966_1053518 3300027695 Unclassified 862
593 Ga0209998_10000167 3300027717 Bacteria 24382
594 Ga0209974_10009694 3300027876 Bacteria 3267
595 Ga0209974_10188511 3300027876 Bacteria 758
596 Ga0209974_10260454 3300027876 Bacteria 655
597 Ga0209974_10361877 3300027876 Bacteria 564
598 Ga0207428_10000035 3300027907 Bacteria 229100
599 Ga0207428_10000514 3300027907 Bacteria 46308
600 Ga0207428_10017267 3300027907 Bacteria 6196
601 Ga0207428_10046714 3300027907 Bacteria 3481
602 Ga0207428_10283835 3300027907 Bacteria 1228
603 Ga0207428_10339063 3300027907 Bacteria 1107
604 Ga0207428_10425267 3300027907 Bacteria 970
605 Ga0268265_10026939 3300028380 Bacteria 4095
606 Ga0268265_10031925 3300028380 Bacteria 3809
607 Ga0268265_10076514 3300028380 Bacteria 2625
608 Ga0268265_10299916 3300028380 Bacteria 1446
609 Ga0268265_10336709 3300028380 Bacteria 1372
610 Ga0268265_10932392 3300028380 Bacteria 854
611 Ga0268264_10026913 3300028381 Bacteria 4698
612 Ga0268264_10088955 3300028381 Bacteria 2658
613 Ga0268264_10422474 3300028381 Unclassified 1286
614 Ga0268264_11013269 3300028381 Unclassified 837
615 Ga0307408_100237858 3300031548 Bacteria 1495
616 Ga0307408_100567843 3300031548 Bacteria 1003
617 Ga0307405_10483709 3300031731 Bacteria 989
618 Ga0307405_10890467 3300031731 Unclassified 752
619 Ga0307413_11702695 3300031824 Bacteria 562
620 Ga0307410_10800635 3300031852 Unclassified 801
621 Ga0307406_10276006 3300031901 Bacteria 1279
622 Ga0307407_10227242 3300031903 Bacteria 1265
623 Ga0307409_100067265 3300031995 Bacteria 2829
624 Ga0307416_102653670 3300032002 Unclassified 598
625 Ga0307411_10250047 3300032005 Bacteria 1393
626 Ga0307411_11640711 3300032005 Bacteria 594
627 Ga0373948_0006067 3300034817 Bacteria 1983
628 Ga0373948_0045541 3300034817 Bacteria 930
629 Ga0373938_0124257 3300034957 Unclassified 668
630 Ga0373940_0000111 3300035088 Bacteria 10041
631 Ga0373940_0022337 3300035088 Bacteria 1625
632 Ga0373940_0136694 3300035088 Unclassified 772
633 Ga0373940_0264407 3300035088 Unclassified 583
634 Ga0373949_0014750 3300035090 Bacteria 1742
635 Ga0373949_0018929 3300035090 Bacteria 1564
636 Ga0373951_0011123 3300035091 Bacteria 2019
637 Ga0373952_0023309 3300035092 Bacteria 1322
638 Ga0373952_0117783 3300035092 Bacteria 717
639 Ga0373932_0060102 3300035112 Bacteria 1152
640 Ga0373939_0009711 3300035114 Bacteria 2391
641 Ga0373939_0098277 3300035114 Bacteria 1000
642 Ga0373939_0107177 3300035114 Unclassified 968
643 Ga0373939_0116307 3300035114 Bacteria 938
644 Ga0373960_0003605 3300035121 Bacteria 3508
645 Ga0373961_0017220 3300035241 Bacteria 1871
646 Ga0373961_0309072 3300035241 Unclassified 587
647 Ga0373962_0013791 3300035242 Bacteria 2052
648 Ga0373962_0015385 3300035242 Bacteria 1961
649 Ga0373962_0138305 3300035242 Bacteria 789
650 Ga0373962_0165693 3300035242 Bacteria 731
651 Ga0373931_0004693 3300035691 Bacteria 6257
652 Ga0373931_0036085 3300035691 Bacteria 2575
653 Ga0373931_0051948 3300035691 Bacteria 2184
654 Ga0395899_0238227 3300037312 Bacteria 1253
655 Ga0395900_0003223 3300037418 Bacteria 17666
656 Ga0395900_0465718 3300037418 Bacteria 1218
657 Ga0395898_0126990 3300037466 Bacteria 2443
658 Ga0395898_0585738 3300037466 Bacteria 1058
659 Ga0395905_0108938 3300037471 Bacteria 2600
660 Ga0395901_0000392 3300038443 Bacteria 52263
661 Ga0395901_0156029 3300038443 Bacteria 2397
662 Ga0439453_0147997 3300041408 Unclassified 556
663 Ga0439443_060293 3300042003 Bacteria 678
664 Ga0439450_011420 3300042008 Bacteria 1740
665 Ga0439455_0106315 3300042012 Bacteria 778
666 Ga0450892_009818 3300042130 Bacteria 832
667 Ga0439458_0127643 3300042157 Unclassified 672
668 Ga0439435_0034781 3300042436 Bacteria 1387
669 Ga0439444_0026231 3300042437 Bacteria 1065
670 Ga0439444_0029852 3300042437 Bacteria 1018
671 Ga0439459_0002093 3300042438 Bacteria 3047
672 Ga0439464_0030079 3300042439 Bacteria 1519
673 Ga0439460_0000554 3300042461 Bacteria 8180
674 Ga0439460_0027976 3300042461 Bacteria 1587
675 Ga0439460_0175090 3300042461 Unclassified 724
676 Ga0439460_0233059 3300042461 Bacteria 633
677 Ga0451577_0008746 3300042876 Bacteria 9817
678 Ga0451577_0026637 3300042876 Bacteria 5236
679 Ga0451577_0127344 3300042876 Bacteria 2282
680 Ga0451577_0221700 3300042876 Bacteria 1709
681 Ga0451577_1594467 3300042876 Unclassified 576
682 Ga0439440_0150091 3300042993 Bacteria 667
683 Ga0439440_0254175 3300042993 Bacteria 536
684 Ga0453683_0006040 3300044673 Bacteria 8346
685 Ga0453683_0052540 3300044673 Bacteria 2552
686 Ga0453683_0117917 3300044673 Bacteria 1670
687 Ga0453684_0047403 3300044712 Bacteria 5700
688 Ga0453684_0287062 3300044712 Bacteria 1875
689 Ga0453684_0442098 3300044712 Bacteria 1449
690 Ga0453684_0640305 3300044712 Bacteria 1161
691 Ga0451576_0005558 3300045051 Bacteria 15750
692 Ga0451576_0084228 3300045051 Bacteria 3307
693 Ga0451576_0154801 3300045051 Bacteria 2391
694 Ga0451576_0177860 3300045051 Bacteria 2221
695 Ga0451576_0223199 3300045051 Bacteria 1967
696 Ga0451576_0780476 3300045051 Bacteria 1003
697 Ga0451576_0855607 3300045051 Bacteria 954
698 Ga0451576_1081346 3300045051 Bacteria 839
699 Ga0451576_1731198 3300045051 Bacteria 647
700 Ga0451576_1884925 3300045051 Bacteria 617
701 Ga0495603_0266729 3300046455 Bacteria 985
702 Ga0495603_0307117 3300046455 Bacteria 911
703 Ga0495580_0007109 3300046472 Bacteria 9015
704 Ga0495580_0037313 3300046472 Bacteria 3489
705 Ga0495580_0163416 3300046472 Bacteria 1540
706 Ga0495580_0673025 3300046472 Bacteria 679
707 Ga0495584_0435273 3300046491 Bacteria 667
708 Ga0495644_0396670 3300046523 Bacteria 546
709 Ga0495642_0041470 3300046528 Bacteria 1872
710 Ga0495642_0097111 3300046528 Bacteria 1251
711 Ga0495642_0292460 3300046528 Bacteria 713
712 Ga0495598_0048581 3300046537 Bacteria 1269
713 Ga0495659_0012568 3300046664 Bacteria 2745
714 Ga0495659_0078377 3300046664 Bacteria 1250
715 Ga0495669_0113998 3300046684 Bacteria 1264
716 Ga0495669_0277098 3300046684 Bacteria 807
717 Ga0495669_0563697 3300046684 Bacteria 554
718 Ga0495636_0413289 3300047318 Unclassified 644
719 Ga0496100_0561485 3300048903 Bacteria 884
720 Ga0496102_0052519 3300048905 Bacteria 3714
721 Ga0496102_0344490 3300048905 Bacteria 1403
722 Ga0496102_0360827 3300048905 Bacteria 1368
723 Ga0496103_0538688 3300048906 Unclassified 746
724 Ga0496104_1653716 3300048907 Unclassified 543
725 Ga0496106_0110711 3300048909 Bacteria 2138
726 Ga0496106_0840083 3300048909 Unclassified 727
727 Ga0496106_1282454 3300048909 Bacteria 569
728 Ga0496107_0595077 3300048910 Unclassified 818
729 Ga0496108_0401356 3300048911 Bacteria 1197
730 Ga0496110_0795276 3300048913 Bacteria 850
731 Ga0496113_0327027 3300048916 Bacteria 1229
732 Ga0496114_1228553 3300048917 Bacteria 636
733 Ga0501299_013434 3300049522 Bacteria 1413
734 Ga0501031_0013398 3300049568 Bacteria 5349
735 Ga0501031_0200317 3300049568 Bacteria 1303
736 Ga0501031_0264925 3300049568 Bacteria 1116
737 Ga0501031_0441193 3300049568 Bacteria 841
738 Ga0501031_0576254 3300049568 Bacteria 724
739 Ga0501032_0038978 3300049569 Unclassified 3234
740 Ga0501032_0219424 3300049569 Bacteria 1238
741 Ga0501033_0021421 3300049570 Bacteria 4877
742 Ga0501033_0060929 3300049570 Bacteria 2782
743 Ga0501033_0087969 3300049570 Bacteria 2273
744 Ga0501033_0181504 3300049570 Bacteria 1508
745 Ga0501034_0508444 3300049571 Bacteria 1118
746 Ga0501036_0004364 3300049572 Bacteria 11411
747 Ga0501036_0004586 3300049572 Bacteria 11162
748 Ga0501036_0023569 3300049572 Bacteria 5186
749 Ga0501036_0080223 3300049572 Bacteria 2759
750 Ga0501036_0122640 3300049572 Bacteria 2195
751 Ga0501036_0174501 3300049572 Bacteria 1810
752 Ga0501036_0398703 3300049572 Bacteria 1148
753 Ga0501036_0763510 3300049572 Bacteria 797
754 Ga0501036_0777204 3300049572 Bacteria 789
755 Ga0501036_1634108 3300049572 Unclassified 520
756 Ga0501037_0045930 3300049573 Bacteria 3205
757 Ga0501037_0248362 3300049573 Bacteria 1246
758 Ga0501037_0297932 3300049573 Bacteria 1120
759 Ga0501037_0315602 3300049573 Bacteria 1083
760 Ga0501037_0451951 3300049573 Bacteria 876
761 Ga0501038_0003376 3300049574 Bacteria 14886
762 Ga0501038_0081481 3300049574 Bacteria 2726
763 Ga0501038_0085470 3300049574 Bacteria 2653
764 Ga0501038_0451101 3300049574 Bacteria 989
765 Ga0501038_0788179 3300049574 Bacteria 707
766 Ga0501038_1057692 3300049574 Bacteria 594
767 Ga0501039_0000357 3300049575 Bacteria 32559
768 Ga0501039_0018950 3300049575 Bacteria 5282
769 Ga0501039_0025129 3300049575 Bacteria 4576
770 Ga0501039_0025590 3300049575 Bacteria 4536
771 Ga0501039_0088388 3300049575 Bacteria 2414
772 Ga0501039_0097980 3300049575 Bacteria 2287
773 Ga0501039_0259431 3300049575 Bacteria 1366
774 Ga0501039_0308522 3300049575 Bacteria 1244
775 Ga0501039_0858119 3300049575 Bacteria 707
776 Ga0501039_1204361 3300049575 Unclassified 586
777 Ga0501040_0000403 3300049576 Bacteria 25545
778 Ga0501040_0000527 3300049576 Bacteria 23025
779 Ga0501040_0022584 3300049576 Bacteria 4212
780 Ga0501040_0041483 3300049576 Bacteria 3135
781 Ga0501040_0044981 3300049576 Bacteria 3010
782 Ga0501040_0067318 3300049576 Bacteria 2468
783 Ga0501040_0075397 3300049576 Bacteria 2331
784 Ga0501040_0155129 3300049576 Bacteria 1617
785 Ga0501040_0175865 3300049576 Bacteria 1516
786 Ga0501040_0448137 3300049576 Bacteria 929
787 Ga0501040_0473272 3300049576 Bacteria 902
788 Ga0501040_0573280 3300049576 Bacteria 815
789 Ga0501040_0577179 3300049576 Bacteria 812
790 Ga0501040_1063528 3300049576 Bacteria 587
791 Ga0501041_0000801 3300049577 Bacteria 16816
792 Ga0501041_0002660 3300049577 Bacteria 10197
793 Ga0501041_0004582 3300049577 Bacteria 8019
794 Ga0501041_0045621 3300049577 Bacteria 2665
795 Ga0501041_0062725 3300049577 Bacteria 2276
796 Ga0501041_0063779 3300049577 Bacteria 2256
797 Ga0501041_0085212 3300049577 Bacteria 1948
798 Ga0501041_0095893 3300049577 Unclassified 1833
799 Ga0501041_0176837 3300049577 Bacteria 1336
800 Ga0501041_0202042 3300049577 Unclassified 1246
801 Ga0501041_0404561 3300049577 Bacteria 865
802 Ga0501041_0411106 3300049577 Bacteria 858
803 Ga0501041_0543334 3300049577 Bacteria 740
804 Ga0501042_0000921 3300049578 Bacteria 16520
805 Ga0501042_0004544 3300049578 Bacteria 8850
806 Ga0501042_0067585 3300049578 Bacteria 2555
807 Ga0501042_0082052 3300049578 Bacteria 2311
808 Ga0501042_0137755 3300049578 Bacteria 1759
809 Ga0501042_0165603 3300049578 Bacteria 1595
810 Ga0501042_0470132 3300049578 Bacteria 912
811 Ga0501042_0671696 3300049578 Bacteria 753
812 Ga0501043_0014063 3300049579 Bacteria 6265
813 Ga0501043_0017942 3300049579 Bacteria 5549
814 Ga0501043_0313275 3300049579 Bacteria 1197
815 Ga0501043_0485461 3300049579 Unclassified 925
816 Ga0501043_0493790 3300049579 Bacteria 915
817 Ga0501043_0540123 3300049579 Bacteria 867
818 Ga0501046_0002458 3300049580 Bacteria 17380
819 Ga0501046_0020367 3300049580 Bacteria 5487
820 Ga0501046_0027677 3300049580 Bacteria 4624
821 Ga0501046_0075373 3300049580 Bacteria 2616
822 Ga0501046_0131303 3300049580 Bacteria 1900
823 Ga0501046_0225497 3300049580 Bacteria 1386
824 Ga0501046_0285631 3300049580 Bacteria 1208
825 Ga0501046_0344279 3300049580 Bacteria 1083
826 Ga0501046_0664023 3300049580 Bacteria 736
827 Ga0501046_0705801 3300049580 Bacteria 710
828 Ga0501046_0743267 3300049580 Bacteria 689
829 Ga0501046_0766117 3300049580 Unclassified 677
830 Ga0501047_0466339 3300049581 Bacteria 1091
831 Ga0501048_0002741 3300049582 Bacteria 13431
832 Ga0501048_0013911 3300049582 Bacteria 5966
833 Ga0501048_0053115 3300049582 Bacteria 2883
834 Ga0501048_0053819 3300049582 Bacteria 2860
835 Ga0501048_0225307 3300049582 Bacteria 1330
836 Ga0501048_0280526 3300049582 Bacteria 1185
837 Ga0501048_0359806 3300049582 Bacteria 1038
838 Ga0501048_0585027 3300049582 Bacteria 801
839 Ga0501048_1119285 3300049582 Bacteria 566
840 Ga0501067_0069038 3300049583 Bacteria 1957
841 Ga0501068_0005528 3300049584 Bacteria 6923
842 Ga0501068_0031746 3300049584 Bacteria 3138
843 Ga0501068_0037069 3300049584 Bacteria 2919
844 Ga0501068_0056118 3300049584 Bacteria 2388
845 Ga0501068_0098815 3300049584 Bacteria 1808
846 Ga0501068_0253019 3300049584 Bacteria 1123
847 Ga0501068_0295389 3300049584 Bacteria 1037
848 Ga0501068_0334784 3300049584 Bacteria 972
849 Ga0501068_0342313 3300049584 Bacteria 960
850 Ga0501068_0406605 3300049584 Bacteria 878
851 Ga0501068_0426878 3300049584 Bacteria 856
852 Ga0501068_0452739 3300049584 Bacteria 830
853 Ga0501068_0489244 3300049584 Unclassified 797
854 Ga0501068_0658728 3300049584 Bacteria 684
855 Ga0501069_0156374 3300049585 Bacteria 1312
856 Ga0501069_0176501 3300049585 Bacteria 1234
857 Ga0501069_0208469 3300049585 Bacteria 1134
858 Ga0501070_0022087 3300049586 Bacteria 5330
859 Ga0501070_0628679 3300049586 Bacteria 854
860 Ga0501070_0667294 3300049586 Bacteria 824
861 Ga0501070_0900920 3300049586 Bacteria 690
862 Ga0501071_0001609 3300049587 Bacteria 13242
863 Ga0501071_0033389 3300049587 Bacteria 3656
864 Ga0501071_0047435 3300049587 Bacteria 3086
865 Ga0501071_0059823 3300049587 Bacteria 2757
866 Ga0501071_0102097 3300049587 Bacteria 2115
867 Ga0501071_0124697 3300049587 Bacteria 1911
868 Ga0501071_0173437 3300049587 Bacteria 1615
869 Ga0501071_0409662 3300049587 Bacteria 1035
870 Ga0501071_0446428 3300049587 Bacteria 990
871 Ga0501071_0547821 3300049587 Bacteria 888
872 Ga0501071_0636729 3300049587 Bacteria 820
873 Ga0501071_0937538 3300049587 Bacteria 668
874 Ga0501072_0003679 3300049588 Bacteria 11565
875 Ga0501072_0011077 3300049588 Bacteria 6881
876 Ga0501072_0016060 3300049588 Bacteria 5741
877 Ga0501072_0048063 3300049588 Bacteria 3360
878 Ga0501072_0081098 3300049588 Bacteria 2571
879 Ga0501072_0096542 3300049588 Bacteria 2348
880 Ga0501072_0397652 3300049588 Bacteria 1093
881 Ga0501072_0435810 3300049588 Bacteria 1038
882 Ga0501072_0454559 3300049588 Bacteria 1014
883 Ga0501072_0459203 3300049588 Bacteria 1008
884 Ga0501072_0554914 3300049588 Bacteria 907
885 Ga0501072_1077977 3300049588 Bacteria 625
886 Ga0501074_0003994 3300049590 Bacteria 10516
887 Ga0501074_0006930 3300049590 Bacteria 8184
888 Ga0501074_0028309 3300049590 Bacteria 4061
889 Ga0501074_0036386 3300049590 Bacteria 3566
890 Ga0501074_0161585 3300049590 Bacteria 1600
891 Ga0501074_0194354 3300049590 Bacteria 1446
892 Ga0501074_0229223 3300049590 Bacteria 1322
893 Ga0501074_0315875 3300049590 Bacteria 1110
894 Ga0501074_0345555 3300049590 Bacteria 1056
895 Ga0501074_0476974 3300049590 Bacteria 884
896 Ga0501074_0478359 3300049590 Bacteria 883
897 Ga0501074_0533938 3300049590 Bacteria 831
898 Ga0501074_0628117 3300049590 Bacteria 759
899 Ga0501074_1119420 3300049590 Bacteria 553
900 Ga0501075_0000805 3300049591 Bacteria 19605
901 Ga0501075_0003261 3300049591 Bacteria 10862
902 Ga0501075_0008114 3300049591 Bacteria 7305
903 Ga0501075_0015118 3300049591 Bacteria 5537
904 Ga0501075_0015487 3300049591 Bacteria 5472
905 Ga0501075_0018006 3300049591 Bacteria 5106
906 Ga0501075_0018424 3300049591 Bacteria 5055
907 Ga0501075_0041411 3300049591 Bacteria 3452
908 Ga0501075_0060597 3300049591 Bacteria 2851
909 Ga0501075_0063044 3300049591 Bacteria 2795
910 Ga0501075_0083194 3300049591 Bacteria 2424
911 Ga0501075_0096848 3300049591 Bacteria 2239
912 Ga0501075_0119040 3300049591 Bacteria 2009
913 Ga0501075_0128408 3300049591 Bacteria 1930
914 Ga0501075_0174003 3300049591 Bacteria 1643
915 Ga0501075_0190371 3300049591 Unclassified 1565
916 Ga0501075_0223708 3300049591 Bacteria 1436
917 Ga0501075_0276601 3300049591 Bacteria 1279
918 Ga0501075_0411574 3300049591 Bacteria 1031
919 Ga0501075_0748371 3300049591 Bacteria 744
920 Ga0501075_0873157 3300049591 Bacteria 684
921 Ga0501075_0874902 3300049591 Bacteria 683
922 Ga0501075_0922607 3300049591 Unclassified 664
923 Ga0501075_1316898 3300049591 Unclassified 547
924 Ga0501076_0000149 3300049592 Bacteria 39948
925 Ga0501076_0000520 3300049592 Bacteria 24444
926 Ga0501076_0000664 3300049592 Bacteria 22038
927 Ga0501076_0005670 3300049592 Bacteria 9002
928 Ga0501076_0019690 3300049592 Bacteria 5160
929 Ga0501076_0026552 3300049592 Bacteria 4487
930 Ga0501076_0030063 3300049592 Bacteria 4230
931 Ga0501076_0035275 3300049592 Bacteria 3914
932 Ga0501076_0079034 3300049592 Bacteria 2640
933 Ga0501076_0125082 3300049592 Bacteria 2083
934 Ga0501076_0140020 3300049592 Bacteria 1965
935 Ga0501076_0205802 3300049592 Bacteria 1607
936 Ga0501076_0365971 3300049592 Bacteria 1185
937 Ga0501076_0511141 3300049592 Bacteria 990
938 Ga0501076_1059739 3300049592 Bacteria 668
939 Ga0501077_0000493 3300049593 Bacteria 23908
940 Ga0501077_0009137 3300049593 Bacteria 6154
941 Ga0501077_0017669 3300049593 Bacteria 4505
942 Ga0501077_0019140 3300049593 Bacteria 4329
943 Ga0501077_0057202 3300049593 Bacteria 2476
944 Ga0501077_0059637 3300049593 Bacteria 2422
945 Ga0501077_0098462 3300049593 Bacteria 1853
946 Ga0501077_0151084 3300049593 Bacteria 1474
947 Ga0501077_0159468 3300049593 Bacteria 1432
948 Ga0501077_0185734 3300049593 Bacteria 1321
949 Ga0501077_0321544 3300049593 Bacteria 986
950 Ga0501077_0423121 3300049593 Unclassified 852
951 Ga0501077_0554930 3300049593 Bacteria 737
952 Ga0501079_0000697 3300049741 Bacteria 22681
953 Ga0501079_0001092 3300049741 Bacteria 18848
954 Ga0501079_0004206 3300049741 Bacteria 10674
955 Ga0501079_0004276 3300049741 Bacteria 10599
956 Ga0501079_0004960 3300049741 Bacteria 9870
957 Ga0501079_0009292 3300049741 Bacteria 7451
958 Ga0501079_0066256 3300049741 Bacteria 2787
959 Ga0501079_0068205 3300049741 Unclassified 2745
960 Ga0501079_0089271 3300049741 Bacteria 2387
961 Ga0501079_0427937 3300049741 Bacteria 1039
962 Ga0501079_0727063 3300049741 Bacteria 781
963 Ga0501079_1248148 3300049741 Bacteria 585
964 Ga0501080_0010134 3300049742 Bacteria 8620
965 Ga0501080_0013911 3300049742 Bacteria 7407
966 Ga0501080_0059868 3300049742 Bacteria 3544
967 Ga0501080_0122565 3300049742 Bacteria 2408
968 Ga0501080_0171179 3300049742 Bacteria 2003
969 Ga0501080_0229033 3300049742 Bacteria 1699
970 Ga0501080_0440505 3300049742 Bacteria 1169
971 Ga0501080_0979382 3300049742 Bacteria 734
972 Ga0501080_1379579 3300049742 Bacteria 602
973 Ga0501080_1467647 3300049742 Bacteria 580
974 Ga0501081_0000991 3300049743 Bacteria 16900
975 Ga0501081_0002545 3300049743 Bacteria 11495
976 Ga0501081_0006988 3300049743 Bacteria 7340
977 Ga0501081_0020687 3300049743 Bacteria 4388
978 Ga0501081_0035684 3300049743 Bacteria 3385
979 Ga0501081_0037134 3300049743 Bacteria 3324
980 Ga0501081_0047816 3300049743 Bacteria 2943
981 Ga0501081_0081995 3300049743 Bacteria 2259
982 Ga0501081_0105018 3300049743 Bacteria 2001
983 Ga0501081_0158160 3300049743 Bacteria 1631
984 Ga0501081_0221285 3300049743 Bacteria 1377
985 Ga0501081_0247990 3300049743 Bacteria 1299
986 Ga0501081_0278407 3300049743 Bacteria 1224
987 Ga0501081_0345019 3300049743 Bacteria 1097
988 Ga0501081_0589291 3300049743 Bacteria 832
989 Ga0501081_0722218 3300049743 Bacteria 748
990 Ga0501081_1018084 3300049743 Bacteria 626
991 Ga0501083_0044391 3300049744 Bacteria 3009
992 Ga0501083_0139305 3300049744 Bacteria 1589
993 Ga0501083_0161374 3300049744 Bacteria 1466
994 Ga0501083_0251193 3300049744 Bacteria 1151
995 Ga0501083_0647933 3300049744 Bacteria 687
996 Ga0501283_079581 3300049779 Bacteria 615
997 Ga0501035_0017732 3300049822 Bacteria 6566
998 Ga0501035_0319496 3300049822 Bacteria 1305
999 Ga0501035_0426843 3300049822 Bacteria 1100
1000 Ga0501035_0583368 3300049822 Unclassified 913
1001 Ga0501035_1448959 3300049822 Unclassified 525
1002 Ga0501044_1519779 3300049823 Unclassified 534
1003 Ga0501045_0000484 3300049824 Bacteria 24590
1004 Ga0501045_0001052 3300049824 Bacteria 18177
1005 Ga0501045_0110133 3300049824 Bacteria 2042
1006 Ga0501045_0147656 3300049824 Bacteria 1749
1007 Ga0501045_0166622 3300049824 Bacteria 1641
1008 Ga0501045_0201331 3300049824 Bacteria 1483
1009 Ga0501045_0286370 3300049824 Bacteria 1226
1010 Ga0501045_0328080 3300049824 Bacteria 1139
1011 Ga0501045_0422199 3300049824 Bacteria 992
1012 Ga0501045_0604975 3300049824 Bacteria 811
1013 Ga0501045_0797650 3300049824 Bacteria 695
1014 Ga0501045_1052946 3300049824 Bacteria 596
1015 nmdc:mga05p37_107525_c1 3300050507 Bacteria 3432
1016 nmdc:mga05p37_10883_c1 3300050507 Bacteria 10801
1017 nmdc:mga05p37_116736_c1 3300050507 Bacteria 3280
1018 nmdc:mga05p37_126051_c1 3300050507 Unclassified 3145
1019 nmdc:mga05p37_127_c1 3300050507 Bacteria 69551
1020 nmdc:mga05p37_1330292_c1 3300050507 Bacteria 730
1021 nmdc:mga05p37_17800_c1 3300050507 Bacteria 8575
1022 nmdc:mga05p37_222600_c1 3300050507 Bacteria 2277
1023 nmdc:mga05p37_239675_c1 3300050507 Bacteria 2182
1024 nmdc:mga05p37_25518_c1 3300050507 Bacteria 7189
1025 nmdc:mga05p37_279393_c1 3300050507 Bacteria 1992
1026 nmdc:mga05p37_309986_c1 3300050507 Bacteria 1871
1027 nmdc:mga05p37_329801_c1 3300050507 Bacteria 1803
1028 nmdc:mga05p37_3448_c1 3300050507 Bacteria 18461
1029 nmdc:mga05p37_3712_c1 3300050507 Bacteria 17860
1030 nmdc:mga05p37_453281_c1 3300050507 Bacteria 1484
1031 nmdc:mga05p37_475753_c1 3300050507 Bacteria 1440
1032 nmdc:mga05p37_480462_c1 3300050507 Bacteria 1431
1033 nmdc:mga05p37_613442_c1 3300050507 Bacteria 1226
1034 nmdc:mga05p37_74592_c1 3300050507 Bacteria 4175
1035 nmdc:mga05p37_76517_c1 3300050507 Bacteria 4120
1036 nmdc:mga05p37_8008_c1 3300050507 Bacteria 12475
1037 nmdc:mga05p37_816036_c1 3300050507 Bacteria 1018
1038 nmdc:mga05p37_851258_c1 3300050507 Bacteria 990
1039 nmdc:mga05p37_921968_c1 3300050507 Bacteria 939
1040 nmdc:mga05p37_96947_c1 3300050507 Bacteria 3633
1041 nmdc:mga05p37_9945_c1 3300050507 Bacteria 11294
1042 nmdc:mga09592_14781_c1 3300050508 Bacteria 6371
1043 nmdc:mga09592_192197_c1 3300050508 Bacteria 1767
1044 nmdc:mga09592_3161_c1 3300050508 Bacteria 13374
1045 nmdc:mga09592_375_c1 3300050508 Bacteria 32667
1046 nmdc:mga09592_47648_c1 3300050508 Bacteria 3612
1047 nmdc:mga09592_492244_c1 3300050508 Bacteria 1056
1048 nmdc:mga09592_566_c2 3300050508 Bacteria 20735
1049 nmdc:mga09592_5844_c1 3300050508 Bacteria 10033
1050 nmdc:mga09592_7226_c1 3300050508 Bacteria 9022
1051 nmdc:mga09592_7732_c1 3300050508 Bacteria 8740
1052 nmdc:mga09592_92993_c1 3300050508 Bacteria 2578
1053 nmdc:mga0qj67_106731_c1 3300050509 Bacteria 924
1054 nmdc:mga0qj67_115_c1 3300050509 Bacteria 52730
1055 nmdc:mga0qj67_12789_c1 3300050509 Bacteria 6329
1056 nmdc:mga0qj67_153712_c1 3300050509 Bacteria 1867
1057 nmdc:mga0qj67_203496_c1 3300050509 Bacteria 1608
1058 nmdc:mga0qj67_2380_c1 3300050509 Bacteria 13393
1059 nmdc:mga0qj67_250233_c1 3300050509 Unclassified 1438
1060 nmdc:mga0qj67_37588_c1 3300050509 Bacteria 3793
1061 nmdc:mga0qj67_379_c1 3300050509 Bacteria 30645
1062 nmdc:mga0qj67_386049_c1 3300050509 Bacteria 1131
1063 nmdc:mga06r32_10498_c1 3300050510 Bacteria 8353
1064 nmdc:mga06r32_1139079_c1 3300050510 Bacteria 728
1065 nmdc:mga06r32_114656_c1 3300050510 Bacteria 2653
1066 nmdc:mga06r32_1154869_c1 3300050510 Bacteria 722
1067 nmdc:mga06r32_1305_c1 3300050510 Bacteria 22500
1068 nmdc:mga06r32_1370783_c1 3300050510 Bacteria 649
1069 nmdc:mga06r32_138939_c1 3300050510 Unclassified 2405
1070 nmdc:mga06r32_22600_c1 3300050510 Bacteria 5816
1071 nmdc:mga06r32_233756_c1 3300050510 Bacteria 1826
1072 nmdc:mga06r32_280361_c1 3300050510 Bacteria 1654
1073 nmdc:mga06r32_2842_c1 3300050510 Bacteria 15542
1074 nmdc:mga06r32_423_c1 3300050510 Bacteria 35563
1075 nmdc:mga06r32_442668_c1 3300050510 Bacteria 1279
1076 nmdc:mga06r32_479473_c1 3300050510 Bacteria 1222
1077 nmdc:mga06r32_522933_c1 3300050510 Bacteria 1162
1078 nmdc:mga06r32_522_c1 3300050510 Bacteria 33144
1079 nmdc:mga06r32_5431_c1 3300050510 Bacteria 11470
1080 nmdc:mga06r32_589306_c1 3300050510 Bacteria 1083
1081 nmdc:mga06r32_59253_c1 3300050510 Bacteria 3681
1082 nmdc:mga06r32_9731_c1 3300050510 Bacteria 8682
1083 nmdc:mga08y16_19385_c1 3300050511 Bacteria 7172
1084 nmdc:mga08y16_193878_c1 3300050511 Unclassified 2107
1085 nmdc:mga08y16_213472_c1 3300050511 Bacteria 1998
1086 nmdc:mga08y16_231452_c1 3300050511 Bacteria 1911
1087 nmdc:mga08y16_29316_c1 3300050511 Bacteria 5798
1088 nmdc:mga08y16_48098_c1 3300050511 Bacteria 4463
1089 nmdc:mga08y16_531313_c1 3300050511 Bacteria 1192
1090 nmdc:mga08y16_5803_c1 3300050511 Bacteria 12934
1091 nmdc:mga08y16_7686_c1 3300050511 Bacteria 11285
1092 nmdc:mga0n895_133016_c1 3300050512 Bacteria 2513
1093 nmdc:mga0n895_136135_c1 3300050512 Bacteria 2483
1094 nmdc:mga0n895_139150_c1 3300050512 Bacteria 2455
1095 nmdc:mga0n895_14621_c1 3300050512 Bacteria 7136
1096 nmdc:mga0n895_151294_c1 3300050512 Bacteria 2351
1097 nmdc:mga0n895_170271_c1 3300050512 Bacteria 2210
1098 nmdc:mga0n895_19405_c1 3300050512 Bacteria 6319
1099 nmdc:mga0n895_1986079_c1 3300050512 Unclassified 540
1100 nmdc:mga0n895_283576_c1 3300050512 Bacteria 1680
1101 nmdc:mga0n895_2838_c1 3300050512 Bacteria 13722
1102 nmdc:mga0n895_379233_c1 3300050512 Unclassified 1431
1103 nmdc:mga0n895_4375_c1 3300050512 Bacteria 11586
1104 nmdc:mga0n895_509625_c1 3300050512 Unclassified 1212
1105 nmdc:mga0n895_573498_c1 3300050512 Bacteria 1133
1106 nmdc:mga0n895_630315_c1 3300050512 Bacteria 1072
1107 nmdc:mga0n895_883897_c1 3300050512 Bacteria 880
1108 nmdc:mga0rr50_132390_c1 3300050513 Bacteria 1998
1109 nmdc:mga0rr50_140485_c1 3300050513 Bacteria 1943
1110 nmdc:mga0rr50_147717_c1 3300050513 Bacteria 1897
1111 nmdc:mga0rr50_1496_c1 3300050513 Bacteria 12847
1112 nmdc:mga0rr50_291779_c1 3300050513 Bacteria 1363
1113 nmdc:mga0rr50_29233_c1 3300050513 Bacteria 3884
1114 nmdc:mga0rr50_457992_c1 3300050513 Bacteria 1082
1115 nmdc:mga0rr50_67169_c1 3300050513 Bacteria 2723
1116 nmdc:mga0rr50_750990_c1 3300050513 Bacteria 833
1117 nmdc:mga08x19_10378_c1 3300050514 Bacteria 5591
1118 nmdc:mga08x19_16985_c1 3300050514 Bacteria 4448
1119 nmdc:mga08x19_35360_c1 3300050514 Bacteria 3160
1120 nmdc:mga0a205_1066773_c1 3300050515 Bacteria 655
1121 nmdc:mga0a205_110958_c1 3300050515 Bacteria 2642
1122 nmdc:mga0a205_1293_c1 3300050515 Bacteria 21041
1123 nmdc:mga0a205_16159_c1 3300050515 Bacteria 6989
1124 nmdc:mga0a205_16163_c1 3300050515 Bacteria 6988
1125 nmdc:mga0a205_162351_c1 3300050515 Bacteria 2130
1126 nmdc:mga0a205_178_c1 3300050515 Bacteria 43234
1127 nmdc:mga0a205_188176_c1 3300050515 Bacteria 1957
1128 nmdc:mga0a205_229700_c1 3300050515 Unclassified 1739
1129 nmdc:mga0a205_23282_c1 3300050515 Bacteria 5874
1130 nmdc:mga0a205_261019_c1 3300050515 Bacteria 1610
1131 nmdc:mga0a205_304228_c1 3300050515 Bacteria 1467
1132 nmdc:mga0a205_34892_c1 3300050515 Bacteria 4828
1133 nmdc:mga0a205_405873_c1 3300050515 Bacteria 1226
1134 nmdc:mga0a205_5041_c1 3300050515 Bacteria 11891
1135 nmdc:mga0a205_5513_c1 3300050515 Bacteria 11398
1136 nmdc:mga0a205_650041_c1 3300050515 Bacteria 906
1137 nmdc:mga0a205_743316_c1 3300050515 Bacteria 830
1138 nmdc:mga0a205_8279_c1 3300050515 Bacteria 9454
1139 Ga0501084_0000115 3300054114 Bacteria 60964
1140 Ga0501084_0001161 3300054114 Bacteria 20535
1141 Ga0501084_0003225 3300054114 Bacteria 13204
1142 Ga0501084_0009378 3300054114 Bacteria 8096
1143 Ga0501084_0009581 3300054114 Bacteria 8012
1144 Ga0501084_0026332 3300054114 Bacteria 4852
1145 Ga0501084_0055713 3300054114 Bacteria 3308
1146 Ga0501084_0104516 3300054114 Bacteria 2378
1147 Ga0501084_0449938 3300054114 Bacteria 1089
1148 Ga0501084_0497423 3300054114 Unclassified 1030
1149 Ga0501084_0498224 3300054114 Bacteria 1029
1150 Ga0501084_0653812 3300054114 Bacteria 887
1151 Ga0501084_0766865 3300054114 Bacteria 813
1152 Ga0501084_0939335 3300054114 Bacteria 727
1153 Ga0501084_1378131 3300054114 Bacteria 591
1154 Ga0590071_020356 3300059421 Bacteria 1563
1155 Ga0590075_026961 3300059424 Bacteria 1447
1156 Ga0501082_0004253 3300060353 Bacteria 12505
1157 Ga0501082_0009232 3300060353 Bacteria 8501
1158 Ga0501082_0010628 3300060353 Bacteria 7923
1159 Ga0501082_0011087 3300060353 Bacteria 7751
1160 Ga0501082_0023355 3300060353 Bacteria 5334
1161 Ga0501082_0028683 3300060353 Bacteria 4794
1162 Ga0501082_0039471 3300060353 Bacteria 4072
1163 Ga0501082_0041308 3300060353 Bacteria 3976
1164 Ga0501082_0059851 3300060353 Bacteria 3282
1165 Ga0501082_0091585 3300060353 Unclassified 2625
1166 Ga0501082_0110384 3300060353 Unclassified 2381
1167 Ga0501082_0149194 3300060353 Bacteria 2030
1168 Ga0501082_0297227 3300060353 Bacteria 1406
1169 Ga0501082_0403433 3300060353 Bacteria 1193
1170 Ga0501082_0496516 3300060353 Bacteria 1067
1171 Ga0501082_0578762 3300060353 Bacteria 982
1172 Ga0501082_0838846 3300060353 Bacteria 804
1173 Ga0530510_0000288 3300061734 Bacteria 32009
1174 Ga0530510_0000417 3300061734 Bacteria 27454
1175 Ga0530510_0001021 3300061734 Bacteria 18537
1176 Ga0530510_0008672 3300061734 Bacteria 7106
1177 Ga0530510_0011087 3300061734 Bacteria 6323
1178 Ga0530510_0032939 3300061734 Bacteria 3729
1179 Ga0530510_0064846 3300061734 Bacteria 2646
1180 Ga0530510_0089015 3300061734 Bacteria 2251
1181 Ga0530510_0101630 3300061734 Bacteria 2102
1182 Ga0530510_0112213 3300061734 Bacteria 1997
1183 Ga0530510_0159336 3300061734 Bacteria 1669
1184 Ga0530510_0166690 3300061734 Bacteria 1631
1185 Ga0530510_0320351 3300061734 Bacteria 1162
1186 Ga0530510_0373084 3300061734 Bacteria 1073
1187 Ga0530510_0396027 3300061734 Bacteria 1040
1188 Ga0530510_0437710 3300061734 Bacteria 988
1189 Ga0099795_10133410
1190 JGI25406J46586_10098226
1191 JGI26129J50193_1000543
1192 Ga0058862_12661207
1193 Ga0065715_10114390
1194 Ga0065707_10543122
1195 Ga0065707_10593414
1196 Ga0065707_10674513
1197 Ga0065707_10847112
1198 Ga0070676_10000095
1199 Ga0070676_10311043
1200 Ga0070676_10984965
1201 Ga0070690_100105606
1202 Ga0070670_100006064
1203 Ga0070670_100289903
1204 Ga0070670_100869820
1205 Ga0070677_10406184
1206 Ga0068869_100006872
1207 Ga0068869_100007400
1208 Ga0070666_10064980
1209 Ga0070680_100008209
1210 Ga0070680_100010125
1211 Ga0070680_100334672
1212 Ga0070680_100357010
1213 Ga0070682_100000272
1214 Ga0070660_100006699
1215 Ga0070660_100695797
1216 Ga0070689_100007039
1217 Ga0070689_100198324
1218 Ga0070691_10010392
1219 Ga0070691_10019069
1220 Ga0070691_10059673
1221 Ga0070687_100002250
1222 Ga0070661_100007569
1223 Ga0070692_10000126
1224 Ga0070692_10007349
1225 Ga0070692_10196366
1226 Ga0070692_10685175
1227 Ga0070692_10764564
1228 Ga0070668_100039686
1229 Ga0070668_100995297
1230 Ga0070669_100046620
1231 Ga0070669_100067140
1232 Ga0070669_100085128
1233 Ga0070669_100401644
1234 Ga0070673_100262549
1235 Ga0070673_100829267
1236 Ga0070659_100002725
1237 Ga0070667_101383061
1238 Ga0070703_10043505
1239 Ga0070703_10215050
1240 Ga0070701_10014758
1241 Ga0070701_10120870
1242 Ga0070701_10252398
1243 Ga0070711_101070743
1244 Ga0070705_100000362
1245 Ga0070705_100013626
1246 Ga0070705_100024712
1247 Ga0070705_100132172
1248 Ga0070705_100295377
1249 Ga0070705_100462509
1250 Ga0070700_100088139
1251 Ga0070700_100095480
1252 Ga0070700_100217355
1253 Ga0070700_100368993
1254 Ga0070694_100002589
1255 Ga0070694_100009916
1256 Ga0070694_100018359
1257 Ga0070694_100018898
1258 Ga0070694_100035848
1259 Ga0070694_100061449
1260 Ga0070694_100080571
1261 Ga0070694_100553199
1262 Ga0070694_101618955
1263 Ga0070708_100003639
1264 Ga0070708_100007382
1265 Ga0070708_100008518
1266 Ga0070708_100027118
1267 Ga0070708_100033751
1268 Ga0070708_100126224
1269 Ga0070708_100184900
1270 Ga0070708_100224209
1271 Ga0070708_100277593
1272 Ga0070708_100316757
1273 Ga0070708_100433139
1274 Ga0070708_100486978
1275 Ga0070663_100061880
1276 Ga0070663_100065034
1277 Ga0070662_100003229
1278 Ga0070662_100032491
1279 Ga0070662_100432645
1280 Ga0070662_100612747
1281 Ga0070662_100677586
1282 Ga0070681_10061586
1283 Ga0070681_10227234
1284 Ga0068867_100000551
1285 Ga0068867_100002221
1286 Ga0068867_100014494
1287 Ga0068867_100261569
1288 Ga0068867_100329459
1289 Ga0070706_100000956
1290 Ga0070706_100004277
1291 Ga0070706_100006502
1292 Ga0070706_100015246
1293 Ga0070706_100017147
1294 Ga0070706_100044078
1295 Ga0070706_100211321
1296 Ga0070706_100345850
1297 Ga0070706_101344911
1298 Ga0070707_100001156
1299 Ga0070707_100009743
1300 Ga0070707_100014710
1301 Ga0070707_100031860
1302 Ga0070707_100036434
1303 Ga0070707_100051412
1304 Ga0070707_100086297
1305 Ga0070707_100141801
1306 Ga0070707_100185609
1307 Ga0070707_100288876
1308 Ga0070707_100414311
1309 Ga0070707_100551902
1310 Ga0070707_101140441
1311 Ga0070698_100008263
1312 Ga0070698_100009214
1313 Ga0070698_100013151
1314 Ga0070698_100097477
1315 Ga0070698_100119467
1316 Ga0070698_100348429
1317 Ga0070698_100401719
1318 Ga0070698_100666809
1319 Ga0070698_100752469
1320 Ga0070698_101566493
1321 Ga0070699_100003221
1322 Ga0070699_100004981
1323 Ga0070699_100005612
1324 Ga0070699_100016841
1325 Ga0070699_100019863
1326 Ga0070699_100055561
1327 Ga0070699_100069333
1328 Ga0070699_100275022
1329 Ga0070699_100473367
1330 Ga0070699_100961635
1331 Ga0070699_101000463
1332 Ga0070679_100001576
1333 Ga0070679_100075648
1334 Ga0070684_100026910
1335 Ga0070697_100010402
1336 Ga0070697_100010930
1337 Ga0070697_100021580
1338 Ga0070697_100026268
1339 Ga0070697_100062981
1340 Ga0070697_100232194
1341 Ga0070697_100240312
1342 Ga0070697_100245732
1343 Ga0070697_100261947
1344 Ga0070697_100343989
1345 Ga0070697_100361071
1346 Ga0070697_100434056
1347 Ga0070697_100603315
1348 Ga0070697_100749971
1349 Ga0068853_100152224
1350 Ga0068853_100767678
1351 Ga0068853_101544874
1352 Ga0070672_100004942
1353 Ga0070672_100035162
1354 Ga0070686_100064856
1355 Ga0070686_101223724
1356 Ga0070695_100000614
1357 Ga0070695_100003609
1358 Ga0070695_100021573
1359 Ga0070695_100272091
1360 Ga0070695_100862712
1361 Ga0070696_100006655
1362 Ga0070696_100024337
1363 Ga0070696_100035533
1364 Ga0070696_100138182
1365 Ga0070696_100251783
1366 Ga0070696_100709615
1367 Ga0070696_101069271
1368 Ga0070693_100001010
1369 Ga0070704_100000183
1370 Ga0070704_100020619
1371 Ga0070704_100034763
1372 Ga0070704_100043177
1373 Ga0070704_100061775
1374 Ga0070704_100077669
1375 Ga0070704_100092028
1376 Ga0070704_100117110
1377 Ga0070704_100167786
1378 Ga0070704_100478635
1379 Ga0070704_100548529
1380 Ga0070704_100774474
1381 Ga0070704_100816316
1382 Ga0068857_100015454
1383 Ga0068857_100048994
1384 Ga0068857_100242789
1385 Ga0068854_100883176
1386 Ga0068856_100001317
1387 Ga0070702_100004128
1388 Ga0070702_100022700
1389 Ga0068852_100317140
1390 Ga0068859_100010873
1391 Ga0068859_100191962
1392 Ga0068859_100230803
1393 Ga0068859_100246468
1394 Ga0068859_100413327
1395 Ga0068859_100988589
1396 Ga0068859_101303049
1397 Ga0068864_100007764
1398 Ga0068866_10172730
1399 Ga0068866_10264831
1400 Ga0068866_10320609
1401 Ga0068861_100062468
1402 Ga0068861_100519040
1403 Ga0068861_100703482
1404 Ga0068861_101412171
1405 Ga0068870_10000253
1406 Ga0068870_10056873
1407 Ga0068870_10081275
1408 Ga0068863_100008693
1409 Ga0068863_100147099
1410 Ga0068863_100805748
1411 Ga0068858_100412010
1412 Ga0068860_100006954
1413 Ga0068860_100215129
1414 Ga0068860_100328393
1415 Ga0068860_100383151
1416 Ga0068862_100001020
1417 Ga0068862_100033965
1418 Ga0068862_100083015
1419 Ga0068862_100203102
1420 Ga0081455_10001737
1421 Ga0081455_10397281
1422 Ga0081538_10042691
1423 Ga0081540_1062515
1424 Ga0081539_10000141
1425 Ga0075432_10280965
1426 Ga0070715_10372346
1427 Ga0070715_10781766
1428 Ga0070716_100184526
1429 Ga0070716_100549577
1430 Ga0097621_101242842
1431 Ga0068871_101397098
1432 Ga0075428_100004712
1433 Ga0075428_100007368
1434 Ga0075428_100045014
1435 Ga0075428_100079455
1436 Ga0075428_100133933
1437 Ga0075428_100378988
1438 Ga0075428_100394492
1439 Ga0075428_100495044
1440 Ga0075428_100695756
1441 Ga0075428_101412226
1442 Ga0075428_101421049
1443 Ga0075428_102710772
1444 Ga0075430_100000005
1445 Ga0075430_100000114
1446 Ga0075430_100004339
1447 Ga0075430_100037725
1448 Ga0075430_100228107
1449 Ga0075430_100245411
1450 Ga0075430_100395075
1451 Ga0075430_100536526
1452 Ga0075431_100000087
1453 Ga0075431_100000188
1454 Ga0075431_100001543
1455 Ga0075431_100001745
1456 Ga0075431_100004641
1457 Ga0075431_100004760
1458 Ga0075431_100005035
1459 Ga0075431_100010317
1460 Ga0075431_100018328
1461 Ga0075431_100019316
1462 Ga0075431_100020403
1463 Ga0075431_100037040
1464 Ga0075431_100096322
1465 Ga0075431_100532801
1466 Ga0075431_100570070
1467 Ga0075431_100570343
1468 Ga0075431_100655798
1469 Ga0075431_100778359
1470 Ga0075431_100778827
1471 Ga0075433_10001653
1472 Ga0075433_10003060
1473 Ga0075433_10004130
1474 Ga0075433_10004555
1475 Ga0075433_10005753
1476 Ga0075433_10008803
1477 Ga0075433_10010998
1478 Ga0075433_10016226
1479 Ga0075433_10017801
1480 Ga0075433_10026561
1481 Ga0075433_10178247
1482 Ga0075433_10198956
1483 Ga0075433_10331457
1484 Ga0075433_10830874
1485 Ga0075433_11332274
1486 Ga0075433_11430582
1487 Ga0075434_100001968
1488 Ga0075434_100015999
1489 Ga0075434_100016066
1490 Ga0075434_100023888
1491 Ga0075434_100040245
1492 Ga0075434_100068403
1493 Ga0075434_100068557
1494 Ga0075434_100104986
1495 Ga0075434_100315316
1496 Ga0075434_100354650
1497 Ga0075434_100373368
1498 Ga0075434_100564454
1499 Ga0075434_100620570
1500 Ga0075434_100964815
1501 Ga0075434_101875498
1502 Ga0075434_102325250
1503 Ga0075429_100000077
1504 Ga0075429_100001009
1505 Ga0075429_100003071
1506 Ga0075429_100003339
1507 Ga0075429_100005435
1508 Ga0075429_100005812
1509 Ga0075429_100008673
1510 Ga0075429_100010209
1511 Ga0075429_100123317
1512 Ga0075429_100397435
1513 Ga0075429_100469107
1514 Ga0075429_100936665
1515 Ga0075429_101402407
1516 Ga0075429_101431688
1517 Ga0068865_100071154
1518 Ga0068865_100228276
1519 Ga0068865_100411959
1520 Ga0075436_100015971
1521 Ga0075436_100048050
1522 Ga0075436_100070481
1523 Ga0075436_100164944
1524 Ga0075436_100409261
1525 Ga0075436_100554986
1526 Ga0075436_100812397
1527 Ga0075436_101022440
1528 Ga0097620_100010873
1529 Ga0097620_100191956
1530 Ga0097620_100230809
1531 Ga0097620_100246461
1532 Ga0097620_100413325
1533 Ga0097620_100988495
1534 Ga0097620_101303058
1535 Ga0075435_100005814
1536 Ga0075435_100015819
1537 Ga0075435_100057602
1538 Ga0075435_100090329
1539 Ga0075435_100256080
1540 Ga0075435_100275282
1541 Ga0075435_100334388
1542 Ga0099794_10003981
1543 Ga0099794_10038355
1544 Ga0099794_10052078
1545 Ga0099794_10545138
1546 Ga0099794_10601302
1547 Ga0099794_10610442
1548 Ga0099794_10685906
1549 Ga0105240_10630869
1550 Ga0111539_10000182
1551 Ga0111539_10000225
1552 Ga0111539_10009233
1553 Ga0111539_10025822
1554 Ga0111539_10032194
1555 Ga0111539_10295467
1556 Ga0111539_10777329
1557 Ga0111539_11013545
1558 Ga0111539_11075436
1559 Ga0105245_11739903
1560 Ga0105247_10033607
1561 Ga0114129_10000129
1562 Ga0114129_10000144
1563 Ga0114129_10000167
1564 Ga0114129_10006909
1565 Ga0114129_10007616
1566 Ga0114129_10012980
1567 Ga0114129_10013686
1568 Ga0114129_10014506
1569 Ga0114129_10016073
1570 Ga0114129_10022488
1571 Ga0114129_10042140
1572 Ga0114129_10045803
1573 Ga0114129_10063138
1574 Ga0114129_10102908
1575 Ga0114129_10180984
1576 Ga0114129_10225091
1577 Ga0114129_10291437
1578 Ga0114129_10560898
1579 Ga0114129_10702793
1580 Ga0114129_10815945
1581 Ga0114129_11100425
1582 Ga0114129_11273325
1583 Ga0114129_11555920
1584 Ga0114129_12409227
1585 Ga0114129_12411540
1586 Ga0105243_10214374
1587 Ga0105243_10786240
1588 Ga0105243_11337339
1589 Ga0105243_12910381
1590 Ga0105241_10000598
1591 Ga0105241_10196421
1592 Ga0105241_10933455
1593 Ga0105242_10777765
1594 Ga0105242_11301538
1595 Ga0105248_10137178
1596 Ga0105248_10376353
1597 Ga0105248_10714166
1598 Ga0105237_10313284
1599 Ga0105249_10021142
1600 Ga0105249_10026052
1601 Ga0105249_10091502
1602 Ga0105249_10259307
1603 Ga0105249_10334604
1604 Ga0105249_10515045
1605 Ga0105249_11399104
1606 Ga0105249_11788699
1607 Ga0105246_10006924
1608 Ga0105246_12105108
1609 Ga0157373_10000102
1610 Ga0157371_10042585
1611 Ga0157371_10121451
1612 Ga0157369_10110417
1613 Ga0157378_10370883
1614 Ga0157378_10579549
1615 Ga0157378_10669171
1616 Ga0157378_11072916
1617 Ga0157378_12536058
1618 Ga0163162_10077285
1619 Ga0163162_10474042
1620 Ga0163162_11211310
1621 Ga0157372_10003901
1622 Ga0157372_10211838
1623 Ga0157375_10113794
1624 Ga0157375_11755925
1625 Ga0157375_12206798
1626 Ga0163163_10076599
1627 Ga0157380_10116240
1628 Ga0157380_10279991
1629 Ga0157380_10355513
1630 Ga0157380_11149443
1631 Ga0182008_10147907
1632 Ga0157379_10246015
1633 Ga0182007_10069352
1634 Ga0163161_10053356
1635 Ga0207653_10002488
1636 Ga0207653_10010894
1637 Ga0207653_10171295
1638 Ga0207642_10025150
1639 Ga0207642_10091300
1640 Ga0207688_10033223
1641 Ga0207647_10541816
1642 Ga0207685_10027870
1643 Ga0207645_10000033
1644 Ga0207645_10125172
1645 Ga0207643_10000057
1646 Ga0207643_10023330
1647 Ga0207643_10233245
1648 Ga0207684_10000290
1649 Ga0207684_10001361
1650 Ga0207684_10004663
1651 Ga0207684_10005034
1652 Ga0207684_10009704
1653 Ga0207684_10012824
1654 Ga0207684_10024710
1655 Ga0207684_10026439
1656 Ga0207684_10043571
1657 Ga0207684_10119760
1658 Ga0207684_10231156
1659 Ga0207684_10405729
1660 Ga0207684_10513086
1661 Ga0207684_10824453
1662 Ga0207654_10224013
1663 Ga0207654_10381196
1664 Ga0207707_10000162
1665 Ga0207707_10191025
1666 Ga0207695_10977398
1667 Ga0207660_10000298
1668 Ga0207660_10065639
1669 Ga0207660_10088120
1670 Ga0207660_10116643
1671 Ga0207660_10308101
1672 Ga0207662_10116143
1673 Ga0207662_10141243
1674 Ga0207662_10263103
1675 Ga0207657_10001228
1676 Ga0207649_10000499
1677 Ga0207652_10004938
1678 Ga0207652_10230311
1679 Ga0207646_10000203
1680 Ga0207646_10003319
1681 Ga0207646_10003381
1682 Ga0207646_10009320
1683 Ga0207646_10029566
1684 Ga0207646_10033438
1685 Ga0207646_10105688
1686 Ga0207646_10217941
1687 Ga0207646_10417598
1688 Ga0207646_10478109
1689 Ga0207646_10494493
1690 Ga0207646_10544901
1691 Ga0207646_11092354
1692 Ga0207681_10032553
1693 Ga0207681_10044320
1694 Ga0207681_10326999
1695 Ga0207681_10376852
1696 Ga0207681_10436439
1697 Ga0207659_10919623
1698 Ga0207690_10005502
1699 Ga0207706_10008636
1700 Ga0207706_10037704
1701 Ga0207706_10050972
1702 Ga0207706_10375331
1703 Ga0207709_10061255
1704 Ga0207709_10835875
1705 Ga0207709_11596647
1706 Ga0207670_10041398
1707 Ga0207670_10117535
1708 Ga0207670_10292613
1709 Ga0207669_10541728
1710 Ga0207704_10259815
1711 Ga0207704_10880327
1712 Ga0207665_10004078
1713 Ga0207665_10595800
1714 Ga0207691_10019489
1715 Ga0207691_10049387
1716 Ga0207689_10000435
1717 Ga0207689_10012462
1718 Ga0207689_10137430
1719 Ga0207689_10679114
1720 Ga0207679_10000443
1721 Ga0207667_10003858
1722 Ga0207651_10079942
1723 Ga0207712_10038058
1724 Ga0207712_10162901
1725 Ga0207712_10203303
1726 Ga0207712_10319554
1727 Ga0207712_10486411
1728 Ga0207712_10831291
1729 Ga0207712_11306868
1730 Ga0207712_11596592
1731 Ga0207668_10026443
1732 Ga0207668_10332273
1733 Ga0207640_10077459
1734 Ga0207658_10382634
1735 Ga0207703_10068471
1736 Ga0207703_10613577
1737 Ga0207639_10043475
1738 Ga0207678_10081025
1739 Ga0207708_10172346
1740 Ga0207708_10206003
1741 Ga0207708_10246764
1742 Ga0207702_10013307
1743 Ga0207641_10057363
1744 Ga0207641_10139457
1745 Ga0207641_10662322
1746 Ga0207648_10005256
1747 Ga0207648_10057823
1748 Ga0207648_10216457
1749 Ga0207648_10223011
1750 Ga0207676_10801287
1751 Ga0207676_11031072
1752 Ga0207674_10001197
1753 Ga0207674_10005197
1754 Ga0207674_10059079
1755 Ga0207675_100017304
1756 Ga0207675_100179859
1757 Ga0207675_100258726
1758 Ga0207675_100362446
1759 Ga0207675_100383036
1760 Ga0207675_100472192
1761 Ga0207683_10618688
1762 Ga0207698_10117601
1763 Ga0209969_1001678
1764 Ga0209967_1020494
1765 Ga0209996_1017505
1766 Ga0209984_1001219
1767 Ga0210000_1009151
1768 Ga0209995_1006121
1769 Ga0209999_1012096
1770 Ga0209982_1019829
1771 Ga0209983_1001259
1772 Ga0209588_1007666
1773 Ga0209588_1014679
1774 Ga0209588_1115404
1775 Ga0209971_1000006
1776 Ga0209971_1012860
1777 Ga0209971_1056035
1778 Ga0209966_1000018
1779 Ga0209966_1004738
1780 Ga0209966_1053518
1781 Ga0209998_10000167
1782 Ga0209974_10009694
1783 Ga0209974_10188511
1784 Ga0209974_10260454
1785 Ga0209974_10361877
1786 Ga0207428_10000035
1787 Ga0207428_10000514
1788 Ga0207428_10017267
1789 Ga0207428_10046714
1790 Ga0207428_10283835
1791 Ga0207428_10339063
1792 Ga0207428_10425267
1793 Ga0268265_10026939
1794 Ga0268265_10031925
1795 Ga0268265_10076514
1796 Ga0268265_10299916
1797 Ga0268265_10336709
1798 Ga0268265_10932392
1799 Ga0268264_10026913
1800 Ga0268264_10088955
1801 Ga0268264_10422474
1802 Ga0268264_11013269
1803 Ga0307408_100237858
1804 Ga0307408_100567843
1805 Ga0307405_10483709
1806 Ga0307405_10890467
1807 Ga0307413_11702695
1808 Ga0307410_10800635
1809 Ga0307406_10276006
1810 Ga0307407_10227242
1811 Ga0307409_100067265
1812 Ga0307416_102653670
1813 Ga0307411_10250047
1814 Ga0307411_11640711
1815 Ga0373948_0006067
1816 Ga0373948_0045541
1817 Ga0373938_0124257
1818 Ga0373940_0000111
1819 Ga0373940_0022337
1820 Ga0373940_0136694
1821 Ga0373940_0264407
1822 Ga0373949_0014750
1823 Ga0373949_0018929
1824 Ga0373951_0011123
1825 Ga0373952_0023309
1826 Ga0373952_0117783
1827 Ga0373932_0060102
1828 Ga0373939_0009711
1829 Ga0373939_0098277
1830 Ga0373939_0107177
1831 Ga0373939_0116307
1832 Ga0373960_0003605
1833 Ga0373961_0017220
1834 Ga0373961_0309072
1835 Ga0373962_0013791
1836 Ga0373962_0015385
1837 Ga0373962_0138305
1838 Ga0373962_0165693
1839 Ga0373931_0004693
1840 Ga0373931_0036085
1841 Ga0373931_0051948
1842 Ga0395899_0238227
1843 Ga0395900_0003223
1844 Ga0395900_0465718
1845 Ga0395898_0126990
1846 Ga0395898_0585738
1847 Ga0395905_0108938
1848 Ga0395901_0000392
1849 Ga0395901_0156029
1850 Ga0439453_0147997
1851 Ga0439443_060293
1852 Ga0439450_011420
1853 Ga0439455_0106315
1854 Ga0450892_009818
1855 Ga0439458_0127643
1856 Ga0439435_0034781
1857 Ga0439444_0026231
1858 Ga0439444_0029852
1859 Ga0439459_0002093
1860 Ga0439464_0030079
1861 Ga0439460_0000554
1862 Ga0439460_0027976
1863 Ga0439460_0175090
1864 Ga0439460_0233059
1865 Ga0451577_0008746
1866 Ga0451577_0026637
1867 Ga0451577_0127344
1868 Ga0451577_0221700
1869 Ga0451577_1594467
1870 Ga0439440_0150091
1871 Ga0439440_0254175
1872 Ga0453683_0006040
1873 Ga0453683_0052540
1874 Ga0453683_0117917
1875 Ga0453684_0047403
1876 Ga0453684_0287062
1877 Ga0453684_0442098
1878 Ga0453684_0640305
1879 Ga0451576_0005558
1880 Ga0451576_0084228
1881 Ga0451576_0154801
1882 Ga0451576_0177860
1883 Ga0451576_0223199
1884 Ga0451576_0780476
1885 Ga0451576_0855607
1886 Ga0451576_1081346
1887 Ga0451576_1731198
1888 Ga0451576_1884925
1889 Ga0495603_0266729
1890 Ga0495603_0307117
1891 Ga0495580_0007109
1892 Ga0495580_0037313
1893 Ga0495580_0163416
1894 Ga0495580_0673025
1895 Ga0495584_0435273
1896 Ga0495644_0396670
1897 Ga0495642_0041470
1898 Ga0495642_0097111
1899 Ga0495642_0292460
1900 Ga0495598_0048581
1901 Ga0495659_0012568
1902 Ga0495659_0078377
1903 Ga0495669_0113998
1904 Ga0495669_0277098
1905 Ga0495669_0563697
1906 Ga0495636_0413289
1907 Ga0496100_0561485
1908 Ga0496102_0052519
1909 Ga0496102_0344490
1910 Ga0496102_0360827
1911 Ga0496103_0538688
1912 Ga0496104_1653716
1913 Ga0496106_0110711
1914 Ga0496106_0840083
1915 Ga0496106_1282454
1916 Ga0496107_0595077
1917 Ga0496108_0401356
1918 Ga0496110_0795276
1919 Ga0496113_0327027
1920 Ga0496114_1228553
1921 Ga0501299_013434
1922 Ga0501031_0013398
1923 Ga0501031_0200317
1924 Ga0501031_0264925
1925 Ga0501031_0441193
1926 Ga0501031_0576254
1927 Ga0501032_0038978
1928 Ga0501032_0219424
1929 Ga0501033_0021421
1930 Ga0501033_0060929
1931 Ga0501033_0087969
1932 Ga0501033_0181504
1933 Ga0501034_0508444
1934 Ga0501036_0004364
1935 Ga0501036_0004586
1936 Ga0501036_0023569
1937 Ga0501036_0080223
1938 Ga0501036_0122640
1939 Ga0501036_0174501
1940 Ga0501036_0398703
1941 Ga0501036_0763510
1942 Ga0501036_0777204
1943 Ga0501036_1634108
1944 Ga0501037_0045930
1945 Ga0501037_0248362
1946 Ga0501037_0297932
1947 Ga0501037_0315602
1948 Ga0501037_0451951
1949 Ga0501038_0003376
1950 Ga0501038_0081481
1951 Ga0501038_0085470
1952 Ga0501038_0451101
1953 Ga0501038_0788179
1954 Ga0501038_1057692
1955 Ga0501039_0000357
1956 Ga0501039_0018950
1957 Ga0501039_0025129
1958 Ga0501039_0025590
1959 Ga0501039_0088388
1960 Ga0501039_0097980
1961 Ga0501039_0259431
1962 Ga0501039_0308522
1963 Ga0501039_0858119
1964 Ga0501039_1204361
1965 Ga0501040_0000403
1966 Ga0501040_0000527
1967 Ga0501040_0022584
1968 Ga0501040_0041483
1969 Ga0501040_0044981
1970 Ga0501040_0067318
1971 Ga0501040_0075397
1972 Ga0501040_0155129
1973 Ga0501040_0175865
1974 Ga0501040_0448137
1975 Ga0501040_0473272
1976 Ga0501040_0573280
1977 Ga0501040_0577179
1978 Ga0501040_1063528
1979 Ga0501041_0000801
1980 Ga0501041_0002660
1981 Ga0501041_0004582
1982 Ga0501041_0045621
1983 Ga0501041_0062725
1984 Ga0501041_0063779
1985 Ga0501041_0085212
1986 Ga0501041_0095893
1987 Ga0501041_0176837
1988 Ga0501041_0202042
1989 Ga0501041_0404561
1990 Ga0501041_0411106
1991 Ga0501041_0543334
1992 Ga0501042_0000921
1993 Ga0501042_0004544
1994 Ga0501042_0067585
1995 Ga0501042_0082052
1996 Ga0501042_0137755
1997 Ga0501042_0165603
1998 Ga0501042_0470132
1999 Ga0501042_0671696
2000 Ga0501043_0014063
2001 Ga0501043_0017942
2002 Ga0501043_0313275
2003 Ga0501043_0485461
2004 Ga0501043_0493790
2005 Ga0501043_0540123
2006 Ga0501046_0002458
2007 Ga0501046_0020367
2008 Ga0501046_0027677
2009 Ga0501046_0075373
2010 Ga0501046_0131303
2011 Ga0501046_0225497
2012 Ga0501046_0285631
2013 Ga0501046_0344279
2014 Ga0501046_0664023
2015 Ga0501046_0705801
2016 Ga0501046_0743267
2017 Ga0501046_0766117
2018 Ga0501047_0466339
2019 Ga0501048_0002741
2020 Ga0501048_0013911
2021 Ga0501048_0053115
2022 Ga0501048_0053819
2023 Ga0501048_0225307
2024 Ga0501048_0280526
2025 Ga0501048_0359806
2026 Ga0501048_0585027
2027 Ga0501048_1119285
2028 Ga0501067_0069038
2029 Ga0501068_0005528
2030 Ga0501068_0031746
2031 Ga0501068_0037069
2032 Ga0501068_0056118
2033 Ga0501068_0098815
2034 Ga0501068_0253019
2035 Ga0501068_0295389
2036 Ga0501068_0334784
2037 Ga0501068_0342313
2038 Ga0501068_0406605
2039 Ga0501068_0426878
2040 Ga0501068_0452739
2041 Ga0501068_0489244
2042 Ga0501068_0658728
2043 Ga0501069_0156374
2044 Ga0501069_0176501
2045 Ga0501069_0208469
2046 Ga0501070_0022087
2047 Ga0501070_0628679
2048 Ga0501070_0667294
2049 Ga0501070_0900920
2050 Ga0501071_0001609
2051 Ga0501071_0033389
2052 Ga0501071_0047435
2053 Ga0501071_0059823
2054 Ga0501071_0102097
2055 Ga0501071_0124697
2056 Ga0501071_0173437
2057 Ga0501071_0409662
2058 Ga0501071_0446428
2059 Ga0501071_0547821
2060 Ga0501071_0636729
2061 Ga0501071_0937538
2062 Ga0501072_0003679
2063 Ga0501072_0011077
2064 Ga0501072_0016060
2065 Ga0501072_0048063
2066 Ga0501072_0081098
2067 Ga0501072_0096542
2068 Ga0501072_0397652
2069 Ga0501072_0435810
2070 Ga0501072_0454559
2071 Ga0501072_0459203
2072 Ga0501072_0554914
2073 Ga0501072_1077977
2074 Ga0501074_0003994
2075 Ga0501074_0006930
2076 Ga0501074_0028309
2077 Ga0501074_0036386
2078 Ga0501074_0161585
2079 Ga0501074_0194354
2080 Ga0501074_0229223
2081 Ga0501074_0315875
2082 Ga0501074_0345555
2083 Ga0501074_0476974
2084 Ga0501074_0478359
2085 Ga0501074_0533938
2086 Ga0501074_0628117
2087 Ga0501074_1119420
2088 Ga0501075_0000805
2089 Ga0501075_0003261
2090 Ga0501075_0008114
2091 Ga0501075_0015118
2092 Ga0501075_0015487
2093 Ga0501075_0018006
2094 Ga0501075_0018424
2095 Ga0501075_0041411
2096 Ga0501075_0060597
2097 Ga0501075_0063044
2098 Ga0501075_0083194
2099 Ga0501075_0096848
2100 Ga0501075_0119040
2101 Ga0501075_0128408
2102 Ga0501075_0174003
2103 Ga0501075_0190371
2104 Ga0501075_0223708
2105 Ga0501075_0276601
2106 Ga0501075_0411574
2107 Ga0501075_0748371
2108 Ga0501075_0873157
2109 Ga0501075_0874902
2110 Ga0501075_0922607
2111 Ga0501075_1316898
2112 Ga0501076_0000149
2113 Ga0501076_0000520
2114 Ga0501076_0000664
2115 Ga0501076_0005670
2116 Ga0501076_0019690
2117 Ga0501076_0026552
2118 Ga0501076_0030063
2119 Ga0501076_0035275
2120 Ga0501076_0079034
2121 Ga0501076_0125082
2122 Ga0501076_0140020
2123 Ga0501076_0205802
2124 Ga0501076_0365971
2125 Ga0501076_0511141
2126 Ga0501076_1059739
2127 Ga0501077_0000493
2128 Ga0501077_0009137
2129 Ga0501077_0017669
2130 Ga0501077_0019140
2131 Ga0501077_0057202
2132 Ga0501077_0059637
2133 Ga0501077_0098462
2134 Ga0501077_0151084
2135 Ga0501077_0159468
2136 Ga0501077_0185734
2137 Ga0501077_0321544
2138 Ga0501077_0423121
2139 Ga0501077_0554930
2140 Ga0501079_0000697
2141 Ga0501079_0001092
2142 Ga0501079_0004206
2143 Ga0501079_0004276
2144 Ga0501079_0004960
2145 Ga0501079_0009292
2146 Ga0501079_0066256
2147 Ga0501079_0068205
2148 Ga0501079_0089271
2149 Ga0501079_0427937
2150 Ga0501079_0727063
2151 Ga0501079_1248148
2152 Ga0501080_0010134
2153 Ga0501080_0013911
2154 Ga0501080_0059868
2155 Ga0501080_0122565
2156 Ga0501080_0171179
2157 Ga0501080_0229033
2158 Ga0501080_0440505
2159 Ga0501080_0979382
2160 Ga0501080_1379579
2161 Ga0501080_1467647
2162 Ga0501081_0000991
2163 Ga0501081_0002545
2164 Ga0501081_0006988
2165 Ga0501081_0020687
2166 Ga0501081_0035684
2167 Ga0501081_0037134
2168 Ga0501081_0047816
2169 Ga0501081_0081995
2170 Ga0501081_0105018
2171 Ga0501081_0158160
2172 Ga0501081_0221285
2173 Ga0501081_0247990
2174 Ga0501081_0278407
2175 Ga0501081_0345019
2176 Ga0501081_0589291
2177 Ga0501081_0722218
2178 Ga0501081_1018084
2179 Ga0501083_0044391
2180 Ga0501083_0139305
2181 Ga0501083_0161374
2182 Ga0501083_0251193
2183 Ga0501083_0647933
2184 Ga0501283_079581
2185 Ga0501035_0017732
2186 Ga0501035_0319496
2187 Ga0501035_0426843
2188 Ga0501035_0583368
2189 Ga0501035_1448959
2190 Ga0501044_1519779
2191 Ga0501045_0000484
2192 Ga0501045_0001052
2193 Ga0501045_0110133
2194 Ga0501045_0147656
2195 Ga0501045_0166622
2196 Ga0501045_0201331
2197 Ga0501045_0286370
2198 Ga0501045_0328080
2199 Ga0501045_0422199
2200 Ga0501045_0604975
2201 Ga0501045_0797650
2202 Ga0501045_1052946
2203 nmdc:mga05p37_107525_c1
2204 nmdc:mga05p37_10883_c1
2205 nmdc:mga05p37_116736_c1
2206 nmdc:mga05p37_126051_c1
2207 nmdc:mga05p37_127_c1
2208 nmdc:mga05p37_1330292_c1
2209 nmdc:mga05p37_17800_c1
2210 nmdc:mga05p37_222600_c1
2211 nmdc:mga05p37_239675_c1
2212 nmdc:mga05p37_25518_c1
2213 nmdc:mga05p37_279393_c1
2214 nmdc:mga05p37_309986_c1
2215 nmdc:mga05p37_329801_c1
2216 nmdc:mga05p37_3448_c1
2217 nmdc:mga05p37_3712_c1
2218 nmdc:mga05p37_453281_c1
2219 nmdc:mga05p37_475753_c1
2220 nmdc:mga05p37_480462_c1
2221 nmdc:mga05p37_613442_c1
2222 nmdc:mga05p37_74592_c1
2223 nmdc:mga05p37_76517_c1
2224 nmdc:mga05p37_8008_c1
2225 nmdc:mga05p37_816036_c1
2226 nmdc:mga05p37_851258_c1
2227 nmdc:mga05p37_921968_c1
2228 nmdc:mga05p37_96947_c1
2229 nmdc:mga05p37_9945_c1
2230 nmdc:mga09592_14781_c1
2231 nmdc:mga09592_192197_c1
2232 nmdc:mga09592_3161_c1
2233 nmdc:mga09592_375_c1
2234 nmdc:mga09592_47648_c1
2235 nmdc:mga09592_492244_c1
2236 nmdc:mga09592_566_c2
2237 nmdc:mga09592_5844_c1
2238 nmdc:mga09592_7226_c1
2239 nmdc:mga09592_7732_c1
2240 nmdc:mga09592_92993_c1
2241 nmdc:mga0qj67_106731_c1
2242 nmdc:mga0qj67_115_c1
2243 nmdc:mga0qj67_12789_c1
2244 nmdc:mga0qj67_153712_c1
2245 nmdc:mga0qj67_203496_c1
2246 nmdc:mga0qj67_2380_c1
2247 nmdc:mga0qj67_250233_c1
2248 nmdc:mga0qj67_37588_c1
2249 nmdc:mga0qj67_379_c1
2250 nmdc:mga0qj67_386049_c1
2251 nmdc:mga06r32_10498_c1
2252 nmdc:mga06r32_1139079_c1
2253 nmdc:mga06r32_114656_c1
2254 nmdc:mga06r32_1154869_c1
2255 nmdc:mga06r32_1305_c1
2256 nmdc:mga06r32_1370783_c1
2257 nmdc:mga06r32_138939_c1
2258 nmdc:mga06r32_22600_c1
2259 nmdc:mga06r32_233756_c1
2260 nmdc:mga06r32_280361_c1
2261 nmdc:mga06r32_2842_c1
2262 nmdc:mga06r32_423_c1
2263 nmdc:mga06r32_442668_c1
2264 nmdc:mga06r32_479473_c1
2265 nmdc:mga06r32_522933_c1
2266 nmdc:mga06r32_522_c1
2267 nmdc:mga06r32_5431_c1
2268 nmdc:mga06r32_589306_c1
2269 nmdc:mga06r32_59253_c1
2270 nmdc:mga06r32_9731_c1
2271 nmdc:mga08y16_19385_c1
2272 nmdc:mga08y16_193878_c1
2273 nmdc:mga08y16_213472_c1
2274 nmdc:mga08y16_231452_c1
2275 nmdc:mga08y16_29316_c1
2276 nmdc:mga08y16_48098_c1
2277 nmdc:mga08y16_531313_c1
2278 nmdc:mga08y16_5803_c1
2279 nmdc:mga08y16_7686_c1
2280 nmdc:mga0n895_133016_c1
2281 nmdc:mga0n895_136135_c1
2282 nmdc:mga0n895_139150_c1
2283 nmdc:mga0n895_14621_c1
2284 nmdc:mga0n895_151294_c1
2285 nmdc:mga0n895_170271_c1
2286 nmdc:mga0n895_19405_c1
2287 nmdc:mga0n895_1986079_c1
2288 nmdc:mga0n895_283576_c1
2289 nmdc:mga0n895_2838_c1
2290 nmdc:mga0n895_379233_c1
2291 nmdc:mga0n895_4375_c1
2292 nmdc:mga0n895_509625_c1
2293 nmdc:mga0n895_573498_c1
2294 nmdc:mga0n895_630315_c1
2295 nmdc:mga0n895_883897_c1
2296 nmdc:mga0rr50_132390_c1
2297 nmdc:mga0rr50_140485_c1
2298 nmdc:mga0rr50_147717_c1
2299 nmdc:mga0rr50_1496_c1
2300 nmdc:mga0rr50_291779_c1
2301 nmdc:mga0rr50_29233_c1
2302 nmdc:mga0rr50_457992_c1
2303 nmdc:mga0rr50_67169_c1
2304 nmdc:mga0rr50_750990_c1
2305 nmdc:mga08x19_10378_c1
2306 nmdc:mga08x19_16985_c1
2307 nmdc:mga08x19_35360_c1
2308 nmdc:mga0a205_1066773_c1
2309 nmdc:mga0a205_110958_c1
2310 nmdc:mga0a205_1293_c1
2311 nmdc:mga0a205_16159_c1
2312 nmdc:mga0a205_16163_c1
2313 nmdc:mga0a205_162351_c1
2314 nmdc:mga0a205_178_c1
2315 nmdc:mga0a205_188176_c1
2316 nmdc:mga0a205_229700_c1
2317 nmdc:mga0a205_23282_c1
2318 nmdc:mga0a205_261019_c1
2319 nmdc:mga0a205_304228_c1
2320 nmdc:mga0a205_34892_c1
2321 nmdc:mga0a205_405873_c1
2322 nmdc:mga0a205_5041_c1
2323 nmdc:mga0a205_5513_c1
2324 nmdc:mga0a205_650041_c1
2325 nmdc:mga0a205_743316_c1
2326 nmdc:mga0a205_8279_c1
2327 Ga0501084_0000115
2328 Ga0501084_0001161
2329 Ga0501084_0003225
2330 Ga0501084_0009378
2331 Ga0501084_0009581
2332 Ga0501084_0026332
2333 Ga0501084_0055713
2334 Ga0501084_0104516
2335 Ga0501084_0449938
2336 Ga0501084_0497423
2337 Ga0501084_0498224
2338 Ga0501084_0653812
2339 Ga0501084_0766865
2340 Ga0501084_0939335
2341 Ga0501084_1378131
2342 Ga0590071_020356
2343 Ga0590075_026961
2344 Ga0501082_0004253
2345 Ga0501082_0009232
2346 Ga0501082_0010628
2347 Ga0501082_0011087
2348 Ga0501082_0023355
2349 Ga0501082_0028683
2350 Ga0501082_0039471
2351 Ga0501082_0041308
2352 Ga0501082_0059851
2353 Ga0501082_0091585
2354 Ga0501082_0110384
2355 Ga0501082_0149194
2356 Ga0501082_0297227
2357 Ga0501082_0403433
2358 Ga0501082_0496516
2359 Ga0501082_0578762
2360 Ga0501082_0838846
2361 Ga0530510_0000288
2362 Ga0530510_0000417
2363 Ga0530510_0001021
2364 Ga0530510_0008672
2365 Ga0530510_0011087
2366 Ga0530510_0032939
2367 Ga0530510_0064846
2368 Ga0530510_0089015
2369 Ga0530510_0101630
2370 Ga0530510_0112213
2371 Ga0530510_0159336
2372 Ga0530510_0166690
2373 Ga0530510_0320351
2374 Ga0530510_0373084
2375 Ga0530510_0396027
2376 Ga0530510_0437710

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

19

141

0.98

Map