F491322

General Info

Members Datasets Scaffolds Average Seq Length
1182 393 2364 192

Family's Representative Sequence

Representative Sequence 3300025936|Ga0207670_10560662|Ga0207670_105606622
Length 233
Sequence MRRRAALEAIYPELERCVVVTIMGAVAAELQSIGHRPGFFYLQHAMGLASSMGLGIALSRPELKVVVVDGDGSVLMNLGGLTTLARYRPRNLVHVVFDNESLLSVGGFPTATSTGSDIAKVGAAAGIERTITVRALDEFRSAFAGALAADTLSLIVAKVEAVGPSAYVTDLSLLENRYQFQRHLRERVLHKAERRSPRLREEGGASERAVQRAVVRLDRSPGKLRVALLLSRA

Samples

Sample ID Description Type Environment
1 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
209 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
212 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
213 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
214 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
215 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
216 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
217 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
218 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
219 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
232 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
233 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
234 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
235 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
236 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
237 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
238 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
239 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
240 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
241 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
242 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
243 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
244 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
245 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
246 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
247 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
248 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
249 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
250 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
251 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
252 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
253 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
254 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
255 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
256 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
262 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
263 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
264 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
265 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
266 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
267 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
268 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
269 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
270 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
271 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
272 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
276 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
279 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
282 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
283 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
284 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
285 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
286 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
287 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
288 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
289 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
290 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
291 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
292 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
293 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
294 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
295 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
296 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
297 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
298 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
299 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
300 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
301 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
302 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
303 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
304 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
305 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
306 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
311 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
312 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
313 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
314 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
315 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
318 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
321 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
322 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
323 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
328 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
329 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
330 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
350 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
351 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
352 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
353 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
354 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
355 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
356 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
357 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
358 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
359 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
360 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
361 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
362 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
367 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
368 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
369 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
370 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
371 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
372 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
373 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
374 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
375 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
376 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
377 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
378 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
379 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
380 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
381 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
382 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
383 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
384 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
385 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
386 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
387 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
388 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
389 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
390 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
392 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
393 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0.93
Isolates 0.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.78
Nodule 0.08
Rhizoplane 3.81
Rhizosphere 93.06
Stem 0
Stem Tuber 0
Unclassified 7.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207670_10560662 3300025936 Bacteria 934
2 MBSR1b_contig_3986932 2162886012 Bacteria 800
3 rootH2_10198595 3300003320 Unclassified 1025
4 Ga0065712_10111273 3300005290 Bacteria 1820
5 Ga0065712_10227585 3300005290 Bacteria 1021
6 Ga0065715_10123992 3300005293 Bacteria 2102
7 Ga0065715_10145971 3300005293 Bacteria 1788
8 Ga0065707_10114551 3300005295 Bacteria 2294
9 Ga0065707_10124965 3300005295 Bacteria 2033
10 Ga0065707_10623721 3300005295 Bacteria 667
11 Ga0070676_10022501 3300005328 Bacteria 3534
12 Ga0070683_100000285 3300005329 Bacteria 34780
13 Ga0070683_100000885 3300005329 Bacteria 22232
14 Ga0070683_100457824 3300005329 Bacteria 1217
15 Ga0070690_100198575 3300005330 Bacteria 1394
16 Ga0070690_100219435 3300005330 Bacteria 1332
17 Ga0070670_100115259 3300005331 Bacteria 2316
18 Ga0070670_101192749 3300005331 Unclassified 695
19 Ga0070670_101223154 3300005331 Unclassified 687
20 Ga0070680_100032407 3300005336 Bacteria 4207
21 Ga0070680_100033912 3300005336 Bacteria 4116
22 Ga0070680_100079500 3300005336 Bacteria 2703
23 Ga0070680_100569918 3300005336 Bacteria 971
24 Ga0068868_100321709 3300005338 Bacteria 1318
25 Ga0068868_100764613 3300005338 Unclassified 869
26 Ga0070689_100000097 3300005340 Bacteria 50763
27 Ga0070689_100045297 3300005340 Bacteria 3387
28 Ga0070689_100076039 3300005340 Bacteria 2630
29 Ga0070691_10000311 3300005341 Bacteria 17106
30 Ga0070691_10319055 3300005341 Bacteria 854
31 Ga0070691_10330130 3300005341 Bacteria 841
32 Ga0070687_100040318 3300005343 Bacteria 2352
33 Ga0070661_100020968 3300005344 Bacteria 4665
34 Ga0070692_10063869 3300005345 Bacteria 1946
35 Ga0070692_10198624 3300005345 Bacteria 1173
36 Ga0070692_10292257 3300005345 Bacteria 992
37 Ga0070668_100006373 3300005347 Bacteria 8744
38 Ga0070668_100009927 3300005347 Bacteria 7051
39 Ga0070668_100121302 3300005347 Bacteria 2090
40 Ga0070669_100008994 3300005353 Bacteria 7125
41 Ga0070669_100010632 3300005353 Bacteria 6534
42 Ga0070669_100031415 3300005353 Bacteria 3836
43 Ga0070669_100173602 3300005353 Bacteria 1682
44 Ga0070675_100623882 3300005354 Bacteria 979
45 Ga0070675_101081867 3300005354 Bacteria 737
46 Ga0070671_100006892 3300005355 Bacteria 9102
47 Ga0070671_100401932 3300005355 Bacteria 1172
48 Ga0070671_100918270 3300005355 Bacteria 765
49 Ga0070674_100184176 3300005356 Bacteria 1602
50 Ga0070674_100330597 3300005356 Bacteria 1225
51 Ga0070673_100110108 3300005364 Bacteria 2283
52 Ga0070673_100676168 3300005364 Bacteria 946
53 Ga0070688_100000331 3300005365 Bacteria 24254
54 Ga0070688_100365484 3300005365 Bacteria 1060
55 Ga0070688_100719393 3300005365 Bacteria 775
56 Ga0070659_100221997 3300005366 Bacteria 1560
57 Ga0070667_100028146 3300005367 Bacteria 4678
58 Ga0070667_100679636 3300005367 Bacteria 951
59 Ga0070667_100777973 3300005367 Bacteria 888
60 Ga0070709_10010582 3300005434 Bacteria 5113
61 Ga0070709_10014499 3300005434 Bacteria 4458
62 Ga0070709_10149359 3300005434 Bacteria 1613
63 Ga0070709_10166502 3300005434 Bacteria 1537
64 Ga0070714_100027756 3300005435 Bacteria 4690
65 Ga0070714_100092496 3300005435 Bacteria 2651
66 Ga0070714_100116478 3300005435 Unclassified 2372
67 Ga0070714_100147307 3300005435 Unclassified 2119
68 Ga0070714_100169619 3300005435 Bacteria 1980
69 Ga0070714_100525394 3300005435 Bacteria 1131
70 Ga0070714_100584890 3300005435 Unclassified 1071
71 Ga0070713_100000652 3300005436 Bacteria 22180
72 Ga0070713_100006798 3300005436 Bacteria 7969
73 Ga0070713_100014331 3300005436 Bacteria 5883
74 Ga0070713_100021942 3300005436 Bacteria 4924
75 Ga0070713_100056483 3300005436 Bacteria 3265
76 Ga0070713_100073704 3300005436 Bacteria 2890
77 Ga0070713_100095141 3300005436 Bacteria 2569
78 Ga0070713_100169079 3300005436 Bacteria 1957
79 Ga0070713_100237810 3300005436 Bacteria 1657
80 Ga0070713_100238354 3300005436 Bacteria 1656
81 Ga0070713_100689425 3300005436 Bacteria 975
82 Ga0070710_10019985 3300005437 Bacteria 3469
83 Ga0070710_10113917 3300005437 Bacteria 1628
84 Ga0070710_10152228 3300005437 Bacteria 1427
85 Ga0070710_10170815 3300005437 Bacteria 1354
86 Ga0070701_10590171 3300005438 Bacteria 734
87 Ga0070711_100001160 3300005439 Bacteria 14179
88 Ga0070711_100004773 3300005439 Bacteria 8031
89 Ga0070711_100010993 3300005439 Bacteria 5612
90 Ga0070711_100016541 3300005439 Bacteria 4685
91 Ga0070711_100577215 3300005439 Bacteria 936
92 Ga0070711_100712998 3300005439 Unclassified 845
93 Ga0070705_100014030 3300005440 Bacteria 4112
94 Ga0070705_100063181 3300005440 Bacteria 2208
95 Ga0070705_100408827 3300005440 Unclassified 1007
96 Ga0070700_100004714 3300005441 Bacteria 7145
97 Ga0070700_100262953 3300005441 Unclassified 1243
98 Ga0070700_100433722 3300005441 Bacteria 996
99 Ga0070700_100863394 3300005441 Bacteria 734
100 Ga0070694_100179358 3300005444 Bacteria 1565
101 Ga0070694_100708600 3300005444 Bacteria 819
102 Ga0070694_101177493 3300005444 Bacteria 642
103 Ga0070708_100000011 3300005445 Bacteria 134770
104 Ga0070708_100049356 3300005445 Unclassified 3723
105 Ga0070708_100051450 3300005445 Bacteria 3650
106 Ga0070708_100061977 3300005445 Bacteria 3343
107 Ga0070708_100152387 3300005445 Bacteria 2150
108 Ga0070708_100323002 3300005445 Bacteria 1454
109 Ga0070663_100121970 3300005455 Bacteria 1970
110 Ga0070662_100033401 3300005457 Bacteria 3622
111 Ga0070662_100062454 3300005457 Bacteria 2722
112 Ga0070662_100320008 3300005457 Bacteria 1265
113 Ga0070681_10001001 3300005458 Bacteria 23934
114 Ga0070681_10021576 3300005458 Bacteria 6455
115 Ga0070681_10065204 3300005458 Bacteria 3611
116 Ga0070681_10110890 3300005458 Bacteria 2683
117 Ga0070681_10664202 3300005458 Bacteria 957
118 Ga0068867_100017645 3300005459 Bacteria 5068
119 Ga0068867_100029757 3300005459 Bacteria 3936
120 Ga0068867_100881280 3300005459 Unclassified 804
121 Ga0070685_10031643 3300005466 Bacteria 2958
122 Ga0070685_10588778 3300005466 Unclassified 799
123 Ga0070706_100005169 3300005467 Bacteria 12456
124 Ga0070706_100026602 3300005467 Bacteria 5323
125 Ga0070706_100040746 3300005467 Bacteria 4287
126 Ga0070706_100052542 3300005467 Unclassified 3760
127 Ga0070707_100108697 3300005468 Unclassified 2690
128 Ga0070707_100109797 3300005468 Bacteria 2675
129 Ga0070707_100119166 3300005468 Bacteria 2562
130 Ga0070707_100292462 3300005468 Bacteria 1583
131 Ga0070707_100316783 3300005468 Unclassified 1516
132 Ga0070707_100336724 3300005468 Bacteria 1466
133 Ga0070707_100495991 3300005468 Bacteria 1183
134 Ga0070707_100501585 3300005468 Unclassified 1175
135 Ga0070707_101008295 3300005468 Bacteria 798
136 Ga0070698_100007599 3300005471 Bacteria 11730
137 Ga0070698_100061946 3300005471 Bacteria 3775
138 Ga0070698_100131771 3300005471 Bacteria 2455
139 Ga0070698_100143391 3300005471 Bacteria 2339
140 Ga0070698_100260561 3300005471 Bacteria 1666
141 Ga0070698_100418818 3300005471 Bacteria 1274
142 Ga0070698_100441858 3300005471 Bacteria 1236
143 Ga0070698_100465619 3300005471 Bacteria 1200
144 Ga0070698_100475518 3300005471 Bacteria 1186
145 Ga0070698_100864887 3300005471 Unclassified 849
146 Ga0070698_101147414 3300005471 Bacteria 726
147 Ga0070699_100001465 3300005518 Bacteria 21610
148 Ga0070699_100011744 3300005518 Bacteria 7558
149 Ga0070699_100041970 3300005518 Bacteria 3958
150 Ga0070699_100048893 3300005518 Bacteria 3660
151 Ga0070699_100119111 3300005518 Bacteria 2321
152 Ga0070699_100162453 3300005518 Unclassified 1977
153 Ga0070699_100177367 3300005518 Bacteria 1890
154 Ga0070699_100385441 3300005518 Bacteria 1266
155 Ga0070699_100725767 3300005518 Bacteria 908
156 Ga0070679_100006936 3300005530 Bacteria 10567
157 Ga0070679_100016478 3300005530 Bacteria 7131
158 Ga0070679_100176249 3300005530 Bacteria 2110
159 Ga0070684_100002974 3300005535 Bacteria 12617
160 Ga0070684_100032801 3300005535 Bacteria 4430
161 Ga0070684_100044962 3300005535 Bacteria 3822
162 Ga0070684_100304938 3300005535 Unclassified 1462
163 Ga0070684_100319971 3300005535 Bacteria 1425
164 Ga0070684_100829755 3300005535 Bacteria 865
165 Ga0070697_100011432 3300005536 Bacteria 6939
166 Ga0070697_100058542 3300005536 Unclassified 3136
167 Ga0070697_100067666 3300005536 Bacteria 2922
168 Ga0070697_100454683 3300005536 Bacteria 1116
169 Ga0070697_100646586 3300005536 Bacteria 931
170 Ga0068853_100260917 3300005539 Bacteria 1593
171 Ga0070672_100029846 3300005543 Bacteria 4092
172 Ga0070672_100039794 3300005543 Bacteria 3603
173 Ga0070672_100099084 3300005543 Bacteria 2362
174 Ga0070672_100290360 3300005543 Bacteria 1384
175 Ga0070672_100784287 3300005543 Bacteria 838
176 Ga0070686_100155207 3300005544 Bacteria 1607
177 Ga0070686_100503922 3300005544 Bacteria 940
178 Ga0070695_100002602 3300005545 Bacteria 10423
179 Ga0070696_100015489 3300005546 Bacteria 5121
180 Ga0070696_100035051 3300005546 Bacteria 3454
181 Ga0070696_101193998 3300005546 Bacteria 642
182 Ga0070693_100133143 3300005547 Bacteria 1557
183 Ga0070704_100008355 3300005549 Bacteria 6203
184 Ga0070704_100918572 3300005549 Bacteria 788
185 Ga0068855_100149447 3300005563 Bacteria 2657
186 Ga0068855_100374073 3300005563 Unclassified 1565
187 Ga0068855_100672466 3300005563 Bacteria 1110
188 Ga0070664_100064215 3300005564 Bacteria 3131
189 Ga0070664_100162795 3300005564 Bacteria 1975
190 Ga0070664_100288604 3300005564 Bacteria 1481
191 Ga0070664_100421363 3300005564 Bacteria 1223
192 Ga0070664_100949999 3300005564 Bacteria 807
193 Ga0068857_100006115 3300005577 Bacteria 10281
194 Ga0068857_100028102 3300005577 Bacteria 4961
195 Ga0068857_101437586 3300005577 Unclassified 671
196 Ga0068854_100451228 3300005578 Bacteria 1074
197 Ga0068854_100481043 3300005578 Bacteria 1042
198 Ga0068854_100591721 3300005578 Unclassified 946
199 Ga0068856_100002563 3300005614 Bacteria 18717
200 Ga0068856_100215639 3300005614 Bacteria 1935
201 Ga0068856_101278035 3300005614 Unclassified 749
202 Ga0070702_100002995 3300005615 Bacteria 7466
203 Ga0068852_100033298 3300005616 Bacteria 4276
204 Ga0068859_100042980 3300005617 Bacteria 4541
205 Ga0068859_100711221 3300005617 Bacteria 1095
206 Ga0068864_100092584 3300005618 Bacteria 2669
207 Ga0068864_100218126 3300005618 Bacteria 1759
208 Ga0068864_100549589 3300005618 Bacteria 1116
209 Ga0068861_100137588 3300005719 Bacteria 1989
210 Ga0068861_100238401 3300005719 Bacteria 1546
211 Ga0068863_100000908 3300005841 Bacteria 29779
212 Ga0068863_100674922 3300005841 Bacteria 1026
213 Ga0068863_100946958 3300005841 Bacteria 862
214 Ga0068863_100952967 3300005841 Bacteria 860
215 Ga0068858_100105360 3300005842 Bacteria 2631
216 Ga0068858_100677679 3300005842 Bacteria 1003
217 Ga0068858_100991778 3300005842 Bacteria 823
218 Ga0068860_100053850 3300005843 Bacteria 3825
219 Ga0068860_100060582 3300005843 Bacteria 3597
220 Ga0068860_100479555 3300005843 Bacteria 1240
221 Ga0068862_100000825 3300005844 Bacteria 30645
222 Ga0081455_10073317 3300005937 Bacteria 2831
223 Ga0081455_10120184 3300005937 Bacteria 2071
224 Ga0081538_10005103 3300005981 Bacteria 11924
225 Ga0081538_10058510 3300005981 Bacteria 2235
226 Ga0081539_10003032 3300005985 Bacteria 21771
227 Ga0081539_10066354 3300005985 Bacteria 1956
228 Ga0081539_10305735 3300005985 Bacteria 682
229 Ga0070717_10007152 3300006028 Bacteria 8272
230 Ga0070717_10011548 3300006028 Bacteria 6710
231 Ga0070717_10029455 3300006028 Unclassified 4404
232 Ga0070717_10040442 3300006028 Bacteria 3797
233 Ga0070717_10072343 3300006028 Bacteria 2879
234 Ga0070717_10122669 3300006028 Bacteria 2228
235 Ga0070717_10253466 3300006028 Bacteria 1555
236 Ga0070717_10363866 3300006028 Unclassified 1295
237 Ga0070717_10671644 3300006028 Unclassified 941
238 Ga0070717_10690742 3300006028 Bacteria 927
239 Ga0070717_10940368 3300006028 Unclassified 787
240 Ga0070717_11188645 3300006028 Unclassified 694
241 Ga0075368_10035707 3300006042 Bacteria 1941
242 Ga0075364_10009943 3300006051 Bacteria 5723
243 Ga0075364_10050996 3300006051 Bacteria 2701
244 Ga0075364_10285451 3300006051 Bacteria 1123
245 Ga0070715_10003272 3300006163 Bacteria 5117
246 Ga0070715_10006430 3300006163 Unclassified 3995
247 Ga0070715_10065527 3300006163 Bacteria 1608
248 Ga0070716_100012863 3300006173 Unclassified 4254
249 Ga0070716_100057385 3300006173 Bacteria 2237
250 Ga0070716_100085772 3300006173 Bacteria 1892
251 Ga0070716_100365074 3300006173 Bacteria 1027
252 Ga0070716_100770581 3300006173 Unclassified 742
253 Ga0070716_100908641 3300006173 Bacteria 690
254 Ga0070712_100002509 3300006175 Bacteria 11315
255 Ga0070712_100002786 3300006175 Bacteria 10794
256 Ga0070712_100154314 3300006175 Bacteria 1766
257 Ga0070712_100467107 3300006175 Bacteria 1053
258 Ga0070712_100650627 3300006175 Bacteria 895
259 Ga0075362_10003235 3300006177 Bacteria 5651
260 Ga0075367_10025633 3300006178 Bacteria 3336
261 Ga0075367_10027307 3300006178 Bacteria 3246
262 Ga0075366_10044372 3300006195 Bacteria 2635
263 Ga0097621_100006910 3300006237 Bacteria 8078
264 Ga0097621_100106784 3300006237 Bacteria 2362
265 Ga0097621_100240621 3300006237 Bacteria 1582
266 Ga0075370_10079271 3300006353 Bacteria 1886
267 Ga0068871_100907182 3300006358 Bacteria 817
268 Ga0075428_100057162 3300006844 Bacteria 4271
269 Ga0075428_100163953 3300006844 Bacteria 2411
270 Ga0075428_100291678 3300006844 Bacteria 1755
271 Ga0075428_100773785 3300006844 Bacteria 1021
272 Ga0075430_100013818 3300006846 Bacteria 6878
273 Ga0075430_100093531 3300006846 Bacteria 2513
274 Ga0075430_100223245 3300006846 Unclassified 1563
275 Ga0075430_100322310 3300006846 Bacteria 1277
276 Ga0075430_100566279 3300006846 Bacteria 937
277 Ga0075431_100136884 3300006847 Bacteria 2525
278 Ga0075431_100155525 3300006847 Bacteria 2352
279 Ga0075431_100262096 3300006847 Bacteria 1754
280 Ga0075431_100344092 3300006847 Bacteria 1500
281 Ga0075433_10014954 3300006852 Bacteria 6353
282 Ga0075433_10111250 3300006852 Bacteria 2430
283 Ga0075433_10127741 3300006852 Bacteria 2258
284 Ga0075433_10150613 3300006852 Bacteria 2069
285 Ga0075433_10881344 3300006852 Bacteria 781
286 Ga0075434_100000451 3300006871 Bacteria 30624
287 Ga0075434_100018027 3300006871 Bacteria 6812
288 Ga0075434_100020202 3300006871 Bacteria 6454
289 Ga0075434_100159251 3300006871 Bacteria 2277
290 Ga0075434_100160874 3300006871 Bacteria 2265
291 Ga0075434_100219315 3300006871 Bacteria 1922
292 Ga0075434_100469607 3300006871 Bacteria 1279
293 Ga0075434_100521139 3300006871 Bacteria 1209
294 Ga0075434_101067696 3300006871 Bacteria 821
295 Ga0075429_100051881 3300006880 Unclassified 3568
296 Ga0075429_100086007 3300006880 Bacteria 2740
297 Ga0075429_100495056 3300006880 Bacteria 1071
298 Ga0075429_100554595 3300006880 Bacteria 1007
299 Ga0068865_100036113 3300006881 Bacteria 3329
300 Ga0068865_100080123 3300006881 Bacteria 2341
301 Ga0068865_100175854 3300006881 Bacteria 1645
302 Ga0075436_100000203 3300006914 Bacteria 36662
303 Ga0097620_100042978 3300006931 Bacteria 4541
304 Ga0097620_100656304 3300006931 Bacteria 1141
305 Ga0097620_100711313 3300006931 Bacteria 1095
306 Ga0075435_100000012 3300007076 Bacteria 108852
307 Ga0075435_100131120 3300007076 Bacteria 2098
308 Ga0075435_100251014 3300007076 Bacteria 1506
309 Ga0075435_100344506 3300007076 Bacteria 1277
310 Ga0075435_100609683 3300007076 Unclassified 947
311 Ga0099794_10052262 3300007265 Bacteria 1969
312 Ga0105240_10037867 3300009093 Bacteria 6194
313 Ga0105240_10099581 3300009093 Bacteria 3538
314 Ga0105240_10211946 3300009093 Unclassified 2263
315 Ga0105240_10445109 3300009093 Bacteria 1451
316 Ga0105240_10855540 3300009093 Bacteria 981
317 Ga0111539_10008520 3300009094 Bacteria 13028
318 Ga0111539_10010938 3300009094 Bacteria 11422
319 Ga0111539_10023712 3300009094 Bacteria 7539
320 Ga0111539_10036591 3300009094 Bacteria 5933
321 Ga0111539_10055948 3300009094 Bacteria 4690
322 Ga0111539_10292196 3300009094 Bacteria 1896
323 Ga0111539_10697814 3300009094 Bacteria 1181
324 Ga0111539_10997450 3300009094 Bacteria 973
325 Ga0111539_11021357 3300009094 Bacteria 961
326 Ga0105245_10585683 3300009098 Bacteria 1140
327 Ga0105247_10079189 3300009101 Bacteria 2067
328 Ga0114129_10008502 3300009147 Bacteria 14631
329 Ga0114129_10021385 3300009147 Bacteria 9183
330 Ga0114129_10023980 3300009147 Bacteria 8646
331 Ga0114129_10033927 3300009147 Bacteria 7209
332 Ga0114129_10057157 3300009147 Bacteria 5462
333 Ga0114129_10100063 3300009147 Bacteria 4012
334 Ga0114129_10161848 3300009147 Bacteria 3056
335 Ga0114129_10170822 3300009147 Bacteria 2964
336 Ga0114129_10207198 3300009147 Bacteria 2652
337 Ga0114129_10249459 3300009147 Bacteria 2384
338 Ga0114129_10276140 3300009147 Bacteria 2246
339 Ga0114129_10569839 3300009147 Bacteria 1470
340 Ga0114129_10664052 3300009147 Bacteria 1344
341 Ga0114129_10911080 3300009147 Bacteria 1113
342 Ga0105241_10424749 3300009174 Bacteria 1170
343 Ga0105242_10023415 3300009176 Bacteria 4866
344 Ga0105242_10177354 3300009176 Bacteria 1878
345 Ga0105242_11110899 3300009176 Bacteria 805
346 Ga0105248_10018116 3300009177 Bacteria 7775
347 Ga0105248_10039701 3300009177 Bacteria 5276
348 Ga0105248_10185947 3300009177 Bacteria 2341
349 Ga0105248_10270063 3300009177 Bacteria 1915
350 Ga0105248_10391189 3300009177 Bacteria 1565
351 Ga0105248_10598732 3300009177 Bacteria 1244
352 Ga0105248_11129416 3300009177 Bacteria 886
353 Ga0105237_10119496 3300009545 Bacteria 2629
354 Ga0105237_10423602 3300009545 Bacteria 1337
355 Ga0105237_11127626 3300009545 Bacteria 791
356 Ga0105238_10030121 3300009551 Bacteria 5523
357 Ga0105238_10089705 3300009551 Bacteria 3062
358 Ga0105238_10114136 3300009551 Bacteria 2681
359 Ga0105238_10591951 3300009551 Bacteria 1116
360 Ga0105249_10000665 3300009553 Bacteria 31200
361 Ga0105249_10005149 3300009553 Bacteria 11284
362 Ga0105249_10854241 3300009553 Bacteria 976
363 Ga0105249_10859848 3300009553 Bacteria 973
364 Ga0105239_11210975 3300010375 Bacteria 870
365 Ga0105246_10362348 3300011119 Bacteria 1192
366 Ga0105246_10462495 3300011119 Bacteria 1069
367 Ga0105246_10586793 3300011119 Bacteria 961
368 Ga0105246_10634169 3300011119 Bacteria 928
369 Ga0157346_1005414 3300012480 Bacteria 790
370 Ga0157371_10016487 3300013102 Bacteria 5512
371 Ga0157370_10000316 3300013104 Bacteria 60618
372 Ga0157370_10275558 3300013104 Bacteria 1554
373 Ga0157370_10358347 3300013104 Bacteria 1344
374 Ga0157369_10002654 3300013105 Bacteria 21358
375 Ga0157369_10011644 3300013105 Bacteria 9986
376 Ga0157369_10020021 3300013105 Bacteria 7484
377 Ga0157369_10140537 3300013105 Bacteria 2555
378 Ga0157369_10420812 3300013105 Bacteria 1385
379 Ga0157374_10404408 3300013296 Bacteria 1362
380 Ga0157374_10487487 3300013296 Unclassified 1236
381 Ga0157374_10836252 3300013296 Unclassified 937
382 Ga0157378_10110887 3300013297 Unclassified 2515
383 Ga0157378_10557879 3300013297 Bacteria 1152
384 Ga0157378_10875750 3300013297 Bacteria 928
385 Ga0163162_10014068 3300013306 Bacteria 7821
386 Ga0163162_10135363 3300013306 Bacteria 2574
387 Ga0163162_10220991 3300013306 Bacteria 2024
388 Ga0157372_10003848 3300013307 Bacteria 16128
389 Ga0157372_10411739 3300013307 Bacteria 1575
390 Ga0157375_10007743 3300013308 Bacteria 9403
391 Ga0157375_10141692 3300013308 Bacteria 2531
392 Ga0157375_10190741 3300013308 Bacteria 2204
393 Ga0157375_10226402 3300013308 Bacteria 2029
394 Ga0157375_10269570 3300013308 Bacteria 1864
395 Ga0157375_10840441 3300013308 Bacteria 1065
396 Ga0157375_11456914 3300013308 Bacteria 807
397 Ga0157375_11859372 3300013308 Bacteria 714
398 Ga0163163_10000017 3300014325 Bacteria 208781
399 Ga0163163_10445224 3300014325 Bacteria 1355
400 Ga0163163_10544211 3300014325 Bacteria 1223
401 Ga0163163_10691813 3300014325 Bacteria 1083
402 Ga0163163_11044961 3300014325 Bacteria 880
403 Ga0157380_10006923 3300014326 Bacteria 8020
404 Ga0157380_10948282 3300014326 Bacteria 890
405 Ga0157380_11674850 3300014326 Bacteria 693
406 Ga0157377_10010222 3300014745 Bacteria 4635
407 Ga0157377_10122749 3300014745 Bacteria 1576
408 Ga0157379_10047690 3300014968 Bacteria 3822
409 Ga0157379_10049003 3300014968 Bacteria 3771
410 Ga0163161_10198470 3300017792 Bacteria 1545
411 Ga0197907_10710089 3300020069 Bacteria 2006
412 Ga0206356_10680555 3300020070 Bacteria 1139
413 Ga0206349_1837458 3300020075 Bacteria 792
414 Ga0206351_10564219 3300020077 Bacteria 1619
415 Ga0206354_11435900 3300020081 Bacteria 1143
416 Ga0206353_11539969 3300020082 Bacteria 1896
417 Ga0213876_10269606 3300021384 Bacteria 905
418 Ga0213876_10273202 3300021384 Bacteria 898
419 Ga0224712_10009247 3300022467 Bacteria 2960
420 Ga0224712_10018351 3300022467 Bacteria 2337
421 Ga0228598_1002744 3300024227 Unclassified 3814
422 Ga0207697_10004143 3300025315 Bacteria 6994
423 Ga0207682_10048231 3300025893 Bacteria 1755
424 Ga0207692_10046021 3300025898 Bacteria 2185
425 Ga0207692_10088359 3300025898 Bacteria 1675
426 Ga0207692_10248120 3300025898 Unclassified 1066
427 Ga0207710_10143408 3300025900 Bacteria 1154
428 Ga0207688_10088773 3300025901 Bacteria 1773
429 Ga0207685_10009413 3300025905 Bacteria 2838
430 Ga0207685_10022188 3300025905 Bacteria 2140
431 Ga0207699_10016009 3300025906 Bacteria 3912
432 Ga0207699_10018311 3300025906 Bacteria 3709
433 Ga0207699_10337245 3300025906 Bacteria 1061
434 Ga0207645_10000951 3300025907 Bacteria 24030
435 Ga0207684_10001709 3300025910 Bacteria 23304
436 Ga0207684_10013136 3300025910 Bacteria 7169
437 Ga0207684_10021919 3300025910 Bacteria 5455
438 Ga0207684_10046428 3300025910 Bacteria 3685
439 Ga0207684_10047401 3300025910 Bacteria 3644
440 Ga0207684_10082242 3300025910 Bacteria 2742
441 Ga0207684_10626605 3300025910 Unclassified 917
442 Ga0207707_10012200 3300025912 Bacteria 7471
443 Ga0207707_10016072 3300025912 Bacteria 6527
444 Ga0207707_10154790 3300025912 Bacteria 2005
445 Ga0207707_10623480 3300025912 Bacteria 911
446 Ga0207707_10960272 3300025912 Unclassified 703
447 Ga0207695_10055205 3300025913 Bacteria 4141
448 Ga0207695_10365071 3300025913 Bacteria 1330
449 Ga0207671_10152266 3300025914 Unclassified 1787
450 Ga0207693_10002323 3300025915 Bacteria 16524
451 Ga0207693_10003126 3300025915 Bacteria 14255
452 Ga0207693_10009038 3300025915 Bacteria 8133
453 Ga0207693_10033877 3300025915 Bacteria 4029
454 Ga0207693_10073386 3300025915 Bacteria 2678
455 Ga0207693_10115182 3300025915 Bacteria 2110
456 Ga0207693_10304452 3300025915 Bacteria 1248
457 Ga0207693_10337040 3300025915 Bacteria 1180
458 Ga0207693_10410322 3300025915 Bacteria 1059
459 Ga0207663_10000275 3300025916 Bacteria 22369
460 Ga0207663_10001046 3300025916 Bacteria 12703
461 Ga0207663_10004310 3300025916 Bacteria 7063
462 Ga0207663_10035038 3300025916 Bacteria 3008
463 Ga0207663_10120740 3300025916 Bacteria 1794
464 Ga0207663_10208778 3300025916 Bacteria 1414
465 Ga0207660_10025592 3300025917 Bacteria 4008
466 Ga0207660_10047006 3300025917 Bacteria 3049
467 Ga0207662_10005032 3300025918 Bacteria 6998
468 Ga0207662_10171795 3300025918 Bacteria 1390
469 Ga0207657_10505701 3300025919 Bacteria 946
470 Ga0207649_10211211 3300025920 Bacteria 1377
471 Ga0207649_10251690 3300025920 Bacteria 1273
472 Ga0207652_10023916 3300025921 Bacteria 5066
473 Ga0207652_10321010 3300025921 Bacteria 1398
474 Ga0207646_10005883 3300025922 Bacteria 12808
475 Ga0207646_10025817 3300025922 Bacteria 5371
476 Ga0207646_10054282 3300025922 Bacteria 3585
477 Ga0207646_10055008 3300025922 Bacteria 3559
478 Ga0207646_10063768 3300025922 Bacteria 3289
479 Ga0207646_10070675 3300025922 Bacteria 3118
480 Ga0207646_10073151 3300025922 Bacteria 3062
481 Ga0207646_10084425 3300025922 Bacteria 2841
482 Ga0207646_10090980 3300025922 Unclassified 2731
483 Ga0207646_10190967 3300025922 Bacteria 1850
484 Ga0207681_10022135 3300025923 Bacteria 4049
485 Ga0207681_10069430 3300025923 Bacteria 2450
486 Ga0207681_10189130 3300025923 Bacteria 1574
487 Ga0207694_10038610 3300025924 Bacteria 3672
488 Ga0207694_10097241 3300025924 Unclassified 2329
489 Ga0207694_10302680 3300025924 Bacteria 1317
490 Ga0207694_10420321 3300025924 Bacteria 1113
491 Ga0207650_10573581 3300025925 Bacteria 947
492 Ga0207659_10736166 3300025926 Bacteria 845
493 Ga0207700_10000856 3300025928 Bacteria 17533
494 Ga0207700_10002332 3300025928 Bacteria 10880
495 Ga0207700_10002921 3300025928 Bacteria 9853
496 Ga0207700_10019902 3300025928 Bacteria 4544
497 Ga0207700_10020055 3300025928 Bacteria 4531
498 Ga0207700_10025563 3300025928 Bacteria 4102
499 Ga0207700_10052889 3300025928 Bacteria 3039
500 Ga0207700_10071210 3300025928 Bacteria 2676
501 Ga0207700_10136102 3300025928 Bacteria 2012
502 Ga0207700_10351628 3300025928 Bacteria 1283
503 Ga0207700_10417653 3300025928 Unclassified 1178
504 Ga0207700_10730181 3300025928 Unclassified 885
505 Ga0207664_10000532 3300025929 Bacteria 27088
506 Ga0207664_10450250 3300025929 Bacteria 1149
507 Ga0207664_11173270 3300025929 Bacteria 685
508 Ga0207706_10001737 3300025933 Bacteria 21437
509 Ga0207706_10012184 3300025933 Bacteria 7835
510 Ga0207706_10067629 3300025933 Bacteria 3143
511 Ga0207706_10625955 3300025933 Bacteria 923
512 Ga0207706_11039974 3300025933 Bacteria 687
513 Ga0207686_10097756 3300025934 Bacteria 1953
514 Ga0207670_10000034 3300025936 Bacteria 109898
515 Ga0207670_10203545 3300025936 Bacteria 1505
516 Ga0207670_10207932 3300025936 Bacteria 1491
517 Ga0207669_10491822 3300025937 Bacteria 980
518 Ga0207669_10838778 3300025937 Bacteria 764
519 Ga0207704_10029935 3300025938 Bacteria 3045
520 Ga0207665_10000132 3300025939 Bacteria 49462
521 Ga0207665_10000500 3300025939 Bacteria 26563
522 Ga0207665_10062371 3300025939 Bacteria 2529
523 Ga0207665_10114808 3300025939 Bacteria 1896
524 Ga0207665_10160474 3300025939 Bacteria 1617
525 Ga0207665_10227406 3300025939 Bacteria 1370
526 Ga0207665_10915203 3300025939 Bacteria 696
527 Ga0207691_10000366 3300025940 Bacteria 45517
528 Ga0207691_10001194 3300025940 Bacteria 25851
529 Ga0207691_10037285 3300025940 Bacteria 4503
530 Ga0207691_10231614 3300025940 Bacteria 1599
531 Ga0207691_10639279 3300025940 Bacteria 899
532 Ga0207691_10833080 3300025940 Bacteria 774
533 Ga0207689_10141974 3300025942 Bacteria 1978
534 Ga0207689_10375498 3300025942 Bacteria 1183
535 Ga0207661_10000208 3300025944 Bacteria 37883
536 Ga0207661_10035976 3300025944 Bacteria 3862
537 Ga0207661_10038493 3300025944 Bacteria 3749
538 Ga0207661_10335798 3300025944 Bacteria 1361
539 Ga0207661_10648445 3300025944 Bacteria 970
540 Ga0207679_10046679 3300025945 Bacteria 3141
541 Ga0207679_10153895 3300025945 Bacteria 1875
542 Ga0207679_10203353 3300025945 Bacteria 1656
543 Ga0207679_11121931 3300025945 Bacteria 721
544 Ga0207667_10174128 3300025949 Unclassified 2211
545 Ga0207667_10409645 3300025949 Bacteria 1380
546 Ga0207667_10452182 3300025949 Bacteria 1305
547 Ga0207667_10753171 3300025949 Bacteria 973
548 Ga0207667_11374379 3300025949 Bacteria 680
549 Ga0207651_10619921 3300025960 Bacteria 947
550 Ga0207712_10000812 3300025961 Bacteria 23033
551 Ga0207712_10095413 3300025961 Bacteria 2199
552 Ga0207712_10375331 3300025961 Bacteria 1189
553 Ga0207668_10002276 3300025972 Bacteria 11215
554 Ga0207668_10006808 3300025972 Bacteria 6771
555 Ga0207668_10217143 3300025972 Bacteria 1533
556 Ga0207668_11324048 3300025972 Bacteria 649
557 Ga0207658_10382666 3300025986 Bacteria 1233
558 Ga0207658_10734297 3300025986 Bacteria 894
559 Ga0207703_10515851 3300026035 Bacteria 1124
560 Ga0207703_10640198 3300026035 Bacteria 1008
561 Ga0207639_10009125 3300026041 Bacteria 6835
562 Ga0207678_10016479 3300026067 Bacteria 6489
563 Ga0207678_10535199 3300026067 Bacteria 1023
564 Ga0207708_10056420 3300026075 Bacteria 2996
565 Ga0207702_10007569 3300026078 Bacteria 9251
566 Ga0207702_10240791 3300026078 Bacteria 1695
567 Ga0207641_10102831 3300026088 Bacteria 2520
568 Ga0207641_10364385 3300026088 Bacteria 1381
569 Ga0207641_10520857 3300026088 Bacteria 1157
570 Ga0207674_10000861 3300026116 Bacteria 39661
571 Ga0207674_10008925 3300026116 Bacteria 11522
572 Ga0207675_100000964 3300026118 Bacteria 28651
573 Ga0207675_100001025 3300026118 Bacteria 27674
574 Ga0209588_1059709 3300027671 Bacteria 1233
575 Ga0207428_10001806 3300027907 Bacteria 21911
576 Ga0207428_10007234 3300027907 Bacteria 10147
577 Ga0207428_10036298 3300027907 Bacteria 4021
578 Ga0268265_10000988 3300028380 Bacteria 25833
579 Ga0268265_10012737 3300028380 Bacteria 5707
580 Ga0268264_10104635 3300028381 Bacteria 2467
581 Ga0268264_10382810 3300028381 Bacteria 1348
582 Ga0268264_10637296 3300028381 Bacteria 1054
583 Ga0265760_10051984 3300031090 Unclassified 1235
584 Ga0265760_10057422 3300031090 Bacteria 1179
585 Ga0265320_10027751 3300031240 Bacteria 2948
586 Ga0265339_10030317 3300031249 Bacteria 3063
587 Ga0265331_10050889 3300031250 Bacteria 1985
588 Ga0265316_10330244 3300031344 Bacteria 1106
589 Ga0265316_10446065 3300031344 Bacteria 928
590 Ga0307408_100029948 3300031548 Bacteria 3776
591 Ga0307408_100033033 3300031548 Bacteria 3612
592 Ga0307408_100076198 3300031548 Bacteria 2494
593 Ga0307408_100087670 3300031548 Bacteria 2342
594 Ga0307408_100240060 3300031548 Bacteria 1489
595 Ga0307408_100462707 3300031548 Unclassified 1103
596 Ga0265314_10032227 3300031711 Bacteria 3857
597 Ga0265314_10091863 3300031711 Bacteria 1974
598 Ga0265314_10294785 3300031711 Bacteria 912
599 Ga0265342_10013220 3300031712 Bacteria 5551
600 Ga0307405_10002927 3300031731 Bacteria 7702
601 Ga0307405_10003773 3300031731 Bacteria 7040
602 Ga0307405_10004305 3300031731 Bacteria 6702
603 Ga0307405_10068469 3300031731 Bacteria 2271
604 Ga0307405_10093298 3300031731 Bacteria 1999
605 Ga0307405_10169603 3300031731 Bacteria 1555
606 Ga0307405_10894460 3300031731 Bacteria 750
607 Ga0307413_10010169 3300031824 Bacteria 4547
608 Ga0307413_10055539 3300031824 Bacteria 2410
609 Ga0307413_10064097 3300031824 Bacteria 2281
610 Ga0307413_10076450 3300031824 Bacteria 2128
611 Ga0307413_10265362 3300031824 Bacteria 1282
612 Ga0307413_10350941 3300031824 Bacteria 1138
613 Ga0307413_10531066 3300031824 Bacteria 951
614 Ga0307413_10615232 3300031824 Bacteria 891
615 Ga0307413_10986246 3300031824 Bacteria 721
616 Ga0307410_10013501 3300031852 Bacteria 4768
617 Ga0307410_10040909 3300031852 Bacteria 3053
618 Ga0307410_10054250 3300031852 Bacteria 2716
619 Ga0307410_10372841 3300031852 Bacteria 1146
620 Ga0307406_10004089 3300031901 Bacteria 7942
621 Ga0307406_10007555 3300031901 Bacteria 6033
622 Ga0307406_10023649 3300031901 Bacteria 3659
623 Ga0307406_10068609 3300031901 Bacteria 2315
624 Ga0307406_10175172 3300031901 Bacteria 1556
625 Ga0307406_10407275 3300031901 Bacteria 1080
626 Ga0307406_11053263 3300031901 Bacteria 700
627 Ga0307407_10003810 3300031903 Bacteria 6278
628 Ga0307407_10029087 3300031903 Bacteria 2963
629 Ga0307407_10035076 3300031903 Bacteria 2752
630 Ga0307407_10037551 3300031903 Bacteria 2677
631 Ga0307407_10185325 3300031903 Bacteria 1382
632 Ga0307407_10211017 3300031903 Bacteria 1307
633 Ga0307407_10436215 3300031903 Bacteria 947
634 Ga0307407_10542824 3300031903 Bacteria 858
635 Ga0307407_10717640 3300031903 Bacteria 754
636 Ga0307412_10002806 3300031911 Bacteria 9671
637 Ga0307412_10020973 3300031911 Bacteria 3985
638 Ga0307412_10041113 3300031911 Bacteria 2994
639 Ga0307412_10041986 3300031911 Bacteria 2968
640 Ga0307412_10100878 3300031911 Bacteria 2041
641 Ga0307412_10215917 3300031911 Bacteria 1467
642 Ga0307409_100000761 3300031995 Bacteria 14553
643 Ga0307409_100001388 3300031995 Bacteria 11835
644 Ga0307409_100006134 3300031995 Bacteria 7027
645 Ga0307409_100012489 3300031995 Bacteria 5414
646 Ga0307409_100017504 3300031995 Bacteria 4780
647 Ga0307409_100084250 3300031995 Bacteria 2580
648 Ga0307409_100085926 3300031995 Bacteria 2559
649 Ga0307409_100089329 3300031995 Bacteria 2518
650 Ga0307409_100234861 3300031995 Bacteria 1665
651 Ga0307409_100264412 3300031995 Bacteria 1581
652 Ga0307409_100437078 3300031995 Bacteria 1259
653 Ga0307409_100953164 3300031995 Bacteria 874
654 Ga0307409_101005625 3300031995 Bacteria 852
655 Ga0307416_100004401 3300032002 Bacteria 8486
656 Ga0307416_100023480 3300032002 Bacteria 4476
657 Ga0307416_100033012 3300032002 Bacteria 3918
658 Ga0307416_100038735 3300032002 Bacteria 3680
659 Ga0307416_100079211 3300032002 Bacteria 2768
660 Ga0307416_100102603 3300032002 Bacteria 2494
661 Ga0307416_100128701 3300032002 Bacteria 2274
662 Ga0307416_100186020 3300032002 Bacteria 1952
663 Ga0307416_100230827 3300032002 Bacteria 1784
664 Ga0307416_100370200 3300032002 Bacteria 1459
665 Ga0307416_101037048 3300032002 Bacteria 924
666 Ga0307414_10009483 3300032004 Bacteria 5594
667 Ga0307414_10043402 3300032004 Bacteria 3063
668 Ga0307414_10048949 3300032004 Bacteria 2920
669 Ga0307414_10059050 3300032004 Bacteria 2706
670 Ga0307414_10073267 3300032004 Bacteria 2477
671 Ga0307411_10006054 3300032005 Bacteria 6015
672 Ga0307411_10038193 3300032005 Bacteria 3026
673 Ga0307411_10038228 3300032005 Bacteria 3025
674 Ga0307411_10066479 3300032005 Bacteria 2422
675 Ga0307411_10093297 3300032005 Bacteria 2107
676 Ga0307411_10101883 3300032005 Bacteria 2033
677 Ga0307411_10198207 3300032005 Bacteria 1539
678 Ga0307411_10604906 3300032005 Bacteria 943
679 Ga0307411_10980833 3300032005 Bacteria 755
680 Ga0307415_100001794 3300032126 Bacteria 10506
681 Ga0307415_100006110 3300032126 Bacteria 6459
682 Ga0307415_100054315 3300032126 Bacteria 2733
683 Ga0307415_100062237 3300032126 Bacteria 2587
684 Ga0307415_100141469 3300032126 Bacteria 1838
685 Ga0307415_100171485 3300032126 Bacteria 1692
686 Ga0307415_100200973 3300032126 Bacteria 1581
687 Ga0373926_0031477 3300035083 Bacteria 1871
688 Ga0373926_0131558 3300035083 Bacteria 948
689 Ga0373934_0010626 3300035086 Bacteria 3456
690 Ga0373934_0038725 3300035086 Bacteria 1878
691 Ga0373934_0253507 3300035086 Bacteria 728
692 Ga0373944_0055787 3300035089 Bacteria 1256
693 Ga0373944_0185753 3300035089 Bacteria 747
694 Ga0373923_0004878 3300035111 Bacteria 4500
695 Ga0373923_0051721 3300035111 Bacteria 1724
696 Ga0373936_0000390 3300035113 Bacteria 14909
697 Ga0373936_0064675 3300035113 Bacteria 1499
698 Ga0373936_0217214 3300035113 Unclassified 847
699 Ga0373939_0256049 3300035114 Bacteria 683
700 Ga0373941_0025679 3300035115 Bacteria 1704
701 Ga0373945_0009002 3300035116 Bacteria 3264
702 Ga0373953_0065589 3300035117 Bacteria 1491
703 Ga0373953_0090854 3300035117 Bacteria 1277
704 Ga0373953_0097404 3300035117 Bacteria 1235
705 Ga0373953_0116800 3300035117 Bacteria 1131
706 Ga0373954_0003568 3300035118 Bacteria 6613
707 Ga0373954_0136756 3300035118 Bacteria 1194
708 Ga0373956_0006456 3300035119 Unclassified 4702
709 Ga0373956_0014240 3300035119 Unclassified 3321
710 Ga0373956_0019987 3300035119 Bacteria 2844
711 Ga0373956_0028031 3300035119 Bacteria 2449
712 Ga0373956_0270232 3300035119 Bacteria 809
713 Ga0373957_0022916 3300035120 Bacteria 2229
714 Ga0373957_0056337 3300035120 Bacteria 1513
715 Ga0373943_0000092 3300035170 Bacteria 33178
716 Ga0373943_0014821 3300035170 Bacteria 3536
717 Ga0373946_0002787 3300035171 Bacteria 6183
718 Ga0373946_0055569 3300035171 Bacteria 1669
719 Ga0373955_0000623 3300035172 Bacteria 15191
720 Ga0373955_0023694 3300035172 Unclassified 3130
721 Ga0373955_0032780 3300035172 Bacteria 2731
722 Ga0373955_0044477 3300035172 Bacteria 2392
723 Ga0373955_0139993 3300035172 Bacteria 1418
724 Ga0373955_0291209 3300035172 Bacteria 983
725 Ga0373961_0194908 3300035241 Bacteria 712
726 Ga0373924_0001882 3300035410 Bacteria 6958
727 Ga0373924_0026409 3300035410 Bacteria 2303
728 Ga0373924_0054813 3300035410 Bacteria 1658
729 Ga0373931_0330755 3300035691 Bacteria 949
730 Ga0373935_0001269 3300035692 Bacteria 13918
731 Ga0373935_0010177 3300035692 Bacteria 5633
732 Ga0373927_0000056 3300035695 Bacteria 81041
733 Ga0373927_0038950 3300035695 Bacteria 3085
734 Ga0373927_0482037 3300035695 Bacteria 819
735 Ga0373933_0005072 3300035724 Bacteria 7185
736 Ga0373933_0005627 3300035724 Bacteria 6828
737 Ga0373933_0071916 3300035724 Bacteria 2106
738 Ga0373933_0195326 3300035724 Bacteria 1294
739 Ga0373933_0239725 3300035724 Bacteria 1166
740 Ga0373947_0000369 3300035725 Bacteria 25404
741 Ga0373947_0008457 3300035725 Bacteria 5931
742 Ga0373947_0505579 3300035725 Unclassified 821
743 Ga0373937_0002023 3300036401 Bacteria 16921
744 Ga0373937_0002809 3300036401 Bacteria 14555
745 Ga0373937_0012977 3300036401 Bacteria 7337
746 Ga0373937_0036193 3300036401 Bacteria 4497
747 Ga0373937_0109659 3300036401 Bacteria 2567
748 Ga0373937_0113489 3300036401 Bacteria 2521
749 Ga0373937_0225097 3300036401 Bacteria 1766
750 Ga0373937_0263540 3300036401 Bacteria 1625
751 Ga0373937_0280241 3300036401 Unclassified 1574
752 Ga0373937_0339178 3300036401 Unclassified 1423
753 Ga0373937_0524823 3300036401 Bacteria 1125
754 Ga0373937_0634962 3300036401 Bacteria 1013
755 Ga0373925_0004133 3300037068 Bacteria 11013
756 Ga0373925_0004354 3300037068 Bacteria 10709
757 Ga0373925_0133698 3300037068 Bacteria 1936
758 Ga0373925_0395427 3300037068 Bacteria 1127
759 Ga0373925_0557763 3300037068 Bacteria 942
760 Ga0395899_0031700 3300037312 Bacteria 3972
761 Ga0395900_0052532 3300037418 Bacteria 4195
762 Ga0395900_0100054 3300037418 Bacteria 2978
763 Ga0395900_0575422 3300037418 Bacteria 1069
764 Ga0395900_0814860 3300037418 Bacteria 861
765 Ga0395898_0029897 3300037466 Bacteria 5454
766 Ga0395898_0144484 3300037466 Bacteria 2277
767 Ga0395898_0600278 3300037466 Bacteria 1043
768 Ga0395905_0085910 3300037471 Bacteria 2948
769 Ga0395905_0232810 3300037471 Bacteria 1722
770 Ga0395905_0290842 3300037471 Bacteria 1520
771 Ga0436364_0678490 3300037853 Bacteria 1679
772 Ga0395901_0009601 3300038443 Bacteria 9815
773 Ga0395901_0275558 3300038443 Bacteria 1749
774 Ga0395901_0342879 3300038443 Bacteria 1543
775 Ga0395901_0491724 3300038443 Bacteria 1250
776 Ga0436365_0110548 3300039437 Bacteria 1212
777 Ga0436365_0523105 3300039437 Bacteria 1225
778 Ga0436365_0833863 3300039437 Bacteria 1027
779 Ga0436365_1827462 3300039437 Bacteria 1320
780 Ga0436360_0502764 3300039438 Bacteria 2770
781 Ga0436363_0068089 3300039450 Unclassified 1675
782 Ga0439453_0019411 3300041408 Bacteria 1210
783 Ga0439453_0059850 3300041408 Unclassified 787
784 Ga0439466_0152783 3300041411 Bacteria 707
785 Ga0451853_1519401 3300041512 Bacteria 1042
786 Ga0439443_000597 3300042003 Bacteria 3369
787 Ga0439443_002666 3300042003 Bacteria 2162
788 Ga0439448_0008249 3300042005 Bacteria 3044
789 Ga0439448_0011276 3300042005 Bacteria 2662
790 Ga0439448_0040467 3300042005 Bacteria 1505
791 Ga0439450_000393 3300042008 Bacteria 5600
792 Ga0439454_001848 3300042011 Bacteria 2126
793 Ga0439462_0035338 3300042015 Unclassified 1328
794 Ga0439463_002823 3300042016 Bacteria 4402
795 Ga0450914_022728 3300042118 Bacteria 709
796 Ga0450891_011340 3300042129 Bacteria 825
797 Ga0450900_000212 3300042136 Bacteria 3875
798 Ga0450904_008991 3300042139 Bacteria 985
799 Ga0439435_0096030 3300042436 Bacteria 906
800 Ga0439435_0138778 3300042436 Bacteria 773
801 Ga0439460_0000651 3300042461 Bacteria 7641
802 Ga0439460_0071462 3300042461 Unclassified 1076
803 Ga0439440_0000294 3300042993 Bacteria 8139
804 Ga0453683_0086775 3300044673 Bacteria 1961
805 Ga0466963_0151990 3300044694 Unclassified 1608
806 Ga0466963_0430429 3300044694 Bacteria 931
807 Ga0466963_0434921 3300044694 Bacteria 925
808 Ga0466970_0070601 3300044765 Bacteria 1878
809 Ga0466957_0046316 3300044842 Unclassified 2640
810 Ga0466957_0201662 3300044842 Bacteria 1307
811 Ga0466959_0218973 3300045049 Bacteria 1321
812 Ga0451576_0011122 3300045051 Bacteria 10266
813 Ga0451576_0217921 3300045051 Bacteria 1993
814 Ga0451576_0357321 3300045051 Bacteria 1530
815 Ga0451576_0598233 3300045051 Bacteria 1159
816 Ga0451576_1104621 3300045051 Unclassified 830
817 Ga0451576_1311171 3300045051 Unclassified 755
818 Ga0466967_0027718 3300045976 Bacteria 4716
819 Ga0466967_0260296 3300045976 Bacteria 1660
820 Ga0466967_0756519 3300045976 Bacteria 964
821 Ga0466967_1461187 3300045976 Bacteria 681
822 Ga0495592_0068072 3300046454 Bacteria 2600
823 Ga0495592_0203842 3300046454 Bacteria 1333
824 Ga0495629_0423965 3300046459 Bacteria 903
825 Ga0495629_0587715 3300046459 Bacteria 745
826 Ga0495641_0048896 3300046461 Bacteria 1938
827 Ga0495651_0013209 3300046462 Bacteria 6385
828 Ga0495651_0041949 3300046462 Bacteria 3554
829 Ga0495651_0080755 3300046462 Unclassified 2456
830 Ga0495651_0132205 3300046462 Bacteria 1820
831 Ga0495651_0329570 3300046462 Bacteria 1015
832 Ga0495651_0431008 3300046462 Bacteria 855
833 Ga0495653_0076189 3300046463 Bacteria 2494
834 Ga0495653_0527590 3300046463 Bacteria 733
835 Ga0495580_0008844 3300046472 Bacteria 7972
836 Ga0495580_0340896 3300046472 Unclassified 1016
837 Ga0495580_0366120 3300046472 Bacteria 975
838 Ga0495580_0653807 3300046472 Bacteria 691
839 Ga0495582_0033473 3300046473 Bacteria 2825
840 Ga0495639_0343632 3300046475 Bacteria 748
841 Ga0495662_0065727 3300046476 Bacteria 1753
842 Ga0495664_0003426 3300046477 Bacteria 8625
843 Ga0495664_0022390 3300046477 Bacteria 3662
844 Ga0495664_0307837 3300046477 Bacteria 956
845 Ga0495664_0348168 3300046477 Bacteria 892
846 Ga0495584_0062085 3300046491 Bacteria 1878
847 Ga0495584_0108093 3300046491 Bacteria 1407
848 Ga0495594_0024115 3300046499 Bacteria 3265
849 Ga0495594_0031022 3300046499 Bacteria 2896
850 Ga0495594_0031466 3300046499 Bacteria 2876
851 Ga0495594_0048715 3300046499 Bacteria 2328
852 Ga0495594_0108151 3300046499 Bacteria 1567
853 Ga0495594_0229467 3300046499 Bacteria 1058
854 Ga0495607_0124645 3300046501 Bacteria 1348
855 Ga0495618_0098173 3300046514 Bacteria 1874
856 Ga0495618_0136450 3300046514 Bacteria 1569
857 Ga0495618_0186810 3300046514 Bacteria 1315
858 Ga0495618_0235306 3300046514 Bacteria 1152
859 Ga0495628_0043123 3300046516 Bacteria 3595
860 Ga0495628_0077687 3300046516 Bacteria 2582
861 Ga0495628_0115379 3300046516 Bacteria 2062
862 Ga0495628_0357407 3300046516 Bacteria 1073
863 Ga0495628_0560345 3300046516 Bacteria 819
864 Ga0495628_0575873 3300046516 Bacteria 806
865 Ga0495630_0004320 3300046517 Bacteria 9971
866 Ga0495630_0097277 3300046517 Unclassified 2226
867 Ga0495630_0297931 3300046517 Bacteria 1232
868 Ga0495630_0848481 3300046517 Unclassified 696
869 Ga0495644_0013225 3300046523 Bacteria 3170
870 Ga0495644_0066851 3300046523 Bacteria 1351
871 Ga0495663_0003118 3300046525 Bacteria 4840
872 Ga0495652_0020868 3300046529 Bacteria 5822
873 Ga0495652_0055925 3300046529 Bacteria 3354
874 Ga0495652_0266821 3300046529 Bacteria 1260
875 Ga0495665_0066744 3300046531 Bacteria 1898
876 Ga0495640_0016254 3300046533 Bacteria 5571
877 Ga0495587_0000936 3300046536 Bacteria 19195
878 Ga0495587_0008132 3300046536 Bacteria 6761
879 Ga0495587_0144889 3300046536 Bacteria 1355
880 Ga0495598_0083349 3300046537 Bacteria 1030
881 Ga0495621_0253039 3300046539 Bacteria 720
882 Ga0495645_0000329 3300046543 Bacteria 33749
883 Ga0495645_0018815 3300046543 Bacteria 4968
884 Ga0495645_0030282 3300046543 Bacteria 3941
885 Ga0495645_0307890 3300046543 Bacteria 1033
886 Ga0495645_0338272 3300046543 Bacteria 973
887 Ga0495622_0108641 3300046557 Bacteria 1270
888 Ga0495667_0009401 3300046559 Bacteria 6621
889 Ga0495667_0053026 3300046559 Bacteria 2671
890 Ga0495667_0311667 3300046559 Bacteria 996
891 Ga0495656_0006666 3300046615 Bacteria 4053
892 Ga0495656_0248589 3300046615 Bacteria 898
893 Ga0495634_0037315 3300046642 Bacteria 3321
894 Ga0495634_0049194 3300046642 Bacteria 2836
895 Ga0495635_0006056 3300046663 Bacteria 8437
896 Ga0495635_0244329 3300046663 Bacteria 1211
897 Ga0495635_0302509 3300046663 Bacteria 1072
898 Ga0495635_0611140 3300046663 Bacteria 711
899 Ga0495659_0131702 3300046664 Bacteria 992
900 Ga0495659_0144698 3300046664 Bacteria 951
901 Ga0495661_0086217 3300046665 Bacteria 1798
902 Ga0495599_0005410 3300046678 Bacteria 7627
903 Ga0495599_0075643 3300046678 Bacteria 2102
904 Ga0495599_0105760 3300046678 Bacteria 1753
905 Ga0495599_0160406 3300046678 Bacteria 1390
906 Ga0495599_0496777 3300046678 Bacteria 718
907 Ga0495623_0003472 3300046679 Bacteria 10436
908 Ga0495623_0007516 3300046679 Bacteria 7071
909 Ga0495623_0031188 3300046679 Bacteria 3428
910 Ga0495647_0009680 3300046681 Bacteria 3269
911 Ga0495658_0103681 3300046683 Bacteria 1701
912 Ga0495658_0189330 3300046683 Bacteria 1279
913 Ga0495613_0015547 3300046689 Bacteria 5660
914 Ga0495613_0160057 3300046689 Bacteria 1602
915 Ga0495624_0067199 3300046690 Bacteria 2237
916 Ga0495624_0086670 3300046690 Bacteria 1934
917 Ga0495670_0077748 3300046691 Bacteria 1687
918 Ga0495589_0061364 3300046794 Bacteria 1846
919 Ga0495600_0061701 3300046809 Bacteria 2449
920 Ga0495600_0092561 3300046809 Bacteria 1972
921 Ga0495600_0131798 3300046809 Bacteria 1625
922 Ga0495600_0273181 3300046809 Bacteria 1072
923 Ga0495600_0619844 3300046809 Bacteria 656
924 Ga0495581_0040047 3300047315 Bacteria 2713
925 Ga0495581_0104510 3300047315 Bacteria 1646
926 Ga0495604_0090450 3300047317 Unclassified 2273
927 Ga0495604_0100239 3300047317 Bacteria 2130
928 Ga0495604_0186167 3300047317 Bacteria 1449
929 Ga0495604_0232930 3300047317 Bacteria 1262
930 Ga0495604_0262911 3300047317 Unclassified 1172
931 Ga0495636_0192747 3300047318 Bacteria 928
932 Ga0495636_0401088 3300047318 Bacteria 653
933 Ga0495674_0003831 3300047319 Bacteria 14607
934 Ga0495674_0005700 3300047319 Bacteria 11933
935 Ga0495674_0205323 3300047319 Bacteria 1633
936 Ga0495676_0119954 3300047321 Bacteria 1915
937 Ga0495680_0077554 3300047322 Bacteria 2517
938 Ga0495680_0160305 3300047322 Bacteria 1634
939 Ga0495680_0170881 3300047322 Bacteria 1573
940 Ga0495680_0182447 3300047322 Bacteria 1514
941 Ga0495680_0645866 3300047322 Bacteria 704
942 Ga0495680_0713853 3300047322 Unclassified 661
943 Ga0495683_0100293 3300047323 Bacteria 1393
944 Ga0495675_0053582 3300047444 Bacteria 2561
945 Ga0495675_0138019 3300047444 Bacteria 1513
946 Ga0495675_0428257 3300047444 Bacteria 768
947 Ga0495677_0013231 3300047445 Bacteria 3003
948 Ga0495684_0006669 3300047471 Bacteria 8958
949 Ga0495684_0159119 3300047471 Bacteria 1686
950 Ga0495593_0231592 3300047673 Unclassified 926
951 Ga0495602_0021240 3300048088 Bacteria 6397
952 Ga0495602_0092043 3300048088 Bacteria 2513
953 Ga0496100_0175215 3300048903 Bacteria 1548
954 Ga0496100_0209843 3300048903 Unclassified 1424
955 Ga0496100_0277621 3300048903 Bacteria 1248
956 Ga0496100_0387000 3300048903 Bacteria 1063
957 Ga0496101_0376913 3300048904 Unclassified 1116
958 Ga0496102_0059709 3300048905 Bacteria 3488
959 Ga0496103_0315890 3300048906 Bacteria 1005
960 Ga0496104_0060246 3300048907 Unclassified 3596
961 Ga0496104_0083649 3300048907 Bacteria 3044
962 Ga0496104_0117022 3300048907 Bacteria 2558
963 Ga0496104_0217333 3300048907 Bacteria 1823
964 Ga0496105_0002488 3300048908 Bacteria 13348
965 Ga0496105_0112693 3300048908 Bacteria 2245
966 Ga0496106_0035788 3300048909 Bacteria 3713
967 Ga0496106_0185201 3300048909 Bacteria 1654
968 Ga0496106_0457742 3300048909 Bacteria 1025
969 Ga0496107_0191722 3300048910 Bacteria 1519
970 Ga0496107_0601924 3300048910 Bacteria 812
971 Ga0496108_0187161 3300048911 Bacteria 1794
972 Ga0496108_0277517 3300048911 Bacteria 1459
973 Ga0496108_0729400 3300048911 Bacteria 858
974 Ga0496109_0122143 3300048912 Bacteria 2427
975 Ga0496109_0176477 3300048912 Bacteria 2006
976 Ga0496109_0179678 3300048912 Bacteria 1987
977 Ga0496109_0383994 3300048912 Bacteria 1327
978 Ga0496110_0026074 3300048913 Bacteria 4998
979 Ga0496110_0125992 3300048913 Bacteria 2311
980 Ga0496110_0229232 3300048913 Bacteria 1689
981 Ga0496110_0345441 3300048913 Unclassified 1355
982 Ga0496110_0513429 3300048913 Bacteria 1090
983 Ga0496110_0737447 3300048913 Bacteria 888
984 Ga0496111_0000311 3300048914 Bacteria 23977
985 Ga0496112_0021496 3300048915 Bacteria 6138
986 Ga0496112_0192597 3300048915 Bacteria 2000
987 Ga0496112_0418786 3300048915 Bacteria 1278
988 Ga0496113_0065518 3300048916 Bacteria 2750
989 Ga0496113_0316621 3300048916 Bacteria 1250
990 Ga0496113_0700474 3300048916 Bacteria 808
991 Ga0496114_0452938 3300048917 Bacteria 1136
992 Ga0496114_0771404 3300048917 Bacteria 839
993 Ga0496115_0020183 3300048918 Bacteria 5137
994 Ga0496115_0028291 3300048918 Unclassified 4392
995 Ga0496115_0106354 3300048918 Bacteria 2303
996 Ga0496115_0353372 3300048918 Bacteria 1198
997 Ga0496115_1025722 3300048918 Bacteria 629
998 Ga0496118_0241029 3300048921 Bacteria 1035
999 Ga0496119_0163471 3300048922 Bacteria 1181
1000 Ga0496121_0052079 3300048924 Bacteria 3442
1001 Ga0496126_0025633 3300048929 Bacteria 5668
1002 Ga0496126_0764738 3300048929 Bacteria 744
1003 Ga0501031_0001140 3300049568 Bacteria 16170
1004 Ga0501031_0002562 3300049568 Bacteria 11583
1005 Ga0501031_0272512 3300049568 Bacteria 1099
1006 Ga0501032_0138551 3300049569 Bacteria 1603
1007 Ga0501033_0015045 3300049570 Bacteria 5871
1008 Ga0501033_0149983 3300049570 Bacteria 1682
1009 Ga0501034_0391694 3300049571 Bacteria 1313
1010 Ga0501036_0001109 3300049572 Bacteria 20452
1011 Ga0501036_0002462 3300049572 Bacteria 14510
1012 Ga0501036_0074672 3300049572 Bacteria 2868
1013 Ga0501037_0051104 3300049573 Bacteria 3023
1014 Ga0501037_0115825 3300049573 Bacteria 1929
1015 Ga0501038_0005474 3300049574 Bacteria 11793
1016 Ga0501038_0016322 3300049574 Bacteria 6732
1017 Ga0501038_0433679 3300049574 Unclassified 1012
1018 Ga0501038_0907499 3300049574 Bacteria 650
1019 Ga0501039_0000611 3300049575 Bacteria 25827
1020 Ga0501039_0000847 3300049575 Bacteria 22083
1021 Ga0501039_0124162 3300049575 Bacteria 2024
1022 Ga0501039_0808293 3300049575 Bacteria 731
1023 Ga0501040_0000181 3300049576 Bacteria 36000
1024 Ga0501040_0391052 3300049576 Bacteria 998
1025 Ga0501041_0000279 3300049577 Bacteria 24413
1026 Ga0501041_0001044 3300049577 Bacteria 15155
1027 Ga0501041_0241748 3300049577 Bacteria 1134
1028 Ga0501042_0000905 3300049578 Bacteria 16572
1029 Ga0501042_0084984 3300049578 Bacteria 2269
1030 Ga0501043_0009968 3300049579 Bacteria 7450
1031 Ga0501043_0821619 3300049579 Bacteria 671
1032 Ga0501046_0012083 3300049580 Bacteria 7362
1033 Ga0501046_0190540 3300049580 Bacteria 1530
1034 Ga0501046_0277307 3300049580 Bacteria 1229
1035 Ga0501047_0179920 3300049581 Bacteria 1981
1036 Ga0501047_0506297 3300049581 Bacteria 1034
1037 Ga0501048_0000939 3300049582 Bacteria 21540
1038 Ga0501048_0002309 3300049582 Bacteria 14558
1039 Ga0501048_0105285 3300049582 Bacteria 1991
1040 Ga0501068_0032267 3300049584 Bacteria 3114
1041 Ga0501070_0196216 3300049586 Bacteria 1658
1042 Ga0501070_0230162 3300049586 Bacteria 1519
1043 Ga0501071_0003534 3300049587 Bacteria 9777
1044 Ga0501071_0007728 3300049587 Bacteria 7089
1045 Ga0501071_0036214 3300049587 Bacteria 3518
1046 Ga0501071_0049469 3300049587 Bacteria 3027
1047 Ga0501071_0117682 3300049587 Bacteria 1968
1048 Ga0501072_0000167 3300049588 Bacteria 47771
1049 Ga0501072_0042645 3300049588 Bacteria 3564
1050 Ga0501072_0189546 3300049588 Bacteria 1640
1051 Ga0501073_0872212 3300049589 Unclassified 620
1052 Ga0501074_0004465 3300049590 Bacteria 10011
1053 Ga0501074_0031861 3300049590 Bacteria 3820
1054 Ga0501075_0000379 3300049591 Bacteria 25645
1055 Ga0501075_0002352 3300049591 Bacteria 12550
1056 Ga0501075_0075011 3300049591 Bacteria 2557
1057 Ga0501075_0089973 3300049591 Bacteria 2328
1058 Ga0501076_0000162 3300049592 Bacteria 38846
1059 Ga0501076_0000369 3300049592 Bacteria 27977
1060 Ga0501076_0016067 3300049592 Bacteria 5668
1061 Ga0501076_0018936 3300049592 Bacteria 5253
1062 Ga0501077_0012356 3300049593 Bacteria 5347
1063 Ga0501077_0245444 3300049593 Bacteria 1138
1064 Ga0501077_0418437 3300049593 Bacteria 857
1065 Ga0501202_024995 3300049652 Bacteria 1214
1066 Ga0501235_036686 3300049669 Bacteria 1115
1067 Ga0501235_038276 3300049669 Bacteria 1093
1068 Ga0501249_010200 3300049679 Bacteria 1961
1069 Ga0501079_0002956 3300049741 Bacteria 12426
1070 Ga0501079_0026542 3300049741 Bacteria 4439
1071 Ga0501079_0163399 3300049741 Bacteria 1736
1072 Ga0501080_0002596 3300049742 Bacteria 15821
1073 Ga0501080_0068160 3300049742 Bacteria 3310
1074 Ga0501080_0798156 3300049742 Bacteria 828
1075 Ga0501081_0000113 3300049743 Bacteria 34768
1076 Ga0501081_0005776 3300049743 Bacteria 8013
1077 Ga0501081_0056562 3300049743 Bacteria 2711
1078 Ga0501081_0180078 3300049743 Bacteria 1529
1079 Ga0501081_0197664 3300049743 Bacteria 1458
1080 Ga0501083_0009872 3300049744 Bacteria 6741
1081 Ga0501035_0005491 3300049822 Bacteria 11978
1082 Ga0501035_0020503 3300049822 Bacteria 6072
1083 Ga0501035_0176649 3300049822 Bacteria 1842
1084 Ga0501035_0434068 3300049822 Bacteria 1089
1085 Ga0501044_0008395 3300049823 Bacteria 11331
1086 Ga0501044_0214904 3300049823 Bacteria 1876
1087 Ga0501045_0000048 3300049824 Bacteria 52104
1088 Ga0501045_0000434 3300049824 Bacteria 25587
1089 Ga0501045_0103729 3300049824 Bacteria 2106
1090 Ga0501045_0103979 3300049824 Bacteria 2104
1091 Ga0501045_0106439 3300049824 Bacteria 2078
1092 Ga0501045_0259682 3300049824 Bacteria 1293
1093 nmdc:mga03683_2171_c1 3300050489 Bacteria 6052
1094 nmdc:mga03n38_317608_c1 3300050490 Bacteria 840
1095 nmdc:mga00v17_150723_c1 3300050491 Bacteria 1494
1096 nmdc:mga00v17_50652_c1 3300050491 Bacteria 2524
1097 nmdc:mga00v17_9898_c1 3300050491 Bacteria 5185
1098 nmdc:mga0k408_24709_c1 3300050493 Bacteria 3398
1099 nmdc:mga0k408_4495_c1 3300050493 Bacteria 7400
1100 nmdc:mga06z11_45651_c2 3300050494 Bacteria 1655
1101 nmdc:mga06z11_94713_c1 3300050494 Bacteria 1628
1102 nmdc:mga07m45_68215_c1 3300050496 Bacteria 2022
1103 nmdc:mga05p37_101671_c1 3300050507 Bacteria 3539
1104 nmdc:mga05p37_11365_c1 3300050507 Bacteria 10595
1105 nmdc:mga05p37_23337_c1 3300050507 Bacteria 7506
1106 nmdc:mga05p37_247277_c1 3300050507 Bacteria 2141
1107 nmdc:mga05p37_320439_c1 3300050507 Bacteria 1835
1108 nmdc:mga05p37_371570_c1 3300050507 Bacteria 1678
1109 nmdc:mga05p37_37516_c1 3300050507 Bacteria 5942
1110 nmdc:mga05p37_49579_c1 3300050507 Bacteria 5164
1111 nmdc:mga05p37_69222_c1 3300050507 Bacteria 4341
1112 nmdc:mga05p37_73_c1 3300050507 Bacteria 87143
1113 nmdc:mga09592_273130_c1 3300050508 Unclassified 1466
1114 nmdc:mga09592_38541_c1 3300050508 Unclassified 4012
1115 nmdc:mga09592_6310_c1 3300050508 Bacteria 9661
1116 nmdc:mga09592_664665_c1 3300050508 Bacteria 889
1117 nmdc:mga0qj67_151654_c1 3300050509 Bacteria 1880
1118 nmdc:mga0qj67_18830_c1 3300050509 Bacteria 5266
1119 nmdc:mga0qj67_295_c1 3300050509 Bacteria 34738
1120 nmdc:mga0qj67_321599_c1 3300050509 Bacteria 1252
1121 nmdc:mga0qj67_54208_c1 3300050509 Bacteria 3175
1122 nmdc:mga06r32_1247_c1 3300050510 Bacteria 22881
1123 nmdc:mga06r32_249779_c1 3300050510 Bacteria 1761
1124 nmdc:mga06r32_83989_c1 3300050510 Bacteria 3103
1125 nmdc:mga08y16_126306_c1 3300050511 Unclassified 2660
1126 nmdc:mga08y16_1290551_c1 3300050511 Bacteria 697
1127 nmdc:mga08y16_15894_c1 3300050511 Bacteria 7911
1128 nmdc:mga08y16_228767_c2 3300050511 Bacteria 1545
1129 nmdc:mga08y16_5598_c1 3300050511 Bacteria 13165
1130 nmdc:mga08y16_65540_c1 3300050511 Bacteria 3792
1131 nmdc:mga0n895_116614_c1 3300050512 Bacteria 2689
1132 nmdc:mga0n895_1175698_c1 3300050512 Bacteria 742
1133 nmdc:mga0n895_162263_c1 3300050512 Bacteria 2267
1134 nmdc:mga0n895_162361_c1 3300050512 Bacteria 2266
1135 nmdc:mga0n895_190442_c1 3300050512 Bacteria 2082
1136 nmdc:mga0n895_327549_c1 3300050512 Bacteria 1552
1137 nmdc:mga0n895_498385_c1 3300050512 Bacteria 1227
1138 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
1139 nmdc:mga0rr50_289066_c1 3300050513 Bacteria 1369
1140 nmdc:mga0rr50_430196_c1 3300050513 Bacteria 1117
1141 nmdc:mga0rr50_511665_c1 3300050513 Bacteria 1021
1142 nmdc:mga0rr50_74540_c1 3300050513 Bacteria 2598
1143 nmdc:mga08x19_113853_c1 3300050514 Unclassified 1806
1144 nmdc:mga08x19_250405_c1 3300050514 Bacteria 1223
1145 nmdc:mga08x19_311_c1 3300050514 Bacteria 35355
1146 nmdc:mga0a205_112130_c1 3300050515 Bacteria 2626
1147 nmdc:mga0a205_13997_c1 3300050515 Bacteria 5010
1148 nmdc:mga0a205_239589_c1 3300050515 Bacteria 1695
1149 nmdc:mga0a205_607259_c1 3300050515 Bacteria 947
1150 Ga0495601_0000814 3300053077 Bacteria 16892
1151 Ga0495601_0026813 3300053077 Unclassified 3560
1152 Ga0495601_0111834 3300053077 Bacteria 1769
1153 Ga0495601_0141591 3300053077 Bacteria 1569
1154 Ga0495601_0169695 3300053077 Bacteria 1426
1155 Ga0495601_0295144 3300053077 Bacteria 1056
1156 Ga0495601_0658035 3300053077 Bacteria 670
1157 Ga0495612_0153132 3300053078 Bacteria 1004
1158 Ga0495612_0156882 3300053078 Bacteria 992
1159 Ga0495612_0184201 3300053078 Unclassified 918
1160 Ga0495595_0020871 3300053084 Bacteria 2855
1161 Ga0495619_0092783 3300053085 Bacteria 2046
1162 Ga0495619_0222219 3300053085 Bacteria 1308
1163 Ga0495619_0558691 3300053085 Bacteria 785
1164 Ga0500628_007332 3300053129 Bacteria 1888
1165 Ga0500573_0250175 3300053140 Unclassified 914
1166 Ga0501084_0001506 3300054114 Bacteria 18475
1167 Ga0501084_0088485 3300054114 Bacteria 2600
1168 Ga0501084_0162429 3300054114 Bacteria 1885
1169 Ga0590074_030614 3300059423 Bacteria 950
1170 Ga0590077_003121 3300059426 Bacteria 3467
1171 Ga0587084_010970 3300059477 Bacteria 1198
1172 Ga0501082_0002405 3300060353 Bacteria 16414
1173 Ga0501082_0030474 3300060353 Bacteria 4648
1174 Ga0501082_0121847 3300060353 Bacteria 2261
1175 Ga0501082_0451203 3300060353 Bacteria 1124
1176 Ga0501082_0464553 3300060353 Bacteria 1106
1177 Ga0501082_1055764 3300060353 Bacteria 710
1178 Ga0530510_0001043 3300061734 Bacteria 18333
1179 Ga0530510_0025200 3300061734 Bacteria 4252
1180 Ga0530510_0095625 3300061734 Bacteria 2170
1181 Ga0530510_0360175 3300061734 Bacteria 1093
1182 2513723079 2513237104 Bacteria 10034502
1183 Ga0207670_10560662
1184 MBSR1b_contig_3986932
1185 rootH2_10198595
1186 Ga0065712_10111273
1187 Ga0065712_10227585
1188 Ga0065715_10123992
1189 Ga0065715_10145971
1190 Ga0065707_10114551
1191 Ga0065707_10124965
1192 Ga0065707_10623721
1193 Ga0070676_10022501
1194 Ga0070683_100000285
1195 Ga0070683_100000885
1196 Ga0070683_100457824
1197 Ga0070690_100198575
1198 Ga0070690_100219435
1199 Ga0070670_100115259
1200 Ga0070670_101192749
1201 Ga0070670_101223154
1202 Ga0070680_100032407
1203 Ga0070680_100033912
1204 Ga0070680_100079500
1205 Ga0070680_100569918
1206 Ga0068868_100321709
1207 Ga0068868_100764613
1208 Ga0070689_100000097
1209 Ga0070689_100045297
1210 Ga0070689_100076039
1211 Ga0070691_10000311
1212 Ga0070691_10319055
1213 Ga0070691_10330130
1214 Ga0070687_100040318
1215 Ga0070661_100020968
1216 Ga0070692_10063869
1217 Ga0070692_10198624
1218 Ga0070692_10292257
1219 Ga0070668_100006373
1220 Ga0070668_100009927
1221 Ga0070668_100121302
1222 Ga0070669_100008994
1223 Ga0070669_100010632
1224 Ga0070669_100031415
1225 Ga0070669_100173602
1226 Ga0070675_100623882
1227 Ga0070675_101081867
1228 Ga0070671_100006892
1229 Ga0070671_100401932
1230 Ga0070671_100918270
1231 Ga0070674_100184176
1232 Ga0070674_100330597
1233 Ga0070673_100110108
1234 Ga0070673_100676168
1235 Ga0070688_100000331
1236 Ga0070688_100365484
1237 Ga0070688_100719393
1238 Ga0070659_100221997
1239 Ga0070667_100028146
1240 Ga0070667_100679636
1241 Ga0070667_100777973
1242 Ga0070709_10010582
1243 Ga0070709_10014499
1244 Ga0070709_10149359
1245 Ga0070709_10166502
1246 Ga0070714_100027756
1247 Ga0070714_100092496
1248 Ga0070714_100116478
1249 Ga0070714_100147307
1250 Ga0070714_100169619
1251 Ga0070714_100525394
1252 Ga0070714_100584890
1253 Ga0070713_100000652
1254 Ga0070713_100006798
1255 Ga0070713_100014331
1256 Ga0070713_100021942
1257 Ga0070713_100056483
1258 Ga0070713_100073704
1259 Ga0070713_100095141
1260 Ga0070713_100169079
1261 Ga0070713_100237810
1262 Ga0070713_100238354
1263 Ga0070713_100689425
1264 Ga0070710_10019985
1265 Ga0070710_10113917
1266 Ga0070710_10152228
1267 Ga0070710_10170815
1268 Ga0070701_10590171
1269 Ga0070711_100001160
1270 Ga0070711_100004773
1271 Ga0070711_100010993
1272 Ga0070711_100016541
1273 Ga0070711_100577215
1274 Ga0070711_100712998
1275 Ga0070705_100014030
1276 Ga0070705_100063181
1277 Ga0070705_100408827
1278 Ga0070700_100004714
1279 Ga0070700_100262953
1280 Ga0070700_100433722
1281 Ga0070700_100863394
1282 Ga0070694_100179358
1283 Ga0070694_100708600
1284 Ga0070694_101177493
1285 Ga0070708_100000011
1286 Ga0070708_100049356
1287 Ga0070708_100051450
1288 Ga0070708_100061977
1289 Ga0070708_100152387
1290 Ga0070708_100323002
1291 Ga0070663_100121970
1292 Ga0070662_100033401
1293 Ga0070662_100062454
1294 Ga0070662_100320008
1295 Ga0070681_10001001
1296 Ga0070681_10021576
1297 Ga0070681_10065204
1298 Ga0070681_10110890
1299 Ga0070681_10664202
1300 Ga0068867_100017645
1301 Ga0068867_100029757
1302 Ga0068867_100881280
1303 Ga0070685_10031643
1304 Ga0070685_10588778
1305 Ga0070706_100005169
1306 Ga0070706_100026602
1307 Ga0070706_100040746
1308 Ga0070706_100052542
1309 Ga0070707_100108697
1310 Ga0070707_100109797
1311 Ga0070707_100119166
1312 Ga0070707_100292462
1313 Ga0070707_100316783
1314 Ga0070707_100336724
1315 Ga0070707_100495991
1316 Ga0070707_100501585
1317 Ga0070707_101008295
1318 Ga0070698_100007599
1319 Ga0070698_100061946
1320 Ga0070698_100131771
1321 Ga0070698_100143391
1322 Ga0070698_100260561
1323 Ga0070698_100418818
1324 Ga0070698_100441858
1325 Ga0070698_100465619
1326 Ga0070698_100475518
1327 Ga0070698_100864887
1328 Ga0070698_101147414
1329 Ga0070699_100001465
1330 Ga0070699_100011744
1331 Ga0070699_100041970
1332 Ga0070699_100048893
1333 Ga0070699_100119111
1334 Ga0070699_100162453
1335 Ga0070699_100177367
1336 Ga0070699_100385441
1337 Ga0070699_100725767
1338 Ga0070679_100006936
1339 Ga0070679_100016478
1340 Ga0070679_100176249
1341 Ga0070684_100002974
1342 Ga0070684_100032801
1343 Ga0070684_100044962
1344 Ga0070684_100304938
1345 Ga0070684_100319971
1346 Ga0070684_100829755
1347 Ga0070697_100011432
1348 Ga0070697_100058542
1349 Ga0070697_100067666
1350 Ga0070697_100454683
1351 Ga0070697_100646586
1352 Ga0068853_100260917
1353 Ga0070672_100029846
1354 Ga0070672_100039794
1355 Ga0070672_100099084
1356 Ga0070672_100290360
1357 Ga0070672_100784287
1358 Ga0070686_100155207
1359 Ga0070686_100503922
1360 Ga0070695_100002602
1361 Ga0070696_100015489
1362 Ga0070696_100035051
1363 Ga0070696_101193998
1364 Ga0070693_100133143
1365 Ga0070704_100008355
1366 Ga0070704_100918572
1367 Ga0068855_100149447
1368 Ga0068855_100374073
1369 Ga0068855_100672466
1370 Ga0070664_100064215
1371 Ga0070664_100162795
1372 Ga0070664_100288604
1373 Ga0070664_100421363
1374 Ga0070664_100949999
1375 Ga0068857_100006115
1376 Ga0068857_100028102
1377 Ga0068857_101437586
1378 Ga0068854_100451228
1379 Ga0068854_100481043
1380 Ga0068854_100591721
1381 Ga0068856_100002563
1382 Ga0068856_100215639
1383 Ga0068856_101278035
1384 Ga0070702_100002995
1385 Ga0068852_100033298
1386 Ga0068859_100042980
1387 Ga0068859_100711221
1388 Ga0068864_100092584
1389 Ga0068864_100218126
1390 Ga0068864_100549589
1391 Ga0068861_100137588
1392 Ga0068861_100238401
1393 Ga0068863_100000908
1394 Ga0068863_100674922
1395 Ga0068863_100946958
1396 Ga0068863_100952967
1397 Ga0068858_100105360
1398 Ga0068858_100677679
1399 Ga0068858_100991778
1400 Ga0068860_100053850
1401 Ga0068860_100060582
1402 Ga0068860_100479555
1403 Ga0068862_100000825
1404 Ga0081455_10073317
1405 Ga0081455_10120184
1406 Ga0081538_10005103
1407 Ga0081538_10058510
1408 Ga0081539_10003032
1409 Ga0081539_10066354
1410 Ga0081539_10305735
1411 Ga0070717_10007152
1412 Ga0070717_10011548
1413 Ga0070717_10029455
1414 Ga0070717_10040442
1415 Ga0070717_10072343
1416 Ga0070717_10122669
1417 Ga0070717_10253466
1418 Ga0070717_10363866
1419 Ga0070717_10671644
1420 Ga0070717_10690742
1421 Ga0070717_10940368
1422 Ga0070717_11188645
1423 Ga0075368_10035707
1424 Ga0075364_10009943
1425 Ga0075364_10050996
1426 Ga0075364_10285451
1427 Ga0070715_10003272
1428 Ga0070715_10006430
1429 Ga0070715_10065527
1430 Ga0070716_100012863
1431 Ga0070716_100057385
1432 Ga0070716_100085772
1433 Ga0070716_100365074
1434 Ga0070716_100770581
1435 Ga0070716_100908641
1436 Ga0070712_100002509
1437 Ga0070712_100002786
1438 Ga0070712_100154314
1439 Ga0070712_100467107
1440 Ga0070712_100650627
1441 Ga0075362_10003235
1442 Ga0075367_10025633
1443 Ga0075367_10027307
1444 Ga0075366_10044372
1445 Ga0097621_100006910
1446 Ga0097621_100106784
1447 Ga0097621_100240621
1448 Ga0075370_10079271
1449 Ga0068871_100907182
1450 Ga0075428_100057162
1451 Ga0075428_100163953
1452 Ga0075428_100291678
1453 Ga0075428_100773785
1454 Ga0075430_100013818
1455 Ga0075430_100093531
1456 Ga0075430_100223245
1457 Ga0075430_100322310
1458 Ga0075430_100566279
1459 Ga0075431_100136884
1460 Ga0075431_100155525
1461 Ga0075431_100262096
1462 Ga0075431_100344092
1463 Ga0075433_10014954
1464 Ga0075433_10111250
1465 Ga0075433_10127741
1466 Ga0075433_10150613
1467 Ga0075433_10881344
1468 Ga0075434_100000451
1469 Ga0075434_100018027
1470 Ga0075434_100020202
1471 Ga0075434_100159251
1472 Ga0075434_100160874
1473 Ga0075434_100219315
1474 Ga0075434_100469607
1475 Ga0075434_100521139
1476 Ga0075434_101067696
1477 Ga0075429_100051881
1478 Ga0075429_100086007
1479 Ga0075429_100495056
1480 Ga0075429_100554595
1481 Ga0068865_100036113
1482 Ga0068865_100080123
1483 Ga0068865_100175854
1484 Ga0075436_100000203
1485 Ga0097620_100042978
1486 Ga0097620_100656304
1487 Ga0097620_100711313
1488 Ga0075435_100000012
1489 Ga0075435_100131120
1490 Ga0075435_100251014
1491 Ga0075435_100344506
1492 Ga0075435_100609683
1493 Ga0099794_10052262
1494 Ga0105240_10037867
1495 Ga0105240_10099581
1496 Ga0105240_10211946
1497 Ga0105240_10445109
1498 Ga0105240_10855540
1499 Ga0111539_10008520
1500 Ga0111539_10010938
1501 Ga0111539_10023712
1502 Ga0111539_10036591
1503 Ga0111539_10055948
1504 Ga0111539_10292196
1505 Ga0111539_10697814
1506 Ga0111539_10997450
1507 Ga0111539_11021357
1508 Ga0105245_10585683
1509 Ga0105247_10079189
1510 Ga0114129_10008502
1511 Ga0114129_10021385
1512 Ga0114129_10023980
1513 Ga0114129_10033927
1514 Ga0114129_10057157
1515 Ga0114129_10100063
1516 Ga0114129_10161848
1517 Ga0114129_10170822
1518 Ga0114129_10207198
1519 Ga0114129_10249459
1520 Ga0114129_10276140
1521 Ga0114129_10569839
1522 Ga0114129_10664052
1523 Ga0114129_10911080
1524 Ga0105241_10424749
1525 Ga0105242_10023415
1526 Ga0105242_10177354
1527 Ga0105242_11110899
1528 Ga0105248_10018116
1529 Ga0105248_10039701
1530 Ga0105248_10185947
1531 Ga0105248_10270063
1532 Ga0105248_10391189
1533 Ga0105248_10598732
1534 Ga0105248_11129416
1535 Ga0105237_10119496
1536 Ga0105237_10423602
1537 Ga0105237_11127626
1538 Ga0105238_10030121
1539 Ga0105238_10089705
1540 Ga0105238_10114136
1541 Ga0105238_10591951
1542 Ga0105249_10000665
1543 Ga0105249_10005149
1544 Ga0105249_10854241
1545 Ga0105249_10859848
1546 Ga0105239_11210975
1547 Ga0105246_10362348
1548 Ga0105246_10462495
1549 Ga0105246_10586793
1550 Ga0105246_10634169
1551 Ga0157346_1005414
1552 Ga0157371_10016487
1553 Ga0157370_10000316
1554 Ga0157370_10275558
1555 Ga0157370_10358347
1556 Ga0157369_10002654
1557 Ga0157369_10011644
1558 Ga0157369_10020021
1559 Ga0157369_10140537
1560 Ga0157369_10420812
1561 Ga0157374_10404408
1562 Ga0157374_10487487
1563 Ga0157374_10836252
1564 Ga0157378_10110887
1565 Ga0157378_10557879
1566 Ga0157378_10875750
1567 Ga0163162_10014068
1568 Ga0163162_10135363
1569 Ga0163162_10220991
1570 Ga0157372_10003848
1571 Ga0157372_10411739
1572 Ga0157375_10007743
1573 Ga0157375_10141692
1574 Ga0157375_10190741
1575 Ga0157375_10226402
1576 Ga0157375_10269570
1577 Ga0157375_10840441
1578 Ga0157375_11456914
1579 Ga0157375_11859372
1580 Ga0163163_10000017
1581 Ga0163163_10445224
1582 Ga0163163_10544211
1583 Ga0163163_10691813
1584 Ga0163163_11044961
1585 Ga0157380_10006923
1586 Ga0157380_10948282
1587 Ga0157380_11674850
1588 Ga0157377_10010222
1589 Ga0157377_10122749
1590 Ga0157379_10047690
1591 Ga0157379_10049003
1592 Ga0163161_10198470
1593 Ga0197907_10710089
1594 Ga0206356_10680555
1595 Ga0206349_1837458
1596 Ga0206351_10564219
1597 Ga0206354_11435900
1598 Ga0206353_11539969
1599 Ga0213876_10269606
1600 Ga0213876_10273202
1601 Ga0224712_10009247
1602 Ga0224712_10018351
1603 Ga0228598_1002744
1604 Ga0207697_10004143
1605 Ga0207682_10048231
1606 Ga0207692_10046021
1607 Ga0207692_10088359
1608 Ga0207692_10248120
1609 Ga0207710_10143408
1610 Ga0207688_10088773
1611 Ga0207685_10009413
1612 Ga0207685_10022188
1613 Ga0207699_10016009
1614 Ga0207699_10018311
1615 Ga0207699_10337245
1616 Ga0207645_10000951
1617 Ga0207684_10001709
1618 Ga0207684_10013136
1619 Ga0207684_10021919
1620 Ga0207684_10046428
1621 Ga0207684_10047401
1622 Ga0207684_10082242
1623 Ga0207684_10626605
1624 Ga0207707_10012200
1625 Ga0207707_10016072
1626 Ga0207707_10154790
1627 Ga0207707_10623480
1628 Ga0207707_10960272
1629 Ga0207695_10055205
1630 Ga0207695_10365071
1631 Ga0207671_10152266
1632 Ga0207693_10002323
1633 Ga0207693_10003126
1634 Ga0207693_10009038
1635 Ga0207693_10033877
1636 Ga0207693_10073386
1637 Ga0207693_10115182
1638 Ga0207693_10304452
1639 Ga0207693_10337040
1640 Ga0207693_10410322
1641 Ga0207663_10000275
1642 Ga0207663_10001046
1643 Ga0207663_10004310
1644 Ga0207663_10035038
1645 Ga0207663_10120740
1646 Ga0207663_10208778
1647 Ga0207660_10025592
1648 Ga0207660_10047006
1649 Ga0207662_10005032
1650 Ga0207662_10171795
1651 Ga0207657_10505701
1652 Ga0207649_10211211
1653 Ga0207649_10251690
1654 Ga0207652_10023916
1655 Ga0207652_10321010
1656 Ga0207646_10005883
1657 Ga0207646_10025817
1658 Ga0207646_10054282
1659 Ga0207646_10055008
1660 Ga0207646_10063768
1661 Ga0207646_10070675
1662 Ga0207646_10073151
1663 Ga0207646_10084425
1664 Ga0207646_10090980
1665 Ga0207646_10190967
1666 Ga0207681_10022135
1667 Ga0207681_10069430
1668 Ga0207681_10189130
1669 Ga0207694_10038610
1670 Ga0207694_10097241
1671 Ga0207694_10302680
1672 Ga0207694_10420321
1673 Ga0207650_10573581
1674 Ga0207659_10736166
1675 Ga0207700_10000856
1676 Ga0207700_10002332
1677 Ga0207700_10002921
1678 Ga0207700_10019902
1679 Ga0207700_10020055
1680 Ga0207700_10025563
1681 Ga0207700_10052889
1682 Ga0207700_10071210
1683 Ga0207700_10136102
1684 Ga0207700_10351628
1685 Ga0207700_10417653
1686 Ga0207700_10730181
1687 Ga0207664_10000532
1688 Ga0207664_10450250
1689 Ga0207664_11173270
1690 Ga0207706_10001737
1691 Ga0207706_10012184
1692 Ga0207706_10067629
1693 Ga0207706_10625955
1694 Ga0207706_11039974
1695 Ga0207686_10097756
1696 Ga0207670_10000034
1697 Ga0207670_10203545
1698 Ga0207670_10207932
1699 Ga0207669_10491822
1700 Ga0207669_10838778
1701 Ga0207704_10029935
1702 Ga0207665_10000132
1703 Ga0207665_10000500
1704 Ga0207665_10062371
1705 Ga0207665_10114808
1706 Ga0207665_10160474
1707 Ga0207665_10227406
1708 Ga0207665_10915203
1709 Ga0207691_10000366
1710 Ga0207691_10001194
1711 Ga0207691_10037285
1712 Ga0207691_10231614
1713 Ga0207691_10639279
1714 Ga0207691_10833080
1715 Ga0207689_10141974
1716 Ga0207689_10375498
1717 Ga0207661_10000208
1718 Ga0207661_10035976
1719 Ga0207661_10038493
1720 Ga0207661_10335798
1721 Ga0207661_10648445
1722 Ga0207679_10046679
1723 Ga0207679_10153895
1724 Ga0207679_10203353
1725 Ga0207679_11121931
1726 Ga0207667_10174128
1727 Ga0207667_10409645
1728 Ga0207667_10452182
1729 Ga0207667_10753171
1730 Ga0207667_11374379
1731 Ga0207651_10619921
1732 Ga0207712_10000812
1733 Ga0207712_10095413
1734 Ga0207712_10375331
1735 Ga0207668_10002276
1736 Ga0207668_10006808
1737 Ga0207668_10217143
1738 Ga0207668_11324048
1739 Ga0207658_10382666
1740 Ga0207658_10734297
1741 Ga0207703_10515851
1742 Ga0207703_10640198
1743 Ga0207639_10009125
1744 Ga0207678_10016479
1745 Ga0207678_10535199
1746 Ga0207708_10056420
1747 Ga0207702_10007569
1748 Ga0207702_10240791
1749 Ga0207641_10102831
1750 Ga0207641_10364385
1751 Ga0207641_10520857
1752 Ga0207674_10000861
1753 Ga0207674_10008925
1754 Ga0207675_100000964
1755 Ga0207675_100001025
1756 Ga0209588_1059709
1757 Ga0207428_10001806
1758 Ga0207428_10007234
1759 Ga0207428_10036298
1760 Ga0268265_10000988
1761 Ga0268265_10012737
1762 Ga0268264_10104635
1763 Ga0268264_10382810
1764 Ga0268264_10637296
1765 Ga0265760_10051984
1766 Ga0265760_10057422
1767 Ga0265320_10027751
1768 Ga0265339_10030317
1769 Ga0265331_10050889
1770 Ga0265316_10330244
1771 Ga0265316_10446065
1772 Ga0307408_100029948
1773 Ga0307408_100033033
1774 Ga0307408_100076198
1775 Ga0307408_100087670
1776 Ga0307408_100240060
1777 Ga0307408_100462707
1778 Ga0265314_10032227
1779 Ga0265314_10091863
1780 Ga0265314_10294785
1781 Ga0265342_10013220
1782 Ga0307405_10002927
1783 Ga0307405_10003773
1784 Ga0307405_10004305
1785 Ga0307405_10068469
1786 Ga0307405_10093298
1787 Ga0307405_10169603
1788 Ga0307405_10894460
1789 Ga0307413_10010169
1790 Ga0307413_10055539
1791 Ga0307413_10064097
1792 Ga0307413_10076450
1793 Ga0307413_10265362
1794 Ga0307413_10350941
1795 Ga0307413_10531066
1796 Ga0307413_10615232
1797 Ga0307413_10986246
1798 Ga0307410_10013501
1799 Ga0307410_10040909
1800 Ga0307410_10054250
1801 Ga0307410_10372841
1802 Ga0307406_10004089
1803 Ga0307406_10007555
1804 Ga0307406_10023649
1805 Ga0307406_10068609
1806 Ga0307406_10175172
1807 Ga0307406_10407275
1808 Ga0307406_11053263
1809 Ga0307407_10003810
1810 Ga0307407_10029087
1811 Ga0307407_10035076
1812 Ga0307407_10037551
1813 Ga0307407_10185325
1814 Ga0307407_10211017
1815 Ga0307407_10436215
1816 Ga0307407_10542824
1817 Ga0307407_10717640
1818 Ga0307412_10002806
1819 Ga0307412_10020973
1820 Ga0307412_10041113
1821 Ga0307412_10041986
1822 Ga0307412_10100878
1823 Ga0307412_10215917
1824 Ga0307409_100000761
1825 Ga0307409_100001388
1826 Ga0307409_100006134
1827 Ga0307409_100012489
1828 Ga0307409_100017504
1829 Ga0307409_100084250
1830 Ga0307409_100085926
1831 Ga0307409_100089329
1832 Ga0307409_100234861
1833 Ga0307409_100264412
1834 Ga0307409_100437078
1835 Ga0307409_100953164
1836 Ga0307409_101005625
1837 Ga0307416_100004401
1838 Ga0307416_100023480
1839 Ga0307416_100033012
1840 Ga0307416_100038735
1841 Ga0307416_100079211
1842 Ga0307416_100102603
1843 Ga0307416_100128701
1844 Ga0307416_100186020
1845 Ga0307416_100230827
1846 Ga0307416_100370200
1847 Ga0307416_101037048
1848 Ga0307414_10009483
1849 Ga0307414_10043402
1850 Ga0307414_10048949
1851 Ga0307414_10059050
1852 Ga0307414_10073267
1853 Ga0307411_10006054
1854 Ga0307411_10038193
1855 Ga0307411_10038228
1856 Ga0307411_10066479
1857 Ga0307411_10093297
1858 Ga0307411_10101883
1859 Ga0307411_10198207
1860 Ga0307411_10604906
1861 Ga0307411_10980833
1862 Ga0307415_100001794
1863 Ga0307415_100006110
1864 Ga0307415_100054315
1865 Ga0307415_100062237
1866 Ga0307415_100141469
1867 Ga0307415_100171485
1868 Ga0307415_100200973
1869 Ga0373926_0031477
1870 Ga0373926_0131558
1871 Ga0373934_0010626
1872 Ga0373934_0038725
1873 Ga0373934_0253507
1874 Ga0373944_0055787
1875 Ga0373944_0185753
1876 Ga0373923_0004878
1877 Ga0373923_0051721
1878 Ga0373936_0000390
1879 Ga0373936_0064675
1880 Ga0373936_0217214
1881 Ga0373939_0256049
1882 Ga0373941_0025679
1883 Ga0373945_0009002
1884 Ga0373953_0065589
1885 Ga0373953_0090854
1886 Ga0373953_0097404
1887 Ga0373953_0116800
1888 Ga0373954_0003568
1889 Ga0373954_0136756
1890 Ga0373956_0006456
1891 Ga0373956_0014240
1892 Ga0373956_0019987
1893 Ga0373956_0028031
1894 Ga0373956_0270232
1895 Ga0373957_0022916
1896 Ga0373957_0056337
1897 Ga0373943_0000092
1898 Ga0373943_0014821
1899 Ga0373946_0002787
1900 Ga0373946_0055569
1901 Ga0373955_0000623
1902 Ga0373955_0023694
1903 Ga0373955_0032780
1904 Ga0373955_0044477
1905 Ga0373955_0139993
1906 Ga0373955_0291209
1907 Ga0373961_0194908
1908 Ga0373924_0001882
1909 Ga0373924_0026409
1910 Ga0373924_0054813
1911 Ga0373931_0330755
1912 Ga0373935_0001269
1913 Ga0373935_0010177
1914 Ga0373927_0000056
1915 Ga0373927_0038950
1916 Ga0373927_0482037
1917 Ga0373933_0005072
1918 Ga0373933_0005627
1919 Ga0373933_0071916
1920 Ga0373933_0195326
1921 Ga0373933_0239725
1922 Ga0373947_0000369
1923 Ga0373947_0008457
1924 Ga0373947_0505579
1925 Ga0373937_0002023
1926 Ga0373937_0002809
1927 Ga0373937_0012977
1928 Ga0373937_0036193
1929 Ga0373937_0109659
1930 Ga0373937_0113489
1931 Ga0373937_0225097
1932 Ga0373937_0263540
1933 Ga0373937_0280241
1934 Ga0373937_0339178
1935 Ga0373937_0524823
1936 Ga0373937_0634962
1937 Ga0373925_0004133
1938 Ga0373925_0004354
1939 Ga0373925_0133698
1940 Ga0373925_0395427
1941 Ga0373925_0557763
1942 Ga0395899_0031700
1943 Ga0395900_0052532
1944 Ga0395900_0100054
1945 Ga0395900_0575422
1946 Ga0395900_0814860
1947 Ga0395898_0029897
1948 Ga0395898_0144484
1949 Ga0395898_0600278
1950 Ga0395905_0085910
1951 Ga0395905_0232810
1952 Ga0395905_0290842
1953 Ga0436364_0678490
1954 Ga0395901_0009601
1955 Ga0395901_0275558
1956 Ga0395901_0342879
1957 Ga0395901_0491724
1958 Ga0436365_0110548
1959 Ga0436365_0523105
1960 Ga0436365_0833863
1961 Ga0436365_1827462
1962 Ga0436360_0502764
1963 Ga0436363_0068089
1964 Ga0439453_0019411
1965 Ga0439453_0059850
1966 Ga0439466_0152783
1967 Ga0451853_1519401
1968 Ga0439443_000597
1969 Ga0439443_002666
1970 Ga0439448_0008249
1971 Ga0439448_0011276
1972 Ga0439448_0040467
1973 Ga0439450_000393
1974 Ga0439454_001848
1975 Ga0439462_0035338
1976 Ga0439463_002823
1977 Ga0450914_022728
1978 Ga0450891_011340
1979 Ga0450900_000212
1980 Ga0450904_008991
1981 Ga0439435_0096030
1982 Ga0439435_0138778
1983 Ga0439460_0000651
1984 Ga0439460_0071462
1985 Ga0439440_0000294
1986 Ga0453683_0086775
1987 Ga0466963_0151990
1988 Ga0466963_0430429
1989 Ga0466963_0434921
1990 Ga0466970_0070601
1991 Ga0466957_0046316
1992 Ga0466957_0201662
1993 Ga0466959_0218973
1994 Ga0451576_0011122
1995 Ga0451576_0217921
1996 Ga0451576_0357321
1997 Ga0451576_0598233
1998 Ga0451576_1104621
1999 Ga0451576_1311171
2000 Ga0466967_0027718
2001 Ga0466967_0260296
2002 Ga0466967_0756519
2003 Ga0466967_1461187
2004 Ga0495592_0068072
2005 Ga0495592_0203842
2006 Ga0495629_0423965
2007 Ga0495629_0587715
2008 Ga0495641_0048896
2009 Ga0495651_0013209
2010 Ga0495651_0041949
2011 Ga0495651_0080755
2012 Ga0495651_0132205
2013 Ga0495651_0329570
2014 Ga0495651_0431008
2015 Ga0495653_0076189
2016 Ga0495653_0527590
2017 Ga0495580_0008844
2018 Ga0495580_0340896
2019 Ga0495580_0366120
2020 Ga0495580_0653807
2021 Ga0495582_0033473
2022 Ga0495639_0343632
2023 Ga0495662_0065727
2024 Ga0495664_0003426
2025 Ga0495664_0022390
2026 Ga0495664_0307837
2027 Ga0495664_0348168
2028 Ga0495584_0062085
2029 Ga0495584_0108093
2030 Ga0495594_0024115
2031 Ga0495594_0031022
2032 Ga0495594_0031466
2033 Ga0495594_0048715
2034 Ga0495594_0108151
2035 Ga0495594_0229467
2036 Ga0495607_0124645
2037 Ga0495618_0098173
2038 Ga0495618_0136450
2039 Ga0495618_0186810
2040 Ga0495618_0235306
2041 Ga0495628_0043123
2042 Ga0495628_0077687
2043 Ga0495628_0115379
2044 Ga0495628_0357407
2045 Ga0495628_0560345
2046 Ga0495628_0575873
2047 Ga0495630_0004320
2048 Ga0495630_0097277
2049 Ga0495630_0297931
2050 Ga0495630_0848481
2051 Ga0495644_0013225
2052 Ga0495644_0066851
2053 Ga0495663_0003118
2054 Ga0495652_0020868
2055 Ga0495652_0055925
2056 Ga0495652_0266821
2057 Ga0495665_0066744
2058 Ga0495640_0016254
2059 Ga0495587_0000936
2060 Ga0495587_0008132
2061 Ga0495587_0144889
2062 Ga0495598_0083349
2063 Ga0495621_0253039
2064 Ga0495645_0000329
2065 Ga0495645_0018815
2066 Ga0495645_0030282
2067 Ga0495645_0307890
2068 Ga0495645_0338272
2069 Ga0495622_0108641
2070 Ga0495667_0009401
2071 Ga0495667_0053026
2072 Ga0495667_0311667
2073 Ga0495656_0006666
2074 Ga0495656_0248589
2075 Ga0495634_0037315
2076 Ga0495634_0049194
2077 Ga0495635_0006056
2078 Ga0495635_0244329
2079 Ga0495635_0302509
2080 Ga0495635_0611140
2081 Ga0495659_0131702
2082 Ga0495659_0144698
2083 Ga0495661_0086217
2084 Ga0495599_0005410
2085 Ga0495599_0075643
2086 Ga0495599_0105760
2087 Ga0495599_0160406
2088 Ga0495599_0496777
2089 Ga0495623_0003472
2090 Ga0495623_0007516
2091 Ga0495623_0031188
2092 Ga0495647_0009680
2093 Ga0495658_0103681
2094 Ga0495658_0189330
2095 Ga0495613_0015547
2096 Ga0495613_0160057
2097 Ga0495624_0067199
2098 Ga0495624_0086670
2099 Ga0495670_0077748
2100 Ga0495589_0061364
2101 Ga0495600_0061701
2102 Ga0495600_0092561
2103 Ga0495600_0131798
2104 Ga0495600_0273181
2105 Ga0495600_0619844
2106 Ga0495581_0040047
2107 Ga0495581_0104510
2108 Ga0495604_0090450
2109 Ga0495604_0100239
2110 Ga0495604_0186167
2111 Ga0495604_0232930
2112 Ga0495604_0262911
2113 Ga0495636_0192747
2114 Ga0495636_0401088
2115 Ga0495674_0003831
2116 Ga0495674_0005700
2117 Ga0495674_0205323
2118 Ga0495676_0119954
2119 Ga0495680_0077554
2120 Ga0495680_0160305
2121 Ga0495680_0170881
2122 Ga0495680_0182447
2123 Ga0495680_0645866
2124 Ga0495680_0713853
2125 Ga0495683_0100293
2126 Ga0495675_0053582
2127 Ga0495675_0138019
2128 Ga0495675_0428257
2129 Ga0495677_0013231
2130 Ga0495684_0006669
2131 Ga0495684_0159119
2132 Ga0495593_0231592
2133 Ga0495602_0021240
2134 Ga0495602_0092043
2135 Ga0496100_0175215
2136 Ga0496100_0209843
2137 Ga0496100_0277621
2138 Ga0496100_0387000
2139 Ga0496101_0376913
2140 Ga0496102_0059709
2141 Ga0496103_0315890
2142 Ga0496104_0060246
2143 Ga0496104_0083649
2144 Ga0496104_0117022
2145 Ga0496104_0217333
2146 Ga0496105_0002488
2147 Ga0496105_0112693
2148 Ga0496106_0035788
2149 Ga0496106_0185201
2150 Ga0496106_0457742
2151 Ga0496107_0191722
2152 Ga0496107_0601924
2153 Ga0496108_0187161
2154 Ga0496108_0277517
2155 Ga0496108_0729400
2156 Ga0496109_0122143
2157 Ga0496109_0176477
2158 Ga0496109_0179678
2159 Ga0496109_0383994
2160 Ga0496110_0026074
2161 Ga0496110_0125992
2162 Ga0496110_0229232
2163 Ga0496110_0345441
2164 Ga0496110_0513429
2165 Ga0496110_0737447
2166 Ga0496111_0000311
2167 Ga0496112_0021496
2168 Ga0496112_0192597
2169 Ga0496112_0418786
2170 Ga0496113_0065518
2171 Ga0496113_0316621
2172 Ga0496113_0700474
2173 Ga0496114_0452938
2174 Ga0496114_0771404
2175 Ga0496115_0020183
2176 Ga0496115_0028291
2177 Ga0496115_0106354
2178 Ga0496115_0353372
2179 Ga0496115_1025722
2180 Ga0496118_0241029
2181 Ga0496119_0163471
2182 Ga0496121_0052079
2183 Ga0496126_0025633
2184 Ga0496126_0764738
2185 Ga0501031_0001140
2186 Ga0501031_0002562
2187 Ga0501031_0272512
2188 Ga0501032_0138551
2189 Ga0501033_0015045
2190 Ga0501033_0149983
2191 Ga0501034_0391694
2192 Ga0501036_0001109
2193 Ga0501036_0002462
2194 Ga0501036_0074672
2195 Ga0501037_0051104
2196 Ga0501037_0115825
2197 Ga0501038_0005474
2198 Ga0501038_0016322
2199 Ga0501038_0433679
2200 Ga0501038_0907499
2201 Ga0501039_0000611
2202 Ga0501039_0000847
2203 Ga0501039_0124162
2204 Ga0501039_0808293
2205 Ga0501040_0000181
2206 Ga0501040_0391052
2207 Ga0501041_0000279
2208 Ga0501041_0001044
2209 Ga0501041_0241748
2210 Ga0501042_0000905
2211 Ga0501042_0084984
2212 Ga0501043_0009968
2213 Ga0501043_0821619
2214 Ga0501046_0012083
2215 Ga0501046_0190540
2216 Ga0501046_0277307
2217 Ga0501047_0179920
2218 Ga0501047_0506297
2219 Ga0501048_0000939
2220 Ga0501048_0002309
2221 Ga0501048_0105285
2222 Ga0501068_0032267
2223 Ga0501070_0196216
2224 Ga0501070_0230162
2225 Ga0501071_0003534
2226 Ga0501071_0007728
2227 Ga0501071_0036214
2228 Ga0501071_0049469
2229 Ga0501071_0117682
2230 Ga0501072_0000167
2231 Ga0501072_0042645
2232 Ga0501072_0189546
2233 Ga0501073_0872212
2234 Ga0501074_0004465
2235 Ga0501074_0031861
2236 Ga0501075_0000379
2237 Ga0501075_0002352
2238 Ga0501075_0075011
2239 Ga0501075_0089973
2240 Ga0501076_0000162
2241 Ga0501076_0000369
2242 Ga0501076_0016067
2243 Ga0501076_0018936
2244 Ga0501077_0012356
2245 Ga0501077_0245444
2246 Ga0501077_0418437
2247 Ga0501202_024995
2248 Ga0501235_036686
2249 Ga0501235_038276
2250 Ga0501249_010200
2251 Ga0501079_0002956
2252 Ga0501079_0026542
2253 Ga0501079_0163399
2254 Ga0501080_0002596
2255 Ga0501080_0068160
2256 Ga0501080_0798156
2257 Ga0501081_0000113
2258 Ga0501081_0005776
2259 Ga0501081_0056562
2260 Ga0501081_0180078
2261 Ga0501081_0197664
2262 Ga0501083_0009872
2263 Ga0501035_0005491
2264 Ga0501035_0020503
2265 Ga0501035_0176649
2266 Ga0501035_0434068
2267 Ga0501044_0008395
2268 Ga0501044_0214904
2269 Ga0501045_0000048
2270 Ga0501045_0000434
2271 Ga0501045_0103729
2272 Ga0501045_0103979
2273 Ga0501045_0106439
2274 Ga0501045_0259682
2275 nmdc:mga03683_2171_c1
2276 nmdc:mga03n38_317608_c1
2277 nmdc:mga00v17_150723_c1
2278 nmdc:mga00v17_50652_c1
2279 nmdc:mga00v17_9898_c1
2280 nmdc:mga0k408_24709_c1
2281 nmdc:mga0k408_4495_c1
2282 nmdc:mga06z11_45651_c2
2283 nmdc:mga06z11_94713_c1
2284 nmdc:mga07m45_68215_c1
2285 nmdc:mga05p37_101671_c1
2286 nmdc:mga05p37_11365_c1
2287 nmdc:mga05p37_23337_c1
2288 nmdc:mga05p37_247277_c1
2289 nmdc:mga05p37_320439_c1
2290 nmdc:mga05p37_371570_c1
2291 nmdc:mga05p37_37516_c1
2292 nmdc:mga05p37_49579_c1
2293 nmdc:mga05p37_69222_c1
2294 nmdc:mga05p37_73_c1
2295 nmdc:mga09592_273130_c1
2296 nmdc:mga09592_38541_c1
2297 nmdc:mga09592_6310_c1
2298 nmdc:mga09592_664665_c1
2299 nmdc:mga0qj67_151654_c1
2300 nmdc:mga0qj67_18830_c1
2301 nmdc:mga0qj67_295_c1
2302 nmdc:mga0qj67_321599_c1
2303 nmdc:mga0qj67_54208_c1
2304 nmdc:mga06r32_1247_c1
2305 nmdc:mga06r32_249779_c1
2306 nmdc:mga06r32_83989_c1
2307 nmdc:mga08y16_126306_c1
2308 nmdc:mga08y16_1290551_c1
2309 nmdc:mga08y16_15894_c1
2310 nmdc:mga08y16_228767_c2
2311 nmdc:mga08y16_5598_c1
2312 nmdc:mga08y16_65540_c1
2313 nmdc:mga0n895_116614_c1
2314 nmdc:mga0n895_1175698_c1
2315 nmdc:mga0n895_162263_c1
2316 nmdc:mga0n895_162361_c1
2317 nmdc:mga0n895_190442_c1
2318 nmdc:mga0n895_327549_c1
2319 nmdc:mga0n895_498385_c1
2320 nmdc:mga0rr50_1_c1
2321 nmdc:mga0rr50_289066_c1
2322 nmdc:mga0rr50_430196_c1
2323 nmdc:mga0rr50_511665_c1
2324 nmdc:mga0rr50_74540_c1
2325 nmdc:mga08x19_113853_c1
2326 nmdc:mga08x19_250405_c1
2327 nmdc:mga08x19_311_c1
2328 nmdc:mga0a205_112130_c1
2329 nmdc:mga0a205_13997_c1
2330 nmdc:mga0a205_239589_c1
2331 nmdc:mga0a205_607259_c1
2332 Ga0495601_0000814
2333 Ga0495601_0026813
2334 Ga0495601_0111834
2335 Ga0495601_0141591
2336 Ga0495601_0169695
2337 Ga0495601_0295144
2338 Ga0495601_0658035
2339 Ga0495612_0153132
2340 Ga0495612_0156882
2341 Ga0495612_0184201
2342 Ga0495595_0020871
2343 Ga0495619_0092783
2344 Ga0495619_0222219
2345 Ga0495619_0558691
2346 Ga0500628_007332
2347 Ga0500573_0250175
2348 Ga0501084_0001506
2349 Ga0501084_0088485
2350 Ga0501084_0162429
2351 Ga0590074_030614
2352 Ga0590077_003121
2353 Ga0587084_010970
2354 Ga0501082_0002405
2355 Ga0501082_0030474
2356 Ga0501082_0121847
2357 Ga0501082_0451203
2358 Ga0501082_0464553
2359 Ga0501082_1055764
2360 Ga0530510_0001043
2361 Ga0530510_0025200
2362 Ga0530510_0095625
2363 Ga0530510_0360175
2364 2513723079

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

23

157

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e9y-assembly1.cif.gz_A arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron 0.8339 2 161
1ozf-assembly1.cif.gz_B the crystal structure of klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactors 0.8184 5 160
6qsi-assembly1.cif.gz_A pseudomonas fluorescens pf-5 thiamine diphosphate-dependent 4-hydroxybenzoylformate decarboxylase 0.8152 1 159
4k9q-assembly1.cif.gz_A the crystal structure of benzoylformate decarboxylase from polynucleobacter necessarius 0.8142 1 164
7b2e-assembly2.cif.gz_D quadruple mutant of oxalyl-coa decarboxylase from methylorubrum extorquens with bound tpp and adp 0.8139 6 166
ID Description Score Start End Superfamily
af_P58416_5_175_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9222 3 173 3.40.50.970
af_P58416_5_175_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9119 3 173 3.40.50.970
af_Q58077_321_493_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8594 4 166 3.40.50.970
af_Q4D595_238_443_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8523 1 177 3.40.50.970
af_Q8S4W9_400_591_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8342 1 165 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A3M1QX13-F1-model_v4 Thiamine pyrophosphate-binding protein 0.991 1 99 GO:0000287
GO:0016831
GO:0030976
AF-A0A2V8G2E8-F1-model_v4 Thiamine pyrophosphate enzyme TPP-binding domain-containing protein 0.984 17 94 GO:0000287
GO:0016831
GO:0030976
AF-A0A3M1QX13-F1-model_v4 Thiamine pyrophosphate-binding protein 0.9812 1 99 GO:0000287
GO:0016831
GO:0030976
AF-A0A535SBU8-F1-model_v4 Thiamine pyrophosphate-binding protein 0.9796 1 81 GO:0000287
GO:0016831
GO:0030976
AF-A0A524KDW5-F1-model_v4 Aldehyde dehydrogenase 0.9736 1 92 GO:0016020
GO:0016831
GO:0030976
GO:0044281

Map