F491322
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1182 | 393 | 2364 | 192 |
Family's Representative Sequence
| Representative Sequence | 3300025936|Ga0207670_10560662|Ga0207670_105606622 |
| Length | 233 |
| Sequence | MRRRAALEAIYPELERCVVVTIMGAVAAELQSIGHRPGFFYLQHAMGLASSMGLGIALSRPELKVVVVDGDGSVLMNLGGLTTLARYRPRNLVHVVFDNESLLSVGGFPTATSTGSDIAKVGAAAGIERTITVRALDEFRSAFAGALAADTLSLIVAKVEAVGPSAYVTDLSLLENRYQFQRHLRERVLHKAERRSPRLREEGGASERAVQRAVVRLDRSPGKLRVALLLSRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 130 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 196 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 197 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 201 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 204 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 208 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 215 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 216 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 220 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 228 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 229 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 230 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 231 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 232 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 233 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 234 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 235 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 236 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 237 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 238 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 239 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 240 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 241 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 242 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 243 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 244 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 245 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 246 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 247 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 248 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 249 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 250 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 251 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 252 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 253 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 254 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 255 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 256 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 257 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 258 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 259 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 315 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 316 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 317 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 318 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 319 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 320 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 323 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 324 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 325 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 326 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 327 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 328 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 329 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 330 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 331 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 332 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 357 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 358 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 359 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 370 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 371 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 372 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 386 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 387 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 389 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 390 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 393 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.98 |
| Metatranscriptomes | 0.93 |
| Isolates | 0.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.78 |
| Nodule | 0.08 |
| Rhizoplane | 3.81 |
| Rhizosphere | 93.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207670_10560662 | 3300025936 | Bacteria | 934 |
| 2 | MBSR1b_contig_3986932 | 2162886012 | Bacteria | 800 |
| 3 | rootH2_10198595 | 3300003320 | Unclassified | 1025 |
| 4 | Ga0065712_10111273 | 3300005290 | Bacteria | 1820 |
| 5 | Ga0065712_10227585 | 3300005290 | Bacteria | 1021 |
| 6 | Ga0065715_10123992 | 3300005293 | Bacteria | 2102 |
| 7 | Ga0065715_10145971 | 3300005293 | Bacteria | 1788 |
| 8 | Ga0065707_10114551 | 3300005295 | Bacteria | 2294 |
| 9 | Ga0065707_10124965 | 3300005295 | Bacteria | 2033 |
| 10 | Ga0065707_10623721 | 3300005295 | Bacteria | 667 |
| 11 | Ga0070676_10022501 | 3300005328 | Bacteria | 3534 |
| 12 | Ga0070683_100000285 | 3300005329 | Bacteria | 34780 |
| 13 | Ga0070683_100000885 | 3300005329 | Bacteria | 22232 |
| 14 | Ga0070683_100457824 | 3300005329 | Bacteria | 1217 |
| 15 | Ga0070690_100198575 | 3300005330 | Bacteria | 1394 |
| 16 | Ga0070690_100219435 | 3300005330 | Bacteria | 1332 |
| 17 | Ga0070670_100115259 | 3300005331 | Bacteria | 2316 |
| 18 | Ga0070670_101192749 | 3300005331 | Unclassified | 695 |
| 19 | Ga0070670_101223154 | 3300005331 | Unclassified | 687 |
| 20 | Ga0070680_100032407 | 3300005336 | Bacteria | 4207 |
| 21 | Ga0070680_100033912 | 3300005336 | Bacteria | 4116 |
| 22 | Ga0070680_100079500 | 3300005336 | Bacteria | 2703 |
| 23 | Ga0070680_100569918 | 3300005336 | Bacteria | 971 |
| 24 | Ga0068868_100321709 | 3300005338 | Bacteria | 1318 |
| 25 | Ga0068868_100764613 | 3300005338 | Unclassified | 869 |
| 26 | Ga0070689_100000097 | 3300005340 | Bacteria | 50763 |
| 27 | Ga0070689_100045297 | 3300005340 | Bacteria | 3387 |
| 28 | Ga0070689_100076039 | 3300005340 | Bacteria | 2630 |
| 29 | Ga0070691_10000311 | 3300005341 | Bacteria | 17106 |
| 30 | Ga0070691_10319055 | 3300005341 | Bacteria | 854 |
| 31 | Ga0070691_10330130 | 3300005341 | Bacteria | 841 |
| 32 | Ga0070687_100040318 | 3300005343 | Bacteria | 2352 |
| 33 | Ga0070661_100020968 | 3300005344 | Bacteria | 4665 |
| 34 | Ga0070692_10063869 | 3300005345 | Bacteria | 1946 |
| 35 | Ga0070692_10198624 | 3300005345 | Bacteria | 1173 |
| 36 | Ga0070692_10292257 | 3300005345 | Bacteria | 992 |
| 37 | Ga0070668_100006373 | 3300005347 | Bacteria | 8744 |
| 38 | Ga0070668_100009927 | 3300005347 | Bacteria | 7051 |
| 39 | Ga0070668_100121302 | 3300005347 | Bacteria | 2090 |
| 40 | Ga0070669_100008994 | 3300005353 | Bacteria | 7125 |
| 41 | Ga0070669_100010632 | 3300005353 | Bacteria | 6534 |
| 42 | Ga0070669_100031415 | 3300005353 | Bacteria | 3836 |
| 43 | Ga0070669_100173602 | 3300005353 | Bacteria | 1682 |
| 44 | Ga0070675_100623882 | 3300005354 | Bacteria | 979 |
| 45 | Ga0070675_101081867 | 3300005354 | Bacteria | 737 |
| 46 | Ga0070671_100006892 | 3300005355 | Bacteria | 9102 |
| 47 | Ga0070671_100401932 | 3300005355 | Bacteria | 1172 |
| 48 | Ga0070671_100918270 | 3300005355 | Bacteria | 765 |
| 49 | Ga0070674_100184176 | 3300005356 | Bacteria | 1602 |
| 50 | Ga0070674_100330597 | 3300005356 | Bacteria | 1225 |
| 51 | Ga0070673_100110108 | 3300005364 | Bacteria | 2283 |
| 52 | Ga0070673_100676168 | 3300005364 | Bacteria | 946 |
| 53 | Ga0070688_100000331 | 3300005365 | Bacteria | 24254 |
| 54 | Ga0070688_100365484 | 3300005365 | Bacteria | 1060 |
| 55 | Ga0070688_100719393 | 3300005365 | Bacteria | 775 |
| 56 | Ga0070659_100221997 | 3300005366 | Bacteria | 1560 |
| 57 | Ga0070667_100028146 | 3300005367 | Bacteria | 4678 |
| 58 | Ga0070667_100679636 | 3300005367 | Bacteria | 951 |
| 59 | Ga0070667_100777973 | 3300005367 | Bacteria | 888 |
| 60 | Ga0070709_10010582 | 3300005434 | Bacteria | 5113 |
| 61 | Ga0070709_10014499 | 3300005434 | Bacteria | 4458 |
| 62 | Ga0070709_10149359 | 3300005434 | Bacteria | 1613 |
| 63 | Ga0070709_10166502 | 3300005434 | Bacteria | 1537 |
| 64 | Ga0070714_100027756 | 3300005435 | Bacteria | 4690 |
| 65 | Ga0070714_100092496 | 3300005435 | Bacteria | 2651 |
| 66 | Ga0070714_100116478 | 3300005435 | Unclassified | 2372 |
| 67 | Ga0070714_100147307 | 3300005435 | Unclassified | 2119 |
| 68 | Ga0070714_100169619 | 3300005435 | Bacteria | 1980 |
| 69 | Ga0070714_100525394 | 3300005435 | Bacteria | 1131 |
| 70 | Ga0070714_100584890 | 3300005435 | Unclassified | 1071 |
| 71 | Ga0070713_100000652 | 3300005436 | Bacteria | 22180 |
| 72 | Ga0070713_100006798 | 3300005436 | Bacteria | 7969 |
| 73 | Ga0070713_100014331 | 3300005436 | Bacteria | 5883 |
| 74 | Ga0070713_100021942 | 3300005436 | Bacteria | 4924 |
| 75 | Ga0070713_100056483 | 3300005436 | Bacteria | 3265 |
| 76 | Ga0070713_100073704 | 3300005436 | Bacteria | 2890 |
| 77 | Ga0070713_100095141 | 3300005436 | Bacteria | 2569 |
| 78 | Ga0070713_100169079 | 3300005436 | Bacteria | 1957 |
| 79 | Ga0070713_100237810 | 3300005436 | Bacteria | 1657 |
| 80 | Ga0070713_100238354 | 3300005436 | Bacteria | 1656 |
| 81 | Ga0070713_100689425 | 3300005436 | Bacteria | 975 |
| 82 | Ga0070710_10019985 | 3300005437 | Bacteria | 3469 |
| 83 | Ga0070710_10113917 | 3300005437 | Bacteria | 1628 |
| 84 | Ga0070710_10152228 | 3300005437 | Bacteria | 1427 |
| 85 | Ga0070710_10170815 | 3300005437 | Bacteria | 1354 |
| 86 | Ga0070701_10590171 | 3300005438 | Bacteria | 734 |
| 87 | Ga0070711_100001160 | 3300005439 | Bacteria | 14179 |
| 88 | Ga0070711_100004773 | 3300005439 | Bacteria | 8031 |
| 89 | Ga0070711_100010993 | 3300005439 | Bacteria | 5612 |
| 90 | Ga0070711_100016541 | 3300005439 | Bacteria | 4685 |
| 91 | Ga0070711_100577215 | 3300005439 | Bacteria | 936 |
| 92 | Ga0070711_100712998 | 3300005439 | Unclassified | 845 |
| 93 | Ga0070705_100014030 | 3300005440 | Bacteria | 4112 |
| 94 | Ga0070705_100063181 | 3300005440 | Bacteria | 2208 |
| 95 | Ga0070705_100408827 | 3300005440 | Unclassified | 1007 |
| 96 | Ga0070700_100004714 | 3300005441 | Bacteria | 7145 |
| 97 | Ga0070700_100262953 | 3300005441 | Unclassified | 1243 |
| 98 | Ga0070700_100433722 | 3300005441 | Bacteria | 996 |
| 99 | Ga0070700_100863394 | 3300005441 | Bacteria | 734 |
| 100 | Ga0070694_100179358 | 3300005444 | Bacteria | 1565 |
| 101 | Ga0070694_100708600 | 3300005444 | Bacteria | 819 |
| 102 | Ga0070694_101177493 | 3300005444 | Bacteria | 642 |
| 103 | Ga0070708_100000011 | 3300005445 | Bacteria | 134770 |
| 104 | Ga0070708_100049356 | 3300005445 | Unclassified | 3723 |
| 105 | Ga0070708_100051450 | 3300005445 | Bacteria | 3650 |
| 106 | Ga0070708_100061977 | 3300005445 | Bacteria | 3343 |
| 107 | Ga0070708_100152387 | 3300005445 | Bacteria | 2150 |
| 108 | Ga0070708_100323002 | 3300005445 | Bacteria | 1454 |
| 109 | Ga0070663_100121970 | 3300005455 | Bacteria | 1970 |
| 110 | Ga0070662_100033401 | 3300005457 | Bacteria | 3622 |
| 111 | Ga0070662_100062454 | 3300005457 | Bacteria | 2722 |
| 112 | Ga0070662_100320008 | 3300005457 | Bacteria | 1265 |
| 113 | Ga0070681_10001001 | 3300005458 | Bacteria | 23934 |
| 114 | Ga0070681_10021576 | 3300005458 | Bacteria | 6455 |
| 115 | Ga0070681_10065204 | 3300005458 | Bacteria | 3611 |
| 116 | Ga0070681_10110890 | 3300005458 | Bacteria | 2683 |
| 117 | Ga0070681_10664202 | 3300005458 | Bacteria | 957 |
| 118 | Ga0068867_100017645 | 3300005459 | Bacteria | 5068 |
| 119 | Ga0068867_100029757 | 3300005459 | Bacteria | 3936 |
| 120 | Ga0068867_100881280 | 3300005459 | Unclassified | 804 |
| 121 | Ga0070685_10031643 | 3300005466 | Bacteria | 2958 |
| 122 | Ga0070685_10588778 | 3300005466 | Unclassified | 799 |
| 123 | Ga0070706_100005169 | 3300005467 | Bacteria | 12456 |
| 124 | Ga0070706_100026602 | 3300005467 | Bacteria | 5323 |
| 125 | Ga0070706_100040746 | 3300005467 | Bacteria | 4287 |
| 126 | Ga0070706_100052542 | 3300005467 | Unclassified | 3760 |
| 127 | Ga0070707_100108697 | 3300005468 | Unclassified | 2690 |
| 128 | Ga0070707_100109797 | 3300005468 | Bacteria | 2675 |
| 129 | Ga0070707_100119166 | 3300005468 | Bacteria | 2562 |
| 130 | Ga0070707_100292462 | 3300005468 | Bacteria | 1583 |
| 131 | Ga0070707_100316783 | 3300005468 | Unclassified | 1516 |
| 132 | Ga0070707_100336724 | 3300005468 | Bacteria | 1466 |
| 133 | Ga0070707_100495991 | 3300005468 | Bacteria | 1183 |
| 134 | Ga0070707_100501585 | 3300005468 | Unclassified | 1175 |
| 135 | Ga0070707_101008295 | 3300005468 | Bacteria | 798 |
| 136 | Ga0070698_100007599 | 3300005471 | Bacteria | 11730 |
| 137 | Ga0070698_100061946 | 3300005471 | Bacteria | 3775 |
| 138 | Ga0070698_100131771 | 3300005471 | Bacteria | 2455 |
| 139 | Ga0070698_100143391 | 3300005471 | Bacteria | 2339 |
| 140 | Ga0070698_100260561 | 3300005471 | Bacteria | 1666 |
| 141 | Ga0070698_100418818 | 3300005471 | Bacteria | 1274 |
| 142 | Ga0070698_100441858 | 3300005471 | Bacteria | 1236 |
| 143 | Ga0070698_100465619 | 3300005471 | Bacteria | 1200 |
| 144 | Ga0070698_100475518 | 3300005471 | Bacteria | 1186 |
| 145 | Ga0070698_100864887 | 3300005471 | Unclassified | 849 |
| 146 | Ga0070698_101147414 | 3300005471 | Bacteria | 726 |
| 147 | Ga0070699_100001465 | 3300005518 | Bacteria | 21610 |
| 148 | Ga0070699_100011744 | 3300005518 | Bacteria | 7558 |
| 149 | Ga0070699_100041970 | 3300005518 | Bacteria | 3958 |
| 150 | Ga0070699_100048893 | 3300005518 | Bacteria | 3660 |
| 151 | Ga0070699_100119111 | 3300005518 | Bacteria | 2321 |
| 152 | Ga0070699_100162453 | 3300005518 | Unclassified | 1977 |
| 153 | Ga0070699_100177367 | 3300005518 | Bacteria | 1890 |
| 154 | Ga0070699_100385441 | 3300005518 | Bacteria | 1266 |
| 155 | Ga0070699_100725767 | 3300005518 | Bacteria | 908 |
| 156 | Ga0070679_100006936 | 3300005530 | Bacteria | 10567 |
| 157 | Ga0070679_100016478 | 3300005530 | Bacteria | 7131 |
| 158 | Ga0070679_100176249 | 3300005530 | Bacteria | 2110 |
| 159 | Ga0070684_100002974 | 3300005535 | Bacteria | 12617 |
| 160 | Ga0070684_100032801 | 3300005535 | Bacteria | 4430 |
| 161 | Ga0070684_100044962 | 3300005535 | Bacteria | 3822 |
| 162 | Ga0070684_100304938 | 3300005535 | Unclassified | 1462 |
| 163 | Ga0070684_100319971 | 3300005535 | Bacteria | 1425 |
| 164 | Ga0070684_100829755 | 3300005535 | Bacteria | 865 |
| 165 | Ga0070697_100011432 | 3300005536 | Bacteria | 6939 |
| 166 | Ga0070697_100058542 | 3300005536 | Unclassified | 3136 |
| 167 | Ga0070697_100067666 | 3300005536 | Bacteria | 2922 |
| 168 | Ga0070697_100454683 | 3300005536 | Bacteria | 1116 |
| 169 | Ga0070697_100646586 | 3300005536 | Bacteria | 931 |
| 170 | Ga0068853_100260917 | 3300005539 | Bacteria | 1593 |
| 171 | Ga0070672_100029846 | 3300005543 | Bacteria | 4092 |
| 172 | Ga0070672_100039794 | 3300005543 | Bacteria | 3603 |
| 173 | Ga0070672_100099084 | 3300005543 | Bacteria | 2362 |
| 174 | Ga0070672_100290360 | 3300005543 | Bacteria | 1384 |
| 175 | Ga0070672_100784287 | 3300005543 | Bacteria | 838 |
| 176 | Ga0070686_100155207 | 3300005544 | Bacteria | 1607 |
| 177 | Ga0070686_100503922 | 3300005544 | Bacteria | 940 |
| 178 | Ga0070695_100002602 | 3300005545 | Bacteria | 10423 |
| 179 | Ga0070696_100015489 | 3300005546 | Bacteria | 5121 |
| 180 | Ga0070696_100035051 | 3300005546 | Bacteria | 3454 |
| 181 | Ga0070696_101193998 | 3300005546 | Bacteria | 642 |
| 182 | Ga0070693_100133143 | 3300005547 | Bacteria | 1557 |
| 183 | Ga0070704_100008355 | 3300005549 | Bacteria | 6203 |
| 184 | Ga0070704_100918572 | 3300005549 | Bacteria | 788 |
| 185 | Ga0068855_100149447 | 3300005563 | Bacteria | 2657 |
| 186 | Ga0068855_100374073 | 3300005563 | Unclassified | 1565 |
| 187 | Ga0068855_100672466 | 3300005563 | Bacteria | 1110 |
| 188 | Ga0070664_100064215 | 3300005564 | Bacteria | 3131 |
| 189 | Ga0070664_100162795 | 3300005564 | Bacteria | 1975 |
| 190 | Ga0070664_100288604 | 3300005564 | Bacteria | 1481 |
| 191 | Ga0070664_100421363 | 3300005564 | Bacteria | 1223 |
| 192 | Ga0070664_100949999 | 3300005564 | Bacteria | 807 |
| 193 | Ga0068857_100006115 | 3300005577 | Bacteria | 10281 |
| 194 | Ga0068857_100028102 | 3300005577 | Bacteria | 4961 |
| 195 | Ga0068857_101437586 | 3300005577 | Unclassified | 671 |
| 196 | Ga0068854_100451228 | 3300005578 | Bacteria | 1074 |
| 197 | Ga0068854_100481043 | 3300005578 | Bacteria | 1042 |
| 198 | Ga0068854_100591721 | 3300005578 | Unclassified | 946 |
| 199 | Ga0068856_100002563 | 3300005614 | Bacteria | 18717 |
| 200 | Ga0068856_100215639 | 3300005614 | Bacteria | 1935 |
| 201 | Ga0068856_101278035 | 3300005614 | Unclassified | 749 |
| 202 | Ga0070702_100002995 | 3300005615 | Bacteria | 7466 |
| 203 | Ga0068852_100033298 | 3300005616 | Bacteria | 4276 |
| 204 | Ga0068859_100042980 | 3300005617 | Bacteria | 4541 |
| 205 | Ga0068859_100711221 | 3300005617 | Bacteria | 1095 |
| 206 | Ga0068864_100092584 | 3300005618 | Bacteria | 2669 |
| 207 | Ga0068864_100218126 | 3300005618 | Bacteria | 1759 |
| 208 | Ga0068864_100549589 | 3300005618 | Bacteria | 1116 |
| 209 | Ga0068861_100137588 | 3300005719 | Bacteria | 1989 |
| 210 | Ga0068861_100238401 | 3300005719 | Bacteria | 1546 |
| 211 | Ga0068863_100000908 | 3300005841 | Bacteria | 29779 |
| 212 | Ga0068863_100674922 | 3300005841 | Bacteria | 1026 |
| 213 | Ga0068863_100946958 | 3300005841 | Bacteria | 862 |
| 214 | Ga0068863_100952967 | 3300005841 | Bacteria | 860 |
| 215 | Ga0068858_100105360 | 3300005842 | Bacteria | 2631 |
| 216 | Ga0068858_100677679 | 3300005842 | Bacteria | 1003 |
| 217 | Ga0068858_100991778 | 3300005842 | Bacteria | 823 |
| 218 | Ga0068860_100053850 | 3300005843 | Bacteria | 3825 |
| 219 | Ga0068860_100060582 | 3300005843 | Bacteria | 3597 |
| 220 | Ga0068860_100479555 | 3300005843 | Bacteria | 1240 |
| 221 | Ga0068862_100000825 | 3300005844 | Bacteria | 30645 |
| 222 | Ga0081455_10073317 | 3300005937 | Bacteria | 2831 |
| 223 | Ga0081455_10120184 | 3300005937 | Bacteria | 2071 |
| 224 | Ga0081538_10005103 | 3300005981 | Bacteria | 11924 |
| 225 | Ga0081538_10058510 | 3300005981 | Bacteria | 2235 |
| 226 | Ga0081539_10003032 | 3300005985 | Bacteria | 21771 |
| 227 | Ga0081539_10066354 | 3300005985 | Bacteria | 1956 |
| 228 | Ga0081539_10305735 | 3300005985 | Bacteria | 682 |
| 229 | Ga0070717_10007152 | 3300006028 | Bacteria | 8272 |
| 230 | Ga0070717_10011548 | 3300006028 | Bacteria | 6710 |
| 231 | Ga0070717_10029455 | 3300006028 | Unclassified | 4404 |
| 232 | Ga0070717_10040442 | 3300006028 | Bacteria | 3797 |
| 233 | Ga0070717_10072343 | 3300006028 | Bacteria | 2879 |
| 234 | Ga0070717_10122669 | 3300006028 | Bacteria | 2228 |
| 235 | Ga0070717_10253466 | 3300006028 | Bacteria | 1555 |
| 236 | Ga0070717_10363866 | 3300006028 | Unclassified | 1295 |
| 237 | Ga0070717_10671644 | 3300006028 | Unclassified | 941 |
| 238 | Ga0070717_10690742 | 3300006028 | Bacteria | 927 |
| 239 | Ga0070717_10940368 | 3300006028 | Unclassified | 787 |
| 240 | Ga0070717_11188645 | 3300006028 | Unclassified | 694 |
| 241 | Ga0075368_10035707 | 3300006042 | Bacteria | 1941 |
| 242 | Ga0075364_10009943 | 3300006051 | Bacteria | 5723 |
| 243 | Ga0075364_10050996 | 3300006051 | Bacteria | 2701 |
| 244 | Ga0075364_10285451 | 3300006051 | Bacteria | 1123 |
| 245 | Ga0070715_10003272 | 3300006163 | Bacteria | 5117 |
| 246 | Ga0070715_10006430 | 3300006163 | Unclassified | 3995 |
| 247 | Ga0070715_10065527 | 3300006163 | Bacteria | 1608 |
| 248 | Ga0070716_100012863 | 3300006173 | Unclassified | 4254 |
| 249 | Ga0070716_100057385 | 3300006173 | Bacteria | 2237 |
| 250 | Ga0070716_100085772 | 3300006173 | Bacteria | 1892 |
| 251 | Ga0070716_100365074 | 3300006173 | Bacteria | 1027 |
| 252 | Ga0070716_100770581 | 3300006173 | Unclassified | 742 |
| 253 | Ga0070716_100908641 | 3300006173 | Bacteria | 690 |
| 254 | Ga0070712_100002509 | 3300006175 | Bacteria | 11315 |
| 255 | Ga0070712_100002786 | 3300006175 | Bacteria | 10794 |
| 256 | Ga0070712_100154314 | 3300006175 | Bacteria | 1766 |
| 257 | Ga0070712_100467107 | 3300006175 | Bacteria | 1053 |
| 258 | Ga0070712_100650627 | 3300006175 | Bacteria | 895 |
| 259 | Ga0075362_10003235 | 3300006177 | Bacteria | 5651 |
| 260 | Ga0075367_10025633 | 3300006178 | Bacteria | 3336 |
| 261 | Ga0075367_10027307 | 3300006178 | Bacteria | 3246 |
| 262 | Ga0075366_10044372 | 3300006195 | Bacteria | 2635 |
| 263 | Ga0097621_100006910 | 3300006237 | Bacteria | 8078 |
| 264 | Ga0097621_100106784 | 3300006237 | Bacteria | 2362 |
| 265 | Ga0097621_100240621 | 3300006237 | Bacteria | 1582 |
| 266 | Ga0075370_10079271 | 3300006353 | Bacteria | 1886 |
| 267 | Ga0068871_100907182 | 3300006358 | Bacteria | 817 |
| 268 | Ga0075428_100057162 | 3300006844 | Bacteria | 4271 |
| 269 | Ga0075428_100163953 | 3300006844 | Bacteria | 2411 |
| 270 | Ga0075428_100291678 | 3300006844 | Bacteria | 1755 |
| 271 | Ga0075428_100773785 | 3300006844 | Bacteria | 1021 |
| 272 | Ga0075430_100013818 | 3300006846 | Bacteria | 6878 |
| 273 | Ga0075430_100093531 | 3300006846 | Bacteria | 2513 |
| 274 | Ga0075430_100223245 | 3300006846 | Unclassified | 1563 |
| 275 | Ga0075430_100322310 | 3300006846 | Bacteria | 1277 |
| 276 | Ga0075430_100566279 | 3300006846 | Bacteria | 937 |
| 277 | Ga0075431_100136884 | 3300006847 | Bacteria | 2525 |
| 278 | Ga0075431_100155525 | 3300006847 | Bacteria | 2352 |
| 279 | Ga0075431_100262096 | 3300006847 | Bacteria | 1754 |
| 280 | Ga0075431_100344092 | 3300006847 | Bacteria | 1500 |
| 281 | Ga0075433_10014954 | 3300006852 | Bacteria | 6353 |
| 282 | Ga0075433_10111250 | 3300006852 | Bacteria | 2430 |
| 283 | Ga0075433_10127741 | 3300006852 | Bacteria | 2258 |
| 284 | Ga0075433_10150613 | 3300006852 | Bacteria | 2069 |
| 285 | Ga0075433_10881344 | 3300006852 | Bacteria | 781 |
| 286 | Ga0075434_100000451 | 3300006871 | Bacteria | 30624 |
| 287 | Ga0075434_100018027 | 3300006871 | Bacteria | 6812 |
| 288 | Ga0075434_100020202 | 3300006871 | Bacteria | 6454 |
| 289 | Ga0075434_100159251 | 3300006871 | Bacteria | 2277 |
| 290 | Ga0075434_100160874 | 3300006871 | Bacteria | 2265 |
| 291 | Ga0075434_100219315 | 3300006871 | Bacteria | 1922 |
| 292 | Ga0075434_100469607 | 3300006871 | Bacteria | 1279 |
| 293 | Ga0075434_100521139 | 3300006871 | Bacteria | 1209 |
| 294 | Ga0075434_101067696 | 3300006871 | Bacteria | 821 |
| 295 | Ga0075429_100051881 | 3300006880 | Unclassified | 3568 |
| 296 | Ga0075429_100086007 | 3300006880 | Bacteria | 2740 |
| 297 | Ga0075429_100495056 | 3300006880 | Bacteria | 1071 |
| 298 | Ga0075429_100554595 | 3300006880 | Bacteria | 1007 |
| 299 | Ga0068865_100036113 | 3300006881 | Bacteria | 3329 |
| 300 | Ga0068865_100080123 | 3300006881 | Bacteria | 2341 |
| 301 | Ga0068865_100175854 | 3300006881 | Bacteria | 1645 |
| 302 | Ga0075436_100000203 | 3300006914 | Bacteria | 36662 |
| 303 | Ga0097620_100042978 | 3300006931 | Bacteria | 4541 |
| 304 | Ga0097620_100656304 | 3300006931 | Bacteria | 1141 |
| 305 | Ga0097620_100711313 | 3300006931 | Bacteria | 1095 |
| 306 | Ga0075435_100000012 | 3300007076 | Bacteria | 108852 |
| 307 | Ga0075435_100131120 | 3300007076 | Bacteria | 2098 |
| 308 | Ga0075435_100251014 | 3300007076 | Bacteria | 1506 |
| 309 | Ga0075435_100344506 | 3300007076 | Bacteria | 1277 |
| 310 | Ga0075435_100609683 | 3300007076 | Unclassified | 947 |
| 311 | Ga0099794_10052262 | 3300007265 | Bacteria | 1969 |
| 312 | Ga0105240_10037867 | 3300009093 | Bacteria | 6194 |
| 313 | Ga0105240_10099581 | 3300009093 | Bacteria | 3538 |
| 314 | Ga0105240_10211946 | 3300009093 | Unclassified | 2263 |
| 315 | Ga0105240_10445109 | 3300009093 | Bacteria | 1451 |
| 316 | Ga0105240_10855540 | 3300009093 | Bacteria | 981 |
| 317 | Ga0111539_10008520 | 3300009094 | Bacteria | 13028 |
| 318 | Ga0111539_10010938 | 3300009094 | Bacteria | 11422 |
| 319 | Ga0111539_10023712 | 3300009094 | Bacteria | 7539 |
| 320 | Ga0111539_10036591 | 3300009094 | Bacteria | 5933 |
| 321 | Ga0111539_10055948 | 3300009094 | Bacteria | 4690 |
| 322 | Ga0111539_10292196 | 3300009094 | Bacteria | 1896 |
| 323 | Ga0111539_10697814 | 3300009094 | Bacteria | 1181 |
| 324 | Ga0111539_10997450 | 3300009094 | Bacteria | 973 |
| 325 | Ga0111539_11021357 | 3300009094 | Bacteria | 961 |
| 326 | Ga0105245_10585683 | 3300009098 | Bacteria | 1140 |
| 327 | Ga0105247_10079189 | 3300009101 | Bacteria | 2067 |
| 328 | Ga0114129_10008502 | 3300009147 | Bacteria | 14631 |
| 329 | Ga0114129_10021385 | 3300009147 | Bacteria | 9183 |
| 330 | Ga0114129_10023980 | 3300009147 | Bacteria | 8646 |
| 331 | Ga0114129_10033927 | 3300009147 | Bacteria | 7209 |
| 332 | Ga0114129_10057157 | 3300009147 | Bacteria | 5462 |
| 333 | Ga0114129_10100063 | 3300009147 | Bacteria | 4012 |
| 334 | Ga0114129_10161848 | 3300009147 | Bacteria | 3056 |
| 335 | Ga0114129_10170822 | 3300009147 | Bacteria | 2964 |
| 336 | Ga0114129_10207198 | 3300009147 | Bacteria | 2652 |
| 337 | Ga0114129_10249459 | 3300009147 | Bacteria | 2384 |
| 338 | Ga0114129_10276140 | 3300009147 | Bacteria | 2246 |
| 339 | Ga0114129_10569839 | 3300009147 | Bacteria | 1470 |
| 340 | Ga0114129_10664052 | 3300009147 | Bacteria | 1344 |
| 341 | Ga0114129_10911080 | 3300009147 | Bacteria | 1113 |
| 342 | Ga0105241_10424749 | 3300009174 | Bacteria | 1170 |
| 343 | Ga0105242_10023415 | 3300009176 | Bacteria | 4866 |
| 344 | Ga0105242_10177354 | 3300009176 | Bacteria | 1878 |
| 345 | Ga0105242_11110899 | 3300009176 | Bacteria | 805 |
| 346 | Ga0105248_10018116 | 3300009177 | Bacteria | 7775 |
| 347 | Ga0105248_10039701 | 3300009177 | Bacteria | 5276 |
| 348 | Ga0105248_10185947 | 3300009177 | Bacteria | 2341 |
| 349 | Ga0105248_10270063 | 3300009177 | Bacteria | 1915 |
| 350 | Ga0105248_10391189 | 3300009177 | Bacteria | 1565 |
| 351 | Ga0105248_10598732 | 3300009177 | Bacteria | 1244 |
| 352 | Ga0105248_11129416 | 3300009177 | Bacteria | 886 |
| 353 | Ga0105237_10119496 | 3300009545 | Bacteria | 2629 |
| 354 | Ga0105237_10423602 | 3300009545 | Bacteria | 1337 |
| 355 | Ga0105237_11127626 | 3300009545 | Bacteria | 791 |
| 356 | Ga0105238_10030121 | 3300009551 | Bacteria | 5523 |
| 357 | Ga0105238_10089705 | 3300009551 | Bacteria | 3062 |
| 358 | Ga0105238_10114136 | 3300009551 | Bacteria | 2681 |
| 359 | Ga0105238_10591951 | 3300009551 | Bacteria | 1116 |
| 360 | Ga0105249_10000665 | 3300009553 | Bacteria | 31200 |
| 361 | Ga0105249_10005149 | 3300009553 | Bacteria | 11284 |
| 362 | Ga0105249_10854241 | 3300009553 | Bacteria | 976 |
| 363 | Ga0105249_10859848 | 3300009553 | Bacteria | 973 |
| 364 | Ga0105239_11210975 | 3300010375 | Bacteria | 870 |
| 365 | Ga0105246_10362348 | 3300011119 | Bacteria | 1192 |
| 366 | Ga0105246_10462495 | 3300011119 | Bacteria | 1069 |
| 367 | Ga0105246_10586793 | 3300011119 | Bacteria | 961 |
| 368 | Ga0105246_10634169 | 3300011119 | Bacteria | 928 |
| 369 | Ga0157346_1005414 | 3300012480 | Bacteria | 790 |
| 370 | Ga0157371_10016487 | 3300013102 | Bacteria | 5512 |
| 371 | Ga0157370_10000316 | 3300013104 | Bacteria | 60618 |
| 372 | Ga0157370_10275558 | 3300013104 | Bacteria | 1554 |
| 373 | Ga0157370_10358347 | 3300013104 | Bacteria | 1344 |
| 374 | Ga0157369_10002654 | 3300013105 | Bacteria | 21358 |
| 375 | Ga0157369_10011644 | 3300013105 | Bacteria | 9986 |
| 376 | Ga0157369_10020021 | 3300013105 | Bacteria | 7484 |
| 377 | Ga0157369_10140537 | 3300013105 | Bacteria | 2555 |
| 378 | Ga0157369_10420812 | 3300013105 | Bacteria | 1385 |
| 379 | Ga0157374_10404408 | 3300013296 | Bacteria | 1362 |
| 380 | Ga0157374_10487487 | 3300013296 | Unclassified | 1236 |
| 381 | Ga0157374_10836252 | 3300013296 | Unclassified | 937 |
| 382 | Ga0157378_10110887 | 3300013297 | Unclassified | 2515 |
| 383 | Ga0157378_10557879 | 3300013297 | Bacteria | 1152 |
| 384 | Ga0157378_10875750 | 3300013297 | Bacteria | 928 |
| 385 | Ga0163162_10014068 | 3300013306 | Bacteria | 7821 |
| 386 | Ga0163162_10135363 | 3300013306 | Bacteria | 2574 |
| 387 | Ga0163162_10220991 | 3300013306 | Bacteria | 2024 |
| 388 | Ga0157372_10003848 | 3300013307 | Bacteria | 16128 |
| 389 | Ga0157372_10411739 | 3300013307 | Bacteria | 1575 |
| 390 | Ga0157375_10007743 | 3300013308 | Bacteria | 9403 |
| 391 | Ga0157375_10141692 | 3300013308 | Bacteria | 2531 |
| 392 | Ga0157375_10190741 | 3300013308 | Bacteria | 2204 |
| 393 | Ga0157375_10226402 | 3300013308 | Bacteria | 2029 |
| 394 | Ga0157375_10269570 | 3300013308 | Bacteria | 1864 |
| 395 | Ga0157375_10840441 | 3300013308 | Bacteria | 1065 |
| 396 | Ga0157375_11456914 | 3300013308 | Bacteria | 807 |
| 397 | Ga0157375_11859372 | 3300013308 | Bacteria | 714 |
| 398 | Ga0163163_10000017 | 3300014325 | Bacteria | 208781 |
| 399 | Ga0163163_10445224 | 3300014325 | Bacteria | 1355 |
| 400 | Ga0163163_10544211 | 3300014325 | Bacteria | 1223 |
| 401 | Ga0163163_10691813 | 3300014325 | Bacteria | 1083 |
| 402 | Ga0163163_11044961 | 3300014325 | Bacteria | 880 |
| 403 | Ga0157380_10006923 | 3300014326 | Bacteria | 8020 |
| 404 | Ga0157380_10948282 | 3300014326 | Bacteria | 890 |
| 405 | Ga0157380_11674850 | 3300014326 | Bacteria | 693 |
| 406 | Ga0157377_10010222 | 3300014745 | Bacteria | 4635 |
| 407 | Ga0157377_10122749 | 3300014745 | Bacteria | 1576 |
| 408 | Ga0157379_10047690 | 3300014968 | Bacteria | 3822 |
| 409 | Ga0157379_10049003 | 3300014968 | Bacteria | 3771 |
| 410 | Ga0163161_10198470 | 3300017792 | Bacteria | 1545 |
| 411 | Ga0197907_10710089 | 3300020069 | Bacteria | 2006 |
| 412 | Ga0206356_10680555 | 3300020070 | Bacteria | 1139 |
| 413 | Ga0206349_1837458 | 3300020075 | Bacteria | 792 |
| 414 | Ga0206351_10564219 | 3300020077 | Bacteria | 1619 |
| 415 | Ga0206354_11435900 | 3300020081 | Bacteria | 1143 |
| 416 | Ga0206353_11539969 | 3300020082 | Bacteria | 1896 |
| 417 | Ga0213876_10269606 | 3300021384 | Bacteria | 905 |
| 418 | Ga0213876_10273202 | 3300021384 | Bacteria | 898 |
| 419 | Ga0224712_10009247 | 3300022467 | Bacteria | 2960 |
| 420 | Ga0224712_10018351 | 3300022467 | Bacteria | 2337 |
| 421 | Ga0228598_1002744 | 3300024227 | Unclassified | 3814 |
| 422 | Ga0207697_10004143 | 3300025315 | Bacteria | 6994 |
| 423 | Ga0207682_10048231 | 3300025893 | Bacteria | 1755 |
| 424 | Ga0207692_10046021 | 3300025898 | Bacteria | 2185 |
| 425 | Ga0207692_10088359 | 3300025898 | Bacteria | 1675 |
| 426 | Ga0207692_10248120 | 3300025898 | Unclassified | 1066 |
| 427 | Ga0207710_10143408 | 3300025900 | Bacteria | 1154 |
| 428 | Ga0207688_10088773 | 3300025901 | Bacteria | 1773 |
| 429 | Ga0207685_10009413 | 3300025905 | Bacteria | 2838 |
| 430 | Ga0207685_10022188 | 3300025905 | Bacteria | 2140 |
| 431 | Ga0207699_10016009 | 3300025906 | Bacteria | 3912 |
| 432 | Ga0207699_10018311 | 3300025906 | Bacteria | 3709 |
| 433 | Ga0207699_10337245 | 3300025906 | Bacteria | 1061 |
| 434 | Ga0207645_10000951 | 3300025907 | Bacteria | 24030 |
| 435 | Ga0207684_10001709 | 3300025910 | Bacteria | 23304 |
| 436 | Ga0207684_10013136 | 3300025910 | Bacteria | 7169 |
| 437 | Ga0207684_10021919 | 3300025910 | Bacteria | 5455 |
| 438 | Ga0207684_10046428 | 3300025910 | Bacteria | 3685 |
| 439 | Ga0207684_10047401 | 3300025910 | Bacteria | 3644 |
| 440 | Ga0207684_10082242 | 3300025910 | Bacteria | 2742 |
| 441 | Ga0207684_10626605 | 3300025910 | Unclassified | 917 |
| 442 | Ga0207707_10012200 | 3300025912 | Bacteria | 7471 |
| 443 | Ga0207707_10016072 | 3300025912 | Bacteria | 6527 |
| 444 | Ga0207707_10154790 | 3300025912 | Bacteria | 2005 |
| 445 | Ga0207707_10623480 | 3300025912 | Bacteria | 911 |
| 446 | Ga0207707_10960272 | 3300025912 | Unclassified | 703 |
| 447 | Ga0207695_10055205 | 3300025913 | Bacteria | 4141 |
| 448 | Ga0207695_10365071 | 3300025913 | Bacteria | 1330 |
| 449 | Ga0207671_10152266 | 3300025914 | Unclassified | 1787 |
| 450 | Ga0207693_10002323 | 3300025915 | Bacteria | 16524 |
| 451 | Ga0207693_10003126 | 3300025915 | Bacteria | 14255 |
| 452 | Ga0207693_10009038 | 3300025915 | Bacteria | 8133 |
| 453 | Ga0207693_10033877 | 3300025915 | Bacteria | 4029 |
| 454 | Ga0207693_10073386 | 3300025915 | Bacteria | 2678 |
| 455 | Ga0207693_10115182 | 3300025915 | Bacteria | 2110 |
| 456 | Ga0207693_10304452 | 3300025915 | Bacteria | 1248 |
| 457 | Ga0207693_10337040 | 3300025915 | Bacteria | 1180 |
| 458 | Ga0207693_10410322 | 3300025915 | Bacteria | 1059 |
| 459 | Ga0207663_10000275 | 3300025916 | Bacteria | 22369 |
| 460 | Ga0207663_10001046 | 3300025916 | Bacteria | 12703 |
| 461 | Ga0207663_10004310 | 3300025916 | Bacteria | 7063 |
| 462 | Ga0207663_10035038 | 3300025916 | Bacteria | 3008 |
| 463 | Ga0207663_10120740 | 3300025916 | Bacteria | 1794 |
| 464 | Ga0207663_10208778 | 3300025916 | Bacteria | 1414 |
| 465 | Ga0207660_10025592 | 3300025917 | Bacteria | 4008 |
| 466 | Ga0207660_10047006 | 3300025917 | Bacteria | 3049 |
| 467 | Ga0207662_10005032 | 3300025918 | Bacteria | 6998 |
| 468 | Ga0207662_10171795 | 3300025918 | Bacteria | 1390 |
| 469 | Ga0207657_10505701 | 3300025919 | Bacteria | 946 |
| 470 | Ga0207649_10211211 | 3300025920 | Bacteria | 1377 |
| 471 | Ga0207649_10251690 | 3300025920 | Bacteria | 1273 |
| 472 | Ga0207652_10023916 | 3300025921 | Bacteria | 5066 |
| 473 | Ga0207652_10321010 | 3300025921 | Bacteria | 1398 |
| 474 | Ga0207646_10005883 | 3300025922 | Bacteria | 12808 |
| 475 | Ga0207646_10025817 | 3300025922 | Bacteria | 5371 |
| 476 | Ga0207646_10054282 | 3300025922 | Bacteria | 3585 |
| 477 | Ga0207646_10055008 | 3300025922 | Bacteria | 3559 |
| 478 | Ga0207646_10063768 | 3300025922 | Bacteria | 3289 |
| 479 | Ga0207646_10070675 | 3300025922 | Bacteria | 3118 |
| 480 | Ga0207646_10073151 | 3300025922 | Bacteria | 3062 |
| 481 | Ga0207646_10084425 | 3300025922 | Bacteria | 2841 |
| 482 | Ga0207646_10090980 | 3300025922 | Unclassified | 2731 |
| 483 | Ga0207646_10190967 | 3300025922 | Bacteria | 1850 |
| 484 | Ga0207681_10022135 | 3300025923 | Bacteria | 4049 |
| 485 | Ga0207681_10069430 | 3300025923 | Bacteria | 2450 |
| 486 | Ga0207681_10189130 | 3300025923 | Bacteria | 1574 |
| 487 | Ga0207694_10038610 | 3300025924 | Bacteria | 3672 |
| 488 | Ga0207694_10097241 | 3300025924 | Unclassified | 2329 |
| 489 | Ga0207694_10302680 | 3300025924 | Bacteria | 1317 |
| 490 | Ga0207694_10420321 | 3300025924 | Bacteria | 1113 |
| 491 | Ga0207650_10573581 | 3300025925 | Bacteria | 947 |
| 492 | Ga0207659_10736166 | 3300025926 | Bacteria | 845 |
| 493 | Ga0207700_10000856 | 3300025928 | Bacteria | 17533 |
| 494 | Ga0207700_10002332 | 3300025928 | Bacteria | 10880 |
| 495 | Ga0207700_10002921 | 3300025928 | Bacteria | 9853 |
| 496 | Ga0207700_10019902 | 3300025928 | Bacteria | 4544 |
| 497 | Ga0207700_10020055 | 3300025928 | Bacteria | 4531 |
| 498 | Ga0207700_10025563 | 3300025928 | Bacteria | 4102 |
| 499 | Ga0207700_10052889 | 3300025928 | Bacteria | 3039 |
| 500 | Ga0207700_10071210 | 3300025928 | Bacteria | 2676 |
| 501 | Ga0207700_10136102 | 3300025928 | Bacteria | 2012 |
| 502 | Ga0207700_10351628 | 3300025928 | Bacteria | 1283 |
| 503 | Ga0207700_10417653 | 3300025928 | Unclassified | 1178 |
| 504 | Ga0207700_10730181 | 3300025928 | Unclassified | 885 |
| 505 | Ga0207664_10000532 | 3300025929 | Bacteria | 27088 |
| 506 | Ga0207664_10450250 | 3300025929 | Bacteria | 1149 |
| 507 | Ga0207664_11173270 | 3300025929 | Bacteria | 685 |
| 508 | Ga0207706_10001737 | 3300025933 | Bacteria | 21437 |
| 509 | Ga0207706_10012184 | 3300025933 | Bacteria | 7835 |
| 510 | Ga0207706_10067629 | 3300025933 | Bacteria | 3143 |
| 511 | Ga0207706_10625955 | 3300025933 | Bacteria | 923 |
| 512 | Ga0207706_11039974 | 3300025933 | Bacteria | 687 |
| 513 | Ga0207686_10097756 | 3300025934 | Bacteria | 1953 |
| 514 | Ga0207670_10000034 | 3300025936 | Bacteria | 109898 |
| 515 | Ga0207670_10203545 | 3300025936 | Bacteria | 1505 |
| 516 | Ga0207670_10207932 | 3300025936 | Bacteria | 1491 |
| 517 | Ga0207669_10491822 | 3300025937 | Bacteria | 980 |
| 518 | Ga0207669_10838778 | 3300025937 | Bacteria | 764 |
| 519 | Ga0207704_10029935 | 3300025938 | Bacteria | 3045 |
| 520 | Ga0207665_10000132 | 3300025939 | Bacteria | 49462 |
| 521 | Ga0207665_10000500 | 3300025939 | Bacteria | 26563 |
| 522 | Ga0207665_10062371 | 3300025939 | Bacteria | 2529 |
| 523 | Ga0207665_10114808 | 3300025939 | Bacteria | 1896 |
| 524 | Ga0207665_10160474 | 3300025939 | Bacteria | 1617 |
| 525 | Ga0207665_10227406 | 3300025939 | Bacteria | 1370 |
| 526 | Ga0207665_10915203 | 3300025939 | Bacteria | 696 |
| 527 | Ga0207691_10000366 | 3300025940 | Bacteria | 45517 |
| 528 | Ga0207691_10001194 | 3300025940 | Bacteria | 25851 |
| 529 | Ga0207691_10037285 | 3300025940 | Bacteria | 4503 |
| 530 | Ga0207691_10231614 | 3300025940 | Bacteria | 1599 |
| 531 | Ga0207691_10639279 | 3300025940 | Bacteria | 899 |
| 532 | Ga0207691_10833080 | 3300025940 | Bacteria | 774 |
| 533 | Ga0207689_10141974 | 3300025942 | Bacteria | 1978 |
| 534 | Ga0207689_10375498 | 3300025942 | Bacteria | 1183 |
| 535 | Ga0207661_10000208 | 3300025944 | Bacteria | 37883 |
| 536 | Ga0207661_10035976 | 3300025944 | Bacteria | 3862 |
| 537 | Ga0207661_10038493 | 3300025944 | Bacteria | 3749 |
| 538 | Ga0207661_10335798 | 3300025944 | Bacteria | 1361 |
| 539 | Ga0207661_10648445 | 3300025944 | Bacteria | 970 |
| 540 | Ga0207679_10046679 | 3300025945 | Bacteria | 3141 |
| 541 | Ga0207679_10153895 | 3300025945 | Bacteria | 1875 |
| 542 | Ga0207679_10203353 | 3300025945 | Bacteria | 1656 |
| 543 | Ga0207679_11121931 | 3300025945 | Bacteria | 721 |
| 544 | Ga0207667_10174128 | 3300025949 | Unclassified | 2211 |
| 545 | Ga0207667_10409645 | 3300025949 | Bacteria | 1380 |
| 546 | Ga0207667_10452182 | 3300025949 | Bacteria | 1305 |
| 547 | Ga0207667_10753171 | 3300025949 | Bacteria | 973 |
| 548 | Ga0207667_11374379 | 3300025949 | Bacteria | 680 |
| 549 | Ga0207651_10619921 | 3300025960 | Bacteria | 947 |
| 550 | Ga0207712_10000812 | 3300025961 | Bacteria | 23033 |
| 551 | Ga0207712_10095413 | 3300025961 | Bacteria | 2199 |
| 552 | Ga0207712_10375331 | 3300025961 | Bacteria | 1189 |
| 553 | Ga0207668_10002276 | 3300025972 | Bacteria | 11215 |
| 554 | Ga0207668_10006808 | 3300025972 | Bacteria | 6771 |
| 555 | Ga0207668_10217143 | 3300025972 | Bacteria | 1533 |
| 556 | Ga0207668_11324048 | 3300025972 | Bacteria | 649 |
| 557 | Ga0207658_10382666 | 3300025986 | Bacteria | 1233 |
| 558 | Ga0207658_10734297 | 3300025986 | Bacteria | 894 |
| 559 | Ga0207703_10515851 | 3300026035 | Bacteria | 1124 |
| 560 | Ga0207703_10640198 | 3300026035 | Bacteria | 1008 |
| 561 | Ga0207639_10009125 | 3300026041 | Bacteria | 6835 |
| 562 | Ga0207678_10016479 | 3300026067 | Bacteria | 6489 |
| 563 | Ga0207678_10535199 | 3300026067 | Bacteria | 1023 |
| 564 | Ga0207708_10056420 | 3300026075 | Bacteria | 2996 |
| 565 | Ga0207702_10007569 | 3300026078 | Bacteria | 9251 |
| 566 | Ga0207702_10240791 | 3300026078 | Bacteria | 1695 |
| 567 | Ga0207641_10102831 | 3300026088 | Bacteria | 2520 |
| 568 | Ga0207641_10364385 | 3300026088 | Bacteria | 1381 |
| 569 | Ga0207641_10520857 | 3300026088 | Bacteria | 1157 |
| 570 | Ga0207674_10000861 | 3300026116 | Bacteria | 39661 |
| 571 | Ga0207674_10008925 | 3300026116 | Bacteria | 11522 |
| 572 | Ga0207675_100000964 | 3300026118 | Bacteria | 28651 |
| 573 | Ga0207675_100001025 | 3300026118 | Bacteria | 27674 |
| 574 | Ga0209588_1059709 | 3300027671 | Bacteria | 1233 |
| 575 | Ga0207428_10001806 | 3300027907 | Bacteria | 21911 |
| 576 | Ga0207428_10007234 | 3300027907 | Bacteria | 10147 |
| 577 | Ga0207428_10036298 | 3300027907 | Bacteria | 4021 |
| 578 | Ga0268265_10000988 | 3300028380 | Bacteria | 25833 |
| 579 | Ga0268265_10012737 | 3300028380 | Bacteria | 5707 |
| 580 | Ga0268264_10104635 | 3300028381 | Bacteria | 2467 |
| 581 | Ga0268264_10382810 | 3300028381 | Bacteria | 1348 |
| 582 | Ga0268264_10637296 | 3300028381 | Bacteria | 1054 |
| 583 | Ga0265760_10051984 | 3300031090 | Unclassified | 1235 |
| 584 | Ga0265760_10057422 | 3300031090 | Bacteria | 1179 |
| 585 | Ga0265320_10027751 | 3300031240 | Bacteria | 2948 |
| 586 | Ga0265339_10030317 | 3300031249 | Bacteria | 3063 |
| 587 | Ga0265331_10050889 | 3300031250 | Bacteria | 1985 |
| 588 | Ga0265316_10330244 | 3300031344 | Bacteria | 1106 |
| 589 | Ga0265316_10446065 | 3300031344 | Bacteria | 928 |
| 590 | Ga0307408_100029948 | 3300031548 | Bacteria | 3776 |
| 591 | Ga0307408_100033033 | 3300031548 | Bacteria | 3612 |
| 592 | Ga0307408_100076198 | 3300031548 | Bacteria | 2494 |
| 593 | Ga0307408_100087670 | 3300031548 | Bacteria | 2342 |
| 594 | Ga0307408_100240060 | 3300031548 | Bacteria | 1489 |
| 595 | Ga0307408_100462707 | 3300031548 | Unclassified | 1103 |
| 596 | Ga0265314_10032227 | 3300031711 | Bacteria | 3857 |
| 597 | Ga0265314_10091863 | 3300031711 | Bacteria | 1974 |
| 598 | Ga0265314_10294785 | 3300031711 | Bacteria | 912 |
| 599 | Ga0265342_10013220 | 3300031712 | Bacteria | 5551 |
| 600 | Ga0307405_10002927 | 3300031731 | Bacteria | 7702 |
| 601 | Ga0307405_10003773 | 3300031731 | Bacteria | 7040 |
| 602 | Ga0307405_10004305 | 3300031731 | Bacteria | 6702 |
| 603 | Ga0307405_10068469 | 3300031731 | Bacteria | 2271 |
| 604 | Ga0307405_10093298 | 3300031731 | Bacteria | 1999 |
| 605 | Ga0307405_10169603 | 3300031731 | Bacteria | 1555 |
| 606 | Ga0307405_10894460 | 3300031731 | Bacteria | 750 |
| 607 | Ga0307413_10010169 | 3300031824 | Bacteria | 4547 |
| 608 | Ga0307413_10055539 | 3300031824 | Bacteria | 2410 |
| 609 | Ga0307413_10064097 | 3300031824 | Bacteria | 2281 |
| 610 | Ga0307413_10076450 | 3300031824 | Bacteria | 2128 |
| 611 | Ga0307413_10265362 | 3300031824 | Bacteria | 1282 |
| 612 | Ga0307413_10350941 | 3300031824 | Bacteria | 1138 |
| 613 | Ga0307413_10531066 | 3300031824 | Bacteria | 951 |
| 614 | Ga0307413_10615232 | 3300031824 | Bacteria | 891 |
| 615 | Ga0307413_10986246 | 3300031824 | Bacteria | 721 |
| 616 | Ga0307410_10013501 | 3300031852 | Bacteria | 4768 |
| 617 | Ga0307410_10040909 | 3300031852 | Bacteria | 3053 |
| 618 | Ga0307410_10054250 | 3300031852 | Bacteria | 2716 |
| 619 | Ga0307410_10372841 | 3300031852 | Bacteria | 1146 |
| 620 | Ga0307406_10004089 | 3300031901 | Bacteria | 7942 |
| 621 | Ga0307406_10007555 | 3300031901 | Bacteria | 6033 |
| 622 | Ga0307406_10023649 | 3300031901 | Bacteria | 3659 |
| 623 | Ga0307406_10068609 | 3300031901 | Bacteria | 2315 |
| 624 | Ga0307406_10175172 | 3300031901 | Bacteria | 1556 |
| 625 | Ga0307406_10407275 | 3300031901 | Bacteria | 1080 |
| 626 | Ga0307406_11053263 | 3300031901 | Bacteria | 700 |
| 627 | Ga0307407_10003810 | 3300031903 | Bacteria | 6278 |
| 628 | Ga0307407_10029087 | 3300031903 | Bacteria | 2963 |
| 629 | Ga0307407_10035076 | 3300031903 | Bacteria | 2752 |
| 630 | Ga0307407_10037551 | 3300031903 | Bacteria | 2677 |
| 631 | Ga0307407_10185325 | 3300031903 | Bacteria | 1382 |
| 632 | Ga0307407_10211017 | 3300031903 | Bacteria | 1307 |
| 633 | Ga0307407_10436215 | 3300031903 | Bacteria | 947 |
| 634 | Ga0307407_10542824 | 3300031903 | Bacteria | 858 |
| 635 | Ga0307407_10717640 | 3300031903 | Bacteria | 754 |
| 636 | Ga0307412_10002806 | 3300031911 | Bacteria | 9671 |
| 637 | Ga0307412_10020973 | 3300031911 | Bacteria | 3985 |
| 638 | Ga0307412_10041113 | 3300031911 | Bacteria | 2994 |
| 639 | Ga0307412_10041986 | 3300031911 | Bacteria | 2968 |
| 640 | Ga0307412_10100878 | 3300031911 | Bacteria | 2041 |
| 641 | Ga0307412_10215917 | 3300031911 | Bacteria | 1467 |
| 642 | Ga0307409_100000761 | 3300031995 | Bacteria | 14553 |
| 643 | Ga0307409_100001388 | 3300031995 | Bacteria | 11835 |
| 644 | Ga0307409_100006134 | 3300031995 | Bacteria | 7027 |
| 645 | Ga0307409_100012489 | 3300031995 | Bacteria | 5414 |
| 646 | Ga0307409_100017504 | 3300031995 | Bacteria | 4780 |
| 647 | Ga0307409_100084250 | 3300031995 | Bacteria | 2580 |
| 648 | Ga0307409_100085926 | 3300031995 | Bacteria | 2559 |
| 649 | Ga0307409_100089329 | 3300031995 | Bacteria | 2518 |
| 650 | Ga0307409_100234861 | 3300031995 | Bacteria | 1665 |
| 651 | Ga0307409_100264412 | 3300031995 | Bacteria | 1581 |
| 652 | Ga0307409_100437078 | 3300031995 | Bacteria | 1259 |
| 653 | Ga0307409_100953164 | 3300031995 | Bacteria | 874 |
| 654 | Ga0307409_101005625 | 3300031995 | Bacteria | 852 |
| 655 | Ga0307416_100004401 | 3300032002 | Bacteria | 8486 |
| 656 | Ga0307416_100023480 | 3300032002 | Bacteria | 4476 |
| 657 | Ga0307416_100033012 | 3300032002 | Bacteria | 3918 |
| 658 | Ga0307416_100038735 | 3300032002 | Bacteria | 3680 |
| 659 | Ga0307416_100079211 | 3300032002 | Bacteria | 2768 |
| 660 | Ga0307416_100102603 | 3300032002 | Bacteria | 2494 |
| 661 | Ga0307416_100128701 | 3300032002 | Bacteria | 2274 |
| 662 | Ga0307416_100186020 | 3300032002 | Bacteria | 1952 |
| 663 | Ga0307416_100230827 | 3300032002 | Bacteria | 1784 |
| 664 | Ga0307416_100370200 | 3300032002 | Bacteria | 1459 |
| 665 | Ga0307416_101037048 | 3300032002 | Bacteria | 924 |
| 666 | Ga0307414_10009483 | 3300032004 | Bacteria | 5594 |
| 667 | Ga0307414_10043402 | 3300032004 | Bacteria | 3063 |
| 668 | Ga0307414_10048949 | 3300032004 | Bacteria | 2920 |
| 669 | Ga0307414_10059050 | 3300032004 | Bacteria | 2706 |
| 670 | Ga0307414_10073267 | 3300032004 | Bacteria | 2477 |
| 671 | Ga0307411_10006054 | 3300032005 | Bacteria | 6015 |
| 672 | Ga0307411_10038193 | 3300032005 | Bacteria | 3026 |
| 673 | Ga0307411_10038228 | 3300032005 | Bacteria | 3025 |
| 674 | Ga0307411_10066479 | 3300032005 | Bacteria | 2422 |
| 675 | Ga0307411_10093297 | 3300032005 | Bacteria | 2107 |
| 676 | Ga0307411_10101883 | 3300032005 | Bacteria | 2033 |
| 677 | Ga0307411_10198207 | 3300032005 | Bacteria | 1539 |
| 678 | Ga0307411_10604906 | 3300032005 | Bacteria | 943 |
| 679 | Ga0307411_10980833 | 3300032005 | Bacteria | 755 |
| 680 | Ga0307415_100001794 | 3300032126 | Bacteria | 10506 |
| 681 | Ga0307415_100006110 | 3300032126 | Bacteria | 6459 |
| 682 | Ga0307415_100054315 | 3300032126 | Bacteria | 2733 |
| 683 | Ga0307415_100062237 | 3300032126 | Bacteria | 2587 |
| 684 | Ga0307415_100141469 | 3300032126 | Bacteria | 1838 |
| 685 | Ga0307415_100171485 | 3300032126 | Bacteria | 1692 |
| 686 | Ga0307415_100200973 | 3300032126 | Bacteria | 1581 |
| 687 | Ga0373926_0031477 | 3300035083 | Bacteria | 1871 |
| 688 | Ga0373926_0131558 | 3300035083 | Bacteria | 948 |
| 689 | Ga0373934_0010626 | 3300035086 | Bacteria | 3456 |
| 690 | Ga0373934_0038725 | 3300035086 | Bacteria | 1878 |
| 691 | Ga0373934_0253507 | 3300035086 | Bacteria | 728 |
| 692 | Ga0373944_0055787 | 3300035089 | Bacteria | 1256 |
| 693 | Ga0373944_0185753 | 3300035089 | Bacteria | 747 |
| 694 | Ga0373923_0004878 | 3300035111 | Bacteria | 4500 |
| 695 | Ga0373923_0051721 | 3300035111 | Bacteria | 1724 |
| 696 | Ga0373936_0000390 | 3300035113 | Bacteria | 14909 |
| 697 | Ga0373936_0064675 | 3300035113 | Bacteria | 1499 |
| 698 | Ga0373936_0217214 | 3300035113 | Unclassified | 847 |
| 699 | Ga0373939_0256049 | 3300035114 | Bacteria | 683 |
| 700 | Ga0373941_0025679 | 3300035115 | Bacteria | 1704 |
| 701 | Ga0373945_0009002 | 3300035116 | Bacteria | 3264 |
| 702 | Ga0373953_0065589 | 3300035117 | Bacteria | 1491 |
| 703 | Ga0373953_0090854 | 3300035117 | Bacteria | 1277 |
| 704 | Ga0373953_0097404 | 3300035117 | Bacteria | 1235 |
| 705 | Ga0373953_0116800 | 3300035117 | Bacteria | 1131 |
| 706 | Ga0373954_0003568 | 3300035118 | Bacteria | 6613 |
| 707 | Ga0373954_0136756 | 3300035118 | Bacteria | 1194 |
| 708 | Ga0373956_0006456 | 3300035119 | Unclassified | 4702 |
| 709 | Ga0373956_0014240 | 3300035119 | Unclassified | 3321 |
| 710 | Ga0373956_0019987 | 3300035119 | Bacteria | 2844 |
| 711 | Ga0373956_0028031 | 3300035119 | Bacteria | 2449 |
| 712 | Ga0373956_0270232 | 3300035119 | Bacteria | 809 |
| 713 | Ga0373957_0022916 | 3300035120 | Bacteria | 2229 |
| 714 | Ga0373957_0056337 | 3300035120 | Bacteria | 1513 |
| 715 | Ga0373943_0000092 | 3300035170 | Bacteria | 33178 |
| 716 | Ga0373943_0014821 | 3300035170 | Bacteria | 3536 |
| 717 | Ga0373946_0002787 | 3300035171 | Bacteria | 6183 |
| 718 | Ga0373946_0055569 | 3300035171 | Bacteria | 1669 |
| 719 | Ga0373955_0000623 | 3300035172 | Bacteria | 15191 |
| 720 | Ga0373955_0023694 | 3300035172 | Unclassified | 3130 |
| 721 | Ga0373955_0032780 | 3300035172 | Bacteria | 2731 |
| 722 | Ga0373955_0044477 | 3300035172 | Bacteria | 2392 |
| 723 | Ga0373955_0139993 | 3300035172 | Bacteria | 1418 |
| 724 | Ga0373955_0291209 | 3300035172 | Bacteria | 983 |
| 725 | Ga0373961_0194908 | 3300035241 | Bacteria | 712 |
| 726 | Ga0373924_0001882 | 3300035410 | Bacteria | 6958 |
| 727 | Ga0373924_0026409 | 3300035410 | Bacteria | 2303 |
| 728 | Ga0373924_0054813 | 3300035410 | Bacteria | 1658 |
| 729 | Ga0373931_0330755 | 3300035691 | Bacteria | 949 |
| 730 | Ga0373935_0001269 | 3300035692 | Bacteria | 13918 |
| 731 | Ga0373935_0010177 | 3300035692 | Bacteria | 5633 |
| 732 | Ga0373927_0000056 | 3300035695 | Bacteria | 81041 |
| 733 | Ga0373927_0038950 | 3300035695 | Bacteria | 3085 |
| 734 | Ga0373927_0482037 | 3300035695 | Bacteria | 819 |
| 735 | Ga0373933_0005072 | 3300035724 | Bacteria | 7185 |
| 736 | Ga0373933_0005627 | 3300035724 | Bacteria | 6828 |
| 737 | Ga0373933_0071916 | 3300035724 | Bacteria | 2106 |
| 738 | Ga0373933_0195326 | 3300035724 | Bacteria | 1294 |
| 739 | Ga0373933_0239725 | 3300035724 | Bacteria | 1166 |
| 740 | Ga0373947_0000369 | 3300035725 | Bacteria | 25404 |
| 741 | Ga0373947_0008457 | 3300035725 | Bacteria | 5931 |
| 742 | Ga0373947_0505579 | 3300035725 | Unclassified | 821 |
| 743 | Ga0373937_0002023 | 3300036401 | Bacteria | 16921 |
| 744 | Ga0373937_0002809 | 3300036401 | Bacteria | 14555 |
| 745 | Ga0373937_0012977 | 3300036401 | Bacteria | 7337 |
| 746 | Ga0373937_0036193 | 3300036401 | Bacteria | 4497 |
| 747 | Ga0373937_0109659 | 3300036401 | Bacteria | 2567 |
| 748 | Ga0373937_0113489 | 3300036401 | Bacteria | 2521 |
| 749 | Ga0373937_0225097 | 3300036401 | Bacteria | 1766 |
| 750 | Ga0373937_0263540 | 3300036401 | Bacteria | 1625 |
| 751 | Ga0373937_0280241 | 3300036401 | Unclassified | 1574 |
| 752 | Ga0373937_0339178 | 3300036401 | Unclassified | 1423 |
| 753 | Ga0373937_0524823 | 3300036401 | Bacteria | 1125 |
| 754 | Ga0373937_0634962 | 3300036401 | Bacteria | 1013 |
| 755 | Ga0373925_0004133 | 3300037068 | Bacteria | 11013 |
| 756 | Ga0373925_0004354 | 3300037068 | Bacteria | 10709 |
| 757 | Ga0373925_0133698 | 3300037068 | Bacteria | 1936 |
| 758 | Ga0373925_0395427 | 3300037068 | Bacteria | 1127 |
| 759 | Ga0373925_0557763 | 3300037068 | Bacteria | 942 |
| 760 | Ga0395899_0031700 | 3300037312 | Bacteria | 3972 |
| 761 | Ga0395900_0052532 | 3300037418 | Bacteria | 4195 |
| 762 | Ga0395900_0100054 | 3300037418 | Bacteria | 2978 |
| 763 | Ga0395900_0575422 | 3300037418 | Bacteria | 1069 |
| 764 | Ga0395900_0814860 | 3300037418 | Bacteria | 861 |
| 765 | Ga0395898_0029897 | 3300037466 | Bacteria | 5454 |
| 766 | Ga0395898_0144484 | 3300037466 | Bacteria | 2277 |
| 767 | Ga0395898_0600278 | 3300037466 | Bacteria | 1043 |
| 768 | Ga0395905_0085910 | 3300037471 | Bacteria | 2948 |
| 769 | Ga0395905_0232810 | 3300037471 | Bacteria | 1722 |
| 770 | Ga0395905_0290842 | 3300037471 | Bacteria | 1520 |
| 771 | Ga0436364_0678490 | 3300037853 | Bacteria | 1679 |
| 772 | Ga0395901_0009601 | 3300038443 | Bacteria | 9815 |
| 773 | Ga0395901_0275558 | 3300038443 | Bacteria | 1749 |
| 774 | Ga0395901_0342879 | 3300038443 | Bacteria | 1543 |
| 775 | Ga0395901_0491724 | 3300038443 | Bacteria | 1250 |
| 776 | Ga0436365_0110548 | 3300039437 | Bacteria | 1212 |
| 777 | Ga0436365_0523105 | 3300039437 | Bacteria | 1225 |
| 778 | Ga0436365_0833863 | 3300039437 | Bacteria | 1027 |
| 779 | Ga0436365_1827462 | 3300039437 | Bacteria | 1320 |
| 780 | Ga0436360_0502764 | 3300039438 | Bacteria | 2770 |
| 781 | Ga0436363_0068089 | 3300039450 | Unclassified | 1675 |
| 782 | Ga0439453_0019411 | 3300041408 | Bacteria | 1210 |
| 783 | Ga0439453_0059850 | 3300041408 | Unclassified | 787 |
| 784 | Ga0439466_0152783 | 3300041411 | Bacteria | 707 |
| 785 | Ga0451853_1519401 | 3300041512 | Bacteria | 1042 |
| 786 | Ga0439443_000597 | 3300042003 | Bacteria | 3369 |
| 787 | Ga0439443_002666 | 3300042003 | Bacteria | 2162 |
| 788 | Ga0439448_0008249 | 3300042005 | Bacteria | 3044 |
| 789 | Ga0439448_0011276 | 3300042005 | Bacteria | 2662 |
| 790 | Ga0439448_0040467 | 3300042005 | Bacteria | 1505 |
| 791 | Ga0439450_000393 | 3300042008 | Bacteria | 5600 |
| 792 | Ga0439454_001848 | 3300042011 | Bacteria | 2126 |
| 793 | Ga0439462_0035338 | 3300042015 | Unclassified | 1328 |
| 794 | Ga0439463_002823 | 3300042016 | Bacteria | 4402 |
| 795 | Ga0450914_022728 | 3300042118 | Bacteria | 709 |
| 796 | Ga0450891_011340 | 3300042129 | Bacteria | 825 |
| 797 | Ga0450900_000212 | 3300042136 | Bacteria | 3875 |
| 798 | Ga0450904_008991 | 3300042139 | Bacteria | 985 |
| 799 | Ga0439435_0096030 | 3300042436 | Bacteria | 906 |
| 800 | Ga0439435_0138778 | 3300042436 | Bacteria | 773 |
| 801 | Ga0439460_0000651 | 3300042461 | Bacteria | 7641 |
| 802 | Ga0439460_0071462 | 3300042461 | Unclassified | 1076 |
| 803 | Ga0439440_0000294 | 3300042993 | Bacteria | 8139 |
| 804 | Ga0453683_0086775 | 3300044673 | Bacteria | 1961 |
| 805 | Ga0466963_0151990 | 3300044694 | Unclassified | 1608 |
| 806 | Ga0466963_0430429 | 3300044694 | Bacteria | 931 |
| 807 | Ga0466963_0434921 | 3300044694 | Bacteria | 925 |
| 808 | Ga0466970_0070601 | 3300044765 | Bacteria | 1878 |
| 809 | Ga0466957_0046316 | 3300044842 | Unclassified | 2640 |
| 810 | Ga0466957_0201662 | 3300044842 | Bacteria | 1307 |
| 811 | Ga0466959_0218973 | 3300045049 | Bacteria | 1321 |
| 812 | Ga0451576_0011122 | 3300045051 | Bacteria | 10266 |
| 813 | Ga0451576_0217921 | 3300045051 | Bacteria | 1993 |
| 814 | Ga0451576_0357321 | 3300045051 | Bacteria | 1530 |
| 815 | Ga0451576_0598233 | 3300045051 | Bacteria | 1159 |
| 816 | Ga0451576_1104621 | 3300045051 | Unclassified | 830 |
| 817 | Ga0451576_1311171 | 3300045051 | Unclassified | 755 |
| 818 | Ga0466967_0027718 | 3300045976 | Bacteria | 4716 |
| 819 | Ga0466967_0260296 | 3300045976 | Bacteria | 1660 |
| 820 | Ga0466967_0756519 | 3300045976 | Bacteria | 964 |
| 821 | Ga0466967_1461187 | 3300045976 | Bacteria | 681 |
| 822 | Ga0495592_0068072 | 3300046454 | Bacteria | 2600 |
| 823 | Ga0495592_0203842 | 3300046454 | Bacteria | 1333 |
| 824 | Ga0495629_0423965 | 3300046459 | Bacteria | 903 |
| 825 | Ga0495629_0587715 | 3300046459 | Bacteria | 745 |
| 826 | Ga0495641_0048896 | 3300046461 | Bacteria | 1938 |
| 827 | Ga0495651_0013209 | 3300046462 | Bacteria | 6385 |
| 828 | Ga0495651_0041949 | 3300046462 | Bacteria | 3554 |
| 829 | Ga0495651_0080755 | 3300046462 | Unclassified | 2456 |
| 830 | Ga0495651_0132205 | 3300046462 | Bacteria | 1820 |
| 831 | Ga0495651_0329570 | 3300046462 | Bacteria | 1015 |
| 832 | Ga0495651_0431008 | 3300046462 | Bacteria | 855 |
| 833 | Ga0495653_0076189 | 3300046463 | Bacteria | 2494 |
| 834 | Ga0495653_0527590 | 3300046463 | Bacteria | 733 |
| 835 | Ga0495580_0008844 | 3300046472 | Bacteria | 7972 |
| 836 | Ga0495580_0340896 | 3300046472 | Unclassified | 1016 |
| 837 | Ga0495580_0366120 | 3300046472 | Bacteria | 975 |
| 838 | Ga0495580_0653807 | 3300046472 | Bacteria | 691 |
| 839 | Ga0495582_0033473 | 3300046473 | Bacteria | 2825 |
| 840 | Ga0495639_0343632 | 3300046475 | Bacteria | 748 |
| 841 | Ga0495662_0065727 | 3300046476 | Bacteria | 1753 |
| 842 | Ga0495664_0003426 | 3300046477 | Bacteria | 8625 |
| 843 | Ga0495664_0022390 | 3300046477 | Bacteria | 3662 |
| 844 | Ga0495664_0307837 | 3300046477 | Bacteria | 956 |
| 845 | Ga0495664_0348168 | 3300046477 | Bacteria | 892 |
| 846 | Ga0495584_0062085 | 3300046491 | Bacteria | 1878 |
| 847 | Ga0495584_0108093 | 3300046491 | Bacteria | 1407 |
| 848 | Ga0495594_0024115 | 3300046499 | Bacteria | 3265 |
| 849 | Ga0495594_0031022 | 3300046499 | Bacteria | 2896 |
| 850 | Ga0495594_0031466 | 3300046499 | Bacteria | 2876 |
| 851 | Ga0495594_0048715 | 3300046499 | Bacteria | 2328 |
| 852 | Ga0495594_0108151 | 3300046499 | Bacteria | 1567 |
| 853 | Ga0495594_0229467 | 3300046499 | Bacteria | 1058 |
| 854 | Ga0495607_0124645 | 3300046501 | Bacteria | 1348 |
| 855 | Ga0495618_0098173 | 3300046514 | Bacteria | 1874 |
| 856 | Ga0495618_0136450 | 3300046514 | Bacteria | 1569 |
| 857 | Ga0495618_0186810 | 3300046514 | Bacteria | 1315 |
| 858 | Ga0495618_0235306 | 3300046514 | Bacteria | 1152 |
| 859 | Ga0495628_0043123 | 3300046516 | Bacteria | 3595 |
| 860 | Ga0495628_0077687 | 3300046516 | Bacteria | 2582 |
| 861 | Ga0495628_0115379 | 3300046516 | Bacteria | 2062 |
| 862 | Ga0495628_0357407 | 3300046516 | Bacteria | 1073 |
| 863 | Ga0495628_0560345 | 3300046516 | Bacteria | 819 |
| 864 | Ga0495628_0575873 | 3300046516 | Bacteria | 806 |
| 865 | Ga0495630_0004320 | 3300046517 | Bacteria | 9971 |
| 866 | Ga0495630_0097277 | 3300046517 | Unclassified | 2226 |
| 867 | Ga0495630_0297931 | 3300046517 | Bacteria | 1232 |
| 868 | Ga0495630_0848481 | 3300046517 | Unclassified | 696 |
| 869 | Ga0495644_0013225 | 3300046523 | Bacteria | 3170 |
| 870 | Ga0495644_0066851 | 3300046523 | Bacteria | 1351 |
| 871 | Ga0495663_0003118 | 3300046525 | Bacteria | 4840 |
| 872 | Ga0495652_0020868 | 3300046529 | Bacteria | 5822 |
| 873 | Ga0495652_0055925 | 3300046529 | Bacteria | 3354 |
| 874 | Ga0495652_0266821 | 3300046529 | Bacteria | 1260 |
| 875 | Ga0495665_0066744 | 3300046531 | Bacteria | 1898 |
| 876 | Ga0495640_0016254 | 3300046533 | Bacteria | 5571 |
| 877 | Ga0495587_0000936 | 3300046536 | Bacteria | 19195 |
| 878 | Ga0495587_0008132 | 3300046536 | Bacteria | 6761 |
| 879 | Ga0495587_0144889 | 3300046536 | Bacteria | 1355 |
| 880 | Ga0495598_0083349 | 3300046537 | Bacteria | 1030 |
| 881 | Ga0495621_0253039 | 3300046539 | Bacteria | 720 |
| 882 | Ga0495645_0000329 | 3300046543 | Bacteria | 33749 |
| 883 | Ga0495645_0018815 | 3300046543 | Bacteria | 4968 |
| 884 | Ga0495645_0030282 | 3300046543 | Bacteria | 3941 |
| 885 | Ga0495645_0307890 | 3300046543 | Bacteria | 1033 |
| 886 | Ga0495645_0338272 | 3300046543 | Bacteria | 973 |
| 887 | Ga0495622_0108641 | 3300046557 | Bacteria | 1270 |
| 888 | Ga0495667_0009401 | 3300046559 | Bacteria | 6621 |
| 889 | Ga0495667_0053026 | 3300046559 | Bacteria | 2671 |
| 890 | Ga0495667_0311667 | 3300046559 | Bacteria | 996 |
| 891 | Ga0495656_0006666 | 3300046615 | Bacteria | 4053 |
| 892 | Ga0495656_0248589 | 3300046615 | Bacteria | 898 |
| 893 | Ga0495634_0037315 | 3300046642 | Bacteria | 3321 |
| 894 | Ga0495634_0049194 | 3300046642 | Bacteria | 2836 |
| 895 | Ga0495635_0006056 | 3300046663 | Bacteria | 8437 |
| 896 | Ga0495635_0244329 | 3300046663 | Bacteria | 1211 |
| 897 | Ga0495635_0302509 | 3300046663 | Bacteria | 1072 |
| 898 | Ga0495635_0611140 | 3300046663 | Bacteria | 711 |
| 899 | Ga0495659_0131702 | 3300046664 | Bacteria | 992 |
| 900 | Ga0495659_0144698 | 3300046664 | Bacteria | 951 |
| 901 | Ga0495661_0086217 | 3300046665 | Bacteria | 1798 |
| 902 | Ga0495599_0005410 | 3300046678 | Bacteria | 7627 |
| 903 | Ga0495599_0075643 | 3300046678 | Bacteria | 2102 |
| 904 | Ga0495599_0105760 | 3300046678 | Bacteria | 1753 |
| 905 | Ga0495599_0160406 | 3300046678 | Bacteria | 1390 |
| 906 | Ga0495599_0496777 | 3300046678 | Bacteria | 718 |
| 907 | Ga0495623_0003472 | 3300046679 | Bacteria | 10436 |
| 908 | Ga0495623_0007516 | 3300046679 | Bacteria | 7071 |
| 909 | Ga0495623_0031188 | 3300046679 | Bacteria | 3428 |
| 910 | Ga0495647_0009680 | 3300046681 | Bacteria | 3269 |
| 911 | Ga0495658_0103681 | 3300046683 | Bacteria | 1701 |
| 912 | Ga0495658_0189330 | 3300046683 | Bacteria | 1279 |
| 913 | Ga0495613_0015547 | 3300046689 | Bacteria | 5660 |
| 914 | Ga0495613_0160057 | 3300046689 | Bacteria | 1602 |
| 915 | Ga0495624_0067199 | 3300046690 | Bacteria | 2237 |
| 916 | Ga0495624_0086670 | 3300046690 | Bacteria | 1934 |
| 917 | Ga0495670_0077748 | 3300046691 | Bacteria | 1687 |
| 918 | Ga0495589_0061364 | 3300046794 | Bacteria | 1846 |
| 919 | Ga0495600_0061701 | 3300046809 | Bacteria | 2449 |
| 920 | Ga0495600_0092561 | 3300046809 | Bacteria | 1972 |
| 921 | Ga0495600_0131798 | 3300046809 | Bacteria | 1625 |
| 922 | Ga0495600_0273181 | 3300046809 | Bacteria | 1072 |
| 923 | Ga0495600_0619844 | 3300046809 | Bacteria | 656 |
| 924 | Ga0495581_0040047 | 3300047315 | Bacteria | 2713 |
| 925 | Ga0495581_0104510 | 3300047315 | Bacteria | 1646 |
| 926 | Ga0495604_0090450 | 3300047317 | Unclassified | 2273 |
| 927 | Ga0495604_0100239 | 3300047317 | Bacteria | 2130 |
| 928 | Ga0495604_0186167 | 3300047317 | Bacteria | 1449 |
| 929 | Ga0495604_0232930 | 3300047317 | Bacteria | 1262 |
| 930 | Ga0495604_0262911 | 3300047317 | Unclassified | 1172 |
| 931 | Ga0495636_0192747 | 3300047318 | Bacteria | 928 |
| 932 | Ga0495636_0401088 | 3300047318 | Bacteria | 653 |
| 933 | Ga0495674_0003831 | 3300047319 | Bacteria | 14607 |
| 934 | Ga0495674_0005700 | 3300047319 | Bacteria | 11933 |
| 935 | Ga0495674_0205323 | 3300047319 | Bacteria | 1633 |
| 936 | Ga0495676_0119954 | 3300047321 | Bacteria | 1915 |
| 937 | Ga0495680_0077554 | 3300047322 | Bacteria | 2517 |
| 938 | Ga0495680_0160305 | 3300047322 | Bacteria | 1634 |
| 939 | Ga0495680_0170881 | 3300047322 | Bacteria | 1573 |
| 940 | Ga0495680_0182447 | 3300047322 | Bacteria | 1514 |
| 941 | Ga0495680_0645866 | 3300047322 | Bacteria | 704 |
| 942 | Ga0495680_0713853 | 3300047322 | Unclassified | 661 |
| 943 | Ga0495683_0100293 | 3300047323 | Bacteria | 1393 |
| 944 | Ga0495675_0053582 | 3300047444 | Bacteria | 2561 |
| 945 | Ga0495675_0138019 | 3300047444 | Bacteria | 1513 |
| 946 | Ga0495675_0428257 | 3300047444 | Bacteria | 768 |
| 947 | Ga0495677_0013231 | 3300047445 | Bacteria | 3003 |
| 948 | Ga0495684_0006669 | 3300047471 | Bacteria | 8958 |
| 949 | Ga0495684_0159119 | 3300047471 | Bacteria | 1686 |
| 950 | Ga0495593_0231592 | 3300047673 | Unclassified | 926 |
| 951 | Ga0495602_0021240 | 3300048088 | Bacteria | 6397 |
| 952 | Ga0495602_0092043 | 3300048088 | Bacteria | 2513 |
| 953 | Ga0496100_0175215 | 3300048903 | Bacteria | 1548 |
| 954 | Ga0496100_0209843 | 3300048903 | Unclassified | 1424 |
| 955 | Ga0496100_0277621 | 3300048903 | Bacteria | 1248 |
| 956 | Ga0496100_0387000 | 3300048903 | Bacteria | 1063 |
| 957 | Ga0496101_0376913 | 3300048904 | Unclassified | 1116 |
| 958 | Ga0496102_0059709 | 3300048905 | Bacteria | 3488 |
| 959 | Ga0496103_0315890 | 3300048906 | Bacteria | 1005 |
| 960 | Ga0496104_0060246 | 3300048907 | Unclassified | 3596 |
| 961 | Ga0496104_0083649 | 3300048907 | Bacteria | 3044 |
| 962 | Ga0496104_0117022 | 3300048907 | Bacteria | 2558 |
| 963 | Ga0496104_0217333 | 3300048907 | Bacteria | 1823 |
| 964 | Ga0496105_0002488 | 3300048908 | Bacteria | 13348 |
| 965 | Ga0496105_0112693 | 3300048908 | Bacteria | 2245 |
| 966 | Ga0496106_0035788 | 3300048909 | Bacteria | 3713 |
| 967 | Ga0496106_0185201 | 3300048909 | Bacteria | 1654 |
| 968 | Ga0496106_0457742 | 3300048909 | Bacteria | 1025 |
| 969 | Ga0496107_0191722 | 3300048910 | Bacteria | 1519 |
| 970 | Ga0496107_0601924 | 3300048910 | Bacteria | 812 |
| 971 | Ga0496108_0187161 | 3300048911 | Bacteria | 1794 |
| 972 | Ga0496108_0277517 | 3300048911 | Bacteria | 1459 |
| 973 | Ga0496108_0729400 | 3300048911 | Bacteria | 858 |
| 974 | Ga0496109_0122143 | 3300048912 | Bacteria | 2427 |
| 975 | Ga0496109_0176477 | 3300048912 | Bacteria | 2006 |
| 976 | Ga0496109_0179678 | 3300048912 | Bacteria | 1987 |
| 977 | Ga0496109_0383994 | 3300048912 | Bacteria | 1327 |
| 978 | Ga0496110_0026074 | 3300048913 | Bacteria | 4998 |
| 979 | Ga0496110_0125992 | 3300048913 | Bacteria | 2311 |
| 980 | Ga0496110_0229232 | 3300048913 | Bacteria | 1689 |
| 981 | Ga0496110_0345441 | 3300048913 | Unclassified | 1355 |
| 982 | Ga0496110_0513429 | 3300048913 | Bacteria | 1090 |
| 983 | Ga0496110_0737447 | 3300048913 | Bacteria | 888 |
| 984 | Ga0496111_0000311 | 3300048914 | Bacteria | 23977 |
| 985 | Ga0496112_0021496 | 3300048915 | Bacteria | 6138 |
| 986 | Ga0496112_0192597 | 3300048915 | Bacteria | 2000 |
| 987 | Ga0496112_0418786 | 3300048915 | Bacteria | 1278 |
| 988 | Ga0496113_0065518 | 3300048916 | Bacteria | 2750 |
| 989 | Ga0496113_0316621 | 3300048916 | Bacteria | 1250 |
| 990 | Ga0496113_0700474 | 3300048916 | Bacteria | 808 |
| 991 | Ga0496114_0452938 | 3300048917 | Bacteria | 1136 |
| 992 | Ga0496114_0771404 | 3300048917 | Bacteria | 839 |
| 993 | Ga0496115_0020183 | 3300048918 | Bacteria | 5137 |
| 994 | Ga0496115_0028291 | 3300048918 | Unclassified | 4392 |
| 995 | Ga0496115_0106354 | 3300048918 | Bacteria | 2303 |
| 996 | Ga0496115_0353372 | 3300048918 | Bacteria | 1198 |
| 997 | Ga0496115_1025722 | 3300048918 | Bacteria | 629 |
| 998 | Ga0496118_0241029 | 3300048921 | Bacteria | 1035 |
| 999 | Ga0496119_0163471 | 3300048922 | Bacteria | 1181 |
| 1000 | Ga0496121_0052079 | 3300048924 | Bacteria | 3442 |
| 1001 | Ga0496126_0025633 | 3300048929 | Bacteria | 5668 |
| 1002 | Ga0496126_0764738 | 3300048929 | Bacteria | 744 |
| 1003 | Ga0501031_0001140 | 3300049568 | Bacteria | 16170 |
| 1004 | Ga0501031_0002562 | 3300049568 | Bacteria | 11583 |
| 1005 | Ga0501031_0272512 | 3300049568 | Bacteria | 1099 |
| 1006 | Ga0501032_0138551 | 3300049569 | Bacteria | 1603 |
| 1007 | Ga0501033_0015045 | 3300049570 | Bacteria | 5871 |
| 1008 | Ga0501033_0149983 | 3300049570 | Bacteria | 1682 |
| 1009 | Ga0501034_0391694 | 3300049571 | Bacteria | 1313 |
| 1010 | Ga0501036_0001109 | 3300049572 | Bacteria | 20452 |
| 1011 | Ga0501036_0002462 | 3300049572 | Bacteria | 14510 |
| 1012 | Ga0501036_0074672 | 3300049572 | Bacteria | 2868 |
| 1013 | Ga0501037_0051104 | 3300049573 | Bacteria | 3023 |
| 1014 | Ga0501037_0115825 | 3300049573 | Bacteria | 1929 |
| 1015 | Ga0501038_0005474 | 3300049574 | Bacteria | 11793 |
| 1016 | Ga0501038_0016322 | 3300049574 | Bacteria | 6732 |
| 1017 | Ga0501038_0433679 | 3300049574 | Unclassified | 1012 |
| 1018 | Ga0501038_0907499 | 3300049574 | Bacteria | 650 |
| 1019 | Ga0501039_0000611 | 3300049575 | Bacteria | 25827 |
| 1020 | Ga0501039_0000847 | 3300049575 | Bacteria | 22083 |
| 1021 | Ga0501039_0124162 | 3300049575 | Bacteria | 2024 |
| 1022 | Ga0501039_0808293 | 3300049575 | Bacteria | 731 |
| 1023 | Ga0501040_0000181 | 3300049576 | Bacteria | 36000 |
| 1024 | Ga0501040_0391052 | 3300049576 | Bacteria | 998 |
| 1025 | Ga0501041_0000279 | 3300049577 | Bacteria | 24413 |
| 1026 | Ga0501041_0001044 | 3300049577 | Bacteria | 15155 |
| 1027 | Ga0501041_0241748 | 3300049577 | Bacteria | 1134 |
| 1028 | Ga0501042_0000905 | 3300049578 | Bacteria | 16572 |
| 1029 | Ga0501042_0084984 | 3300049578 | Bacteria | 2269 |
| 1030 | Ga0501043_0009968 | 3300049579 | Bacteria | 7450 |
| 1031 | Ga0501043_0821619 | 3300049579 | Bacteria | 671 |
| 1032 | Ga0501046_0012083 | 3300049580 | Bacteria | 7362 |
| 1033 | Ga0501046_0190540 | 3300049580 | Bacteria | 1530 |
| 1034 | Ga0501046_0277307 | 3300049580 | Bacteria | 1229 |
| 1035 | Ga0501047_0179920 | 3300049581 | Bacteria | 1981 |
| 1036 | Ga0501047_0506297 | 3300049581 | Bacteria | 1034 |
| 1037 | Ga0501048_0000939 | 3300049582 | Bacteria | 21540 |
| 1038 | Ga0501048_0002309 | 3300049582 | Bacteria | 14558 |
| 1039 | Ga0501048_0105285 | 3300049582 | Bacteria | 1991 |
| 1040 | Ga0501068_0032267 | 3300049584 | Bacteria | 3114 |
| 1041 | Ga0501070_0196216 | 3300049586 | Bacteria | 1658 |
| 1042 | Ga0501070_0230162 | 3300049586 | Bacteria | 1519 |
| 1043 | Ga0501071_0003534 | 3300049587 | Bacteria | 9777 |
| 1044 | Ga0501071_0007728 | 3300049587 | Bacteria | 7089 |
| 1045 | Ga0501071_0036214 | 3300049587 | Bacteria | 3518 |
| 1046 | Ga0501071_0049469 | 3300049587 | Bacteria | 3027 |
| 1047 | Ga0501071_0117682 | 3300049587 | Bacteria | 1968 |
| 1048 | Ga0501072_0000167 | 3300049588 | Bacteria | 47771 |
| 1049 | Ga0501072_0042645 | 3300049588 | Bacteria | 3564 |
| 1050 | Ga0501072_0189546 | 3300049588 | Bacteria | 1640 |
| 1051 | Ga0501073_0872212 | 3300049589 | Unclassified | 620 |
| 1052 | Ga0501074_0004465 | 3300049590 | Bacteria | 10011 |
| 1053 | Ga0501074_0031861 | 3300049590 | Bacteria | 3820 |
| 1054 | Ga0501075_0000379 | 3300049591 | Bacteria | 25645 |
| 1055 | Ga0501075_0002352 | 3300049591 | Bacteria | 12550 |
| 1056 | Ga0501075_0075011 | 3300049591 | Bacteria | 2557 |
| 1057 | Ga0501075_0089973 | 3300049591 | Bacteria | 2328 |
| 1058 | Ga0501076_0000162 | 3300049592 | Bacteria | 38846 |
| 1059 | Ga0501076_0000369 | 3300049592 | Bacteria | 27977 |
| 1060 | Ga0501076_0016067 | 3300049592 | Bacteria | 5668 |
| 1061 | Ga0501076_0018936 | 3300049592 | Bacteria | 5253 |
| 1062 | Ga0501077_0012356 | 3300049593 | Bacteria | 5347 |
| 1063 | Ga0501077_0245444 | 3300049593 | Bacteria | 1138 |
| 1064 | Ga0501077_0418437 | 3300049593 | Bacteria | 857 |
| 1065 | Ga0501202_024995 | 3300049652 | Bacteria | 1214 |
| 1066 | Ga0501235_036686 | 3300049669 | Bacteria | 1115 |
| 1067 | Ga0501235_038276 | 3300049669 | Bacteria | 1093 |
| 1068 | Ga0501249_010200 | 3300049679 | Bacteria | 1961 |
| 1069 | Ga0501079_0002956 | 3300049741 | Bacteria | 12426 |
| 1070 | Ga0501079_0026542 | 3300049741 | Bacteria | 4439 |
| 1071 | Ga0501079_0163399 | 3300049741 | Bacteria | 1736 |
| 1072 | Ga0501080_0002596 | 3300049742 | Bacteria | 15821 |
| 1073 | Ga0501080_0068160 | 3300049742 | Bacteria | 3310 |
| 1074 | Ga0501080_0798156 | 3300049742 | Bacteria | 828 |
| 1075 | Ga0501081_0000113 | 3300049743 | Bacteria | 34768 |
| 1076 | Ga0501081_0005776 | 3300049743 | Bacteria | 8013 |
| 1077 | Ga0501081_0056562 | 3300049743 | Bacteria | 2711 |
| 1078 | Ga0501081_0180078 | 3300049743 | Bacteria | 1529 |
| 1079 | Ga0501081_0197664 | 3300049743 | Bacteria | 1458 |
| 1080 | Ga0501083_0009872 | 3300049744 | Bacteria | 6741 |
| 1081 | Ga0501035_0005491 | 3300049822 | Bacteria | 11978 |
| 1082 | Ga0501035_0020503 | 3300049822 | Bacteria | 6072 |
| 1083 | Ga0501035_0176649 | 3300049822 | Bacteria | 1842 |
| 1084 | Ga0501035_0434068 | 3300049822 | Bacteria | 1089 |
| 1085 | Ga0501044_0008395 | 3300049823 | Bacteria | 11331 |
| 1086 | Ga0501044_0214904 | 3300049823 | Bacteria | 1876 |
| 1087 | Ga0501045_0000048 | 3300049824 | Bacteria | 52104 |
| 1088 | Ga0501045_0000434 | 3300049824 | Bacteria | 25587 |
| 1089 | Ga0501045_0103729 | 3300049824 | Bacteria | 2106 |
| 1090 | Ga0501045_0103979 | 3300049824 | Bacteria | 2104 |
| 1091 | Ga0501045_0106439 | 3300049824 | Bacteria | 2078 |
| 1092 | Ga0501045_0259682 | 3300049824 | Bacteria | 1293 |
| 1093 | nmdc:mga03683_2171_c1 | 3300050489 | Bacteria | 6052 |
| 1094 | nmdc:mga03n38_317608_c1 | 3300050490 | Bacteria | 840 |
| 1095 | nmdc:mga00v17_150723_c1 | 3300050491 | Bacteria | 1494 |
| 1096 | nmdc:mga00v17_50652_c1 | 3300050491 | Bacteria | 2524 |
| 1097 | nmdc:mga00v17_9898_c1 | 3300050491 | Bacteria | 5185 |
| 1098 | nmdc:mga0k408_24709_c1 | 3300050493 | Bacteria | 3398 |
| 1099 | nmdc:mga0k408_4495_c1 | 3300050493 | Bacteria | 7400 |
| 1100 | nmdc:mga06z11_45651_c2 | 3300050494 | Bacteria | 1655 |
| 1101 | nmdc:mga06z11_94713_c1 | 3300050494 | Bacteria | 1628 |
| 1102 | nmdc:mga07m45_68215_c1 | 3300050496 | Bacteria | 2022 |
| 1103 | nmdc:mga05p37_101671_c1 | 3300050507 | Bacteria | 3539 |
| 1104 | nmdc:mga05p37_11365_c1 | 3300050507 | Bacteria | 10595 |
| 1105 | nmdc:mga05p37_23337_c1 | 3300050507 | Bacteria | 7506 |
| 1106 | nmdc:mga05p37_247277_c1 | 3300050507 | Bacteria | 2141 |
| 1107 | nmdc:mga05p37_320439_c1 | 3300050507 | Bacteria | 1835 |
| 1108 | nmdc:mga05p37_371570_c1 | 3300050507 | Bacteria | 1678 |
| 1109 | nmdc:mga05p37_37516_c1 | 3300050507 | Bacteria | 5942 |
| 1110 | nmdc:mga05p37_49579_c1 | 3300050507 | Bacteria | 5164 |
| 1111 | nmdc:mga05p37_69222_c1 | 3300050507 | Bacteria | 4341 |
| 1112 | nmdc:mga05p37_73_c1 | 3300050507 | Bacteria | 87143 |
| 1113 | nmdc:mga09592_273130_c1 | 3300050508 | Unclassified | 1466 |
| 1114 | nmdc:mga09592_38541_c1 | 3300050508 | Unclassified | 4012 |
| 1115 | nmdc:mga09592_6310_c1 | 3300050508 | Bacteria | 9661 |
| 1116 | nmdc:mga09592_664665_c1 | 3300050508 | Bacteria | 889 |
| 1117 | nmdc:mga0qj67_151654_c1 | 3300050509 | Bacteria | 1880 |
| 1118 | nmdc:mga0qj67_18830_c1 | 3300050509 | Bacteria | 5266 |
| 1119 | nmdc:mga0qj67_295_c1 | 3300050509 | Bacteria | 34738 |
| 1120 | nmdc:mga0qj67_321599_c1 | 3300050509 | Bacteria | 1252 |
| 1121 | nmdc:mga0qj67_54208_c1 | 3300050509 | Bacteria | 3175 |
| 1122 | nmdc:mga06r32_1247_c1 | 3300050510 | Bacteria | 22881 |
| 1123 | nmdc:mga06r32_249779_c1 | 3300050510 | Bacteria | 1761 |
| 1124 | nmdc:mga06r32_83989_c1 | 3300050510 | Bacteria | 3103 |
| 1125 | nmdc:mga08y16_126306_c1 | 3300050511 | Unclassified | 2660 |
| 1126 | nmdc:mga08y16_1290551_c1 | 3300050511 | Bacteria | 697 |
| 1127 | nmdc:mga08y16_15894_c1 | 3300050511 | Bacteria | 7911 |
| 1128 | nmdc:mga08y16_228767_c2 | 3300050511 | Bacteria | 1545 |
| 1129 | nmdc:mga08y16_5598_c1 | 3300050511 | Bacteria | 13165 |
| 1130 | nmdc:mga08y16_65540_c1 | 3300050511 | Bacteria | 3792 |
| 1131 | nmdc:mga0n895_116614_c1 | 3300050512 | Bacteria | 2689 |
| 1132 | nmdc:mga0n895_1175698_c1 | 3300050512 | Bacteria | 742 |
| 1133 | nmdc:mga0n895_162263_c1 | 3300050512 | Bacteria | 2267 |
| 1134 | nmdc:mga0n895_162361_c1 | 3300050512 | Bacteria | 2266 |
| 1135 | nmdc:mga0n895_190442_c1 | 3300050512 | Bacteria | 2082 |
| 1136 | nmdc:mga0n895_327549_c1 | 3300050512 | Bacteria | 1552 |
| 1137 | nmdc:mga0n895_498385_c1 | 3300050512 | Bacteria | 1227 |
| 1138 | nmdc:mga0rr50_1_c1 | 3300050513 | Bacteria | 558123 |
| 1139 | nmdc:mga0rr50_289066_c1 | 3300050513 | Bacteria | 1369 |
| 1140 | nmdc:mga0rr50_430196_c1 | 3300050513 | Bacteria | 1117 |
| 1141 | nmdc:mga0rr50_511665_c1 | 3300050513 | Bacteria | 1021 |
| 1142 | nmdc:mga0rr50_74540_c1 | 3300050513 | Bacteria | 2598 |
| 1143 | nmdc:mga08x19_113853_c1 | 3300050514 | Unclassified | 1806 |
| 1144 | nmdc:mga08x19_250405_c1 | 3300050514 | Bacteria | 1223 |
| 1145 | nmdc:mga08x19_311_c1 | 3300050514 | Bacteria | 35355 |
| 1146 | nmdc:mga0a205_112130_c1 | 3300050515 | Bacteria | 2626 |
| 1147 | nmdc:mga0a205_13997_c1 | 3300050515 | Bacteria | 5010 |
| 1148 | nmdc:mga0a205_239589_c1 | 3300050515 | Bacteria | 1695 |
| 1149 | nmdc:mga0a205_607259_c1 | 3300050515 | Bacteria | 947 |
| 1150 | Ga0495601_0000814 | 3300053077 | Bacteria | 16892 |
| 1151 | Ga0495601_0026813 | 3300053077 | Unclassified | 3560 |
| 1152 | Ga0495601_0111834 | 3300053077 | Bacteria | 1769 |
| 1153 | Ga0495601_0141591 | 3300053077 | Bacteria | 1569 |
| 1154 | Ga0495601_0169695 | 3300053077 | Bacteria | 1426 |
| 1155 | Ga0495601_0295144 | 3300053077 | Bacteria | 1056 |
| 1156 | Ga0495601_0658035 | 3300053077 | Bacteria | 670 |
| 1157 | Ga0495612_0153132 | 3300053078 | Bacteria | 1004 |
| 1158 | Ga0495612_0156882 | 3300053078 | Bacteria | 992 |
| 1159 | Ga0495612_0184201 | 3300053078 | Unclassified | 918 |
| 1160 | Ga0495595_0020871 | 3300053084 | Bacteria | 2855 |
| 1161 | Ga0495619_0092783 | 3300053085 | Bacteria | 2046 |
| 1162 | Ga0495619_0222219 | 3300053085 | Bacteria | 1308 |
| 1163 | Ga0495619_0558691 | 3300053085 | Bacteria | 785 |
| 1164 | Ga0500628_007332 | 3300053129 | Bacteria | 1888 |
| 1165 | Ga0500573_0250175 | 3300053140 | Unclassified | 914 |
| 1166 | Ga0501084_0001506 | 3300054114 | Bacteria | 18475 |
| 1167 | Ga0501084_0088485 | 3300054114 | Bacteria | 2600 |
| 1168 | Ga0501084_0162429 | 3300054114 | Bacteria | 1885 |
| 1169 | Ga0590074_030614 | 3300059423 | Bacteria | 950 |
| 1170 | Ga0590077_003121 | 3300059426 | Bacteria | 3467 |
| 1171 | Ga0587084_010970 | 3300059477 | Bacteria | 1198 |
| 1172 | Ga0501082_0002405 | 3300060353 | Bacteria | 16414 |
| 1173 | Ga0501082_0030474 | 3300060353 | Bacteria | 4648 |
| 1174 | Ga0501082_0121847 | 3300060353 | Bacteria | 2261 |
| 1175 | Ga0501082_0451203 | 3300060353 | Bacteria | 1124 |
| 1176 | Ga0501082_0464553 | 3300060353 | Bacteria | 1106 |
| 1177 | Ga0501082_1055764 | 3300060353 | Bacteria | 710 |
| 1178 | Ga0530510_0001043 | 3300061734 | Bacteria | 18333 |
| 1179 | Ga0530510_0025200 | 3300061734 | Bacteria | 4252 |
| 1180 | Ga0530510_0095625 | 3300061734 | Bacteria | 2170 |
| 1181 | Ga0530510_0360175 | 3300061734 | Bacteria | 1093 |
| 1182 | 2513723079 | 2513237104 | Bacteria | 10034502 |
| 1183 | Ga0207670_10560662 | |||
| 1184 | MBSR1b_contig_3986932 | |||
| 1185 | rootH2_10198595 | |||
| 1186 | Ga0065712_10111273 | |||
| 1187 | Ga0065712_10227585 | |||
| 1188 | Ga0065715_10123992 | |||
| 1189 | Ga0065715_10145971 | |||
| 1190 | Ga0065707_10114551 | |||
| 1191 | Ga0065707_10124965 | |||
| 1192 | Ga0065707_10623721 | |||
| 1193 | Ga0070676_10022501 | |||
| 1194 | Ga0070683_100000285 | |||
| 1195 | Ga0070683_100000885 | |||
| 1196 | Ga0070683_100457824 | |||
| 1197 | Ga0070690_100198575 | |||
| 1198 | Ga0070690_100219435 | |||
| 1199 | Ga0070670_100115259 | |||
| 1200 | Ga0070670_101192749 | |||
| 1201 | Ga0070670_101223154 | |||
| 1202 | Ga0070680_100032407 | |||
| 1203 | Ga0070680_100033912 | |||
| 1204 | Ga0070680_100079500 | |||
| 1205 | Ga0070680_100569918 | |||
| 1206 | Ga0068868_100321709 | |||
| 1207 | Ga0068868_100764613 | |||
| 1208 | Ga0070689_100000097 | |||
| 1209 | Ga0070689_100045297 | |||
| 1210 | Ga0070689_100076039 | |||
| 1211 | Ga0070691_10000311 | |||
| 1212 | Ga0070691_10319055 | |||
| 1213 | Ga0070691_10330130 | |||
| 1214 | Ga0070687_100040318 | |||
| 1215 | Ga0070661_100020968 | |||
| 1216 | Ga0070692_10063869 | |||
| 1217 | Ga0070692_10198624 | |||
| 1218 | Ga0070692_10292257 | |||
| 1219 | Ga0070668_100006373 | |||
| 1220 | Ga0070668_100009927 | |||
| 1221 | Ga0070668_100121302 | |||
| 1222 | Ga0070669_100008994 | |||
| 1223 | Ga0070669_100010632 | |||
| 1224 | Ga0070669_100031415 | |||
| 1225 | Ga0070669_100173602 | |||
| 1226 | Ga0070675_100623882 | |||
| 1227 | Ga0070675_101081867 | |||
| 1228 | Ga0070671_100006892 | |||
| 1229 | Ga0070671_100401932 | |||
| 1230 | Ga0070671_100918270 | |||
| 1231 | Ga0070674_100184176 | |||
| 1232 | Ga0070674_100330597 | |||
| 1233 | Ga0070673_100110108 | |||
| 1234 | Ga0070673_100676168 | |||
| 1235 | Ga0070688_100000331 | |||
| 1236 | Ga0070688_100365484 | |||
| 1237 | Ga0070688_100719393 | |||
| 1238 | Ga0070659_100221997 | |||
| 1239 | Ga0070667_100028146 | |||
| 1240 | Ga0070667_100679636 | |||
| 1241 | Ga0070667_100777973 | |||
| 1242 | Ga0070709_10010582 | |||
| 1243 | Ga0070709_10014499 | |||
| 1244 | Ga0070709_10149359 | |||
| 1245 | Ga0070709_10166502 | |||
| 1246 | Ga0070714_100027756 | |||
| 1247 | Ga0070714_100092496 | |||
| 1248 | Ga0070714_100116478 | |||
| 1249 | Ga0070714_100147307 | |||
| 1250 | Ga0070714_100169619 | |||
| 1251 | Ga0070714_100525394 | |||
| 1252 | Ga0070714_100584890 | |||
| 1253 | Ga0070713_100000652 | |||
| 1254 | Ga0070713_100006798 | |||
| 1255 | Ga0070713_100014331 | |||
| 1256 | Ga0070713_100021942 | |||
| 1257 | Ga0070713_100056483 | |||
| 1258 | Ga0070713_100073704 | |||
| 1259 | Ga0070713_100095141 | |||
| 1260 | Ga0070713_100169079 | |||
| 1261 | Ga0070713_100237810 | |||
| 1262 | Ga0070713_100238354 | |||
| 1263 | Ga0070713_100689425 | |||
| 1264 | Ga0070710_10019985 | |||
| 1265 | Ga0070710_10113917 | |||
| 1266 | Ga0070710_10152228 | |||
| 1267 | Ga0070710_10170815 | |||
| 1268 | Ga0070701_10590171 | |||
| 1269 | Ga0070711_100001160 | |||
| 1270 | Ga0070711_100004773 | |||
| 1271 | Ga0070711_100010993 | |||
| 1272 | Ga0070711_100016541 | |||
| 1273 | Ga0070711_100577215 | |||
| 1274 | Ga0070711_100712998 | |||
| 1275 | Ga0070705_100014030 | |||
| 1276 | Ga0070705_100063181 | |||
| 1277 | Ga0070705_100408827 | |||
| 1278 | Ga0070700_100004714 | |||
| 1279 | Ga0070700_100262953 | |||
| 1280 | Ga0070700_100433722 | |||
| 1281 | Ga0070700_100863394 | |||
| 1282 | Ga0070694_100179358 | |||
| 1283 | Ga0070694_100708600 | |||
| 1284 | Ga0070694_101177493 | |||
| 1285 | Ga0070708_100000011 | |||
| 1286 | Ga0070708_100049356 | |||
| 1287 | Ga0070708_100051450 | |||
| 1288 | Ga0070708_100061977 | |||
| 1289 | Ga0070708_100152387 | |||
| 1290 | Ga0070708_100323002 | |||
| 1291 | Ga0070663_100121970 | |||
| 1292 | Ga0070662_100033401 | |||
| 1293 | Ga0070662_100062454 | |||
| 1294 | Ga0070662_100320008 | |||
| 1295 | Ga0070681_10001001 | |||
| 1296 | Ga0070681_10021576 | |||
| 1297 | Ga0070681_10065204 | |||
| 1298 | Ga0070681_10110890 | |||
| 1299 | Ga0070681_10664202 | |||
| 1300 | Ga0068867_100017645 | |||
| 1301 | Ga0068867_100029757 | |||
| 1302 | Ga0068867_100881280 | |||
| 1303 | Ga0070685_10031643 | |||
| 1304 | Ga0070685_10588778 | |||
| 1305 | Ga0070706_100005169 | |||
| 1306 | Ga0070706_100026602 | |||
| 1307 | Ga0070706_100040746 | |||
| 1308 | Ga0070706_100052542 | |||
| 1309 | Ga0070707_100108697 | |||
| 1310 | Ga0070707_100109797 | |||
| 1311 | Ga0070707_100119166 | |||
| 1312 | Ga0070707_100292462 | |||
| 1313 | Ga0070707_100316783 | |||
| 1314 | Ga0070707_100336724 | |||
| 1315 | Ga0070707_100495991 | |||
| 1316 | Ga0070707_100501585 | |||
| 1317 | Ga0070707_101008295 | |||
| 1318 | Ga0070698_100007599 | |||
| 1319 | Ga0070698_100061946 | |||
| 1320 | Ga0070698_100131771 | |||
| 1321 | Ga0070698_100143391 | |||
| 1322 | Ga0070698_100260561 | |||
| 1323 | Ga0070698_100418818 | |||
| 1324 | Ga0070698_100441858 | |||
| 1325 | Ga0070698_100465619 | |||
| 1326 | Ga0070698_100475518 | |||
| 1327 | Ga0070698_100864887 | |||
| 1328 | Ga0070698_101147414 | |||
| 1329 | Ga0070699_100001465 | |||
| 1330 | Ga0070699_100011744 | |||
| 1331 | Ga0070699_100041970 | |||
| 1332 | Ga0070699_100048893 | |||
| 1333 | Ga0070699_100119111 | |||
| 1334 | Ga0070699_100162453 | |||
| 1335 | Ga0070699_100177367 | |||
| 1336 | Ga0070699_100385441 | |||
| 1337 | Ga0070699_100725767 | |||
| 1338 | Ga0070679_100006936 | |||
| 1339 | Ga0070679_100016478 | |||
| 1340 | Ga0070679_100176249 | |||
| 1341 | Ga0070684_100002974 | |||
| 1342 | Ga0070684_100032801 | |||
| 1343 | Ga0070684_100044962 | |||
| 1344 | Ga0070684_100304938 | |||
| 1345 | Ga0070684_100319971 | |||
| 1346 | Ga0070684_100829755 | |||
| 1347 | Ga0070697_100011432 | |||
| 1348 | Ga0070697_100058542 | |||
| 1349 | Ga0070697_100067666 | |||
| 1350 | Ga0070697_100454683 | |||
| 1351 | Ga0070697_100646586 | |||
| 1352 | Ga0068853_100260917 | |||
| 1353 | Ga0070672_100029846 | |||
| 1354 | Ga0070672_100039794 | |||
| 1355 | Ga0070672_100099084 | |||
| 1356 | Ga0070672_100290360 | |||
| 1357 | Ga0070672_100784287 | |||
| 1358 | Ga0070686_100155207 | |||
| 1359 | Ga0070686_100503922 | |||
| 1360 | Ga0070695_100002602 | |||
| 1361 | Ga0070696_100015489 | |||
| 1362 | Ga0070696_100035051 | |||
| 1363 | Ga0070696_101193998 | |||
| 1364 | Ga0070693_100133143 | |||
| 1365 | Ga0070704_100008355 | |||
| 1366 | Ga0070704_100918572 | |||
| 1367 | Ga0068855_100149447 | |||
| 1368 | Ga0068855_100374073 | |||
| 1369 | Ga0068855_100672466 | |||
| 1370 | Ga0070664_100064215 | |||
| 1371 | Ga0070664_100162795 | |||
| 1372 | Ga0070664_100288604 | |||
| 1373 | Ga0070664_100421363 | |||
| 1374 | Ga0070664_100949999 | |||
| 1375 | Ga0068857_100006115 | |||
| 1376 | Ga0068857_100028102 | |||
| 1377 | Ga0068857_101437586 | |||
| 1378 | Ga0068854_100451228 | |||
| 1379 | Ga0068854_100481043 | |||
| 1380 | Ga0068854_100591721 | |||
| 1381 | Ga0068856_100002563 | |||
| 1382 | Ga0068856_100215639 | |||
| 1383 | Ga0068856_101278035 | |||
| 1384 | Ga0070702_100002995 | |||
| 1385 | Ga0068852_100033298 | |||
| 1386 | Ga0068859_100042980 | |||
| 1387 | Ga0068859_100711221 | |||
| 1388 | Ga0068864_100092584 | |||
| 1389 | Ga0068864_100218126 | |||
| 1390 | Ga0068864_100549589 | |||
| 1391 | Ga0068861_100137588 | |||
| 1392 | Ga0068861_100238401 | |||
| 1393 | Ga0068863_100000908 | |||
| 1394 | Ga0068863_100674922 | |||
| 1395 | Ga0068863_100946958 | |||
| 1396 | Ga0068863_100952967 | |||
| 1397 | Ga0068858_100105360 | |||
| 1398 | Ga0068858_100677679 | |||
| 1399 | Ga0068858_100991778 | |||
| 1400 | Ga0068860_100053850 | |||
| 1401 | Ga0068860_100060582 | |||
| 1402 | Ga0068860_100479555 | |||
| 1403 | Ga0068862_100000825 | |||
| 1404 | Ga0081455_10073317 | |||
| 1405 | Ga0081455_10120184 | |||
| 1406 | Ga0081538_10005103 | |||
| 1407 | Ga0081538_10058510 | |||
| 1408 | Ga0081539_10003032 | |||
| 1409 | Ga0081539_10066354 | |||
| 1410 | Ga0081539_10305735 | |||
| 1411 | Ga0070717_10007152 | |||
| 1412 | Ga0070717_10011548 | |||
| 1413 | Ga0070717_10029455 | |||
| 1414 | Ga0070717_10040442 | |||
| 1415 | Ga0070717_10072343 | |||
| 1416 | Ga0070717_10122669 | |||
| 1417 | Ga0070717_10253466 | |||
| 1418 | Ga0070717_10363866 | |||
| 1419 | Ga0070717_10671644 | |||
| 1420 | Ga0070717_10690742 | |||
| 1421 | Ga0070717_10940368 | |||
| 1422 | Ga0070717_11188645 | |||
| 1423 | Ga0075368_10035707 | |||
| 1424 | Ga0075364_10009943 | |||
| 1425 | Ga0075364_10050996 | |||
| 1426 | Ga0075364_10285451 | |||
| 1427 | Ga0070715_10003272 | |||
| 1428 | Ga0070715_10006430 | |||
| 1429 | Ga0070715_10065527 | |||
| 1430 | Ga0070716_100012863 | |||
| 1431 | Ga0070716_100057385 | |||
| 1432 | Ga0070716_100085772 | |||
| 1433 | Ga0070716_100365074 | |||
| 1434 | Ga0070716_100770581 | |||
| 1435 | Ga0070716_100908641 | |||
| 1436 | Ga0070712_100002509 | |||
| 1437 | Ga0070712_100002786 | |||
| 1438 | Ga0070712_100154314 | |||
| 1439 | Ga0070712_100467107 | |||
| 1440 | Ga0070712_100650627 | |||
| 1441 | Ga0075362_10003235 | |||
| 1442 | Ga0075367_10025633 | |||
| 1443 | Ga0075367_10027307 | |||
| 1444 | Ga0075366_10044372 | |||
| 1445 | Ga0097621_100006910 | |||
| 1446 | Ga0097621_100106784 | |||
| 1447 | Ga0097621_100240621 | |||
| 1448 | Ga0075370_10079271 | |||
| 1449 | Ga0068871_100907182 | |||
| 1450 | Ga0075428_100057162 | |||
| 1451 | Ga0075428_100163953 | |||
| 1452 | Ga0075428_100291678 | |||
| 1453 | Ga0075428_100773785 | |||
| 1454 | Ga0075430_100013818 | |||
| 1455 | Ga0075430_100093531 | |||
| 1456 | Ga0075430_100223245 | |||
| 1457 | Ga0075430_100322310 | |||
| 1458 | Ga0075430_100566279 | |||
| 1459 | Ga0075431_100136884 | |||
| 1460 | Ga0075431_100155525 | |||
| 1461 | Ga0075431_100262096 | |||
| 1462 | Ga0075431_100344092 | |||
| 1463 | Ga0075433_10014954 | |||
| 1464 | Ga0075433_10111250 | |||
| 1465 | Ga0075433_10127741 | |||
| 1466 | Ga0075433_10150613 | |||
| 1467 | Ga0075433_10881344 | |||
| 1468 | Ga0075434_100000451 | |||
| 1469 | Ga0075434_100018027 | |||
| 1470 | Ga0075434_100020202 | |||
| 1471 | Ga0075434_100159251 | |||
| 1472 | Ga0075434_100160874 | |||
| 1473 | Ga0075434_100219315 | |||
| 1474 | Ga0075434_100469607 | |||
| 1475 | Ga0075434_100521139 | |||
| 1476 | Ga0075434_101067696 | |||
| 1477 | Ga0075429_100051881 | |||
| 1478 | Ga0075429_100086007 | |||
| 1479 | Ga0075429_100495056 | |||
| 1480 | Ga0075429_100554595 | |||
| 1481 | Ga0068865_100036113 | |||
| 1482 | Ga0068865_100080123 | |||
| 1483 | Ga0068865_100175854 | |||
| 1484 | Ga0075436_100000203 | |||
| 1485 | Ga0097620_100042978 | |||
| 1486 | Ga0097620_100656304 | |||
| 1487 | Ga0097620_100711313 | |||
| 1488 | Ga0075435_100000012 | |||
| 1489 | Ga0075435_100131120 | |||
| 1490 | Ga0075435_100251014 | |||
| 1491 | Ga0075435_100344506 | |||
| 1492 | Ga0075435_100609683 | |||
| 1493 | Ga0099794_10052262 | |||
| 1494 | Ga0105240_10037867 | |||
| 1495 | Ga0105240_10099581 | |||
| 1496 | Ga0105240_10211946 | |||
| 1497 | Ga0105240_10445109 | |||
| 1498 | Ga0105240_10855540 | |||
| 1499 | Ga0111539_10008520 | |||
| 1500 | Ga0111539_10010938 | |||
| 1501 | Ga0111539_10023712 | |||
| 1502 | Ga0111539_10036591 | |||
| 1503 | Ga0111539_10055948 | |||
| 1504 | Ga0111539_10292196 | |||
| 1505 | Ga0111539_10697814 | |||
| 1506 | Ga0111539_10997450 | |||
| 1507 | Ga0111539_11021357 | |||
| 1508 | Ga0105245_10585683 | |||
| 1509 | Ga0105247_10079189 | |||
| 1510 | Ga0114129_10008502 | |||
| 1511 | Ga0114129_10021385 | |||
| 1512 | Ga0114129_10023980 | |||
| 1513 | Ga0114129_10033927 | |||
| 1514 | Ga0114129_10057157 | |||
| 1515 | Ga0114129_10100063 | |||
| 1516 | Ga0114129_10161848 | |||
| 1517 | Ga0114129_10170822 | |||
| 1518 | Ga0114129_10207198 | |||
| 1519 | Ga0114129_10249459 | |||
| 1520 | Ga0114129_10276140 | |||
| 1521 | Ga0114129_10569839 | |||
| 1522 | Ga0114129_10664052 | |||
| 1523 | Ga0114129_10911080 | |||
| 1524 | Ga0105241_10424749 | |||
| 1525 | Ga0105242_10023415 | |||
| 1526 | Ga0105242_10177354 | |||
| 1527 | Ga0105242_11110899 | |||
| 1528 | Ga0105248_10018116 | |||
| 1529 | Ga0105248_10039701 | |||
| 1530 | Ga0105248_10185947 | |||
| 1531 | Ga0105248_10270063 | |||
| 1532 | Ga0105248_10391189 | |||
| 1533 | Ga0105248_10598732 | |||
| 1534 | Ga0105248_11129416 | |||
| 1535 | Ga0105237_10119496 | |||
| 1536 | Ga0105237_10423602 | |||
| 1537 | Ga0105237_11127626 | |||
| 1538 | Ga0105238_10030121 | |||
| 1539 | Ga0105238_10089705 | |||
| 1540 | Ga0105238_10114136 | |||
| 1541 | Ga0105238_10591951 | |||
| 1542 | Ga0105249_10000665 | |||
| 1543 | Ga0105249_10005149 | |||
| 1544 | Ga0105249_10854241 | |||
| 1545 | Ga0105249_10859848 | |||
| 1546 | Ga0105239_11210975 | |||
| 1547 | Ga0105246_10362348 | |||
| 1548 | Ga0105246_10462495 | |||
| 1549 | Ga0105246_10586793 | |||
| 1550 | Ga0105246_10634169 | |||
| 1551 | Ga0157346_1005414 | |||
| 1552 | Ga0157371_10016487 | |||
| 1553 | Ga0157370_10000316 | |||
| 1554 | Ga0157370_10275558 | |||
| 1555 | Ga0157370_10358347 | |||
| 1556 | Ga0157369_10002654 | |||
| 1557 | Ga0157369_10011644 | |||
| 1558 | Ga0157369_10020021 | |||
| 1559 | Ga0157369_10140537 | |||
| 1560 | Ga0157369_10420812 | |||
| 1561 | Ga0157374_10404408 | |||
| 1562 | Ga0157374_10487487 | |||
| 1563 | Ga0157374_10836252 | |||
| 1564 | Ga0157378_10110887 | |||
| 1565 | Ga0157378_10557879 | |||
| 1566 | Ga0157378_10875750 | |||
| 1567 | Ga0163162_10014068 | |||
| 1568 | Ga0163162_10135363 | |||
| 1569 | Ga0163162_10220991 | |||
| 1570 | Ga0157372_10003848 | |||
| 1571 | Ga0157372_10411739 | |||
| 1572 | Ga0157375_10007743 | |||
| 1573 | Ga0157375_10141692 | |||
| 1574 | Ga0157375_10190741 | |||
| 1575 | Ga0157375_10226402 | |||
| 1576 | Ga0157375_10269570 | |||
| 1577 | Ga0157375_10840441 | |||
| 1578 | Ga0157375_11456914 | |||
| 1579 | Ga0157375_11859372 | |||
| 1580 | Ga0163163_10000017 | |||
| 1581 | Ga0163163_10445224 | |||
| 1582 | Ga0163163_10544211 | |||
| 1583 | Ga0163163_10691813 | |||
| 1584 | Ga0163163_11044961 | |||
| 1585 | Ga0157380_10006923 | |||
| 1586 | Ga0157380_10948282 | |||
| 1587 | Ga0157380_11674850 | |||
| 1588 | Ga0157377_10010222 | |||
| 1589 | Ga0157377_10122749 | |||
| 1590 | Ga0157379_10047690 | |||
| 1591 | Ga0157379_10049003 | |||
| 1592 | Ga0163161_10198470 | |||
| 1593 | Ga0197907_10710089 | |||
| 1594 | Ga0206356_10680555 | |||
| 1595 | Ga0206349_1837458 | |||
| 1596 | Ga0206351_10564219 | |||
| 1597 | Ga0206354_11435900 | |||
| 1598 | Ga0206353_11539969 | |||
| 1599 | Ga0213876_10269606 | |||
| 1600 | Ga0213876_10273202 | |||
| 1601 | Ga0224712_10009247 | |||
| 1602 | Ga0224712_10018351 | |||
| 1603 | Ga0228598_1002744 | |||
| 1604 | Ga0207697_10004143 | |||
| 1605 | Ga0207682_10048231 | |||
| 1606 | Ga0207692_10046021 | |||
| 1607 | Ga0207692_10088359 | |||
| 1608 | Ga0207692_10248120 | |||
| 1609 | Ga0207710_10143408 | |||
| 1610 | Ga0207688_10088773 | |||
| 1611 | Ga0207685_10009413 | |||
| 1612 | Ga0207685_10022188 | |||
| 1613 | Ga0207699_10016009 | |||
| 1614 | Ga0207699_10018311 | |||
| 1615 | Ga0207699_10337245 | |||
| 1616 | Ga0207645_10000951 | |||
| 1617 | Ga0207684_10001709 | |||
| 1618 | Ga0207684_10013136 | |||
| 1619 | Ga0207684_10021919 | |||
| 1620 | Ga0207684_10046428 | |||
| 1621 | Ga0207684_10047401 | |||
| 1622 | Ga0207684_10082242 | |||
| 1623 | Ga0207684_10626605 | |||
| 1624 | Ga0207707_10012200 | |||
| 1625 | Ga0207707_10016072 | |||
| 1626 | Ga0207707_10154790 | |||
| 1627 | Ga0207707_10623480 | |||
| 1628 | Ga0207707_10960272 | |||
| 1629 | Ga0207695_10055205 | |||
| 1630 | Ga0207695_10365071 | |||
| 1631 | Ga0207671_10152266 | |||
| 1632 | Ga0207693_10002323 | |||
| 1633 | Ga0207693_10003126 | |||
| 1634 | Ga0207693_10009038 | |||
| 1635 | Ga0207693_10033877 | |||
| 1636 | Ga0207693_10073386 | |||
| 1637 | Ga0207693_10115182 | |||
| 1638 | Ga0207693_10304452 | |||
| 1639 | Ga0207693_10337040 | |||
| 1640 | Ga0207693_10410322 | |||
| 1641 | Ga0207663_10000275 | |||
| 1642 | Ga0207663_10001046 | |||
| 1643 | Ga0207663_10004310 | |||
| 1644 | Ga0207663_10035038 | |||
| 1645 | Ga0207663_10120740 | |||
| 1646 | Ga0207663_10208778 | |||
| 1647 | Ga0207660_10025592 | |||
| 1648 | Ga0207660_10047006 | |||
| 1649 | Ga0207662_10005032 | |||
| 1650 | Ga0207662_10171795 | |||
| 1651 | Ga0207657_10505701 | |||
| 1652 | Ga0207649_10211211 | |||
| 1653 | Ga0207649_10251690 | |||
| 1654 | Ga0207652_10023916 | |||
| 1655 | Ga0207652_10321010 | |||
| 1656 | Ga0207646_10005883 | |||
| 1657 | Ga0207646_10025817 | |||
| 1658 | Ga0207646_10054282 | |||
| 1659 | Ga0207646_10055008 | |||
| 1660 | Ga0207646_10063768 | |||
| 1661 | Ga0207646_10070675 | |||
| 1662 | Ga0207646_10073151 | |||
| 1663 | Ga0207646_10084425 | |||
| 1664 | Ga0207646_10090980 | |||
| 1665 | Ga0207646_10190967 | |||
| 1666 | Ga0207681_10022135 | |||
| 1667 | Ga0207681_10069430 | |||
| 1668 | Ga0207681_10189130 | |||
| 1669 | Ga0207694_10038610 | |||
| 1670 | Ga0207694_10097241 | |||
| 1671 | Ga0207694_10302680 | |||
| 1672 | Ga0207694_10420321 | |||
| 1673 | Ga0207650_10573581 | |||
| 1674 | Ga0207659_10736166 | |||
| 1675 | Ga0207700_10000856 | |||
| 1676 | Ga0207700_10002332 | |||
| 1677 | Ga0207700_10002921 | |||
| 1678 | Ga0207700_10019902 | |||
| 1679 | Ga0207700_10020055 | |||
| 1680 | Ga0207700_10025563 | |||
| 1681 | Ga0207700_10052889 | |||
| 1682 | Ga0207700_10071210 | |||
| 1683 | Ga0207700_10136102 | |||
| 1684 | Ga0207700_10351628 | |||
| 1685 | Ga0207700_10417653 | |||
| 1686 | Ga0207700_10730181 | |||
| 1687 | Ga0207664_10000532 | |||
| 1688 | Ga0207664_10450250 | |||
| 1689 | Ga0207664_11173270 | |||
| 1690 | Ga0207706_10001737 | |||
| 1691 | Ga0207706_10012184 | |||
| 1692 | Ga0207706_10067629 | |||
| 1693 | Ga0207706_10625955 | |||
| 1694 | Ga0207706_11039974 | |||
| 1695 | Ga0207686_10097756 | |||
| 1696 | Ga0207670_10000034 | |||
| 1697 | Ga0207670_10203545 | |||
| 1698 | Ga0207670_10207932 | |||
| 1699 | Ga0207669_10491822 | |||
| 1700 | Ga0207669_10838778 | |||
| 1701 | Ga0207704_10029935 | |||
| 1702 | Ga0207665_10000132 | |||
| 1703 | Ga0207665_10000500 | |||
| 1704 | Ga0207665_10062371 | |||
| 1705 | Ga0207665_10114808 | |||
| 1706 | Ga0207665_10160474 | |||
| 1707 | Ga0207665_10227406 | |||
| 1708 | Ga0207665_10915203 | |||
| 1709 | Ga0207691_10000366 | |||
| 1710 | Ga0207691_10001194 | |||
| 1711 | Ga0207691_10037285 | |||
| 1712 | Ga0207691_10231614 | |||
| 1713 | Ga0207691_10639279 | |||
| 1714 | Ga0207691_10833080 | |||
| 1715 | Ga0207689_10141974 | |||
| 1716 | Ga0207689_10375498 | |||
| 1717 | Ga0207661_10000208 | |||
| 1718 | Ga0207661_10035976 | |||
| 1719 | Ga0207661_10038493 | |||
| 1720 | Ga0207661_10335798 | |||
| 1721 | Ga0207661_10648445 | |||
| 1722 | Ga0207679_10046679 | |||
| 1723 | Ga0207679_10153895 | |||
| 1724 | Ga0207679_10203353 | |||
| 1725 | Ga0207679_11121931 | |||
| 1726 | Ga0207667_10174128 | |||
| 1727 | Ga0207667_10409645 | |||
| 1728 | Ga0207667_10452182 | |||
| 1729 | Ga0207667_10753171 | |||
| 1730 | Ga0207667_11374379 | |||
| 1731 | Ga0207651_10619921 | |||
| 1732 | Ga0207712_10000812 | |||
| 1733 | Ga0207712_10095413 | |||
| 1734 | Ga0207712_10375331 | |||
| 1735 | Ga0207668_10002276 | |||
| 1736 | Ga0207668_10006808 | |||
| 1737 | Ga0207668_10217143 | |||
| 1738 | Ga0207668_11324048 | |||
| 1739 | Ga0207658_10382666 | |||
| 1740 | Ga0207658_10734297 | |||
| 1741 | Ga0207703_10515851 | |||
| 1742 | Ga0207703_10640198 | |||
| 1743 | Ga0207639_10009125 | |||
| 1744 | Ga0207678_10016479 | |||
| 1745 | Ga0207678_10535199 | |||
| 1746 | Ga0207708_10056420 | |||
| 1747 | Ga0207702_10007569 | |||
| 1748 | Ga0207702_10240791 | |||
| 1749 | Ga0207641_10102831 | |||
| 1750 | Ga0207641_10364385 | |||
| 1751 | Ga0207641_10520857 | |||
| 1752 | Ga0207674_10000861 | |||
| 1753 | Ga0207674_10008925 | |||
| 1754 | Ga0207675_100000964 | |||
| 1755 | Ga0207675_100001025 | |||
| 1756 | Ga0209588_1059709 | |||
| 1757 | Ga0207428_10001806 | |||
| 1758 | Ga0207428_10007234 | |||
| 1759 | Ga0207428_10036298 | |||
| 1760 | Ga0268265_10000988 | |||
| 1761 | Ga0268265_10012737 | |||
| 1762 | Ga0268264_10104635 | |||
| 1763 | Ga0268264_10382810 | |||
| 1764 | Ga0268264_10637296 | |||
| 1765 | Ga0265760_10051984 | |||
| 1766 | Ga0265760_10057422 | |||
| 1767 | Ga0265320_10027751 | |||
| 1768 | Ga0265339_10030317 | |||
| 1769 | Ga0265331_10050889 | |||
| 1770 | Ga0265316_10330244 | |||
| 1771 | Ga0265316_10446065 | |||
| 1772 | Ga0307408_100029948 | |||
| 1773 | Ga0307408_100033033 | |||
| 1774 | Ga0307408_100076198 | |||
| 1775 | Ga0307408_100087670 | |||
| 1776 | Ga0307408_100240060 | |||
| 1777 | Ga0307408_100462707 | |||
| 1778 | Ga0265314_10032227 | |||
| 1779 | Ga0265314_10091863 | |||
| 1780 | Ga0265314_10294785 | |||
| 1781 | Ga0265342_10013220 | |||
| 1782 | Ga0307405_10002927 | |||
| 1783 | Ga0307405_10003773 | |||
| 1784 | Ga0307405_10004305 | |||
| 1785 | Ga0307405_10068469 | |||
| 1786 | Ga0307405_10093298 | |||
| 1787 | Ga0307405_10169603 | |||
| 1788 | Ga0307405_10894460 | |||
| 1789 | Ga0307413_10010169 | |||
| 1790 | Ga0307413_10055539 | |||
| 1791 | Ga0307413_10064097 | |||
| 1792 | Ga0307413_10076450 | |||
| 1793 | Ga0307413_10265362 | |||
| 1794 | Ga0307413_10350941 | |||
| 1795 | Ga0307413_10531066 | |||
| 1796 | Ga0307413_10615232 | |||
| 1797 | Ga0307413_10986246 | |||
| 1798 | Ga0307410_10013501 | |||
| 1799 | Ga0307410_10040909 | |||
| 1800 | Ga0307410_10054250 | |||
| 1801 | Ga0307410_10372841 | |||
| 1802 | Ga0307406_10004089 | |||
| 1803 | Ga0307406_10007555 | |||
| 1804 | Ga0307406_10023649 | |||
| 1805 | Ga0307406_10068609 | |||
| 1806 | Ga0307406_10175172 | |||
| 1807 | Ga0307406_10407275 | |||
| 1808 | Ga0307406_11053263 | |||
| 1809 | Ga0307407_10003810 | |||
| 1810 | Ga0307407_10029087 | |||
| 1811 | Ga0307407_10035076 | |||
| 1812 | Ga0307407_10037551 | |||
| 1813 | Ga0307407_10185325 | |||
| 1814 | Ga0307407_10211017 | |||
| 1815 | Ga0307407_10436215 | |||
| 1816 | Ga0307407_10542824 | |||
| 1817 | Ga0307407_10717640 | |||
| 1818 | Ga0307412_10002806 | |||
| 1819 | Ga0307412_10020973 | |||
| 1820 | Ga0307412_10041113 | |||
| 1821 | Ga0307412_10041986 | |||
| 1822 | Ga0307412_10100878 | |||
| 1823 | Ga0307412_10215917 | |||
| 1824 | Ga0307409_100000761 | |||
| 1825 | Ga0307409_100001388 | |||
| 1826 | Ga0307409_100006134 | |||
| 1827 | Ga0307409_100012489 | |||
| 1828 | Ga0307409_100017504 | |||
| 1829 | Ga0307409_100084250 | |||
| 1830 | Ga0307409_100085926 | |||
| 1831 | Ga0307409_100089329 | |||
| 1832 | Ga0307409_100234861 | |||
| 1833 | Ga0307409_100264412 | |||
| 1834 | Ga0307409_100437078 | |||
| 1835 | Ga0307409_100953164 | |||
| 1836 | Ga0307409_101005625 | |||
| 1837 | Ga0307416_100004401 | |||
| 1838 | Ga0307416_100023480 | |||
| 1839 | Ga0307416_100033012 | |||
| 1840 | Ga0307416_100038735 | |||
| 1841 | Ga0307416_100079211 | |||
| 1842 | Ga0307416_100102603 | |||
| 1843 | Ga0307416_100128701 | |||
| 1844 | Ga0307416_100186020 | |||
| 1845 | Ga0307416_100230827 | |||
| 1846 | Ga0307416_100370200 | |||
| 1847 | Ga0307416_101037048 | |||
| 1848 | Ga0307414_10009483 | |||
| 1849 | Ga0307414_10043402 | |||
| 1850 | Ga0307414_10048949 | |||
| 1851 | Ga0307414_10059050 | |||
| 1852 | Ga0307414_10073267 | |||
| 1853 | Ga0307411_10006054 | |||
| 1854 | Ga0307411_10038193 | |||
| 1855 | Ga0307411_10038228 | |||
| 1856 | Ga0307411_10066479 | |||
| 1857 | Ga0307411_10093297 | |||
| 1858 | Ga0307411_10101883 | |||
| 1859 | Ga0307411_10198207 | |||
| 1860 | Ga0307411_10604906 | |||
| 1861 | Ga0307411_10980833 | |||
| 1862 | Ga0307415_100001794 | |||
| 1863 | Ga0307415_100006110 | |||
| 1864 | Ga0307415_100054315 | |||
| 1865 | Ga0307415_100062237 | |||
| 1866 | Ga0307415_100141469 | |||
| 1867 | Ga0307415_100171485 | |||
| 1868 | Ga0307415_100200973 | |||
| 1869 | Ga0373926_0031477 | |||
| 1870 | Ga0373926_0131558 | |||
| 1871 | Ga0373934_0010626 | |||
| 1872 | Ga0373934_0038725 | |||
| 1873 | Ga0373934_0253507 | |||
| 1874 | Ga0373944_0055787 | |||
| 1875 | Ga0373944_0185753 | |||
| 1876 | Ga0373923_0004878 | |||
| 1877 | Ga0373923_0051721 | |||
| 1878 | Ga0373936_0000390 | |||
| 1879 | Ga0373936_0064675 | |||
| 1880 | Ga0373936_0217214 | |||
| 1881 | Ga0373939_0256049 | |||
| 1882 | Ga0373941_0025679 | |||
| 1883 | Ga0373945_0009002 | |||
| 1884 | Ga0373953_0065589 | |||
| 1885 | Ga0373953_0090854 | |||
| 1886 | Ga0373953_0097404 | |||
| 1887 | Ga0373953_0116800 | |||
| 1888 | Ga0373954_0003568 | |||
| 1889 | Ga0373954_0136756 | |||
| 1890 | Ga0373956_0006456 | |||
| 1891 | Ga0373956_0014240 | |||
| 1892 | Ga0373956_0019987 | |||
| 1893 | Ga0373956_0028031 | |||
| 1894 | Ga0373956_0270232 | |||
| 1895 | Ga0373957_0022916 | |||
| 1896 | Ga0373957_0056337 | |||
| 1897 | Ga0373943_0000092 | |||
| 1898 | Ga0373943_0014821 | |||
| 1899 | Ga0373946_0002787 | |||
| 1900 | Ga0373946_0055569 | |||
| 1901 | Ga0373955_0000623 | |||
| 1902 | Ga0373955_0023694 | |||
| 1903 | Ga0373955_0032780 | |||
| 1904 | Ga0373955_0044477 | |||
| 1905 | Ga0373955_0139993 | |||
| 1906 | Ga0373955_0291209 | |||
| 1907 | Ga0373961_0194908 | |||
| 1908 | Ga0373924_0001882 | |||
| 1909 | Ga0373924_0026409 | |||
| 1910 | Ga0373924_0054813 | |||
| 1911 | Ga0373931_0330755 | |||
| 1912 | Ga0373935_0001269 | |||
| 1913 | Ga0373935_0010177 | |||
| 1914 | Ga0373927_0000056 | |||
| 1915 | Ga0373927_0038950 | |||
| 1916 | Ga0373927_0482037 | |||
| 1917 | Ga0373933_0005072 | |||
| 1918 | Ga0373933_0005627 | |||
| 1919 | Ga0373933_0071916 | |||
| 1920 | Ga0373933_0195326 | |||
| 1921 | Ga0373933_0239725 | |||
| 1922 | Ga0373947_0000369 | |||
| 1923 | Ga0373947_0008457 | |||
| 1924 | Ga0373947_0505579 | |||
| 1925 | Ga0373937_0002023 | |||
| 1926 | Ga0373937_0002809 | |||
| 1927 | Ga0373937_0012977 | |||
| 1928 | Ga0373937_0036193 | |||
| 1929 | Ga0373937_0109659 | |||
| 1930 | Ga0373937_0113489 | |||
| 1931 | Ga0373937_0225097 | |||
| 1932 | Ga0373937_0263540 | |||
| 1933 | Ga0373937_0280241 | |||
| 1934 | Ga0373937_0339178 | |||
| 1935 | Ga0373937_0524823 | |||
| 1936 | Ga0373937_0634962 | |||
| 1937 | Ga0373925_0004133 | |||
| 1938 | Ga0373925_0004354 | |||
| 1939 | Ga0373925_0133698 | |||
| 1940 | Ga0373925_0395427 | |||
| 1941 | Ga0373925_0557763 | |||
| 1942 | Ga0395899_0031700 | |||
| 1943 | Ga0395900_0052532 | |||
| 1944 | Ga0395900_0100054 | |||
| 1945 | Ga0395900_0575422 | |||
| 1946 | Ga0395900_0814860 | |||
| 1947 | Ga0395898_0029897 | |||
| 1948 | Ga0395898_0144484 | |||
| 1949 | Ga0395898_0600278 | |||
| 1950 | Ga0395905_0085910 | |||
| 1951 | Ga0395905_0232810 | |||
| 1952 | Ga0395905_0290842 | |||
| 1953 | Ga0436364_0678490 | |||
| 1954 | Ga0395901_0009601 | |||
| 1955 | Ga0395901_0275558 | |||
| 1956 | Ga0395901_0342879 | |||
| 1957 | Ga0395901_0491724 | |||
| 1958 | Ga0436365_0110548 | |||
| 1959 | Ga0436365_0523105 | |||
| 1960 | Ga0436365_0833863 | |||
| 1961 | Ga0436365_1827462 | |||
| 1962 | Ga0436360_0502764 | |||
| 1963 | Ga0436363_0068089 | |||
| 1964 | Ga0439453_0019411 | |||
| 1965 | Ga0439453_0059850 | |||
| 1966 | Ga0439466_0152783 | |||
| 1967 | Ga0451853_1519401 | |||
| 1968 | Ga0439443_000597 | |||
| 1969 | Ga0439443_002666 | |||
| 1970 | Ga0439448_0008249 | |||
| 1971 | Ga0439448_0011276 | |||
| 1972 | Ga0439448_0040467 | |||
| 1973 | Ga0439450_000393 | |||
| 1974 | Ga0439454_001848 | |||
| 1975 | Ga0439462_0035338 | |||
| 1976 | Ga0439463_002823 | |||
| 1977 | Ga0450914_022728 | |||
| 1978 | Ga0450891_011340 | |||
| 1979 | Ga0450900_000212 | |||
| 1980 | Ga0450904_008991 | |||
| 1981 | Ga0439435_0096030 | |||
| 1982 | Ga0439435_0138778 | |||
| 1983 | Ga0439460_0000651 | |||
| 1984 | Ga0439460_0071462 | |||
| 1985 | Ga0439440_0000294 | |||
| 1986 | Ga0453683_0086775 | |||
| 1987 | Ga0466963_0151990 | |||
| 1988 | Ga0466963_0430429 | |||
| 1989 | Ga0466963_0434921 | |||
| 1990 | Ga0466970_0070601 | |||
| 1991 | Ga0466957_0046316 | |||
| 1992 | Ga0466957_0201662 | |||
| 1993 | Ga0466959_0218973 | |||
| 1994 | Ga0451576_0011122 | |||
| 1995 | Ga0451576_0217921 | |||
| 1996 | Ga0451576_0357321 | |||
| 1997 | Ga0451576_0598233 | |||
| 1998 | Ga0451576_1104621 | |||
| 1999 | Ga0451576_1311171 | |||
| 2000 | Ga0466967_0027718 | |||
| 2001 | Ga0466967_0260296 | |||
| 2002 | Ga0466967_0756519 | |||
| 2003 | Ga0466967_1461187 | |||
| 2004 | Ga0495592_0068072 | |||
| 2005 | Ga0495592_0203842 | |||
| 2006 | Ga0495629_0423965 | |||
| 2007 | Ga0495629_0587715 | |||
| 2008 | Ga0495641_0048896 | |||
| 2009 | Ga0495651_0013209 | |||
| 2010 | Ga0495651_0041949 | |||
| 2011 | Ga0495651_0080755 | |||
| 2012 | Ga0495651_0132205 | |||
| 2013 | Ga0495651_0329570 | |||
| 2014 | Ga0495651_0431008 | |||
| 2015 | Ga0495653_0076189 | |||
| 2016 | Ga0495653_0527590 | |||
| 2017 | Ga0495580_0008844 | |||
| 2018 | Ga0495580_0340896 | |||
| 2019 | Ga0495580_0366120 | |||
| 2020 | Ga0495580_0653807 | |||
| 2021 | Ga0495582_0033473 | |||
| 2022 | Ga0495639_0343632 | |||
| 2023 | Ga0495662_0065727 | |||
| 2024 | Ga0495664_0003426 | |||
| 2025 | Ga0495664_0022390 | |||
| 2026 | Ga0495664_0307837 | |||
| 2027 | Ga0495664_0348168 | |||
| 2028 | Ga0495584_0062085 | |||
| 2029 | Ga0495584_0108093 | |||
| 2030 | Ga0495594_0024115 | |||
| 2031 | Ga0495594_0031022 | |||
| 2032 | Ga0495594_0031466 | |||
| 2033 | Ga0495594_0048715 | |||
| 2034 | Ga0495594_0108151 | |||
| 2035 | Ga0495594_0229467 | |||
| 2036 | Ga0495607_0124645 | |||
| 2037 | Ga0495618_0098173 | |||
| 2038 | Ga0495618_0136450 | |||
| 2039 | Ga0495618_0186810 | |||
| 2040 | Ga0495618_0235306 | |||
| 2041 | Ga0495628_0043123 | |||
| 2042 | Ga0495628_0077687 | |||
| 2043 | Ga0495628_0115379 | |||
| 2044 | Ga0495628_0357407 | |||
| 2045 | Ga0495628_0560345 | |||
| 2046 | Ga0495628_0575873 | |||
| 2047 | Ga0495630_0004320 | |||
| 2048 | Ga0495630_0097277 | |||
| 2049 | Ga0495630_0297931 | |||
| 2050 | Ga0495630_0848481 | |||
| 2051 | Ga0495644_0013225 | |||
| 2052 | Ga0495644_0066851 | |||
| 2053 | Ga0495663_0003118 | |||
| 2054 | Ga0495652_0020868 | |||
| 2055 | Ga0495652_0055925 | |||
| 2056 | Ga0495652_0266821 | |||
| 2057 | Ga0495665_0066744 | |||
| 2058 | Ga0495640_0016254 | |||
| 2059 | Ga0495587_0000936 | |||
| 2060 | Ga0495587_0008132 | |||
| 2061 | Ga0495587_0144889 | |||
| 2062 | Ga0495598_0083349 | |||
| 2063 | Ga0495621_0253039 | |||
| 2064 | Ga0495645_0000329 | |||
| 2065 | Ga0495645_0018815 | |||
| 2066 | Ga0495645_0030282 | |||
| 2067 | Ga0495645_0307890 | |||
| 2068 | Ga0495645_0338272 | |||
| 2069 | Ga0495622_0108641 | |||
| 2070 | Ga0495667_0009401 | |||
| 2071 | Ga0495667_0053026 | |||
| 2072 | Ga0495667_0311667 | |||
| 2073 | Ga0495656_0006666 | |||
| 2074 | Ga0495656_0248589 | |||
| 2075 | Ga0495634_0037315 | |||
| 2076 | Ga0495634_0049194 | |||
| 2077 | Ga0495635_0006056 | |||
| 2078 | Ga0495635_0244329 | |||
| 2079 | Ga0495635_0302509 | |||
| 2080 | Ga0495635_0611140 | |||
| 2081 | Ga0495659_0131702 | |||
| 2082 | Ga0495659_0144698 | |||
| 2083 | Ga0495661_0086217 | |||
| 2084 | Ga0495599_0005410 | |||
| 2085 | Ga0495599_0075643 | |||
| 2086 | Ga0495599_0105760 | |||
| 2087 | Ga0495599_0160406 | |||
| 2088 | Ga0495599_0496777 | |||
| 2089 | Ga0495623_0003472 | |||
| 2090 | Ga0495623_0007516 | |||
| 2091 | Ga0495623_0031188 | |||
| 2092 | Ga0495647_0009680 | |||
| 2093 | Ga0495658_0103681 | |||
| 2094 | Ga0495658_0189330 | |||
| 2095 | Ga0495613_0015547 | |||
| 2096 | Ga0495613_0160057 | |||
| 2097 | Ga0495624_0067199 | |||
| 2098 | Ga0495624_0086670 | |||
| 2099 | Ga0495670_0077748 | |||
| 2100 | Ga0495589_0061364 | |||
| 2101 | Ga0495600_0061701 | |||
| 2102 | Ga0495600_0092561 | |||
| 2103 | Ga0495600_0131798 | |||
| 2104 | Ga0495600_0273181 | |||
| 2105 | Ga0495600_0619844 | |||
| 2106 | Ga0495581_0040047 | |||
| 2107 | Ga0495581_0104510 | |||
| 2108 | Ga0495604_0090450 | |||
| 2109 | Ga0495604_0100239 | |||
| 2110 | Ga0495604_0186167 | |||
| 2111 | Ga0495604_0232930 | |||
| 2112 | Ga0495604_0262911 | |||
| 2113 | Ga0495636_0192747 | |||
| 2114 | Ga0495636_0401088 | |||
| 2115 | Ga0495674_0003831 | |||
| 2116 | Ga0495674_0005700 | |||
| 2117 | Ga0495674_0205323 | |||
| 2118 | Ga0495676_0119954 | |||
| 2119 | Ga0495680_0077554 | |||
| 2120 | Ga0495680_0160305 | |||
| 2121 | Ga0495680_0170881 | |||
| 2122 | Ga0495680_0182447 | |||
| 2123 | Ga0495680_0645866 | |||
| 2124 | Ga0495680_0713853 | |||
| 2125 | Ga0495683_0100293 | |||
| 2126 | Ga0495675_0053582 | |||
| 2127 | Ga0495675_0138019 | |||
| 2128 | Ga0495675_0428257 | |||
| 2129 | Ga0495677_0013231 | |||
| 2130 | Ga0495684_0006669 | |||
| 2131 | Ga0495684_0159119 | |||
| 2132 | Ga0495593_0231592 | |||
| 2133 | Ga0495602_0021240 | |||
| 2134 | Ga0495602_0092043 | |||
| 2135 | Ga0496100_0175215 | |||
| 2136 | Ga0496100_0209843 | |||
| 2137 | Ga0496100_0277621 | |||
| 2138 | Ga0496100_0387000 | |||
| 2139 | Ga0496101_0376913 | |||
| 2140 | Ga0496102_0059709 | |||
| 2141 | Ga0496103_0315890 | |||
| 2142 | Ga0496104_0060246 | |||
| 2143 | Ga0496104_0083649 | |||
| 2144 | Ga0496104_0117022 | |||
| 2145 | Ga0496104_0217333 | |||
| 2146 | Ga0496105_0002488 | |||
| 2147 | Ga0496105_0112693 | |||
| 2148 | Ga0496106_0035788 | |||
| 2149 | Ga0496106_0185201 | |||
| 2150 | Ga0496106_0457742 | |||
| 2151 | Ga0496107_0191722 | |||
| 2152 | Ga0496107_0601924 | |||
| 2153 | Ga0496108_0187161 | |||
| 2154 | Ga0496108_0277517 | |||
| 2155 | Ga0496108_0729400 | |||
| 2156 | Ga0496109_0122143 | |||
| 2157 | Ga0496109_0176477 | |||
| 2158 | Ga0496109_0179678 | |||
| 2159 | Ga0496109_0383994 | |||
| 2160 | Ga0496110_0026074 | |||
| 2161 | Ga0496110_0125992 | |||
| 2162 | Ga0496110_0229232 | |||
| 2163 | Ga0496110_0345441 | |||
| 2164 | Ga0496110_0513429 | |||
| 2165 | Ga0496110_0737447 | |||
| 2166 | Ga0496111_0000311 | |||
| 2167 | Ga0496112_0021496 | |||
| 2168 | Ga0496112_0192597 | |||
| 2169 | Ga0496112_0418786 | |||
| 2170 | Ga0496113_0065518 | |||
| 2171 | Ga0496113_0316621 | |||
| 2172 | Ga0496113_0700474 | |||
| 2173 | Ga0496114_0452938 | |||
| 2174 | Ga0496114_0771404 | |||
| 2175 | Ga0496115_0020183 | |||
| 2176 | Ga0496115_0028291 | |||
| 2177 | Ga0496115_0106354 | |||
| 2178 | Ga0496115_0353372 | |||
| 2179 | Ga0496115_1025722 | |||
| 2180 | Ga0496118_0241029 | |||
| 2181 | Ga0496119_0163471 | |||
| 2182 | Ga0496121_0052079 | |||
| 2183 | Ga0496126_0025633 | |||
| 2184 | Ga0496126_0764738 | |||
| 2185 | Ga0501031_0001140 | |||
| 2186 | Ga0501031_0002562 | |||
| 2187 | Ga0501031_0272512 | |||
| 2188 | Ga0501032_0138551 | |||
| 2189 | Ga0501033_0015045 | |||
| 2190 | Ga0501033_0149983 | |||
| 2191 | Ga0501034_0391694 | |||
| 2192 | Ga0501036_0001109 | |||
| 2193 | Ga0501036_0002462 | |||
| 2194 | Ga0501036_0074672 | |||
| 2195 | Ga0501037_0051104 | |||
| 2196 | Ga0501037_0115825 | |||
| 2197 | Ga0501038_0005474 | |||
| 2198 | Ga0501038_0016322 | |||
| 2199 | Ga0501038_0433679 | |||
| 2200 | Ga0501038_0907499 | |||
| 2201 | Ga0501039_0000611 | |||
| 2202 | Ga0501039_0000847 | |||
| 2203 | Ga0501039_0124162 | |||
| 2204 | Ga0501039_0808293 | |||
| 2205 | Ga0501040_0000181 | |||
| 2206 | Ga0501040_0391052 | |||
| 2207 | Ga0501041_0000279 | |||
| 2208 | Ga0501041_0001044 | |||
| 2209 | Ga0501041_0241748 | |||
| 2210 | Ga0501042_0000905 | |||
| 2211 | Ga0501042_0084984 | |||
| 2212 | Ga0501043_0009968 | |||
| 2213 | Ga0501043_0821619 | |||
| 2214 | Ga0501046_0012083 | |||
| 2215 | Ga0501046_0190540 | |||
| 2216 | Ga0501046_0277307 | |||
| 2217 | Ga0501047_0179920 | |||
| 2218 | Ga0501047_0506297 | |||
| 2219 | Ga0501048_0000939 | |||
| 2220 | Ga0501048_0002309 | |||
| 2221 | Ga0501048_0105285 | |||
| 2222 | Ga0501068_0032267 | |||
| 2223 | Ga0501070_0196216 | |||
| 2224 | Ga0501070_0230162 | |||
| 2225 | Ga0501071_0003534 | |||
| 2226 | Ga0501071_0007728 | |||
| 2227 | Ga0501071_0036214 | |||
| 2228 | Ga0501071_0049469 | |||
| 2229 | Ga0501071_0117682 | |||
| 2230 | Ga0501072_0000167 | |||
| 2231 | Ga0501072_0042645 | |||
| 2232 | Ga0501072_0189546 | |||
| 2233 | Ga0501073_0872212 | |||
| 2234 | Ga0501074_0004465 | |||
| 2235 | Ga0501074_0031861 | |||
| 2236 | Ga0501075_0000379 | |||
| 2237 | Ga0501075_0002352 | |||
| 2238 | Ga0501075_0075011 | |||
| 2239 | Ga0501075_0089973 | |||
| 2240 | Ga0501076_0000162 | |||
| 2241 | Ga0501076_0000369 | |||
| 2242 | Ga0501076_0016067 | |||
| 2243 | Ga0501076_0018936 | |||
| 2244 | Ga0501077_0012356 | |||
| 2245 | Ga0501077_0245444 | |||
| 2246 | Ga0501077_0418437 | |||
| 2247 | Ga0501202_024995 | |||
| 2248 | Ga0501235_036686 | |||
| 2249 | Ga0501235_038276 | |||
| 2250 | Ga0501249_010200 | |||
| 2251 | Ga0501079_0002956 | |||
| 2252 | Ga0501079_0026542 | |||
| 2253 | Ga0501079_0163399 | |||
| 2254 | Ga0501080_0002596 | |||
| 2255 | Ga0501080_0068160 | |||
| 2256 | Ga0501080_0798156 | |||
| 2257 | Ga0501081_0000113 | |||
| 2258 | Ga0501081_0005776 | |||
| 2259 | Ga0501081_0056562 | |||
| 2260 | Ga0501081_0180078 | |||
| 2261 | Ga0501081_0197664 | |||
| 2262 | Ga0501083_0009872 | |||
| 2263 | Ga0501035_0005491 | |||
| 2264 | Ga0501035_0020503 | |||
| 2265 | Ga0501035_0176649 | |||
| 2266 | Ga0501035_0434068 | |||
| 2267 | Ga0501044_0008395 | |||
| 2268 | Ga0501044_0214904 | |||
| 2269 | Ga0501045_0000048 | |||
| 2270 | Ga0501045_0000434 | |||
| 2271 | Ga0501045_0103729 | |||
| 2272 | Ga0501045_0103979 | |||
| 2273 | Ga0501045_0106439 | |||
| 2274 | Ga0501045_0259682 | |||
| 2275 | nmdc:mga03683_2171_c1 | |||
| 2276 | nmdc:mga03n38_317608_c1 | |||
| 2277 | nmdc:mga00v17_150723_c1 | |||
| 2278 | nmdc:mga00v17_50652_c1 | |||
| 2279 | nmdc:mga00v17_9898_c1 | |||
| 2280 | nmdc:mga0k408_24709_c1 | |||
| 2281 | nmdc:mga0k408_4495_c1 | |||
| 2282 | nmdc:mga06z11_45651_c2 | |||
| 2283 | nmdc:mga06z11_94713_c1 | |||
| 2284 | nmdc:mga07m45_68215_c1 | |||
| 2285 | nmdc:mga05p37_101671_c1 | |||
| 2286 | nmdc:mga05p37_11365_c1 | |||
| 2287 | nmdc:mga05p37_23337_c1 | |||
| 2288 | nmdc:mga05p37_247277_c1 | |||
| 2289 | nmdc:mga05p37_320439_c1 | |||
| 2290 | nmdc:mga05p37_371570_c1 | |||
| 2291 | nmdc:mga05p37_37516_c1 | |||
| 2292 | nmdc:mga05p37_49579_c1 | |||
| 2293 | nmdc:mga05p37_69222_c1 | |||
| 2294 | nmdc:mga05p37_73_c1 | |||
| 2295 | nmdc:mga09592_273130_c1 | |||
| 2296 | nmdc:mga09592_38541_c1 | |||
| 2297 | nmdc:mga09592_6310_c1 | |||
| 2298 | nmdc:mga09592_664665_c1 | |||
| 2299 | nmdc:mga0qj67_151654_c1 | |||
| 2300 | nmdc:mga0qj67_18830_c1 | |||
| 2301 | nmdc:mga0qj67_295_c1 | |||
| 2302 | nmdc:mga0qj67_321599_c1 | |||
| 2303 | nmdc:mga0qj67_54208_c1 | |||
| 2304 | nmdc:mga06r32_1247_c1 | |||
| 2305 | nmdc:mga06r32_249779_c1 | |||
| 2306 | nmdc:mga06r32_83989_c1 | |||
| 2307 | nmdc:mga08y16_126306_c1 | |||
| 2308 | nmdc:mga08y16_1290551_c1 | |||
| 2309 | nmdc:mga08y16_15894_c1 | |||
| 2310 | nmdc:mga08y16_228767_c2 | |||
| 2311 | nmdc:mga08y16_5598_c1 | |||
| 2312 | nmdc:mga08y16_65540_c1 | |||
| 2313 | nmdc:mga0n895_116614_c1 | |||
| 2314 | nmdc:mga0n895_1175698_c1 | |||
| 2315 | nmdc:mga0n895_162263_c1 | |||
| 2316 | nmdc:mga0n895_162361_c1 | |||
| 2317 | nmdc:mga0n895_190442_c1 | |||
| 2318 | nmdc:mga0n895_327549_c1 | |||
| 2319 | nmdc:mga0n895_498385_c1 | |||
| 2320 | nmdc:mga0rr50_1_c1 | |||
| 2321 | nmdc:mga0rr50_289066_c1 | |||
| 2322 | nmdc:mga0rr50_430196_c1 | |||
| 2323 | nmdc:mga0rr50_511665_c1 | |||
| 2324 | nmdc:mga0rr50_74540_c1 | |||
| 2325 | nmdc:mga08x19_113853_c1 | |||
| 2326 | nmdc:mga08x19_250405_c1 | |||
| 2327 | nmdc:mga08x19_311_c1 | |||
| 2328 | nmdc:mga0a205_112130_c1 | |||
| 2329 | nmdc:mga0a205_13997_c1 | |||
| 2330 | nmdc:mga0a205_239589_c1 | |||
| 2331 | nmdc:mga0a205_607259_c1 | |||
| 2332 | Ga0495601_0000814 | |||
| 2333 | Ga0495601_0026813 | |||
| 2334 | Ga0495601_0111834 | |||
| 2335 | Ga0495601_0141591 | |||
| 2336 | Ga0495601_0169695 | |||
| 2337 | Ga0495601_0295144 | |||
| 2338 | Ga0495601_0658035 | |||
| 2339 | Ga0495612_0153132 | |||
| 2340 | Ga0495612_0156882 | |||
| 2341 | Ga0495612_0184201 | |||
| 2342 | Ga0495595_0020871 | |||
| 2343 | Ga0495619_0092783 | |||
| 2344 | Ga0495619_0222219 | |||
| 2345 | Ga0495619_0558691 | |||
| 2346 | Ga0500628_007332 | |||
| 2347 | Ga0500573_0250175 | |||
| 2348 | Ga0501084_0001506 | |||
| 2349 | Ga0501084_0088485 | |||
| 2350 | Ga0501084_0162429 | |||
| 2351 | Ga0590074_030614 | |||
| 2352 | Ga0590077_003121 | |||
| 2353 | Ga0587084_010970 | |||
| 2354 | Ga0501082_0002405 | |||
| 2355 | Ga0501082_0030474 | |||
| 2356 | Ga0501082_0121847 | |||
| 2357 | Ga0501082_0451203 | |||
| 2358 | Ga0501082_0464553 | |||
| 2359 | Ga0501082_1055764 | |||
| 2360 | Ga0530510_0001043 | |||
| 2361 | Ga0530510_0025200 | |||
| 2362 | Ga0530510_0095625 | |||
| 2363 | Ga0530510_0360175 | |||
| 2364 | 2513723079 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e9y-assembly1.cif.gz_A | arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron | 0.8339 | 2 | 161 |
| 1ozf-assembly1.cif.gz_B | the crystal structure of klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactors | 0.8184 | 5 | 160 |
| 6qsi-assembly1.cif.gz_A | pseudomonas fluorescens pf-5 thiamine diphosphate-dependent 4-hydroxybenzoylformate decarboxylase | 0.8152 | 1 | 159 |
| 4k9q-assembly1.cif.gz_A | the crystal structure of benzoylformate decarboxylase from polynucleobacter necessarius | 0.8142 | 1 | 164 |
| 7b2e-assembly2.cif.gz_D | quadruple mutant of oxalyl-coa decarboxylase from methylorubrum extorquens with bound tpp and adp | 0.8139 | 6 | 166 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P58416_5_175_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9222 | 3 | 173 | 3.40.50.970 |
| af_P58416_5_175_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9119 | 3 | 173 | 3.40.50.970 |
| af_Q58077_321_493_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8594 | 4 | 166 | 3.40.50.970 |
| af_Q4D595_238_443_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8523 | 1 | 177 | 3.40.50.970 |
| af_Q8S4W9_400_591_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8342 | 1 | 165 | 3.40.50.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1QX13-F1-model_v4 | Thiamine pyrophosphate-binding protein | 0.991 | 1 | 99 |
GO:0000287
GO:0016831 GO:0030976 |
| AF-A0A2V8G2E8-F1-model_v4 | Thiamine pyrophosphate enzyme TPP-binding domain-containing protein | 0.984 | 17 | 94 |
GO:0000287
GO:0016831 GO:0030976 |
| AF-A0A3M1QX13-F1-model_v4 | Thiamine pyrophosphate-binding protein | 0.9812 | 1 | 99 |
GO:0000287
GO:0016831 GO:0030976 |
| AF-A0A535SBU8-F1-model_v4 | Thiamine pyrophosphate-binding protein | 0.9796 | 1 | 81 |
GO:0000287
GO:0016831 GO:0030976 |
| AF-A0A524KDW5-F1-model_v4 | Aldehyde dehydrogenase | 0.9736 | 1 | 92 |
GO:0016020
GO:0016831 GO:0030976 GO:0044281 |