F491257

General Info

Members Datasets Scaffolds Average Seq Length
1176 382 1176 500

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0000273|Ga0466963_0000273_2983_4719
Length 571
Sequence MQLSEGPADLPVNAVALIVLDGWGLAPAGPGNAVASAHTPVFDELWSRYPHTSLKTSGRAVGLPEGQMGNSEVGHLNLGAGAVVVQDLTRIDEAIEHGDLASNAVLQEAFSSGERVHLIGLVSDGGVHSGFRHLKALIELAAEIDVPDLVLHAFTDGRDTLPHSGAGYLETAEGWMQSAGKGRIASVVGRYYAMDRDDRWERIQAAYDLLVHGRAEHHASSGVEAAHDAYDRGETDEFITPVLVGEEGRIRAQDIVVAFNFRPDRMREITRALADPEFTEIDRGGAEPVQRYVTMTEYEEGWPHPVAFEPHRPATTLPLELAAKGLHQLHVAETEKYPHVTYFAQEGEDRVLVPSPREVPTYDHKPEMSAHEAARKFVSAWAQERPAFGIINFANPDMVGHTGVVQAAVQAVETVDSCLGEVVEAVHGGGGACVVTADHGNADNMIEPDGSPNTAHSLNPVPLIVTVEGLTLRDGGVLADVAPTVLALLGLEQPEGMTATKLIRAPGAHGRRARPEHVPGGRMTRARRIKARQDAEGAASQWAHAPPRSIYKLDNLRLRFYTGSGTKGFLL

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
172 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
173 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
174 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
175 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
176 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
177 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
180 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
183 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
184 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
185 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
200 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
222 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
223 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
224 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
225 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
226 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
227 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
228 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
229 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
230 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
231 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
232 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
233 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
234 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
235 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
236 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
237 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
238 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
243 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
244 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
245 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
246 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
256 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
257 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
258 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
259 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
260 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
261 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
264 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
265 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
266 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
267 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
268 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
269 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
270 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
271 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
272 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
273 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
274 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
279 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
280 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
281 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
282 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
283 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
284 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
285 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
286 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
291 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
298 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
299 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
303 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
304 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
312 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
315 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
316 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
317 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
318 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
319 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
320 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
321 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
322 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
323 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
324 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
325 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
326 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
342 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
343 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
344 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
345 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
346 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
347 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
348 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
349 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
350 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
351 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
352 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
353 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
358 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
359 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
360 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
361 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
362 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
363 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
364 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
365 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
366 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
367 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
368 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
369 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
370 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
371 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
372 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
373 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
374 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
375 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
376 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
377 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
378 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
379 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
380 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
381 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
382 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 10.63
Rhizosphere 84.52
Stem 0
Stem Tuber 0
Unclassified 3.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000167 3300001977 Bacteria 8560
2 JGI24748J21848_1001590 3300002074 Bacteria 2527
3 JGI24034J26672_10000104 3300002239 Bacteria 13847
4 JGI25406J46586_10022658 3300003203 Bacteria 2498
5 JGI25406J46586_10026917 3300003203 Bacteria 2211
6 JGI25407J50210_10001803 3300003373 Bacteria 4938
7 JGI25407J50210_10001927 3300003373 Bacteria 4814
8 JGI25407J50210_10002817 3300003373 Bacteria 4138
9 JGI25404J52841_10006407 3300003659 Bacteria 2460
10 Ga0070658_10004160 3300005327 Bacteria 11848
11 Ga0070658_10156784 3300005327 Bacteria 1909
12 Ga0070683_100000682 3300005329 Bacteria 24589
13 Ga0070683_100006431 3300005329 Bacteria 9856
14 Ga0070683_100008910 3300005329 Bacteria 8551
15 Ga0070683_100010038 3300005329 Bacteria 8122
16 Ga0070683_100014931 3300005329 Bacteria 6808
17 Ga0070683_100017176 3300005329 Bacteria 6391
18 Ga0070683_100034666 3300005329 Bacteria 4612
19 Ga0070683_100052582 3300005329 Bacteria 3774
20 Ga0070683_100054804 3300005329 Bacteria 3698
21 Ga0070683_100116675 3300005329 Bacteria 2520
22 Ga0070683_100158979 3300005329 Bacteria 2143
23 Ga0070677_10000004 3300005333 Bacteria 81101
24 Ga0070666_10048044 3300005335 Bacteria 2866
25 Ga0070680_100003345 3300005336 Bacteria 11961
26 Ga0070680_100016204 3300005336 Bacteria 5862
27 Ga0070680_100086547 3300005336 Bacteria 2590
28 Ga0070682_100000013 3300005337 Bacteria 254641
29 Ga0070682_100000045 3300005337 Bacteria 131960
30 Ga0070682_100003538 3300005337 Bacteria 8644
31 Ga0068868_100000033 3300005338 Bacteria 75402
32 Ga0068868_100007612 3300005338 Bacteria 7723
33 Ga0070660_100001782 3300005339 Bacteria 14790
34 Ga0070660_100016628 3300005339 Bacteria 5344
35 Ga0070689_100049457 3300005340 Bacteria 3246
36 Ga0070691_10008221 3300005341 Bacteria 4782
37 Ga0070661_100000023 3300005344 Bacteria 123104
38 Ga0070661_100128955 3300005344 Bacteria 1899
39 Ga0070692_10019194 3300005345 Bacteria 3299
40 Ga0070669_100005033 3300005353 Bacteria 9556
41 Ga0070675_100000101 3300005354 Bacteria 50140
42 Ga0070675_100015766 3300005354 Bacteria 5981
43 Ga0070674_100000008 3300005356 Bacteria 143844
44 Ga0070674_100000029 3300005356 Bacteria 69489
45 Ga0070673_100005926 3300005364 Bacteria 7897
46 Ga0070673_100006213 3300005364 Bacteria 7751
47 Ga0070673_100138496 3300005364 Bacteria 2051
48 Ga0070688_100000068 3300005365 Bacteria 50778
49 Ga0070659_100000030 3300005366 Bacteria 128662
50 Ga0070659_100004757 3300005366 Bacteria 9702
51 Ga0070659_100017601 3300005366 Bacteria 5382
52 Ga0070659_100018207 3300005366 Bacteria 5300
53 Ga0070659_100033746 3300005366 Bacteria 3977
54 Ga0070659_100113105 3300005366 Bacteria 2192
55 Ga0070667_100006419 3300005367 Bacteria 9773
56 Ga0070709_10044052 3300005434 Bacteria 2762
57 Ga0070714_100000228 3300005435 Bacteria 44348
58 Ga0070714_100001436 3300005435 Bacteria 17333
59 Ga0070714_100003341 3300005435 Bacteria 11963
60 Ga0070714_100031539 3300005435 Bacteria 4423
61 Ga0070714_100042377 3300005435 Bacteria 3845
62 Ga0070714_100064090 3300005435 Bacteria 3162
63 Ga0070714_100114738 3300005435 Bacteria 2390
64 Ga0070714_100219592 3300005435 Bacteria 1746
65 Ga0070713_100000009 3300005436 Bacteria 153056
66 Ga0070713_100019536 3300005436 Bacteria 5177
67 Ga0070713_100022221 3300005436 Bacteria 4898
68 Ga0070713_100031284 3300005436 Bacteria 4238
69 Ga0070713_100102944 3300005436 Bacteria 2477
70 Ga0070710_10000009 3300005437 Bacteria 165863
71 Ga0070710_10031211 3300005437 Bacteria 2874
72 Ga0070710_10040070 3300005437 Bacteria 2581
73 Ga0070711_100003340 3300005439 Bacteria 9338
74 Ga0070711_100011026 3300005439 Bacteria 5607
75 Ga0070711_100076384 3300005439 Bacteria 2375
76 Ga0070700_100001344 3300005441 Bacteria 12221
77 Ga0070700_100004038 3300005441 Bacteria 7638
78 Ga0070663_100003079 3300005455 Bacteria 9535
79 Ga0070678_100011655 3300005456 Bacteria 5433
80 Ga0070678_100033935 3300005456 Bacteria 3548
81 Ga0070662_100000004 3300005457 Bacteria 195534
82 Ga0070662_100003078 3300005457 Bacteria 10347
83 Ga0070681_10004654 3300005458 Bacteria 13109
84 Ga0070681_10021554 3300005458 Bacteria 6459
85 Ga0070681_10101094 3300005458 Bacteria 2828
86 Ga0068867_100006138 3300005459 Bacteria 8506
87 Ga0070685_10000127 3300005466 Bacteria 48844
88 Ga0070685_10005555 3300005466 Bacteria 6394
89 Ga0070679_100001522 3300005530 Bacteria 20653
90 Ga0070679_100003939 3300005530 Bacteria 13660
91 Ga0070679_100009474 3300005530 Bacteria 9212
92 Ga0070679_100031188 3300005530 Bacteria 5265
93 Ga0070679_100055874 3300005530 Bacteria 3932
94 Ga0070679_100063537 3300005530 Bacteria 3680
95 Ga0070679_100064550 3300005530 Bacteria 3649
96 Ga0070679_100254294 3300005530 Bacteria 1712
97 Ga0070684_100001766 3300005535 Bacteria 15773
98 Ga0070684_100008210 3300005535 Bacteria 8157
99 Ga0070684_100008468 3300005535 Bacteria 8043
100 Ga0070684_100034900 3300005535 Bacteria 4303
101 Ga0070684_100040324 3300005535 Bacteria 4020
102 Ga0070684_100139387 3300005535 Bacteria 2192
103 Ga0070684_100146242 3300005535 Bacteria 2139
104 Ga0068853_100011850 3300005539 Bacteria 7088
105 Ga0068853_100050807 3300005539 Bacteria 3567
106 Ga0070672_100000027 3300005543 Bacteria 67016
107 Ga0070686_100125632 3300005544 Bacteria 1767
108 Ga0070695_100000265 3300005545 Bacteria 26294
109 Ga0070693_100000376 3300005547 Bacteria 20214
110 Ga0070693_100011458 3300005547 Bacteria 4466
111 Ga0070665_100000106 3300005548 Bacteria 157315
112 Ga0070665_100001191 3300005548 Bacteria 31756
113 Ga0070665_100001955 3300005548 Bacteria 23184
114 Ga0070665_100038430 3300005548 Bacteria 4811
115 Ga0070704_100067316 3300005549 Bacteria 2586
116 Ga0068855_100014745 3300005563 Bacteria 9416
117 Ga0070664_100015011 3300005564 Bacteria 6323
118 Ga0070664_100019724 3300005564 Bacteria 5549
119 Ga0068857_100062863 3300005577 Bacteria 3300
120 Ga0068857_100149959 3300005577 Bacteria 2112
121 Ga0068854_100000114 3300005578 Bacteria 55089
122 Ga0068856_100000577 3300005614 Bacteria 40018
123 Ga0068856_100021907 3300005614 Bacteria 6213
124 Ga0068856_100026071 3300005614 Bacteria 5700
125 Ga0068856_100039508 3300005614 Bacteria 4633
126 Ga0068856_100081832 3300005614 Bacteria 3204
127 Ga0068856_100082799 3300005614 Bacteria 3185
128 Ga0068856_100094185 3300005614 Bacteria 2982
129 Ga0070702_100037020 3300005615 Bacteria 2708
130 Ga0070702_100047882 3300005615 Bacteria 2431
131 Ga0068852_100000184 3300005616 Bacteria 42515
132 Ga0068852_100007961 3300005616 Bacteria 7770
133 Ga0068859_100205402 3300005617 Bacteria 2055
134 Ga0068864_100000045 3300005618 Bacteria 154739
135 Ga0068864_100047347 3300005618 Bacteria 3692
136 Ga0068866_10000001 3300005718 Bacteria 519680
137 Ga0068866_10000031 3300005718 Bacteria 56943
138 Ga0068851_10004695 3300005834 Bacteria 6177
139 Ga0068851_10018437 3300005834 Bacteria 3361
140 Ga0068870_10038670 3300005840 Bacteria 2465
141 Ga0068863_100000021 3300005841 Bacteria 198088
142 Ga0068863_100073925 3300005841 Bacteria 3224
143 Ga0068858_100000091 3300005842 Bacteria 93802
144 Ga0068858_100000216 3300005842 Bacteria 62188
145 Ga0068858_100044814 3300005842 Bacteria 4099
146 Ga0068860_100028039 3300005843 Bacteria 5423
147 Ga0068862_100000973 3300005844 Bacteria 27530
148 Ga0081455_10001981 3300005937 Bacteria 24463
149 Ga0081455_10016719 3300005937 Bacteria 7065
150 Ga0081455_10019018 3300005937 Bacteria 6514
151 Ga0081455_10026557 3300005937 Bacteria 5322
152 Ga0081455_10036852 3300005937 Bacteria 4349
153 Ga0081455_10043246 3300005937 Bacteria 3943
154 Ga0081455_10103892 3300005937 Bacteria 2274
155 Ga0081455_10149935 3300005937 Bacteria 1799
156 Ga0081538_10000066 3300005981 Bacteria 98455
157 Ga0081538_10000259 3300005981 Bacteria 60118
158 Ga0081538_10000464 3300005981 Bacteria 45462
159 Ga0081538_10000514 3300005981 Bacteria 43252
160 Ga0081538_10000671 3300005981 Bacteria 37656
161 Ga0081538_10000920 3300005981 Bacteria 31733
162 Ga0081538_10001367 3300005981 Bacteria 25112
163 Ga0081538_10001716 3300005981 Bacteria 22311
164 Ga0081538_10001796 3300005981 Bacteria 21666
165 Ga0081538_10001868 3300005981 Bacteria 21217
166 Ga0081538_10001885 3300005981 Bacteria 21119
167 Ga0081538_10001951 3300005981 Bacteria 20662
168 Ga0081538_10003478 3300005981 Bacteria 14875
169 Ga0081538_10004433 3300005981 Bacteria 12939
170 Ga0081538_10004837 3300005981 Bacteria 12279
171 Ga0081538_10005710 3300005981 Bacteria 11126
172 Ga0081538_10007479 3300005981 Bacteria 9439
173 Ga0081538_10013656 3300005981 Bacteria 6421
174 Ga0081538_10014112 3300005981 Bacteria 6277
175 Ga0081538_10016644 3300005981 Bacteria 5624
176 Ga0081538_10021826 3300005981 Bacteria 4659
177 Ga0081538_10031229 3300005981 Bacteria 3598
178 Ga0081538_10046302 3300005981 Bacteria 2684
179 Ga0081538_10057348 3300005981 Bacteria 2270
180 Ga0081538_10067849 3300005981 Bacteria 1988
181 Ga0081540_1000139 3300005983 Bacteria 76578
182 Ga0081540_1000306 3300005983 Bacteria 50547
183 Ga0081540_1026139 3300005983 Bacteria 3340
184 Ga0081539_10000288 3300005985 Bacteria 113905
185 Ga0081539_10000791 3300005985 Bacteria 61600
186 Ga0081539_10003296 3300005985 Bacteria 20206
187 Ga0081539_10006119 3300005985 Bacteria 11731
188 Ga0081539_10018233 3300005985 Bacteria 4881
189 Ga0081539_10041810 3300005985 Bacteria 2675
190 Ga0070717_10004065 3300006028 Bacteria 10546
191 Ga0070717_10012533 3300006028 Bacteria 6465
192 Ga0070717_10090410 3300006028 Bacteria 2583
193 Ga0070717_10099897 3300006028 Bacteria 2463
194 Ga0075365_10013272 3300006038 Bacteria 4917
195 Ga0075365_10020924 3300006038 Bacteria 4069
196 Ga0075365_10028757 3300006038 Bacteria 3546
197 Ga0075365_10034216 3300006038 Bacteria 3281
198 Ga0075365_10035119 3300006038 Bacteria 3242
199 Ga0075363_100068621 3300006048 Bacteria 1923
200 Ga0075364_10075351 3300006051 Bacteria 2226
201 Ga0075364_10092093 3300006051 Bacteria 2012
202 Ga0075364_10098454 3300006051 Bacteria 1945
203 Ga0070715_10000001 3300006163 Bacteria 693690
204 Ga0070716_100064474 3300006173 Bacteria 2130
205 Ga0070712_100000003 3300006175 Bacteria 253696
206 Ga0070712_100003339 3300006175 Bacteria 9862
207 Ga0070712_100003379 3300006175 Bacteria 9812
208 Ga0070712_100004441 3300006175 Bacteria 8657
209 Ga0070712_100014909 3300006175 Bacteria 4996
210 Ga0070712_100025707 3300006175 Bacteria 3915
211 Ga0070712_100159453 3300006175 Bacteria 1741
212 Ga0075367_10073065 3300006178 Bacteria 2066
213 Ga0075428_100025755 3300006844 Bacteria 6515
214 Ga0075428_100053256 3300006844 Bacteria 4433
215 Ga0075428_100064842 3300006844 Bacteria 4000
216 Ga0075428_100145148 3300006844 Bacteria 2579
217 Ga0075430_100017889 3300006846 Bacteria 6033
218 Ga0075430_100039029 3300006846 Bacteria 4021
219 Ga0075430_100046313 3300006846 Bacteria 3673
220 Ga0075430_100058117 3300006846 Bacteria 3252
221 Ga0075431_100000075 3300006847 Bacteria 57994
222 Ga0075431_100005144 3300006847 Bacteria 12873
223 Ga0075431_100026586 3300006847 Bacteria 5937
224 Ga0075431_100064714 3300006847 Bacteria 3776
225 Ga0075433_10001554 3300006852 Bacteria 16977
226 Ga0075433_10045006 3300006852 Bacteria 3835
227 Ga0075434_100003025 3300006871 Bacteria 14950
228 Ga0075434_100003679 3300006871 Bacteria 13696
229 Ga0075434_100018375 3300006871 Bacteria 6753
230 Ga0075429_100002308 3300006880 Bacteria 16014
231 Ga0075429_100073357 3300006880 Bacteria 2981
232 Ga0075429_100080839 3300006880 Bacteria 2834
233 Ga0068865_100000160 3300006881 Bacteria 36781
234 Ga0068865_100122247 3300006881 Bacteria 1938
235 Ga0075436_100092306 3300006914 Bacteria 2105
236 Ga0075436_100147263 3300006914 Bacteria 1656
237 Ga0097620_100205407 3300006931 Bacteria 2055
238 Ga0075435_100115086 3300007076 Bacteria 2239
239 Ga0105240_10058261 3300009093 Bacteria 4822
240 Ga0105240_10061141 3300009093 Bacteria 4694
241 Ga0105240_10110181 3300009093 Bacteria 3333
242 Ga0111539_10008241 3300009094 Bacteria 13268
243 Ga0111539_10011787 3300009094 Bacteria 10960
244 Ga0111539_10014997 3300009094 Bacteria 9657
245 Ga0111539_10022251 3300009094 Bacteria 7792
246 Ga0111539_10040504 3300009094 Bacteria 5608
247 Ga0111539_10044673 3300009094 Bacteria 5306
248 Ga0111539_10176543 3300009094 Bacteria 2495
249 Ga0105245_10000016 3300009098 Bacteria 204372
250 Ga0105245_10000456 3300009098 Bacteria 37383
251 Ga0105245_10005125 3300009098 Bacteria 11514
252 Ga0105245_10008155 3300009098 Bacteria 9161
253 Ga0105245_10014206 3300009098 Bacteria 6940
254 Ga0105245_10136902 3300009098 Bacteria 2302
255 Ga0105245_10193181 3300009098 Bacteria 1951
256 Ga0105247_10000393 3300009101 Bacteria 37140
257 Ga0114129_10008963 3300009147 Bacteria 14264
258 Ga0114129_10024279 3300009147 Bacteria 8589
259 Ga0114129_10168988 3300009147 Bacteria 2982
260 Ga0114129_10447196 3300009147 Bacteria 1695
261 Ga0105243_10009266 3300009148 Bacteria 7515
262 Ga0105243_10026089 3300009148 Bacteria 4471
263 Ga0105243_10061148 3300009148 Bacteria 3011
264 Ga0105243_10062605 3300009148 Bacteria 2979
265 Ga0105243_10109557 3300009148 Bacteria 2307
266 Ga0105242_10000893 3300009176 Bacteria 23179
267 Ga0105242_10025382 3300009176 Bacteria 4690
268 Ga0105248_10000249 3300009177 Bacteria 62662
269 Ga0105248_10117921 3300009177 Bacteria 2994
270 Ga0105237_10001661 3300009545 Bacteria 28883
271 Ga0105238_10000011 3300009551 Bacteria 261080
272 Ga0105238_10205639 3300009551 Bacteria 1945
273 Ga0105249_10000068 3300009553 Bacteria 148594
274 Ga0105249_10009291 3300009553 Bacteria 8598
275 Ga0105239_10075213 3300010375 Bacteria 3713
276 Ga0105239_10120285 3300010375 Bacteria 2916
277 Ga0105246_10014139 3300011119 Bacteria 5016
278 Ga0105246_10036239 3300011119 Bacteria 3304
279 Ga0105246_10139585 3300011119 Bacteria 1821
280 Ga0157371_10011147 3300013102 Bacteria 6956
281 Ga0157370_10008024 3300013104 Bacteria 11436
282 Ga0157370_10012340 3300013104 Bacteria 8867
283 Ga0157369_10000110 3300013105 Bacteria 115514
284 Ga0157369_10031554 3300013105 Bacteria 5833
285 Ga0157369_10072870 3300013105 Bacteria 3686
286 Ga0157369_10089867 3300013105 Bacteria 3279
287 Ga0157374_10005737 3300013296 Bacteria 10475
288 Ga0157374_10006397 3300013296 Bacteria 9999
289 Ga0157378_10018959 3300013297 Bacteria 6048
290 Ga0157372_10000129 3300013307 Bacteria 82491
291 Ga0157372_10007044 3300013307 Bacteria 11976
292 Ga0157372_10163531 3300013307 Bacteria 2573
293 Ga0157372_10183659 3300013307 Bacteria 2422
294 Ga0157375_10001152 3300013308 Bacteria 22842
295 Ga0157375_10013338 3300013308 Bacteria 7309
296 Ga0163163_10024319 3300014325 Bacteria 5764
297 Ga0157380_10000132 3300014326 Bacteria 41696
298 Ga0157380_10006960 3300014326 Bacteria 8003
299 Ga0157380_10095379 3300014326 Bacteria 2464
300 Ga0157379_10001717 3300014968 Bacteria 18137
301 Ga0157379_10084278 3300014968 Bacteria 2849
302 Ga0157376_10013180 3300014969 Bacteria 6160
303 Ga0157376_10125257 3300014969 Bacteria 2284
304 Ga0163161_10000035 3300017792 Bacteria 155979
305 Ga0206353_11536562 3300020082 Bacteria 4877
306 Ga0213874_10000263 3300021377 Bacteria 10106
307 Ga0213874_10006555 3300021377 Bacteria 2759
308 Ga0213876_10004900 3300021384 Bacteria 7421
309 Ga0213876_10018870 3300021384 Bacteria 3642
310 Ga0213875_10000095 3300021388 Bacteria 102332
311 Ga0213875_10029251 3300021388 Bacteria 2613
312 Ga0207656_10002580 3300025321 Bacteria 6127
313 Ga0207656_10005030 3300025321 Bacteria 4645
314 Ga0207682_10000031 3300025893 Bacteria 57806
315 Ga0207692_10000005 3300025898 Bacteria 370169
316 Ga0207692_10049620 3300025898 Bacteria 2119
317 Ga0207692_10063646 3300025898 Bacteria 1918
318 Ga0207642_10000002 3300025899 Bacteria 658166
319 Ga0207642_10000122 3300025899 Bacteria 21318
320 Ga0207642_10019184 3300025899 Bacteria 2643
321 Ga0207710_10000195 3300025900 Bacteria 57216
322 Ga0207688_10000574 3300025901 Bacteria 18050
323 Ga0207688_10005824 3300025901 Bacteria 6706
324 Ga0207688_10010122 3300025901 Bacteria 5130
325 Ga0207688_10032304 3300025901 Bacteria 2892
326 Ga0207680_10010636 3300025903 Bacteria 4612
327 Ga0207680_10050043 3300025903 Bacteria 2491
328 Ga0207685_10000036 3300025905 Bacteria 65666
329 Ga0207705_10011755 3300025909 Bacteria 6324
330 Ga0207705_10017978 3300025909 Bacteria 5056
331 Ga0207705_10060566 3300025909 Bacteria 2734
332 Ga0207707_10006013 3300025912 Bacteria 10621
333 Ga0207707_10006637 3300025912 Bacteria 10099
334 Ga0207707_10010986 3300025912 Bacteria 7878
335 Ga0207707_10041204 3300025912 Bacteria 4033
336 Ga0207707_10042359 3300025912 Bacteria 3974
337 Ga0207707_10116782 3300025912 Bacteria 2332
338 Ga0207671_10002660 3300025914 Bacteria 18745
339 Ga0207671_10090654 3300025914 Bacteria 2303
340 Ga0207693_10000028 3300025915 Bacteria 120041
341 Ga0207693_10000920 3300025915 Bacteria 26422
342 Ga0207693_10001165 3300025915 Bacteria 23432
343 Ga0207693_10001560 3300025915 Bacteria 20234
344 Ga0207693_10007247 3300025915 Bacteria 9125
345 Ga0207693_10008453 3300025915 Bacteria 8424
346 Ga0207693_10010457 3300025915 Bacteria 7530
347 Ga0207693_10014455 3300025915 Bacteria 6346
348 Ga0207693_10019840 3300025915 Bacteria 5346
349 Ga0207663_10005734 3300025916 Bacteria 6284
350 Ga0207663_10058760 3300025916 Bacteria 2429
351 Ga0207663_10065905 3300025916 Bacteria 2316
352 Ga0207660_10004934 3300025917 Bacteria 8693
353 Ga0207657_10000895 3300025919 Bacteria 31534
354 Ga0207657_10005572 3300025919 Bacteria 13149
355 Ga0207657_10008838 3300025919 Bacteria 10190
356 Ga0207657_10021014 3300025919 Bacteria 6154
357 Ga0207649_10000063 3300025920 Bacteria 96360
358 Ga0207652_10000349 3300025921 Bacteria 47896
359 Ga0207652_10008277 3300025921 Bacteria 8360
360 Ga0207652_10081403 3300025921 Bacteria 2832
361 Ga0207652_10224982 3300025921 Bacteria 1691
362 Ga0207681_10011629 3300025923 Bacteria 5410
363 Ga0207694_10000004 3300025924 Bacteria 967075
364 Ga0207694_10043428 3300025924 Bacteria 3469
365 Ga0207694_10050210 3300025924 Bacteria 3230
366 Ga0207659_10000010 3300025926 Bacteria 286639
367 Ga0207687_10000007 3300025927 Bacteria 604185
368 Ga0207687_10000018 3300025927 Bacteria 236159
369 Ga0207687_10000177 3300025927 Bacteria 42164
370 Ga0207687_10004028 3300025927 Bacteria 9845
371 Ga0207687_10043291 3300025927 Bacteria 3102
372 Ga0207687_10084038 3300025927 Bacteria 2307
373 Ga0207700_10000081 3300025928 Bacteria 59083
374 Ga0207700_10014327 3300025928 Bacteria 5193
375 Ga0207664_10000060 3300025929 Bacteria 116764
376 Ga0207664_10005856 3300025929 Bacteria 8405
377 Ga0207664_10006739 3300025929 Bacteria 7934
378 Ga0207664_10017802 3300025929 Bacteria 5220
379 Ga0207664_10030175 3300025929 Bacteria 4139
380 Ga0207664_10050301 3300025929 Bacteria 3286
381 Ga0207690_10000094 3300025932 Bacteria 74114
382 Ga0207690_10006892 3300025932 Bacteria 6740
383 Ga0207690_10047230 3300025932 Bacteria 2855
384 Ga0207690_10083172 3300025932 Bacteria 2241
385 Ga0207706_10000012 3300025933 Bacteria 195475
386 Ga0207706_10006002 3300025933 Bacteria 11295
387 Ga0207706_10010294 3300025933 Bacteria 8551
388 Ga0207706_10046641 3300025933 Bacteria 3837
389 Ga0207686_10000033 3300025934 Bacteria 143602
390 Ga0207686_10005471 3300025934 Bacteria 6817
391 Ga0207686_10019818 3300025934 Bacteria 3833
392 Ga0207709_10012022 3300025935 Bacteria 4773
393 Ga0207709_10034179 3300025935 Bacteria 2994
394 Ga0207669_10000004 3300025937 Bacteria 196828
395 Ga0207669_10000012 3300025937 Bacteria 138242
396 Ga0207669_10025626 3300025937 Bacteria 3192
397 Ga0207704_10000236 3300025938 Bacteria 27317
398 Ga0207704_10030307 3300025938 Bacteria 3032
399 Ga0207665_10003251 3300025939 Bacteria 10879
400 Ga0207665_10124725 3300025939 Bacteria 1822
401 Ga0207691_10000136 3300025940 Bacteria 67179
402 Ga0207691_10007573 3300025940 Bacteria 10450
403 Ga0207711_10000020 3300025941 Bacteria 363325
404 Ga0207689_10075688 3300025942 Bacteria 2767
405 Ga0207661_10000224 3300025944 Bacteria 36954
406 Ga0207661_10002814 3300025944 Bacteria 12013
407 Ga0207661_10003313 3300025944 Bacteria 11175
408 Ga0207661_10013702 3300025944 Bacteria 5921
409 Ga0207661_10033341 3300025944 Bacteria 3996
410 Ga0207661_10052959 3300025944 Bacteria 3245
411 Ga0207661_10075262 3300025944 Bacteria 2770
412 Ga0207679_10009479 3300025945 Bacteria 6239
413 Ga0207679_10040804 3300025945 Bacteria 3325
414 Ga0207651_10000460 3300025960 Bacteria 17106
415 Ga0207651_10020147 3300025960 Bacteria 4018
416 Ga0207651_10080053 3300025960 Bacteria 2350
417 Ga0207712_10000007 3300025961 Bacteria 539589
418 Ga0207712_10016430 3300025961 Bacteria 4792
419 Ga0207712_10037616 3300025961 Bacteria 3303
420 Ga0207668_10018553 3300025972 Bacteria 4382
421 Ga0207640_10000015 3300025981 Bacteria 215411
422 Ga0207640_10013825 3300025981 Bacteria 4634
423 Ga0207658_10057816 3300025986 Bacteria 2883
424 Ga0207677_10000338 3300026023 Bacteria 33505
425 Ga0207703_10000023 3300026035 Bacteria 222018
426 Ga0207703_10000152 3300026035 Bacteria 79658
427 Ga0207639_10023349 3300026041 Bacteria 4466
428 Ga0207639_10191344 3300026041 Bacteria 1748
429 Ga0207678_10007745 3300026067 Bacteria 9489
430 Ga0207678_10072220 3300026067 Bacteria 2957
431 Ga0207708_10001047 3300026075 Bacteria 20695
432 Ga0207708_10033916 3300026075 Bacteria 3881
433 Ga0207708_10072952 3300026075 Bacteria 2630
434 Ga0207708_10086924 3300026075 Bacteria 2406
435 Ga0207702_10000060 3300026078 Bacteria 125473
436 Ga0207702_10003607 3300026078 Bacteria 14060
437 Ga0207702_10077475 3300026078 Bacteria 2875
438 Ga0207641_10000151 3300026088 Bacteria 99225
439 Ga0207648_10000766 3300026089 Bacteria 36117
440 Ga0207648_10011873 3300026089 Bacteria 8185
441 Ga0207648_10056680 3300026089 Bacteria 3419
442 Ga0207676_10000016 3300026095 Bacteria 311561
443 Ga0207674_10073827 3300026116 Bacteria 3424
444 Ga0207674_10096118 3300026116 Bacteria 2948
445 Ga0207674_10164679 3300026116 Bacteria 2171
446 Ga0207674_10257859 3300026116 Bacteria 1691
447 Ga0207675_100001704 3300026118 Bacteria 22024
448 Ga0207683_10002374 3300026121 Bacteria 16445
449 Ga0207683_10003745 3300026121 Bacteria 13186
450 Ga0207683_10067514 3300026121 Bacteria 3155
451 Ga0207698_10000012 3300026142 Bacteria 260061
452 Ga0207698_10014684 3300026142 Bacteria 5215
453 Ga0207698_10022568 3300026142 Bacteria 4377
454 Ga0207698_10120357 3300026142 Bacteria 2220
455 Ga0207428_10018799 3300027907 Bacteria 5896
456 Ga0207428_10026212 3300027907 Bacteria 4866
457 Ga0207428_10054977 3300027907 Bacteria 3167
458 Ga0207428_10134202 3300027907 Bacteria 1893
459 Ga0268266_10000047 3300028379 Bacteria 310996
460 Ga0268266_10000085 3300028379 Bacteria 201288
461 Ga0268266_10007839 3300028379 Bacteria 9568
462 Ga0268266_10055173 3300028379 Bacteria 3415
463 Ga0268265_10001017 3300028380 Bacteria 25271
464 Ga0268265_10059034 3300028380 Bacteria 2933
465 Ga0268264_10013352 3300028381 Bacteria 6759
466 Ga0268264_10118473 3300028381 Bacteria 2330
467 Ga0265337_1000231 3300028556 Bacteria 30088
468 Ga0265337_1006811 3300028556 Bacteria 4349
469 Ga0265326_10000007 3300028558 Bacteria 223057
470 Ga0265326_10000024 3300028558 Bacteria 112928
471 Ga0265319_1000015 3300028563 Bacteria 176382
472 Ga0265319_1000025 3300028563 Bacteria 142639
473 Ga0265319_1000144 3300028563 Bacteria 52606
474 Ga0265319_1002445 3300028563 Bacteria 10147
475 Ga0265319_1004984 3300028563 Bacteria 6466
476 Ga0265334_10000151 3300028573 Bacteria 42917
477 Ga0265318_10001571 3300028577 Bacteria 13227
478 Ga0265318_10002150 3300028577 Bacteria 10707
479 Ga0265322_10000001 3300028654 Bacteria 543854
480 Ga0265336_10000002 3300028666 Bacteria 830172
481 Ga0265336_10000622 3300028666 Bacteria 19519
482 Ga0265336_10005990 3300028666 Bacteria 4431
483 Ga0265338_10000001 3300028800 Bacteria 1177449
484 Ga0265338_10000473 3300028800 Bacteria 71777
485 Ga0265338_10036287 3300028800 Bacteria 4720
486 Ga0265338_10048163 3300028800 Bacteria 3881
487 Ga0265324_10001009 3300029957 Bacteria 17266
488 Ga0265320_10000002 3300031240 Bacteria 542875
489 Ga0265320_10005211 3300031240 Bacteria 8387
490 Ga0265325_10006013 3300031241 Bacteria 7426
491 Ga0265329_10004822 3300031242 Bacteria 5539
492 Ga0265340_10000001 3300031247 Bacteria 1647668
493 Ga0265339_10023212 3300031249 Bacteria 3588
494 Ga0265339_10054152 3300031249 Bacteria 2180
495 Ga0265331_10019616 3300031250 Bacteria 3489
496 Ga0265327_10000011 3300031251 Bacteria 543807
497 Ga0265327_10008104 3300031251 Bacteria 7910
498 Ga0265327_10011730 3300031251 Bacteria 6002
499 Ga0265316_10083107 3300031344 Bacteria 2453
500 Ga0265314_10000062 3300031711 Bacteria 159496
501 Ga0316576_10035815 3300031727 Bacteria 3546
502 Ga0307405_10060015 3300031731 Bacteria 2399
503 Ga0307413_10110574 3300031824 Bacteria 1839
504 Ga0307410_10013468 3300031852 Bacteria 4773
505 Ga0307410_10031150 3300031852 Bacteria 3419
506 Ga0307406_10042399 3300031901 Bacteria 2841
507 Ga0307407_10010086 3300031903 Bacteria 4437
508 Ga0307409_100002102 3300031995 Bacteria 10248
509 Ga0307409_100184376 3300031995 Bacteria 1851
510 Ga0307416_100022798 3300032002 Bacteria 4529
511 Ga0307411_10128450 3300032005 Bacteria 1848
512 Ga0307415_100001872 3300032126 Bacteria 10327
513 Ga0307415_100003690 3300032126 Bacteria 7836
514 Ga0307415_100032167 3300032126 Bacteria 3389
515 Ga0373949_0006908 3300035090 Bacteria 2492
516 Ga0373941_0001018 3300035115 Bacteria 5819
517 Ga0373945_0001407 3300035116 Bacteria 7307
518 Ga0373943_0001797 3300035170 Bacteria 9695
519 Ga0316574_0002945 3300035398 Bacteria 8666
520 Ga0373931_0020416 3300035691 Bacteria 3315
521 Ga0373931_0020433 3300035691 Bacteria 3314
522 Ga0373935_0039197 3300035692 Bacteria 2970
523 Ga0373933_0077155 3300035724 Bacteria 2036
524 Ga0373947_0001552 3300035725 Bacteria 14072
525 Ga0373937_0000355 3300036401 Bacteria 42585
526 Ga0373937_0018464 3300036401 Bacteria 6229
527 Ga0373937_0043006 3300036401 Bacteria 4123
528 Ga0373937_0142681 3300036401 Bacteria 2241
529 Ga0373937_0158223 3300036401 Bacteria 2124
530 Ga0316584_0004124 3300036712 Bacteria 9584
531 Ga0373925_0046514 3300037068 Bacteria 3227
532 Ga0395899_0003392 3300037312 Bacteria 12645
533 Ga0395899_0036378 3300037312 Bacteria 3693
534 Ga0395899_0047643 3300037312 Bacteria 3190
535 Ga0395899_0077262 3300037312 Bacteria 2428
536 Ga0395900_0009508 3300037418 Bacteria 9968
537 Ga0395900_0011245 3300037418 Bacteria 9152
538 Ga0395900_0015469 3300037418 Bacteria 7778
539 Ga0395900_0076548 3300037418 Bacteria 3438
540 Ga0395900_0165799 3300037418 Bacteria 2251
541 Ga0395900_0304740 3300037418 Bacteria 1578
542 Ga0395898_0007626 3300037466 Bacteria 11487
543 Ga0395898_0023168 3300037466 Bacteria 6276
544 Ga0395898_0023591 3300037466 Bacteria 6215
545 Ga0395898_0037026 3300037466 Bacteria 4842
546 Ga0395898_0037130 3300037466 Bacteria 4834
547 Ga0395898_0054637 3300037466 Bacteria 3896
548 Ga0395898_0111523 3300037466 Bacteria 2622
549 Ga0395898_0134855 3300037466 Bacteria 2364
550 Ga0395898_0174659 3300037466 Bacteria 2053
551 Ga0395905_0001832 3300037471 Bacteria 24559
552 Ga0395905_0048185 3300037471 Bacteria 3994
553 Ga0395905_0090877 3300037471 Bacteria 2862
554 Ga0395905_0109187 3300037471 Bacteria 2597
555 Ga0436364_0121330 3300037853 Bacteria 4890
556 Ga0436364_0349017 3300037853 Bacteria 2572
557 Ga0436364_0412746 3300037853 Bacteria 2633
558 Ga0436364_0674729 3300037853 Bacteria 4110
559 Ga0436364_0765160 3300037853 Bacteria 2371
560 Ga0436364_1294613 3300037853 Bacteria 100298
561 Ga0436364_1445105 3300037853 Bacteria 2976
562 Ga0395901_0006703 3300038443 Bacteria 11639
563 Ga0395901_0028513 3300038443 Bacteria 5741
564 Ga0395901_0119765 3300038443 Bacteria 2766
565 Ga0395901_0213677 3300038443 Bacteria 2018
566 Ga0436365_0254126 3300039437 Bacteria 67152
567 Ga0436365_0388687 3300039437 Bacteria 8356
568 Ga0436365_0911509 3300039437 Bacteria 21390
569 Ga0436365_0947003 3300039437 Bacteria 4351
570 Ga0436365_1029997 3300039437 Bacteria 4333
571 Ga0436365_1102419 3300039437 Bacteria 6206
572 Ga0436365_1238206 3300039437 Bacteria 4092
573 Ga0436365_1799679 3300039437 Bacteria 12113
574 Ga0436360_0953769 3300039438 Bacteria 3088
575 Ga0436363_0365326 3300039450 Bacteria 16368
576 Ga0436363_1063131 3300039450 Bacteria 8992
577 Ga0436363_1120367 3300039450 Bacteria 2861
578 Ga0436362_0534151 3300039453 Bacteria 2260
579 Ga0436362_0705873 3300039453 Bacteria 2690
580 Ga0439453_0001968 3300041408 Bacteria 2756
581 Ga0451791_0552643 3300041451 Bacteria 2388
582 Ga0451853_3236511 3300041512 Bacteria 3713
583 Ga0450907_007797 3300042146 Bacteria 1784
584 Ga0451577_0015034 3300042876 Bacteria 7201
585 Ga0466969_0006958 3300044656 Bacteria 6019
586 Ga0453683_0031377 3300044673 Bacteria 3358
587 Ga0466966_0011260 3300044684 Bacteria 5936
588 Ga0466966_0023906 3300044684 Bacteria 3999
589 Ga0466961_0005282 3300044693 Bacteria 8128
590 Ga0466961_0010521 3300044693 Bacteria 5902
591 Ga0466961_0013029 3300044693 Bacteria 5319
592 Ga0466961_0049240 3300044693 Bacteria 2693
593 Ga0466963_0000001 3300044694 Bacteria 110556
594 Ga0466963_0000010 3300044694 Bacteria 68690
595 Ga0466963_0000273 3300044694 Bacteria 22985
596 Ga0466963_0000649 3300044694 Bacteria 16741
597 Ga0466963_0001551 3300044694 Bacteria 12458
598 Ga0466963_0002000 3300044694 Bacteria 11192
599 Ga0466963_0003004 3300044694 Bacteria 9545
600 Ga0466963_0008179 3300044694 Bacteria 6267
601 Ga0466963_0009198 3300044694 Bacteria 5945
602 Ga0466963_0026379 3300044694 Bacteria 3716
603 Ga0466963_0026609 3300044694 Bacteria 3700
604 Ga0466963_0037534 3300044694 Bacteria 3165
605 Ga0466963_0038954 3300044694 Bacteria 3110
606 Ga0466963_0076656 3300044694 Bacteria 2258
607 Ga0466963_0106562 3300044694 Bacteria 1922
608 Ga0466964_0000213 3300044706 Bacteria 16442
609 Ga0466964_0008942 3300044706 Bacteria 3767
610 Ga0466964_0012120 3300044706 Bacteria 3260
611 Ga0466964_0024069 3300044706 Bacteria 2371
612 Ga0466964_0045512 3300044706 Bacteria 1786
613 Ga0453684_0002840 3300044712 Bacteria 40778
614 Ga0466971_0001423 3300044719 Bacteria 10052
615 Ga0466971_0004429 3300044719 Bacteria 6060
616 Ga0466971_0010626 3300044719 Bacteria 4025
617 Ga0466971_0014088 3300044719 Bacteria 3515
618 Ga0466971_0019320 3300044719 Bacteria 3026
619 Ga0466971_0086977 3300044719 Bacteria 1429
620 Ga0466968_0002564 3300044735 Bacteria 6678
621 Ga0466968_0023533 3300044735 Bacteria 2511
622 Ga0466970_0004127 3300044765 Bacteria 7141
623 Ga0466970_0060600 3300044765 Bacteria 2027
624 Ga0466970_0077622 3300044765 Bacteria 1791
625 Ga0466957_0007031 3300044842 Bacteria 6360
626 Ga0466957_0008323 3300044842 Bacteria 5898
627 Ga0466957_0013544 3300044842 Bacteria 4731
628 Ga0466957_0014318 3300044842 Bacteria 4618
629 Ga0466957_0027178 3300044842 Bacteria 3399
630 Ga0466957_0035244 3300044842 Bacteria 3003
631 Ga0466957_0052692 3300044842 Bacteria 2478
632 Ga0466957_0083582 3300044842 Bacteria 1992
633 Ga0466957_0097389 3300044842 Bacteria 1850
634 Ga0466960_0000054 3300044901 Bacteria 38136
635 Ga0466960_0009445 3300044901 Bacteria 4021
636 Ga0466960_0014856 3300044901 Bacteria 3345
637 Ga0466959_0002079 3300045049 Bacteria 12668
638 Ga0466959_0003840 3300045049 Bacteria 9964
639 Ga0466959_0004063 3300045049 Bacteria 9736
640 Ga0466959_0004535 3300045049 Bacteria 9315
641 Ga0466959_0012882 3300045049 Bacteria 6053
642 Ga0466959_0050370 3300045049 Bacteria 3057
643 Ga0466959_0083050 3300045049 Bacteria 2307
644 Ga0466959_0085246 3300045049 Bacteria 2274
645 Ga0451576_0012750 3300045051 Bacteria 9434
646 Ga0466958_0001164 3300045836 Bacteria 12224
647 Ga0466958_0002150 3300045836 Bacteria 9809
648 Ga0466958_0003309 3300045836 Bacteria 8342
649 Ga0466958_0003505 3300045836 Bacteria 8150
650 Ga0466958_0026049 3300045836 Bacteria 3454
651 Ga0466958_0050797 3300045836 Bacteria 2510
652 Ga0466958_0053947 3300045836 Bacteria 2437
653 Ga0466958_0076320 3300045836 Bacteria 2057
654 Ga0466958_0103608 3300045836 Bacteria 1772
655 Ga0466967_0000065 3300045976 Bacteria 39018
656 Ga0466967_0000332 3300045976 Bacteria 21635
657 Ga0466967_0001331 3300045976 Bacteria 14150
658 Ga0466967_0002553 3300045976 Bacteria 11410
659 Ga0466967_0004922 3300045976 Bacteria 9130
660 Ga0466967_0008361 3300045976 Bacteria 7573
661 Ga0466967_0010334 3300045976 Bacteria 6995
662 Ga0466967_0013660 3300045976 Bacteria 6288
663 Ga0466967_0019009 3300045976 Bacteria 5514
664 Ga0466967_0021311 3300045976 Bacteria 5260
665 Ga0466967_0026681 3300045976 Bacteria 4789
666 Ga0466967_0034677 3300045976 Bacteria 4286
667 Ga0466967_0041969 3300045976 Bacteria 3949
668 Ga0466967_0050611 3300045976 Bacteria 3638
669 Ga0466967_0050647 3300045976 Bacteria 3637
670 Ga0466967_0054758 3300045976 Bacteria 3512
671 Ga0466967_0055584 3300045976 Bacteria 3487
672 Ga0466967_0070911 3300045976 Bacteria 3118
673 Ga0466967_0094359 3300045976 Bacteria 2724
674 Ga0466967_0098308 3300045976 Bacteria 2672
675 Ga0466967_0102242 3300045976 Bacteria 2621
676 Ga0466967_0109242 3300045976 Bacteria 2539
677 Ga0466967_0130811 3300045976 Bacteria 2329
678 Ga0466967_0164310 3300045976 Bacteria 2085
679 Ga0466967_0312490 3300045976 Bacteria 1514
680 Ga0495592_0000036 3300046454 Bacteria 125461
681 Ga0495592_0000732 3300046454 Bacteria 22931
682 Ga0495603_0000030 3300046455 Bacteria 60760
683 Ga0495603_0003452 3300046455 Bacteria 9401
684 Ga0495629_0000272 3300046459 Bacteria 44883
685 Ga0495629_0016715 3300046459 Bacteria 5265
686 Ga0495629_0034828 3300046459 Bacteria 3559
687 Ga0495629_0068316 3300046459 Bacteria 2480
688 Ga0495638_0015309 3300046460 Bacteria 5153
689 Ga0495641_0000044 3300046461 Bacteria 77415
690 Ga0495641_0000244 3300046461 Bacteria 42830
691 Ga0495641_0003908 3300046461 Bacteria 10839
692 Ga0495641_0087717 3300046461 Bacteria 1392
693 Ga0495651_0000029 3300046462 Bacteria 105042
694 Ga0495651_0014666 3300046462 Bacteria 6060
695 Ga0495651_0047771 3300046462 Bacteria 3307
696 Ga0495651_0105612 3300046462 Bacteria 2089
697 Ga0495651_0174542 3300046462 Bacteria 1527
698 Ga0495653_0000718 3300046463 Bacteria 25191
699 Ga0495653_0001363 3300046463 Bacteria 18977
700 Ga0495653_0008307 3300046463 Bacteria 8509
701 Ga0495653_0012191 3300046463 Bacteria 7014
702 Ga0495653_0018382 3300046463 Bacteria 5679
703 Ga0495653_0020520 3300046463 Bacteria 5357
704 Ga0495653_0030477 3300046463 Bacteria 4296
705 Ga0495653_0062262 3300046463 Bacteria 2819
706 Ga0495653_0108363 3300046463 Bacteria 2000
707 Ga0495650_0000055 3300046471 Bacteria 308438
708 Ga0495580_0015952 3300046472 Bacteria 5653
709 Ga0495582_0000011 3300046473 Bacteria 113352
710 Ga0495639_0003274 3300046475 Bacteria 7035
711 Ga0495662_0000458 3300046476 Bacteria 18383
712 Ga0495662_0020681 3300046476 Bacteria 3183
713 Ga0495664_0000007 3300046477 Bacteria 386710
714 Ga0495664_0043944 3300046477 Bacteria 2647
715 Ga0495664_0102031 3300046477 Bacteria 1729
716 Ga0495594_0000003 3300046499 Bacteria 199267
717 Ga0495596_0023521 3300046500 Bacteria 2499
718 Ga0495606_0000752 3300046507 Bacteria 50099
719 Ga0495608_0000068 3300046511 Bacteria 79694
720 Ga0495608_0000294 3300046511 Bacteria 35070
721 Ga0495608_0001071 3300046511 Bacteria 19292
722 Ga0495608_0003047 3300046511 Bacteria 11967
723 Ga0495618_0000478 3300046514 Bacteria 28566
724 Ga0495618_0000594 3300046514 Bacteria 25841
725 Ga0495618_0006493 3300046514 Bacteria 7098
726 Ga0495618_0008047 3300046514 Bacteria 6382
727 Ga0495618_0022141 3300046514 Bacteria 3923
728 Ga0495618_0069294 3300046514 Bacteria 2242
729 Ga0495620_0000144 3300046515 Bacteria 58204
730 Ga0495628_0000016 3300046516 Bacteria 170260
731 Ga0495628_0001219 3300046516 Bacteria 23555
732 Ga0495628_0043822 3300046516 Bacteria 3562
733 Ga0495628_0049354 3300046516 Bacteria 3333
734 Ga0495630_0000056 3300046517 Bacteria 91477
735 Ga0495630_0000408 3300046517 Bacteria 33471
736 Ga0495630_0000505 3300046517 Bacteria 28893
737 Ga0495630_0000541 3300046517 Bacteria 27642
738 Ga0495630_0003283 3300046517 Bacteria 11285
739 Ga0495630_0087042 3300046517 Bacteria 2359
740 Ga0495631_0017942 3300046518 Bacteria 3339
741 Ga0495644_0000642 3300046523 Bacteria 14607
742 Ga0495644_0007527 3300046523 Bacteria 4198
743 Ga0495666_0001576 3300046526 Bacteria 11217
744 Ga0495652_0000019 3300046529 Bacteria 190248
745 Ga0495652_0000045 3300046529 Bacteria 122469
746 Ga0495652_0020416 3300046529 Bacteria 5889
747 Ga0495652_0031934 3300046529 Bacteria 4608
748 Ga0495665_0019672 3300046531 Bacteria 3631
749 Ga0495640_0003352 3300046533 Bacteria 12891
750 Ga0495640_0019226 3300046533 Bacteria 5046
751 Ga0495640_0039081 3300046533 Bacteria 3332
752 Ga0495586_0009241 3300046535 Bacteria 5241
753 Ga0495586_0022930 3300046535 Bacteria 3332
754 Ga0495587_0000083 3300046536 Bacteria 73166
755 Ga0495587_0002971 3300046536 Bacteria 11337
756 Ga0495587_0013955 3300046536 Bacteria 5045
757 Ga0495587_0014131 3300046536 Bacteria 5013
758 Ga0495645_0000051 3300046543 Bacteria 87212
759 Ga0495645_0000558 3300046543 Bacteria 25592
760 Ga0495645_0001902 3300046543 Bacteria 14187
761 Ga0495645_0077688 3300046543 Bacteria 2386
762 Ga0495622_0000180 3300046557 Bacteria 51095
763 Ga0495667_0000032 3300046559 Bacteria 143493
764 Ga0495667_0004076 3300046559 Bacteria 9816
765 Ga0495667_0007846 3300046559 Bacteria 7234
766 Ga0495667_0034052 3300046559 Bacteria 3406
767 Ga0495667_0053041 3300046559 Bacteria 2671
768 Ga0495656_0000483 3300046615 Bacteria 12964
769 Ga0495668_0070338 3300046616 Bacteria 1924
770 Ga0495634_0000018 3300046642 Bacteria 121323
771 Ga0495634_0000247 3300046642 Bacteria 50931
772 Ga0495634_0003355 3300046642 Bacteria 12860
773 Ga0495634_0013196 3300046642 Bacteria 5972
774 Ga0495634_0017230 3300046642 Bacteria 5158
775 Ga0495634_0045320 3300046642 Bacteria 2974
776 Ga0495625_0000696 3300046660 Bacteria 47763
777 Ga0495635_0000016 3300046663 Bacteria 214088
778 Ga0495635_0008356 3300046663 Bacteria 7227
779 Ga0495635_0009815 3300046663 Bacteria 6694
780 Ga0495635_0012397 3300046663 Bacteria 5973
781 Ga0495635_0015687 3300046663 Bacteria 5292
782 Ga0495635_0061532 3300046663 Bacteria 2578
783 Ga0495588_0000165 3300046674 Bacteria 85841
784 Ga0495657_0000004 3300046675 Bacteria 266465
785 Ga0495657_0000013 3300046675 Bacteria 195590
786 Ga0495657_0011595 3300046675 Bacteria 6586
787 Ga0495599_0000187 3300046678 Bacteria 40807
788 Ga0495599_0024325 3300046678 Bacteria 3788
789 Ga0495599_0043015 3300046678 Bacteria 2835
790 Ga0495623_0000121 3300046679 Bacteria 47882
791 Ga0495646_0001537 3300046680 Bacteria 13770
792 Ga0495646_0029254 3300046680 Bacteria 3445
793 Ga0495646_0030054 3300046680 Bacteria 3394
794 Ga0495647_0000008 3300046681 Bacteria 101193
795 Ga0495647_0000169 3300046681 Bacteria 17284
796 Ga0495647_0000468 3300046681 Bacteria 11697
797 Ga0495658_0000005 3300046683 Bacteria 149839
798 Ga0495658_0012335 3300046683 Bacteria 4324
799 Ga0495658_0013455 3300046683 Bacteria 4165
800 Ga0495658_0036522 3300046683 Bacteria 2711
801 Ga0495669_0000603 3300046684 Bacteria 15735
802 Ga0495613_0000113 3300046689 Bacteria 79559
803 Ga0495613_0000203 3300046689 Bacteria 58232
804 Ga0495624_0000008 3300046690 Bacteria 145035
805 Ga0495624_0000267 3300046690 Bacteria 41318
806 Ga0495624_0005932 3300046690 Bacteria 8730
807 Ga0495624_0108268 3300046690 Bacteria 1709
808 Ga0495670_0032167 3300046691 Bacteria 2608
809 Ga0495649_0001624 3300046694 Bacteria 16726
810 Ga0495600_0000787 3300046809 Bacteria 16744
811 Ga0495600_0018373 3300046809 Bacteria 4454
812 Ga0495600_0021081 3300046809 Bacteria 4171
813 Ga0495600_0042473 3300046809 Bacteria 2964
814 Ga0495604_0000019 3300047317 Bacteria 175064
815 Ga0495604_0000072 3300047317 Bacteria 88631
816 Ga0495604_0000398 3300047317 Bacteria 39366
817 Ga0495604_0000824 3300047317 Bacteria 25900
818 Ga0495604_0000917 3300047317 Bacteria 24518
819 Ga0495674_0001564 3300047319 Bacteria 22423
820 Ga0495674_0012591 3300047319 Bacteria 7969
821 Ga0495674_0014198 3300047319 Bacteria 7459
822 Ga0495674_0033320 3300047319 Bacteria 4668
823 Ga0495674_0083367 3300047319 Bacteria 2741
824 Ga0495674_0119007 3300047319 Bacteria 2233
825 Ga0495676_0000299 3300047321 Bacteria 40098
826 Ga0495676_0008653 3300047321 Bacteria 9317
827 Ga0495676_0058227 3300047321 Bacteria 3041
828 Ga0495676_0059321 3300047321 Bacteria 3005
829 Ga0495676_0153713 3300047321 Bacteria 1634
830 Ga0495680_0002092 3300047322 Bacteria 20739
831 Ga0495680_0004810 3300047322 Bacteria 12812
832 Ga0495680_0007700 3300047322 Bacteria 9831
833 Ga0495680_0008488 3300047322 Bacteria 9332
834 Ga0495680_0041474 3300047322 Bacteria 3660
835 Ga0495675_0000031 3300047444 Bacteria 99240
836 Ga0495675_0000107 3300047444 Bacteria 59970
837 Ga0495673_0010571 3300047469 Bacteria 5010
838 Ga0495684_0006217 3300047471 Bacteria 9286
839 Ga0495684_0018384 3300047471 Bacteria 5386
840 Ga0495684_0021987 3300047471 Bacteria 4909
841 Ga0495684_0062533 3300047471 Bacteria 2831
842 Ga0495684_0135647 3300047471 Bacteria 1847
843 Ga0495686_0000020 3300047472 Bacteria 429191
844 Ga0495686_0001936 3300047472 Bacteria 20622
845 Ga0495686_0004284 3300047472 Bacteria 11817
846 Ga0495593_0000333 3300047673 Bacteria 26121
847 Ga0495602_0000133 3300048088 Bacteria 69392
848 Ga0495602_0000208 3300048088 Bacteria 54818
849 Ga0495602_0000497 3300048088 Bacteria 36490
850 Ga0495602_0025389 3300048088 Bacteria 5736
851 Ga0495614_0000165 3300048089 Bacteria 24279
852 Ga0496100_0000002 3300048903 Bacteria 489057
853 Ga0496100_0000018 3300048903 Bacteria 162451
854 Ga0496100_0000463 3300048903 Bacteria 19446
855 Ga0496100_0005719 3300048903 Bacteria 6726
856 Ga0496101_0000001 3300048904 Bacteria 489057
857 Ga0496101_0000062 3300048904 Bacteria 126595
858 Ga0496101_0001372 3300048904 Bacteria 14597
859 Ga0496101_0003568 3300048904 Bacteria 9707
860 Ga0496101_0040738 3300048904 Bacteria 3309
861 Ga0496101_0111615 3300048904 Bacteria 2059
862 Ga0496102_0000002 3300048905 Bacteria 814588
863 Ga0496102_0000039 3300048905 Bacteria 198306
864 Ga0496102_0003661 3300048905 Bacteria 12988
865 Ga0496102_0005815 3300048905 Bacteria 10487
866 Ga0496102_0029803 3300048905 Bacteria 4883
867 Ga0496102_0064989 3300048905 Bacteria 3343
868 Ga0496102_0115856 3300048905 Bacteria 2500
869 Ga0496103_0000008 3300048906 Bacteria 340474
870 Ga0496103_0000017 3300048906 Bacteria 244768
871 Ga0496103_0100974 3300048906 Bacteria 1826
872 Ga0496104_0000001 3300048907 Bacteria 711867
873 Ga0496104_0000004 3300048907 Bacteria 641830
874 Ga0496104_0000009 3300048907 Bacteria 488055
875 Ga0496104_0000129 3300048907 Bacteria 69982
876 Ga0496104_0005543 3300048907 Bacteria 11055
877 Ga0496104_0030115 3300048907 Bacteria 5041
878 Ga0496104_0039390 3300048907 Bacteria 4425
879 Ga0496104_0116657 3300048907 Bacteria 2562
880 Ga0496105_0000001 3300048908 Bacteria 1328178
881 Ga0496105_0000007 3300048908 Bacteria 339658
882 Ga0496105_0000846 3300048908 Bacteria 20846
883 Ga0496105_0004668 3300048908 Bacteria 10329
884 Ga0496105_0010632 3300048908 Bacteria 7240
885 Ga0496105_0011882 3300048908 Bacteria 6894
886 Ga0496105_0026130 3300048908 Bacteria 4759
887 Ga0496105_0046758 3300048908 Bacteria 3572
888 Ga0496105_0064643 3300048908 Bacteria 3019
889 Ga0496105_0134719 3300048908 Bacteria 2035
890 Ga0496105_0144987 3300048908 Bacteria 1953
891 Ga0496105_0153315 3300048908 Bacteria 1893
892 Ga0496106_0000061 3300048909 Bacteria 86524
893 Ga0496106_0000081 3300048909 Bacteria 76468
894 Ga0496106_0000145 3300048909 Bacteria 52447
895 Ga0496106_0021330 3300048909 Bacteria 4809
896 Ga0496107_0000006 3300048910 Bacteria 258746
897 Ga0496107_0000013 3300048910 Bacteria 178284
898 Ga0496107_0021675 3300048910 Bacteria 4540
899 Ga0496107_0024708 3300048910 Bacteria 4251
900 Ga0496107_0032767 3300048910 Bacteria 3715
901 Ga0496107_0033560 3300048910 Bacteria 3672
902 Ga0496107_0044880 3300048910 Bacteria 3178
903 Ga0496107_0118878 3300048910 Bacteria 1946
904 Ga0496107_0154467 3300048910 Bacteria 1699
905 Ga0496108_0000001 3300048911 Bacteria 919044
906 Ga0496108_0000062 3300048911 Bacteria 122391
907 Ga0496108_0000747 3300048911 Bacteria 25332
908 Ga0496108_0001172 3300048911 Bacteria 20452
909 Ga0496108_0015294 3300048911 Bacteria 6261
910 Ga0496108_0025893 3300048911 Bacteria 4837
911 Ga0496108_0036442 3300048911 Bacteria 4092
912 Ga0496108_0057327 3300048911 Bacteria 3273
913 Ga0496108_0102782 3300048911 Bacteria 2439
914 Ga0496108_0133462 3300048911 Bacteria 2134
915 Ga0496108_0271139 3300048911 Bacteria 1477
916 Ga0496109_0000003 3300048912 Bacteria 420862
917 Ga0496109_0000007 3300048912 Bacteria 247554
918 Ga0496109_0000129 3300048912 Bacteria 77469
919 Ga0496109_0001311 3300048912 Bacteria 20538
920 Ga0496109_0001369 3300048912 Bacteria 20218
921 Ga0496109_0002916 3300048912 Bacteria 14294
922 Ga0496109_0004496 3300048912 Bacteria 11655
923 Ga0496109_0009062 3300048912 Bacteria 8475
924 Ga0496109_0037796 3300048912 Bacteria 4363
925 Ga0496109_0076768 3300048912 Bacteria 3073
926 Ga0496109_0079598 3300048912 Bacteria 3019
927 Ga0496109_0084905 3300048912 Bacteria 2921
928 Ga0496109_0116828 3300048912 Bacteria 2483
929 Ga0496109_0239826 3300048912 Bacteria 1706
930 Ga0496110_0000039 3300048913 Bacteria 63169
931 Ga0496110_0000062 3300048913 Bacteria 53333
932 Ga0496110_0002594 3300048913 Bacteria 13596
933 Ga0496110_0013117 3300048913 Bacteria 6840
934 Ga0496110_0020943 3300048913 Bacteria 5525
935 Ga0496110_0042091 3300048913 Bacteria 3987
936 Ga0496110_0068996 3300048913 Bacteria 3129
937 Ga0496110_0108325 3300048913 Bacteria 2494
938 Ga0496110_0224326 3300048913 Bacteria 1709
939 Ga0496111_0000010 3300048914 Bacteria 92600
940 Ga0496111_0001293 3300048914 Bacteria 14032
941 Ga0496111_0016015 3300048914 Bacteria 5160
942 Ga0496111_0032766 3300048914 Bacteria 3705
943 Ga0496111_0052833 3300048914 Bacteria 2935
944 Ga0496111_0057332 3300048914 Bacteria 2820
945 Ga0496111_0062281 3300048914 Bacteria 2705
946 Ga0496111_0064421 3300048914 Bacteria 2659
947 Ga0496111_0083057 3300048914 Bacteria 2340
948 Ga0496111_0114457 3300048914 Bacteria 1988
949 Ga0496112_0000003 3300048915 Bacteria 660147
950 Ga0496112_0001122 3300048915 Bacteria 19906
951 Ga0496112_0016477 3300048915 Bacteria 6925
952 Ga0496112_0017549 3300048915 Bacteria 6727
953 Ga0496112_0053133 3300048915 Bacteria 3978
954 Ga0496112_0072829 3300048915 Bacteria 3396
955 Ga0496112_0166699 3300048915 Bacteria 2169
956 Ga0496112_0175849 3300048915 Bacteria 2106
957 Ga0496112_0203834 3300048915 Bacteria 1936
958 Ga0496113_0000014 3300048916 Bacteria 79850
959 Ga0496113_0010329 3300048916 Bacteria 6170
960 Ga0496113_0024605 3300048916 Bacteria 4282
961 Ga0496113_0028372 3300048916 Bacteria 4025
962 Ga0496113_0040460 3300048916 Bacteria 3435
963 Ga0496113_0098660 3300048916 Bacteria 2261
964 Ga0496113_0164147 3300048916 Bacteria 1757
965 Ga0496114_0000014 3300048917 Bacteria 297902
966 Ga0496114_0014859 3300048917 Bacteria 6256
967 Ga0496115_0000003 3300048918 Bacteria 354994
968 Ga0496115_0000075 3300048918 Bacteria 90155
969 Ga0496115_0000121 3300048918 Bacteria 71105
970 Ga0496115_0000125 3300048918 Bacteria 69936
971 Ga0496115_0002542 3300048918 Bacteria 13124
972 Ga0496115_0003578 3300048918 Bacteria 11174
973 Ga0496115_0022547 3300048918 Bacteria 4880
974 Ga0496115_0082399 3300048918 Bacteria 2621
975 Ga0496115_0126385 3300048918 Bacteria 2106
976 Ga0496116_0000680 3300048919 Bacteria 44185
977 Ga0496117_0004578 3300048920 Bacteria 15133
978 Ga0496118_0010367 3300048921 Bacteria 9235
979 Ga0496119_0001947 3300048922 Bacteria 23515
980 Ga0496119_0022969 3300048922 Bacteria 4442
981 Ga0496119_0045690 3300048922 Bacteria 2743
982 Ga0496119_0053846 3300048922 Bacteria 2454
983 Ga0496120_0018638 3300048923 Bacteria 4465
984 Ga0496121_0012140 3300048924 Bacteria 9454
985 Ga0496121_0082381 3300048924 Bacteria 2544
986 Ga0496125_0082753 3300048928 Bacteria 2445
987 Ga0501031_0000137 3300049568 Bacteria 40779
988 Ga0501031_0028123 3300049568 Bacteria 3665
989 Ga0501032_0000409 3300049569 Bacteria 35358
990 Ga0501033_0000223 3300049570 Bacteria 54471
991 Ga0501034_0023191 3300049571 Bacteria 6324
992 Ga0501034_0039153 3300049571 Bacteria 4802
993 Ga0501034_0041516 3300049571 Bacteria 4654
994 Ga0501036_0000395 3300049572 Bacteria 30754
995 Ga0501036_0005110 3300049572 Bacteria 10610
996 Ga0501036_0032127 3300049572 Bacteria 4435
997 Ga0501036_0039770 3300049572 Bacteria 3979
998 Ga0501036_0076136 3300049572 Bacteria 2839
999 Ga0501036_0093353 3300049572 Bacteria 2543
1000 Ga0501037_0000315 3300049573 Bacteria 41061
1001 Ga0501038_0000323 3300049574 Bacteria 41119
1002 Ga0501038_0029084 3300049574 Bacteria 4901
1003 Ga0501038_0031807 3300049574 Bacteria 4661
1004 Ga0501038_0119381 3300049574 Bacteria 2176
1005 Ga0501038_0133977 3300049574 Bacteria 2031
1006 Ga0501039_0001294 3300049575 Bacteria 18277
1007 Ga0501039_0008934 3300049575 Bacteria 7635
1008 Ga0501039_0011591 3300049575 Bacteria 6713
1009 Ga0501039_0037664 3300049575 Bacteria 3734
1010 Ga0501039_0187606 3300049575 Bacteria 1626
1011 Ga0501040_0007295 3300049576 Bacteria 7163
1012 Ga0501040_0020937 3300049576 Bacteria 4361
1013 Ga0501040_0094803 3300049576 Bacteria 2077
1014 Ga0501040_0112454 3300049576 Bacteria 1905
1015 Ga0501041_0003440 3300049577 Bacteria 9111
1016 Ga0501041_0134828 3300049577 Bacteria 1539
1017 Ga0501042_0010330 3300049578 Bacteria 6251
1018 Ga0501042_0017883 3300049578 Bacteria 4898
1019 Ga0501042_0044566 3300049578 Bacteria 3161
1020 Ga0501042_0062756 3300049578 Bacteria 2655
1021 Ga0501042_0081726 3300049578 Bacteria 2316
1022 Ga0501042_0104307 3300049578 Bacteria 2040
1023 Ga0501042_0112166 3300049578 Bacteria 1963
1024 Ga0501043_0000587 3300049579 Bacteria 32215
1025 Ga0501046_0000443 3300049580 Bacteria 41637
1026 Ga0501046_0002209 3300049580 Bacteria 18390
1027 Ga0501047_0000321 3300049581 Bacteria 55420
1028 Ga0501047_0028750 3300049581 Bacteria 5361
1029 Ga0501048_0000336 3300049582 Bacteria 32387
1030 Ga0501048_0037368 3300049582 Bacteria 3487
1031 Ga0501068_0025852 3300049584 Bacteria 3455
1032 Ga0501069_0013225 3300049585 Bacteria 4398
1033 Ga0501069_0015723 3300049585 Bacteria 4057
1034 Ga0501069_0034529 3300049585 Bacteria 2786
1035 Ga0501069_0043607 3300049585 Bacteria 2483
1036 Ga0501069_0060934 3300049585 Bacteria 2107
1037 Ga0501069_0089268 3300049585 Bacteria 1742
1038 Ga0501070_0000354 3300049586 Bacteria 41627
1039 Ga0501070_0019793 3300049586 Bacteria 5644
1040 Ga0501070_0069408 3300049586 Bacteria 2918
1041 Ga0501070_0077285 3300049586 Bacteria 2755
1042 Ga0501070_0167828 3300049586 Bacteria 1808
1043 Ga0501071_0009527 3300049587 Bacteria 6473
1044 Ga0501071_0010306 3300049587 Bacteria 6259
1045 Ga0501071_0024317 3300049587 Bacteria 4237
1046 Ga0501071_0158450 3300049587 Bacteria 1691
1047 Ga0501072_0000517 3300049588 Bacteria 27742
1048 Ga0501072_0006920 3300049588 Bacteria 8609
1049 Ga0501072_0050104 3300049588 Bacteria 3288
1050 Ga0501072_0086008 3300049588 Bacteria 2495
1051 Ga0501072_0123020 3300049588 Bacteria 2067
1052 Ga0501072_0126760 3300049588 Bacteria 2034
1053 Ga0501073_0013645 3300049589 Bacteria 5911
1054 Ga0501073_0029719 3300049589 Bacteria 3905
1055 Ga0501074_0008948 3300049590 Bacteria 7262
1056 Ga0501074_0016482 3300049590 Bacteria 5364
1057 Ga0501074_0021021 3300049590 Bacteria 4740
1058 Ga0501074_0026492 3300049590 Bacteria 4203
1059 Ga0501074_0048043 3300049590 Bacteria 3083
1060 Ga0501074_0056607 3300049590 Bacteria 2826
1061 Ga0501074_0129296 3300049590 Bacteria 1807
1062 Ga0501075_0001259 3300049591 Bacteria 16393
1063 Ga0501075_0007340 3300049591 Bacteria 7645
1064 Ga0501075_0016242 3300049591 Bacteria 5359
1065 Ga0501076_0000710 3300049592 Bacteria 21481
1066 Ga0501076_0020736 3300049592 Bacteria 5033
1067 Ga0501076_0035717 3300049592 Bacteria 3889
1068 Ga0501076_0103370 3300049592 Bacteria 2298
1069 Ga0501077_0004020 3300049593 Bacteria 8874
1070 Ga0501079_0009561 3300049741 Bacteria 7351
1071 Ga0501079_0052330 3300049741 Bacteria 3151
1072 Ga0501080_0008519 3300049742 Bacteria 9298
1073 Ga0501080_0018770 3300049742 Bacteria 6401
1074 Ga0501081_0019127 3300049743 Bacteria 4555
1075 Ga0501081_0035346 3300049743 Bacteria 3401
1076 Ga0501081_0039587 3300049743 Bacteria 3227
1077 Ga0501083_0006159 3300049744 Bacteria 8510
1078 Ga0501083_0032660 3300049744 Bacteria 3568
1079 Ga0501035_0000380 3300049822 Bacteria 51102
1080 Ga0501035_0036377 3300049822 Bacteria 4462
1081 Ga0501044_0000681 3300049823 Bacteria 41084
1082 Ga0501044_0060609 3300049823 Bacteria 3874
1083 Ga0501044_0084578 3300049823 Bacteria 3206
1084 Ga0501044_0087319 3300049823 Bacteria 3150
1085 Ga0501045_0002778 3300049824 Bacteria 11955
1086 Ga0501045_0023645 3300049824 Bacteria 4408
1087 Ga0501045_0024403 3300049824 Bacteria 4341
1088 Ga0501045_0051616 3300049824 Bacteria 3001
1089 Ga0501045_0096095 3300049824 Bacteria 2192
1090 nmdc:mga0yw44_16097_c1 3300050492 Bacteria 4031
1091 nmdc:mga0yw44_4558_c1 3300050492 Bacteria 6382
1092 nmdc:mga0yw44_72501_c1 3300050492 Bacteria 2141
1093 nmdc:mga0yw44_87222_c1 3300050492 Bacteria 1967
1094 nmdc:mga05p37_14337_c1 3300050507 Bacteria 9516
1095 nmdc:mga05p37_162575_c1 3300050507 Bacteria 2726
1096 nmdc:mga05p37_21167_c2 3300050507 Bacteria 7331
1097 nmdc:mga05p37_22716_c2 3300050507 Bacteria 5879
1098 nmdc:mga05p37_246215_c1 3300050507 Bacteria 2146
1099 nmdc:mga05p37_407674_c1 3300050507 Bacteria 1585
1100 nmdc:mga05p37_44560_c1 3300050507 Bacteria 5457
1101 nmdc:mga09592_148082_c1 3300050508 Bacteria 2025
1102 nmdc:mga09592_59299_c1 3300050508 Bacteria 3235
1103 nmdc:mga09592_5985_c1 3300050508 Bacteria 9918
1104 nmdc:mga09592_6374_c1 3300050508 Bacteria 9611
1105 nmdc:mga0qj67_15405_c1 3300050509 Bacteria 5790
1106 nmdc:mga0qj67_18969_c1 3300050509 Bacteria 5248
1107 nmdc:mga06r32_126845_c1 3300050510 Bacteria 2521
1108 nmdc:mga06r32_244_c1 3300050510 Bacteria 44802
1109 nmdc:mga06r32_68265_c1 3300050510 Bacteria 3434
1110 nmdc:mga08y16_131777_c1 3300050511 Bacteria 2599
1111 nmdc:mga08y16_173159_c1 3300050511 Bacteria 2241
1112 nmdc:mga08y16_22986_c1 3300050511 Bacteria 6582
1113 nmdc:mga08y16_23135_c1 3300050511 Bacteria 6560
1114 nmdc:mga08y16_30153_c1 3300050511 Bacteria 5709
1115 nmdc:mga08y16_84929_c1 3300050511 Bacteria 3299
1116 nmdc:mga0n895_206876_c1 3300050512 Bacteria 1993
1117 nmdc:mga0n895_2605_c1 3300050512 Bacteria 14183
1118 nmdc:mga0n895_28347_c1 3300050512 Bacteria 5325
1119 nmdc:mga0n895_7227_c1 3300050512 Bacteria 9509
1120 nmdc:mga0rr50_28018_c1 3300050513 Bacteria 3954
1121 nmdc:mga08x19_18157_c1 3300050514 Bacteria 4309
1122 nmdc:mga08x19_55413_c1 3300050514 Bacteria 2555
1123 nmdc:mga0a205_189767_c1 3300050515 Bacteria 1948
1124 nmdc:mga0a205_24_c2 3300050515 Bacteria 81894
1125 nmdc:mga0a205_540_c1 3300050515 Bacteria 29856
1126 nmdc:mga0a205_67562_c1 3300050515 Bacteria 3453
1127 Ga0495601_0000013 3300053077 Bacteria 226476
1128 Ga0495601_0000304 3300053077 Bacteria 26118
1129 Ga0495601_0000326 3300053077 Bacteria 25282
1130 Ga0495601_0003210 3300053077 Bacteria 9356
1131 Ga0495601_0053134 3300053077 Bacteria 2560
1132 Ga0495601_0068164 3300053077 Bacteria 2267
1133 Ga0495612_0000136 3300053078 Bacteria 31282
1134 Ga0495612_0000312 3300053078 Bacteria 19614
1135 Ga0495612_0002565 3300053078 Bacteria 7492
1136 Ga0495612_0005159 3300053078 Bacteria 5399
1137 Ga0495612_0005579 3300053078 Bacteria 5201
1138 Ga0495655_0000001 3300053083 Bacteria 419518
1139 Ga0495655_0003329 3300053083 Bacteria 2642
1140 Ga0495595_0000003 3300053084 Bacteria 266465
1141 Ga0495595_0000172 3300053084 Bacteria 25608
1142 Ga0495619_0000021 3300053085 Bacteria 187095
1143 Ga0495619_0000031 3300053085 Bacteria 145508
1144 Ga0495619_0000106 3300053085 Bacteria 62413
1145 Ga0495619_0000836 3300053085 Bacteria 20199
1146 Ga0495619_0001746 3300053085 Bacteria 14440
1147 Ga0495619_0002472 3300053085 Bacteria 12091
1148 Ga0495619_0009846 3300053085 Bacteria 6024
1149 Ga0495619_0013727 3300053085 Bacteria 5108
1150 Ga0495619_0030485 3300053085 Bacteria 3492
1151 Ga0495619_0035066 3300053085 Bacteria 3263
1152 Ga0495619_0066584 3300053085 Bacteria 2404
1153 Ga0495619_0084158 3300053085 Bacteria 2146
1154 Ga0500566_0023867 3300053094 Bacteria 3591
1155 Ga0500641_0011610 3300053096 Bacteria 3200
1156 Ga0500556_0000771 3300053104 Bacteria 18957
1157 Ga0500614_005477 3300053123 Bacteria 2665
1158 Ga0500628_000010 3300053129 Bacteria 122210
1159 Ga0500616_0003419 3300053153 Bacteria 12157
1160 Ga0500616_0009210 3300053153 Bacteria 6022
1161 Ga0501084_0000440 3300054114 Bacteria 31982
1162 Ga0501084_0014400 3300054114 Bacteria 6554
1163 Ga0501084_0019930 3300054114 Bacteria 5590
1164 Ga0501084_0043094 3300054114 Bacteria 3775
1165 Ga0501084_0043250 3300054114 Bacteria 3769
1166 Ga0501084_0177549 3300054114 Bacteria 1798
1167 Ga0501082_0002337 3300060353 Bacteria 16599
1168 Ga0501082_0025609 3300060353 Bacteria 5083
1169 Ga0466962_0003445 3300061719 Bacteria 7536
1170 Ga0466962_0018114 3300061719 Bacteria 3387
1171 Ga0466962_0035137 3300061719 Bacteria 2399
1172 Ga0466962_0038642 3300061719 Bacteria 2285
1173 Ga0466962_0062945 3300061719 Bacteria 1771
1174 Ga0530510_0006663 3300061734 Bacteria 8055
1175 Ga0530510_0013146 3300061734 Bacteria 5822
1176 Ga0530510_0082617 3300061734 Bacteria 2339

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0164310 Ga0466967_0164310_22_1224 388
2 3300048914 Ga0496111_0032766 Ga0496111_0032766_2464_3663 388
3 3300048911 Ga0496108_0102782 Ga0496108_0102782_199_1617 404
4 3300046461 Ga0495641_0087717 Ga0495641_0087717_35_1303 411
5 3300048905 Ga0496102_0064989 Ga0496102_0064989_2026_3318 414
6 3300048910 Ga0496107_0021675 Ga0496107_0021675_52_1344 414
7 3300048911 Ga0496108_0271139 Ga0496108_0271139_173_1453 419
8 3300048904 Ga0496101_0111615 Ga0496101_0111615_12_1307 420
9 3300044735 Ga0466968_0023533 Ga0466968_0023533_1186_2472 421
10 3300009147 Ga0114129_10447196 Ga0114129_104471961 424
11 3300046463 Ga0495653_0062262 Ga0495653_0062262_43_1347 426
12 3300048908 Ga0496105_0064643 Ga0496105_0064643_1681_2985 426
13 3300048913 Ga0496110_0224326 Ga0496110_0224326_325_1647 433
14 3300049824 Ga0501045_0024403 Ga0501045_0024403_2986_4302 434
15 3300039453 Ga0436362_0534151 Ga0436362_0534151_15_1349 437
16 3300048910 Ga0496107_0118878 Ga0496107_0118878_17_1351 437
17 3300044694 Ga0466963_0003004 Ga0466963_0003004_8128_9468 438
18 3300044719 Ga0466971_0086977 Ga0466971_0086977_18_1355 438
19 3300053085 Ga0495619_0084158 Ga0495619_0084158_760_2097 438
20 3300045836 Ga0466958_0053947 Ga0466958_0053947_1069_2409 439
21 3300046462 Ga0495651_0174542 Ga0495651_0174542_24_1481 440
22 3300046463 Ga0495653_0108363 Ga0495653_0108363_289_1746 440
23 3300053085 Ga0495619_0030485 Ga0495619_0030485_496_1953 440
24 3300049588 Ga0501072_0123020 Ga0501072_0123020_638_2008 441
25 3300049824 Ga0501045_0051616 Ga0501045_0051616_1335_2762 441
26 3300046678 Ga0495599_0024325 Ga0495599_0024325_88_1443 443
27 3300010375 Ga0105239_10120285 Ga0105239_101202851 444
28 3300049586 Ga0501070_0019793 Ga0501070_0019793_4265_5608 445
29 3300041408 Ga0439453_0001968 Ga0439453_0001968_879_2255 446
30 3300049577 Ga0501041_0134828 Ga0501041_0134828_166_1509 446
31 3300049743 Ga0501081_0019127 Ga0501081_0019127_57_1400 446
32 3300011119 Ga0105246_10139585 Ga0105246_101395851 448
33 3300049575 Ga0501039_0187606 Ga0501039_0187606_127_1575 448
34 3300005937 Ga0081455_10001981 Ga0081455_100019816 454
35 3300037418 Ga0395900_0011245 Ga0395900_0011245_985_2424 459
36 3300005329 Ga0070683_100158979 Ga0070683_1001589792 460
37 3300005535 Ga0070684_100034900 Ga0070684_1000349003 460
38 3300009093 Ga0105240_10110181 Ga0105240_101101813 460
39 3300020082 Ga0206353_11536562 Ga0206353_115365625 460
40 3300044656 Ga0466969_0006958 Ga0466969_0006958_4288_5709 461
41 3300044693 Ga0466961_0049240 Ga0466961_0049240_870_2291 461
42 3300044694 Ga0466963_0008179 Ga0466963_0008179_1444_2865 461
43 3300044735 Ga0466968_0002564 Ga0466968_0002564_4726_6147 461
44 3300044765 Ga0466970_0004127 Ga0466970_0004127_423_1844 461
45 3300044842 Ga0466957_0014318 Ga0466957_0014318_1449_2870 461
46 3300045049 Ga0466959_0004063 Ga0466959_0004063_7651_9072 461
47 3300045976 Ga0466967_0055584 Ga0466967_0055584_1723_3144 461
48 3300009147 Ga0114129_10024279 Ga0114129_100242792 462
49 3300044842 Ga0466957_0035244 Ga0466957_0035244_1539_2960 462
50 3300049582 Ga0501048_0037368 Ga0501048_0037368_1113_2576 462
51 3300049592 Ga0501076_0103370 Ga0501076_0103370_443_1906 462
52 3300025912 Ga0207707_10116782 Ga0207707_101167822 464
53 3300005329 Ga0070683_100000682 Ga0070683_10000068210 466
54 3300005458 Ga0070681_10101094 Ga0070681_101010942 466
55 3300005535 Ga0070684_100008210 Ga0070684_1000082109 466
56 3300025912 Ga0207707_10010986 Ga0207707_100109862 466
57 3300025944 Ga0207661_10033341 Ga0207661_100333412 466
58 3300045976 Ga0466967_0098308 Ga0466967_0098308_869_2311 466
59 3300005435 Ga0070714_100219592 Ga0070714_1002195921 467
60 3300025909 Ga0207705_10011755 Ga0207705_100117554 467
61 3300044694 Ga0466963_0038954 Ga0466963_0038954_727_2172 467
62 3300044694 Ga0466963_0076656 Ga0466963_0076656_774_2219 467
63 3300044706 Ga0466964_0024069 Ga0466964_0024069_98_1543 467
64 3300045976 Ga0466967_0004922 Ga0466967_0004922_3631_5076 467
65 3300049824 Ga0501045_0023645 Ga0501045_0023645_1673_3151 467
66 3300005336 Ga0070680_100016204 Ga0070680_1000162046 468
67 3300005364 Ga0070673_100138496 Ga0070673_1001384962 468
68 3300005434 Ga0070709_10044052 Ga0070709_100440523 468
69 3300005435 Ga0070714_100031539 Ga0070714_1000315393 468
70 3300005456 Ga0070678_100033935 Ga0070678_1000339353 468
71 3300005530 Ga0070679_100009474 Ga0070679_1000094744 468
72 3300005547 Ga0070693_100011458 Ga0070693_1000114582 468
73 3300005563 Ga0068855_100014745 Ga0068855_1000147458 468
74 3300006028 Ga0070717_10004065 Ga0070717_100040653 468
75 3300006173 Ga0070716_100064474 Ga0070716_1000644742 468
76 3300006871 Ga0075434_100018375 Ga0075434_1000183753 468
77 3300006914 Ga0075436_100147263 Ga0075436_1001472631 468
78 3300013104 Ga0157370_10008024 Ga0157370_100080247 468
79 3300013105 Ga0157369_10072870 Ga0157369_100728703 468
80 3300013105 Ga0157369_10089867 Ga0157369_100898673 468
81 3300025909 Ga0207705_10017978 Ga0207705_100179783 468
82 3300025915 Ga0207693_10010457 Ga0207693_100104572 468
83 3300025915 Ga0207693_10019840 Ga0207693_100198405 468
84 3300025919 Ga0207657_10005572 Ga0207657_100055728 468
85 3300025921 Ga0207652_10081403 Ga0207652_100814033 468
86 3300025929 Ga0207664_10006739 Ga0207664_100067394 468
87 3300025939 Ga0207665_10003251 Ga0207665_100032512 468
88 3300025944 Ga0207661_10052959 Ga0207661_100529593 468
89 3300025960 Ga0207651_10080053 Ga0207651_100800532 468
90 3300026121 Ga0207683_10002374 Ga0207683_1000237414 468
91 3300035090 Ga0373949_0006908 Ga0373949_0006908_331_1773 468
92 3300035691 Ga0373931_0020433 Ga0373931_0020433_918_2360 468
93 3300048905 Ga0496102_0003661 Ga0496102_0003661_9580_11022 468
94 3300048907 Ga0496104_0005543 Ga0496104_0005543_3268_4710 468
95 3300048908 Ga0496105_0011882 Ga0496105_0011882_158_1600 468
96 3300048918 Ga0496115_0002542 Ga0496115_0002542_788_2230 468
97 3300048918 Ga0496115_0022547 Ga0496115_0022547_3406_4848 468
98 3300050514 nmdc:mga08x19_18157_c1 nmdc:mga08x19_18157_c1_196_1638 468
99 3300005336 Ga0070680_100086547 Ga0070680_1000865472 469
100 3300005366 Ga0070659_100017601 Ga0070659_1000176013 469
101 3300005435 Ga0070714_100042377 Ga0070714_1000423772 469
102 3300005436 Ga0070713_100031284 Ga0070713_1000312843 469
103 3300005530 Ga0070679_100031188 Ga0070679_1000311885 469
104 3300005530 Ga0070679_100254294 Ga0070679_1002542942 469
105 3300005535 Ga0070684_100139387 Ga0070684_1001393872 469
106 3300005545 Ga0070695_100000265 Ga0070695_1000002656 469
107 3300009093 Ga0105240_10058261 Ga0105240_100582612 469
108 3300013307 Ga0157372_10183659 Ga0157372_101836592 469
109 3300025912 Ga0207707_10041204 Ga0207707_100412043 469
110 3300025915 Ga0207693_10000920 Ga0207693_100009207 469
111 3300025919 Ga0207657_10008838 Ga0207657_100088382 469
112 3300025924 Ga0207694_10043428 Ga0207694_100434282 469
113 3300025927 Ga0207687_10084038 Ga0207687_100840382 469
114 3300025929 Ga0207664_10017802 Ga0207664_100178022 469
115 3300025939 Ga0207665_10124725 Ga0207665_101247252 469
116 3300035724 Ga0373933_0077155 Ga0373933_0077155_374_1831 469
117 3300036401 Ga0373937_0000355 Ga0373937_0000355_11442_12899 469
118 3300044693 Ga0466961_0005282 Ga0466961_0005282_4839_6296 469
119 3300044694 Ga0466963_0000010 Ga0466963_0000010_59895_61352 469
120 3300044694 Ga0466963_0000649 Ga0466963_0000649_5467_6924 469
121 3300044694 Ga0466963_0002000 Ga0466963_0002000_2614_4071 469
122 3300044706 Ga0466964_0000213 Ga0466964_0000213_5036_6493 469
123 3300044706 Ga0466964_0008942 Ga0466964_0008942_1764_3218 469
124 3300044706 Ga0466964_0012120 Ga0466964_0012120_1634_3091 469
125 3300044706 Ga0466964_0045512 Ga0466964_0045512_40_1497 469
126 3300044719 Ga0466971_0004429 Ga0466971_0004429_3874_5331 469
127 3300044719 Ga0466971_0010626 Ga0466971_0010626_920_2377 469
128 3300044842 Ga0466957_0008323 Ga0466957_0008323_2448_3905 469
129 3300044842 Ga0466957_0052692 Ga0466957_0052692_659_2116 469
130 3300044901 Ga0466960_0009445 Ga0466960_0009445_1161_2618 469
131 3300045049 Ga0466959_0003840 Ga0466959_0003840_3035_4492 469
132 3300045836 Ga0466958_0002150 Ga0466958_0002150_8084_9541 469
133 3300045976 Ga0466967_0001331 Ga0466967_0001331_9429_10886 469
134 3300045976 Ga0466967_0010334 Ga0466967_0010334_3027_4481 469
135 3300045976 Ga0466967_0070911 Ga0466967_0070911_474_1931 469
136 3300045976 Ga0466967_0094359 Ga0466967_0094359_633_2090 469
137 3300045976 Ga0466967_0109242 Ga0466967_0109242_558_2015 469
138 3300046454 Ga0495592_0000732 Ga0495592_0000732_7889_9346 469
139 3300046462 Ga0495651_0000029 Ga0495651_0000029_35746_37203 469
140 3300046463 Ga0495653_0001363 Ga0495653_0001363_4565_6022 469
141 3300046463 Ga0495653_0030477 Ga0495653_0030477_2244_3698 469
142 3300046477 Ga0495664_0102031 Ga0495664_0102031_161_1618 469
143 3300046514 Ga0495618_0022141 Ga0495618_0022141_656_2113 469
144 3300046516 Ga0495628_0000016 Ga0495628_0000016_35719_37176 469
145 3300046529 Ga0495652_0000045 Ga0495652_0000045_113868_115325 469
146 3300046536 Ga0495587_0000083 Ga0495587_0000083_6521_7978 469
147 3300046536 Ga0495587_0014131 Ga0495587_0014131_1576_3027 469
148 3300046543 Ga0495645_0001902 Ga0495645_0001902_4504_5961 469
149 3300046559 Ga0495667_0034052 Ga0495667_0034052_68_1522 469
150 3300046675 Ga0495657_0011595 Ga0495657_0011595_3950_5407 469
151 3300046678 Ga0495599_0000187 Ga0495599_0000187_6190_7647 469
152 3300046679 Ga0495623_0000121 Ga0495623_0000121_35738_37195 469
153 3300046680 Ga0495646_0001537 Ga0495646_0001537_7989_9446 469
154 3300046683 Ga0495658_0036522 Ga0495658_0036522_335_1789 469
155 3300046690 Ga0495624_0108268 Ga0495624_0108268_137_1591 469
156 3300047317 Ga0495604_0000072 Ga0495604_0000072_81695_83152 469
157 3300047319 Ga0495674_0083367 Ga0495674_0083367_109_1566 469
158 3300047444 Ga0495675_0000031 Ga0495675_0000031_66653_68110 469
159 3300047471 Ga0495684_0018384 Ga0495684_0018384_1251_2705 469
160 3300048088 Ga0495602_0000133 Ga0495602_0000133_35746_37203 469
161 3300048905 Ga0496102_0005815 Ga0496102_0005815_2529_3986 469
162 3300048907 Ga0496104_0039390 Ga0496104_0039390_45_1499 469
163 3300048908 Ga0496105_0010632 Ga0496105_0010632_1606_3060 469
164 3300048911 Ga0496108_0036442 Ga0496108_0036442_12_1466 469
165 3300048912 Ga0496109_0009062 Ga0496109_0009062_4255_5709 469
166 3300048912 Ga0496109_0116828 Ga0496109_0116828_402_1850 469
167 3300048912 Ga0496109_0239826 Ga0496109_0239826_163_1617 469
168 3300048915 Ga0496112_0053133 Ga0496112_0053133_2354_3811 469
169 3300048915 Ga0496112_0175849 Ga0496112_0175849_584_2041 469
170 3300048922 Ga0496119_0045690 Ga0496119_0045690_453_1955 469
171 3300050507 nmdc:mga05p37_21167_c2 nmdc:mga05p37_21167_c2_5014_6468 469
172 3300050512 nmdc:mga0n895_206876_c1 nmdc:mga0n895_206876_c1_352_1815 469
173 3300050513 nmdc:mga0rr50_28018_c1 nmdc:mga0rr50_28018_c1_1253_2716 469
174 3300053077 Ga0495601_0000304 Ga0495601_0000304_12990_14447 469
175 3300053085 Ga0495619_0000836 Ga0495619_0000836_13461_14918 469
176 3300061719 Ga0466962_0035137 Ga0466962_0035137_65_1522 469
177 3300061719 Ga0466962_0038642 Ga0466962_0038642_653_2110 469
178 3300005985 Ga0081539_10000288 Ga0081539_1000028875 470
179 3300006038 Ga0075365_10013272 Ga0075365_100132723 470
180 3300006051 Ga0075364_10075351 Ga0075364_100753512 470
181 3300006846 Ga0075430_100017889 Ga0075430_1000178895 470
182 3300006880 Ga0075429_100073357 Ga0075429_1000733572 470
183 3300037471 Ga0395905_0109187 Ga0395905_0109187_63_1478 470
184 3300053085 Ga0495619_0066584 Ga0495619_0066584_743_2197 470
185 3300045976 Ga0466967_0054758 Ga0466967_0054758_87_1589 471
186 3300046514 Ga0495618_0008047 Ga0495618_0008047_465_1916 471
187 3300046517 Ga0495630_0087042 Ga0495630_0087042_860_2311 471
188 3300046663 Ga0495635_0015687 Ga0495635_0015687_3764_5215 471
189 3300053077 Ga0495601_0068164 Ga0495601_0068164_78_1529 471
190 3300005544 Ga0070686_100125632 Ga0070686_1001256322 472
191 3300005937 Ga0081455_10016719 Ga0081455_100167197 472
192 3300005981 Ga0081538_10001868 Ga0081538_100018689 472
193 3300005981 Ga0081538_10031229 Ga0081538_100312293 472
194 3300025934 Ga0207686_10019818 Ga0207686_100198182 472
195 3300031824 Ga0307413_10110574 Ga0307413_101105742 472
196 3300031995 Ga0307409_100184376 Ga0307409_1001843761 472
197 3300032126 Ga0307415_100003690 Ga0307415_1000036901 472
198 3300037418 Ga0395900_0076548 Ga0395900_0076548_1756_3207 472
199 3300037466 Ga0395898_0174659 Ga0395898_0174659_529_1980 472
200 3300037471 Ga0395905_0090877 Ga0395905_0090877_1121_2572 472
201 3300039438 Ga0436360_0953769 Ga0436360_0953769_540_2009 472
202 3300046642 Ga0495634_0045320 Ga0495634_0045320_1494_2933 472
203 3300044673 Ga0453683_0031377 Ga0453683_0031377_685_2202 473
204 3300045051 Ga0451576_0012750 Ga0451576_0012750_7221_8738 473
205 3300005981 Ga0081538_10001885 Ga0081538_1000188512 474
206 3300005981 Ga0081538_10057348 Ga0081538_100573482 474
207 3300049574 Ga0501038_0029084 Ga0501038_0029084_2494_3930 474
208 3300049576 Ga0501040_0112454 Ga0501040_0112454_51_1487 474
209 3300049586 Ga0501070_0069408 Ga0501070_0069408_374_1810 474
210 3300049587 Ga0501071_0010306 Ga0501071_0010306_3732_5168 474
211 3300049590 Ga0501074_0129296 Ga0501074_0129296_59_1495 474
212 3300054114 Ga0501084_0043094 Ga0501084_0043094_13_1449 474
213 3300061734 Ga0530510_0006663 Ga0530510_0006663_6106_7542 474
214 3300005327 Ga0070658_10156784 Ga0070658_101567842 475
215 3300005530 Ga0070679_100064550 Ga0070679_1000645503 475
216 3300009094 Ga0111539_10008241 Ga0111539_100082417 475
217 3300025921 Ga0207652_10224982 Ga0207652_102249822 475
218 3300027907 Ga0207428_10054977 Ga0207428_100549773 475
219 3300042146 Ga0450907_007797 Ga0450907_007797_46_1521 475
220 3300050511 nmdc:mga08y16_23135_c1 nmdc:mga08y16_23135_c1_4138_5631 475
221 3300005339 Ga0070660_100001782 Ga0070660_10000178215 476
222 3300006846 Ga0075430_100039029 Ga0075430_1000390292 476
223 3300011119 Ga0105246_10014139 Ga0105246_100141394 476
224 3300025919 Ga0207657_10021014 Ga0207657_100210143 476
225 3300044684 Ga0466966_0023906 Ga0466966_0023906_2369_3826 476
226 3300045049 Ga0466959_0083050 Ga0466959_0083050_557_2041 476
227 3300045836 Ga0466958_0003505 Ga0466958_0003505_1624_3108 476
228 3300048907 Ga0496104_0030115 Ga0496104_0030115_2684_4141 476
229 3300048908 Ga0496105_0026130 Ga0496105_0026130_92_1549 476
230 3300048910 Ga0496107_0044880 Ga0496107_0044880_377_1834 476
231 3300048912 Ga0496109_0076768 Ga0496109_0076768_188_1645 476
232 3300048916 Ga0496113_0010329 Ga0496113_0010329_3473_4930 476
233 3300049585 Ga0501069_0015723 Ga0501069_0015723_217_1674 476
234 3300050507 nmdc:mga05p37_407674_c1 nmdc:mga05p37_407674_c1_17_1528 476
235 3300050509 nmdc:mga0qj67_18969_c1 nmdc:mga0qj67_18969_c1_2954_4423 476
236 3300061719 Ga0466962_0062945 Ga0466962_0062945_14_1498 476
237 3300003373 JGI25407J50210_10001927 JGI25407J50210_100019272 477
238 3300005937 Ga0081455_10043246 Ga0081455_100432463 477
239 3300005981 Ga0081538_10000920 Ga0081538_1000092022 477
240 3300037312 Ga0395899_0077262 Ga0395899_0077262_901_2385 477
241 3300037418 Ga0395900_0165799 Ga0395900_0165799_45_1529 477
242 3300037466 Ga0395898_0037130 Ga0395898_0037130_2723_4207 477
243 3300044694 Ga0466963_0026379 Ga0466963_0026379_1309_2754 477
244 3300044719 Ga0466971_0014088 Ga0466971_0014088_643_2091 477
245 3300045836 Ga0466958_0050797 Ga0466958_0050797_999_2447 477
246 3300045976 Ga0466967_0026681 Ga0466967_0026681_1865_3313 477
247 3300045976 Ga0466967_0050611 Ga0466967_0050611_2070_3518 477
248 3300045976 Ga0466967_0130811 Ga0466967_0130811_740_2188 477
249 3300045976 Ga0466967_0312490 Ga0466967_0312490_38_1483 477
250 3300049578 Ga0501042_0081726 Ga0501042_0081726_338_1837 477
251 3300050509 nmdc:mga0qj67_15405_c1 nmdc:mga0qj67_15405_c1_918_2387 477
252 3300054114 Ga0501084_0177549 Ga0501084_0177549_13_1512 477
253 3300005548 Ga0070665_100001191 Ga0070665_10000119123 478
254 3300009148 Ga0105243_10062605 Ga0105243_100626053 478
255 3300035116 Ga0373945_0001407 Ga0373945_0001407_2889_4373 478
256 3300035170 Ga0373943_0001797 Ga0373943_0001797_7342_8826 478
257 3300035692 Ga0373935_0039197 Ga0373935_0039197_1262_2746 478
258 3300035725 Ga0373947_0001552 Ga0373947_0001552_11757_13241 478
259 3300044694 Ga0466963_0009198 Ga0466963_0009198_449_1900 478
260 3300044694 Ga0466963_0037534 Ga0466963_0037534_820_2271 478
261 3300045976 Ga0466967_0000332 Ga0466967_0000332_7443_8945 478
262 3300045976 Ga0466967_0002553 Ga0466967_0002553_2230_3681 478
263 3300045976 Ga0466967_0034677 Ga0466967_0034677_2685_4133 478
264 3300046459 Ga0495629_0016715 Ga0495629_0016715_1795_3279 478
265 3300046461 Ga0495641_0003908 Ga0495641_0003908_940_2424 478
266 3300046462 Ga0495651_0014666 Ga0495651_0014666_782_2266 478
267 3300046463 Ga0495653_0008307 Ga0495653_0008307_5731_7215 478
268 3300046472 Ga0495580_0015952 Ga0495580_0015952_3498_4982 478
269 3300046475 Ga0495639_0003274 Ga0495639_0003274_1749_3233 478
270 3300046477 Ga0495664_0043944 Ga0495664_0043944_649_2133 478
271 3300046514 Ga0495618_0069294 Ga0495618_0069294_531_2015 478
272 3300046516 Ga0495628_0049354 Ga0495628_0049354_928_2412 478
273 3300046517 Ga0495630_0000505 Ga0495630_0000505_14012_15496 478
274 3300046526 Ga0495666_0001576 Ga0495666_0001576_9357_10841 478
275 3300046531 Ga0495665_0019672 Ga0495665_0019672_777_2261 478
276 3300046533 Ga0495640_0039081 Ga0495640_0039081_228_1712 478
277 3300046535 Ga0495586_0022930 Ga0495586_0022930_1621_3105 478
278 3300046543 Ga0495645_0077688 Ga0495645_0077688_124_1608 478
279 3300046559 Ga0495667_0053041 Ga0495667_0053041_373_1857 478
280 3300046642 Ga0495634_0003355 Ga0495634_0003355_10600_12084 478
281 3300046663 Ga0495635_0012397 Ga0495635_0012397_78_1562 478
282 3300046678 Ga0495599_0043015 Ga0495599_0043015_985_2469 478
283 3300046681 Ga0495647_0000468 Ga0495647_0000468_9986_11470 478
284 3300046683 Ga0495658_0012335 Ga0495658_0012335_228_1712 478
285 3300046690 Ga0495624_0005932 Ga0495624_0005932_391_1875 478
286 3300046809 Ga0495600_0042473 Ga0495600_0042473_963_2447 478
287 3300047319 Ga0495674_0012591 Ga0495674_0012591_914_2398 478
288 3300047321 Ga0495676_0059321 Ga0495676_0059321_519_2003 478
289 3300047322 Ga0495680_0004810 Ga0495680_0004810_2612_4096 478
290 3300047471 Ga0495684_0021987 Ga0495684_0021987_2895_4379 478
291 3300047673 Ga0495593_0000333 Ga0495593_0000333_14567_16051 478
292 3300048089 Ga0495614_0000165 Ga0495614_0000165_21788_23272 478
293 3300048907 Ga0496104_0000001 Ga0496104_0000001_640159_641706 478
294 3300048913 Ga0496110_0000039 Ga0496110_0000039_45806_47353 478
295 3300048914 Ga0496111_0001293 Ga0496111_0001293_9729_11276 478
296 3300053078 Ga0495612_0005159 Ga0495612_0005159_959_2443 478
297 3300053104 Ga0500556_0000771 Ga0500556_0000771_425_1894 478
298 3300053153 Ga0500616_0003419 Ga0500616_0003419_425_1894 478
299 3300003203 JGI25406J46586_10026917 JGI25406J46586_100269172 479
300 3300005985 Ga0081539_10003296 Ga0081539_1000329613 479
301 3300005985 Ga0081539_10006119 Ga0081539_100061193 479
302 3300006844 Ga0075428_100053256 Ga0075428_1000532564 479
303 3300009094 Ga0111539_10022251 Ga0111539_100222514 479
304 3300026075 Ga0207708_10086924 Ga0207708_100869242 479
305 3300027907 Ga0207428_10018799 Ga0207428_100187994 479
306 3300045836 Ga0466958_0003309 Ga0466958_0003309_4489_6003 479
307 3300049568 Ga0501031_0028123 Ga0501031_0028123_1153_2643 479
308 3300049572 Ga0501036_0005110 Ga0501036_0005110_1024_2514 479
309 3300049574 Ga0501038_0031807 Ga0501038_0031807_989_2479 479
310 3300049575 Ga0501039_0001294 Ga0501039_0001294_8830_10320 479
311 3300049576 Ga0501040_0007295 Ga0501040_0007295_2224_3714 479
312 3300049576 Ga0501040_0094803 Ga0501040_0094803_536_2014 479
313 3300049577 Ga0501041_0003440 Ga0501041_0003440_5090_6580 479
314 3300049578 Ga0501042_0010330 Ga0501042_0010330_3589_5079 479
315 3300049580 Ga0501046_0002209 Ga0501046_0002209_14693_16183 479
316 3300049585 Ga0501069_0013225 Ga0501069_0013225_861_2351 479
317 3300049585 Ga0501069_0060934 Ga0501069_0060934_463_1944 479
318 3300049587 Ga0501071_0009527 Ga0501071_0009527_2536_4026 479
319 3300049588 Ga0501072_0000517 Ga0501072_0000517_19688_21178 479
320 3300049588 Ga0501072_0086008 Ga0501072_0086008_538_2016 479
321 3300049590 Ga0501074_0016482 Ga0501074_0016482_2135_3625 479
322 3300049591 Ga0501075_0007340 Ga0501075_0007340_5432_6922 479
323 3300049592 Ga0501076_0000710 Ga0501076_0000710_14823_16313 479
324 3300049593 Ga0501077_0004020 Ga0501077_0004020_3549_5039 479
325 3300049743 Ga0501081_0035346 Ga0501081_0035346_393_1883 479
326 3300049822 Ga0501035_0036377 Ga0501035_0036377_1612_3102 479
327 3300049824 Ga0501045_0002778 Ga0501045_0002778_6581_8071 479
328 3300050511 nmdc:mga08y16_22986_c1 nmdc:mga08y16_22986_c1_3166_4620 479
329 3300054114 Ga0501084_0000440 Ga0501084_0000440_28316_29806 479
330 3300060353 Ga0501082_0002337 Ga0501082_0002337_12566_14056 479
331 3300061734 Ga0530510_0013146 Ga0530510_0013146_2190_3680 479
332 3300005981 Ga0081538_10001951 Ga0081538_100019516 480
333 3300031852 Ga0307410_10031150 Ga0307410_100311503 480
334 3300031903 Ga0307407_10010086 Ga0307407_100100862 480
335 3300031995 Ga0307409_100002102 Ga0307409_1000021026 480
336 3300032002 Ga0307416_100022798 Ga0307416_1000227984 480
337 3300032005 Ga0307411_10128450 Ga0307411_101284502 480
338 3300037312 Ga0395899_0047643 Ga0395899_0047643_749_2233 480
339 3300037471 Ga0395905_0001832 Ga0395905_0001832_10939_12423 480
340 3300005329 Ga0070683_100006431 Ga0070683_1000064316 481
341 3300005336 Ga0070680_100003345 Ga0070680_1000033455 481
342 3300005366 Ga0070659_100018207 Ga0070659_1000182072 481
343 3300005457 Ga0070662_100003078 Ga0070662_1000030786 481
344 3300005458 Ga0070681_10004654 Ga0070681_100046549 481
345 3300005530 Ga0070679_100003939 Ga0070679_1000039398 481
346 3300005535 Ga0070684_100008468 Ga0070684_1000084684 481
347 3300005577 Ga0068857_100149959 Ga0068857_1001499592 481
348 3300005614 Ga0068856_100094185 Ga0068856_1000941852 481
349 3300005981 Ga0081538_10000259 Ga0081538_1000025923 481
350 3300006844 Ga0075428_100064842 Ga0075428_1000648422 481
351 3300006844 Ga0075428_100145148 Ga0075428_1001451483 481
352 3300009553 Ga0105249_10009291 Ga0105249_100092915 481
353 3300013105 Ga0157369_10031554 Ga0157369_100315545 481
354 3300025912 Ga0207707_10006637 Ga0207707_100066374 481
355 3300025917 Ga0207660_10004934 Ga0207660_100049343 481
356 3300025921 Ga0207652_10008277 Ga0207652_100082775 481
357 3300025933 Ga0207706_10006002 Ga0207706_100060029 481
358 3300025944 Ga0207661_10002814 Ga0207661_100028146 481
359 3300025972 Ga0207668_10018553 Ga0207668_100185533 481
360 3300026116 Ga0207674_10164679 Ga0207674_101646792 481
361 3300026118 Ga0207675_100001704 Ga0207675_1000017042 481
362 3300035691 Ga0373931_0020416 Ga0373931_0020416_1242_2702 481
363 3300038443 Ga0395901_0213677 Ga0395901_0213677_509_1969 481
364 3300049574 Ga0501038_0133977 Ga0501038_0133977_544_2016 481
365 3300049585 Ga0501069_0089268 Ga0501069_0089268_181_1653 481
366 3300049589 Ga0501073_0029719 Ga0501073_0029719_2240_3712 481
367 3300049590 Ga0501074_0048043 Ga0501074_0048043_1233_2705 481
368 3300049823 Ga0501044_0087319 Ga0501044_0087319_445_1917 481
369 3300050507 nmdc:mga05p37_246215_c1 nmdc:mga05p37_246215_c1_611_2068 481
370 3300054114 Ga0501084_0043250 Ga0501084_0043250_292_1764 481
371 3300005435 Ga0070714_100064090 Ga0070714_1000640903 482
372 3300005436 Ga0070713_100022221 Ga0070713_1000222213 482
373 3300005981 Ga0081538_10000464 Ga0081538_1000046425 482
374 3300009094 Ga0111539_10040504 Ga0111539_100405044 482
375 3300025915 Ga0207693_10014455 Ga0207693_100144554 482
376 3300026142 Ga0207698_10120357 Ga0207698_101203572 482
377 3300031901 Ga0307406_10042399 Ga0307406_100423992 482
378 3300049578 Ga0501042_0112166 Ga0501042_0112166_62_1525 482
379 3300050507 nmdc:mga05p37_22716_c2 nmdc:mga05p37_22716_c2_816_2279 482
380 3300050511 nmdc:mga08y16_84929_c1 nmdc:mga08y16_84929_c1_40_1503 482
381 3300003373 JGI25407J50210_10002817 JGI25407J50210_100028174 483
382 3300005617 Ga0068859_100205402 Ga0068859_1002054022 483
383 3300005981 Ga0081538_10001367 Ga0081538_1000136713 483
384 3300006847 Ga0075431_100064714 Ga0075431_1000647143 483
385 3300006931 Ga0097620_100205407 Ga0097620_1002054072 483
386 3300009093 Ga0105240_10061141 Ga0105240_100611412 483
387 3300013104 Ga0157370_10012340 Ga0157370_100123407 483
388 3300025914 Ga0207671_10090654 Ga0207671_100906542 483
389 3300026116 Ga0207674_10257859 Ga0207674_102578591 483
390 3300046514 Ga0495618_0000478 Ga0495618_0000478_16283_17854 483
391 3300050510 nmdc:mga06r32_68265_c1 nmdc:mga06r32_68265_c1_810_2315 483
392 3300005615 Ga0070702_100047882 Ga0070702_1000478822 484
393 3300005981 Ga0081538_10046302 Ga0081538_100463023 484
394 3300026075 Ga0207708_10072952 Ga0207708_100729523 484
395 3300031731 Ga0307405_10060015 Ga0307405_100600152 484
396 3300032126 Ga0307415_100001872 Ga0307415_1000018726 484
397 3300037312 Ga0395899_0036378 Ga0395899_0036378_1654_3129 484
398 3300037466 Ga0395898_0023591 Ga0395898_0023591_2992_4494 484
399 3300037466 Ga0395898_0054637 Ga0395898_0054637_1755_3230 484
400 3300037471 Ga0395905_0048185 Ga0395905_0048185_1213_2688 484
401 3300038443 Ga0395901_0028513 Ga0395901_0028513_1850_3325 484
402 3300048905 Ga0496102_0000002 Ga0496102_0000002_454107_455666 484
403 3300048906 Ga0496103_0000017 Ga0496103_0000017_47324_48883 484
404 3300048910 Ga0496107_0154467 Ga0496107_0154467_14_1489 484
405 3300049742 Ga0501080_0008519 Ga0501080_0008519_2380_3936 484
406 3300036712 Ga0316584_0004124 Ga0316584_0004124_6941_8476 485
407 3300037466 Ga0395898_0111523 Ga0395898_0111523_342_1847 485
408 3300044694 Ga0466963_0106562 Ga0466963_0106562_320_1810 485
409 3300044719 Ga0466971_0019320 Ga0466971_0019320_739_2223 485
410 3300044901 Ga0466960_0000054 Ga0466960_0000054_10716_12230 485
411 3300045976 Ga0466967_0008361 Ga0466967_0008361_3555_5075 485
412 3300046460 Ga0495638_0015309 Ga0495638_0015309_867_2381 485
413 3300046471 Ga0495650_0000055 Ga0495650_0000055_21090_22586 485
414 3300046511 Ga0495608_0000068 Ga0495608_0000068_28499_30004 485
415 3300046675 Ga0495657_0000004 Ga0495657_0000004_72248_73753 485
416 3300047444 Ga0495675_0000107 Ga0495675_0000107_26034_27539 485
417 3300048915 Ga0496112_0016477 Ga0496112_0016477_4735_6231 485
418 3300048924 Ga0496121_0012140 Ga0496121_0012140_3799_5319 485
419 3300050510 nmdc:mga06r32_126845_c1 nmdc:mga06r32_126845_c1_904_2376 485
420 3300053084 Ga0495595_0000003 Ga0495595_0000003_72248_73753 485
421 3300053085 Ga0495619_0000106 Ga0495619_0000106_32420_33925 485
422 3300053153 Ga0500616_0009210 Ga0500616_0009210_1808_3301 485
423 3300061719 Ga0466962_0018114 Ga0466962_0018114_1637_3121 485
424 3300005981 Ga0081538_10004433 Ga0081538_1000443310 486
425 3300006880 Ga0075429_100080839 Ga0075429_1000808392 486
426 3300025903 Ga0207680_10050043 Ga0207680_100500431 486
427 3300031852 Ga0307410_10013468 Ga0307410_100134684 486
428 3300050508 nmdc:mga09592_59299_c1 nmdc:mga09592_59299_c1_712_2208 486
429 3300005439 Ga0070711_100076384 Ga0070711_1000763842 487
430 3300005577 Ga0068857_100062863 Ga0068857_1000628632 487
431 3300005937 Ga0081455_10026557 Ga0081455_100265574 487
432 3300005981 Ga0081538_10000671 Ga0081538_1000067128 487
433 3300005981 Ga0081538_10005710 Ga0081538_100057106 487
434 3300025916 Ga0207663_10058760 Ga0207663_100587602 487
435 3300026116 Ga0207674_10096118 Ga0207674_100961183 487
436 3300046477 Ga0495664_0000007 Ga0495664_0000007_337263_338870 487
437 3300046680 Ga0495646_0030054 Ga0495646_0030054_1147_2643 487
438 3300047317 Ga0495604_0000824 Ga0495604_0000824_3138_4634 487
439 3300048918 Ga0496115_0000121 Ga0496115_0000121_19851_21401 487
440 3300049592 Ga0501076_0020736 Ga0501076_0020736_807_2282 487
441 3300049743 Ga0501081_0039587 Ga0501081_0039587_973_2448 487
442 3300005329 Ga0070683_100014931 Ga0070683_1000149314 488
443 3300005435 Ga0070714_100114738 Ga0070714_1001147383 488
444 3300005437 Ga0070710_10040070 Ga0070710_100400702 488
445 3300005981 Ga0081538_10016644 Ga0081538_100166444 488
446 3300006028 Ga0070717_10099897 Ga0070717_100998972 488
447 3300025898 Ga0207692_10063646 Ga0207692_100636462 488
448 3300041451 Ga0451791_0552643 Ga0451791_0552643_774_2255 488
449 3300049572 Ga0501036_0039770 Ga0501036_0039770_2064_3545 488
450 3300049575 Ga0501039_0008934 Ga0501039_0008934_3659_5140 488
451 3300061734 Ga0530510_0082617 Ga0530510_0082617_311_1792 488
452 3300028563 Ga0265319_1000015 Ga0265319_100001563 489
453 3300039437 Ga0436365_1238206 Ga0436365_1238206_1420_2955 489
454 3300044842 Ga0466957_0007031 Ga0466957_0007031_47_1582 489
455 3300045049 Ga0466959_0012882 Ga0466959_0012882_845_2380 489
456 3300045836 Ga0466958_0001164 Ga0466958_0001164_6493_8028 489
457 3300045976 Ga0466967_0021311 Ga0466967_0021311_188_1723 489
458 3300048918 Ga0496115_0000075 Ga0496115_0000075_36805_38421 489
459 3300005842 Ga0068858_100044814 Ga0068858_1000448143 490
460 3300005981 Ga0081538_10001796 Ga0081538_1000179612 490
461 3300006881 Ga0068865_100122247 Ga0068865_1001222472 490
462 3300009148 Ga0105243_10061148 Ga0105243_100611482 490
463 3300025901 Ga0207688_10010122 Ga0207688_100101224 490
464 3300025924 Ga0207694_10050210 Ga0207694_100502103 490
465 3300025933 Ga0207706_10046641 Ga0207706_100466413 490
466 3300025935 Ga0207709_10034179 Ga0207709_100341793 490
467 3300025942 Ga0207689_10075688 Ga0207689_100756882 490
468 3300026075 Ga0207708_10033916 Ga0207708_100339163 490
469 3300027907 Ga0207428_10134202 Ga0207428_101342022 490
470 3300044842 Ga0466957_0097389 Ga0466957_0097389_251_1744 490
471 3300046529 Ga0495652_0000019 Ga0495652_0000019_37011_38528 490
472 3300048911 Ga0496108_0025893 Ga0496108_0025893_366_1889 490
473 3300048913 Ga0496110_0108325 Ga0496110_0108325_598_2121 490
474 3300048916 Ga0496113_0098660 Ga0496113_0098660_495_2018 490
475 3300049572 Ga0501036_0076136 Ga0501036_0076136_403_1977 490
476 3300049574 Ga0501038_0119381 Ga0501038_0119381_354_1928 490
477 3300049576 Ga0501040_0020937 Ga0501040_0020937_828_2402 490
478 3300049590 Ga0501074_0021021 Ga0501074_0021021_1133_2707 490
479 3300049591 Ga0501075_0016242 Ga0501075_0016242_3659_5233 490
480 3300049741 Ga0501079_0052330 Ga0501079_0052330_1262_2836 490
481 3300054114 Ga0501084_0014400 Ga0501084_0014400_4239_5813 490
482 3300006163 Ga0070715_10000001 Ga0070715_10000001268 491
483 3300006175 Ga0070712_100159453 Ga0070712_1001594532 491
484 3300025905 Ga0207685_10000036 Ga0207685_1000003655 491
485 3300032126 Ga0307415_100032167 Ga0307415_1000321672 491
486 3300037418 Ga0395900_0015469 Ga0395900_0015469_2784_4286 491
487 3300037466 Ga0395898_0007626 Ga0395898_0007626_9490_10992 491
488 3300044765 Ga0466970_0077622 Ga0466970_0077622_178_1680 491
489 3300045049 Ga0466959_0004535 Ga0466959_0004535_3650_5152 491
490 3300053085 Ga0495619_0002472 Ga0495619_0002472_7839_9371 491
491 3300005436 Ga0070713_100019536 Ga0070713_1000195366 492
492 3300005981 Ga0081538_10004837 Ga0081538_100048375 492
493 3300005981 Ga0081538_10007479 Ga0081538_100074798 492
494 3300025928 Ga0207700_10014327 Ga0207700_100143272 492
495 3300028563 Ga0265319_1002445 Ga0265319_10024455 492
496 3300028577 Ga0265318_10001571 Ga0265318_1000157113 492
497 3300028800 Ga0265338_10048163 Ga0265338_100481632 492
498 3300031240 Ga0265320_10005211 Ga0265320_100052116 492
499 3300042876 Ga0451577_0015034 Ga0451577_0015034_5033_6586 492
500 3300044712 Ga0453684_0002840 Ga0453684_0002840_14426_15979 492
501 3300046515 Ga0495620_0000144 Ga0495620_0000144_36779_38296 492
502 3300046543 Ga0495645_0000051 Ga0495645_0000051_16698_18296 492
503 3300050515 nmdc:mga0a205_189767_c1 nmdc:mga0a205_189767_c1_46_1569 492
504 3300003373 JGI25407J50210_10001803 JGI25407J50210_100018034 493
505 3300005981 Ga0081538_10003478 Ga0081538_100034788 493
506 3300005981 Ga0081538_10013656 Ga0081538_100136564 493
507 3300005981 Ga0081538_10014112 Ga0081538_100141123 493
508 3300005981 Ga0081538_10021826 Ga0081538_100218264 493
509 3300005981 Ga0081538_10067849 Ga0081538_100678492 493
510 3300006847 Ga0075431_100005144 Ga0075431_10000514412 493
511 3300028563 Ga0265319_1000025 Ga0265319_100002531 493
512 3300028563 Ga0265319_1004984 Ga0265319_10049844 493
513 3300028800 Ga0265338_10000473 Ga0265338_1000047346 493
514 3300031241 Ga0265325_10006013 Ga0265325_100060137 493
515 3300031250 Ga0265331_10019616 Ga0265331_100196163 493
516 3300031251 Ga0265327_10008104 Ga0265327_100081043 493
517 3300037068 Ga0373925_0046514 Ga0373925_0046514_588_2123 493
518 3300047321 Ga0495676_0058227 Ga0495676_0058227_1342_2877 493
519 3300050508 nmdc:mga09592_6374_c1 nmdc:mga09592_6374_c1_5240_6742 493
520 3300053085 Ga0495619_0035066 Ga0495619_0035066_1433_2989 493
521 3300005981 Ga0081538_10001716 Ga0081538_1000171615 494
522 3300006051 Ga0075364_10098454 Ga0075364_100984541 494
523 3300025944 Ga0207661_10075262 Ga0207661_100752623 494
524 3300028556 Ga0265337_1006811 Ga0265337_10068112 494
525 3300028563 Ga0265319_1000144 Ga0265319_100014419 494
526 3300028577 Ga0265318_10002150 Ga0265318_100021505 494
527 3300028666 Ga0265336_10000002 Ga0265336_10000002417 494
528 3300028800 Ga0265338_10000001 Ga0265338_10000001396 494
529 3300031247 Ga0265340_10000001 Ga0265340_10000001395 494
530 3300031249 Ga0265339_10023212 Ga0265339_100232125 494
531 3300031344 Ga0265316_10083107 Ga0265316_100831072 494
532 3300036401 Ga0373937_0043006 Ga0373937_0043006_1292_2800 494
533 3300037418 Ga0395900_0304740 Ga0395900_0304740_32_1519 494
534 3300037466 Ga0395898_0037026 Ga0395898_0037026_2321_3808 494
535 3300044694 Ga0466963_0000273 Ga0466963_0000273_2983_4719 494
536 3300046511 Ga0495608_0000294 Ga0495608_0000294_33107_34615 494
537 3300046514 Ga0495618_0006493 Ga0495618_0006493_4029_5537 494
538 3300046516 Ga0495628_0043822 Ga0495628_0043822_1026_2534 494
539 3300046529 Ga0495652_0031934 Ga0495652_0031934_2202_3710 494
540 3300046533 Ga0495640_0019226 Ga0495640_0019226_1252_2760 494
541 3300046536 Ga0495587_0013955 Ga0495587_0013955_1683_3191 494
542 3300046559 Ga0495667_0007846 Ga0495667_0007846_2111_3619 494
543 3300046642 Ga0495634_0013196 Ga0495634_0013196_1292_2800 494
544 3300046663 Ga0495635_0008356 Ga0495635_0008356_1297_2805 494
545 3300046680 Ga0495646_0029254 Ga0495646_0029254_1032_2540 494
546 3300046809 Ga0495600_0018373 Ga0495600_0018373_1918_3426 494
547 3300047317 Ga0495604_0000917 Ga0495604_0000917_21760_23268 494
548 3300047319 Ga0495674_0014198 Ga0495674_0014198_913_2421 494
549 3300047471 Ga0495684_0062533 Ga0495684_0062533_1301_2809 494
550 3300048088 Ga0495602_0025389 Ga0495602_0025389_3046_4554 494
551 3300048916 Ga0496113_0164147 Ga0496113_0164147_201_1709 494
552 3300005329 Ga0070683_100116675 Ga0070683_1001166752 495
553 3300005353 Ga0070669_100005033 Ga0070669_1000050336 495
554 3300005366 Ga0070659_100000030 Ga0070659_10000003084 495
555 3300005366 Ga0070659_100113105 Ga0070659_1001131052 495
556 3300005435 Ga0070714_100000228 Ga0070714_10000022815 495
557 3300005437 Ga0070710_10000009 Ga0070710_10000009125 495
558 3300005614 Ga0068856_100081832 Ga0068856_1000818322 495
559 3300005937 Ga0081455_10036852 Ga0081455_100368522 495
560 3300005983 Ga0081540_1026139 Ga0081540_10261394 495
561 3300005985 Ga0081539_10018233 Ga0081539_100182337 495
562 3300006175 Ga0070712_100004441 Ga0070712_1000044414 495
563 3300006914 Ga0075436_100092306 Ga0075436_1000923062 495
564 3300014969 Ga0157376_10013180 Ga0157376_100131802 495
565 3300021388 Ga0213875_10000095 Ga0213875_1000009537 495
566 3300025898 Ga0207692_10000005 Ga0207692_10000005202 495
567 3300025901 Ga0207688_10032304 Ga0207688_100323043 495
568 3300025916 Ga0207663_10065905 Ga0207663_100659052 495
569 3300025923 Ga0207681_10011629 Ga0207681_100116295 495
570 3300025927 Ga0207687_10043291 Ga0207687_100432914 495
571 3300025929 Ga0207664_10000060 Ga0207664_1000006015 495
572 3300025932 Ga0207690_10000094 Ga0207690_1000009467 495
573 3300025932 Ga0207690_10083172 Ga0207690_100831722 495
574 3300028558 Ga0265326_10000024 Ga0265326_1000002498 495
575 3300028573 Ga0265334_10000151 Ga0265334_1000015130 495
576 3300028666 Ga0265336_10000622 Ga0265336_1000062213 495
577 3300028800 Ga0265338_10036287 Ga0265338_100362872 495
578 3300031251 Ga0265327_10011730 Ga0265327_100117303 495
579 3300037853 Ga0436364_1294613 Ga0436364_1294613_63677_65212 495
580 3300038443 Ga0395901_0119765 Ga0395901_0119765_186_1694 495
581 3300044694 Ga0466963_0026609 Ga0466963_0026609_196_1737 495
582 3300045836 Ga0466958_0076320 Ga0466958_0076320_274_1815 495
583 3300045976 Ga0466967_0013660 Ga0466967_0013660_2241_3749 495
584 3300046694 Ga0495649_0001624 Ga0495649_0001624_11580_13115 495
585 3300048903 Ga0496100_0005719 Ga0496100_0005719_4909_6417 495
586 3300048904 Ga0496101_0003568 Ga0496101_0003568_7805_9313 495
587 3300048905 Ga0496102_0029803 Ga0496102_0029803_2827_4335 495
588 3300048907 Ga0496104_0116657 Ga0496104_0116657_371_1879 495
589 3300048908 Ga0496105_0153315 Ga0496105_0153315_96_1604 495
590 3300048910 Ga0496107_0033560 Ga0496107_0033560_1608_3116 495
591 3300048911 Ga0496108_0000747 Ga0496108_0000747_5496_7004 495
592 3300048912 Ga0496109_0002916 Ga0496109_0002916_11899_13407 495
593 3300048912 Ga0496109_0004496 Ga0496109_0004496_4742_6325 495
594 3300048913 Ga0496110_0002594 Ga0496110_0002594_7363_8871 495
595 3300048913 Ga0496110_0013117 Ga0496110_0013117_385_1893 495
596 3300048914 Ga0496111_0016015 Ga0496111_0016015_3011_4519 495
597 3300048915 Ga0496112_0203834 Ga0496112_0203834_402_1910 495
598 3300048916 Ga0496113_0028372 Ga0496113_0028372_642_2192 495
599 3300050508 nmdc:mga09592_5985_c1 nmdc:mga09592_5985_c1_879_2429 495
600 3300050511 nmdc:mga08y16_173159_c1 nmdc:mga08y16_173159_c1_300_1817 495
601 3300050514 nmdc:mga08x19_55413_c1 nmdc:mga08x19_55413_c1_305_1867 495
602 3300053078 Ga0495612_0000136 Ga0495612_0000136_18117_19802 495
603 3300005337 Ga0070682_100003538 Ga0070682_1000035389 496
604 3300005366 Ga0070659_100033746 Ga0070659_1000337462 496
605 3300005435 Ga0070714_100001436 Ga0070714_10000143613 496
606 3300005436 Ga0070713_100102944 Ga0070713_1001029442 496
607 3300005437 Ga0070710_10031211 Ga0070710_100312111 496
608 3300005441 Ga0070700_100001344 Ga0070700_1000013442 496
609 3300005535 Ga0070684_100001766 Ga0070684_1000017663 496
610 3300005564 Ga0070664_100015011 Ga0070664_1000150112 496
611 3300005614 Ga0068856_100039508 Ga0068856_1000395083 496
612 3300005618 Ga0068864_100047347 Ga0068864_1000473473 496
613 3300006028 Ga0070717_10012533 Ga0070717_100125332 496
614 3300006028 Ga0070717_10090410 Ga0070717_100904102 496
615 3300006038 Ga0075365_10035119 Ga0075365_100351192 496
616 3300006175 Ga0070712_100000003 Ga0070712_10000000384 496
617 3300006175 Ga0070712_100025707 Ga0070712_1000257073 496
618 3300006847 Ga0075431_100026586 Ga0075431_1000265863 496
619 3300006852 Ga0075433_10045006 Ga0075433_100450063 496
620 3300009094 Ga0111539_10014997 Ga0111539_100149977 496
621 3300009098 Ga0105245_10014206 Ga0105245_100142064 496
622 3300009177 Ga0105248_10117921 Ga0105248_101179213 496
623 3300013296 Ga0157374_10005737 Ga0157374_100057376 496
624 3300013307 Ga0157372_10007044 Ga0157372_100070446 496
625 3300014325 Ga0163163_10024319 Ga0163163_100243192 496
626 3300014326 Ga0157380_10095379 Ga0157380_100953792 496
627 3300014969 Ga0157376_10125257 Ga0157376_101252572 496
628 3300021377 Ga0213874_10000263 Ga0213874_100002635 496
629 3300021377 Ga0213874_10006555 Ga0213874_100065552 496
630 3300021384 Ga0213876_10004900 Ga0213876_100049004 496
631 3300025898 Ga0207692_10049620 Ga0207692_100496202 496
632 3300025901 Ga0207688_10000574 Ga0207688_1000057420 496
633 3300025915 Ga0207693_10000028 Ga0207693_100000288 496
634 3300025915 Ga0207693_10001165 Ga0207693_1000116520 496
635 3300025929 Ga0207664_10005856 Ga0207664_100058562 496
636 3300025929 Ga0207664_10030175 Ga0207664_100301754 496
637 3300025933 Ga0207706_10010294 Ga0207706_100102947 496
638 3300025945 Ga0207679_10009479 Ga0207679_100094796 496
639 3300026067 Ga0207678_10072220 Ga0207678_100722203 496
640 3300026075 Ga0207708_10001047 Ga0207708_1000104716 496
641 3300026078 Ga0207702_10077475 Ga0207702_100774753 496
642 3300028380 Ga0268265_10059034 Ga0268265_100590342 496
643 3300036401 Ga0373937_0018464 Ga0373937_0018464_3665_5203 496
644 3300037466 Ga0395898_0134855 Ga0395898_0134855_802_2337 496
645 3300037853 Ga0436364_0121330 Ga0436364_0121330_2065_3600 496
646 3300037853 Ga0436364_0349017 Ga0436364_0349017_633_2168 496
647 3300039437 Ga0436365_0254126 Ga0436365_0254126_28754_30289 496
648 3300039437 Ga0436365_0388687 Ga0436365_0388687_6181_7716 496
649 3300039437 Ga0436365_1029997 Ga0436365_1029997_231_1772 496
650 3300039437 Ga0436365_1102419 Ga0436365_1102419_2747_4285 496
651 3300039450 Ga0436363_0365326 Ga0436363_0365326_5164_6699 496
652 3300039450 Ga0436363_1063131 Ga0436363_1063131_7067_8608 496
653 3300044693 Ga0466961_0010521 Ga0466961_0010521_267_1811 496
654 3300044693 Ga0466961_0013029 Ga0466961_0013029_1698_3236 496
655 3300044719 Ga0466971_0001423 Ga0466971_0001423_2570_4108 496
656 3300044765 Ga0466970_0060600 Ga0466970_0060600_322_1854 496
657 3300044842 Ga0466957_0027178 Ga0466957_0027178_340_1878 496
658 3300044842 Ga0466957_0083582 Ga0466957_0083582_428_1966 496
659 3300044901 Ga0466960_0014856 Ga0466960_0014856_169_1680 496
660 3300045049 Ga0466959_0002079 Ga0466959_0002079_10739_12280 496
661 3300045049 Ga0466959_0085246 Ga0466959_0085246_655_2226 496
662 3300045836 Ga0466958_0026049 Ga0466958_0026049_985_2523 496
663 3300045836 Ga0466958_0103608 Ga0466958_0103608_18_1559 496
664 3300046511 Ga0495608_0003047 Ga0495608_0003047_6765_8303 496
665 3300046559 Ga0495667_0004076 Ga0495667_0004076_3672_5210 496
666 3300046663 Ga0495635_0009815 Ga0495635_0009815_2276_3814 496
667 3300047319 Ga0495674_0033320 Ga0495674_0033320_893_2431 496
668 3300048903 Ga0496100_0000463 Ga0496100_0000463_16725_18260 496
669 3300048904 Ga0496101_0001372 Ga0496101_0001372_7287_8822 496
670 3300048905 Ga0496102_0115856 Ga0496102_0115856_840_2354 496
671 3300048908 Ga0496105_0134719 Ga0496105_0134719_480_1994 496
672 3300048908 Ga0496105_0144987 Ga0496105_0144987_44_1582 496
673 3300048910 Ga0496107_0032767 Ga0496107_0032767_2166_3680 496
674 3300048912 Ga0496109_0079598 Ga0496109_0079598_1035_2549 496
675 3300048914 Ga0496111_0052833 Ga0496111_0052833_1179_2696 496
676 3300048914 Ga0496111_0114457 Ga0496111_0114457_346_1860 496
677 3300048915 Ga0496112_0072829 Ga0496112_0072829_1288_2826 496
678 3300048916 Ga0496113_0024605 Ga0496113_0024605_303_1817 496
679 3300048918 Ga0496115_0082399 Ga0496115_0082399_201_1715 496
680 3300050507 nmdc:mga05p37_162575_c1 nmdc:mga05p37_162575_c1_577_2112 496
681 3300050512 nmdc:mga0n895_28347_c1 nmdc:mga0n895_28347_c1_2119_3654 496
682 3300050515 nmdc:mga0a205_67562_c1 nmdc:mga0a205_67562_c1_1694_3229 496
683 3300061719 Ga0466962_0003445 Ga0466962_0003445_3943_5481 496
684 3300005614 Ga0068856_100021907 Ga0068856_1000219075 497
685 3300009545 Ga0105237_10001661 Ga0105237_100016616 497
686 3300025912 Ga0207707_10042359 Ga0207707_100423592 497
687 3300025914 Ga0207671_10002660 Ga0207671_1000266023 497
688 3300039450 Ga0436363_1120367 Ga0436363_1120367_525_2063 497
689 3300044684 Ga0466966_0011260 Ga0466966_0011260_1141_2691 497
690 3300044694 Ga0466963_0001551 Ga0466963_0001551_8966_10519 497
691 3300045049 Ga0466959_0050370 Ga0466959_0050370_1441_2991 497
692 3300046463 Ga0495653_0000718 Ga0495653_0000718_19209_20852 497
693 3300046543 Ga0495645_0000558 Ga0495645_0000558_8686_10269 497
694 3300047319 Ga0495674_0119007 Ga0495674_0119007_430_1926 497
695 3300047471 Ga0495684_0006217 Ga0495684_0006217_5582_7174 497
696 3300048906 Ga0496103_0100974 Ga0496103_0100974_134_1669 497
697 3300048915 Ga0496112_0017549 Ga0496112_0017549_744_2285 497
698 3300049585 Ga0501069_0034529 Ga0501069_0034529_77_1621 497
699 3300049586 Ga0501070_0167828 Ga0501070_0167828_225_1769 497
700 3300053078 Ga0495612_0000312 Ga0495612_0000312_4637_6133 497
701 3300005435 Ga0070714_100003341 Ga0070714_1000033419 498
702 3300005439 Ga0070711_100011026 Ga0070711_1000110265 498
703 3300006175 Ga0070712_100003339 Ga0070712_1000033395 498
704 3300006871 Ga0075434_100003679 Ga0075434_10000367910 498
705 3300009147 Ga0114129_10008963 Ga0114129_100089632 498
706 3300021384 Ga0213876_10018870 Ga0213876_100188704 498
707 3300025915 Ga0207693_10008453 Ga0207693_100084533 498
708 3300025929 Ga0207664_10050301 Ga0207664_100503012 498
709 3300025937 Ga0207669_10025626 Ga0207669_100256262 498
710 3300026089 Ga0207648_10056680 Ga0207648_100566802 498
711 3300031727 Ga0316576_10035815 Ga0316576_100358152 498
712 3300037853 Ga0436364_0765160 Ga0436364_0765160_20_1567 498
713 3300039437 Ga0436365_0911509 Ga0436365_0911509_645_2192 498
714 3300039437 Ga0436365_1799679 Ga0436365_1799679_7024_8571 498
715 3300045976 Ga0466967_0019009 Ga0466967_0019009_763_2307 498
716 3300045976 Ga0466967_0041969 Ga0466967_0041969_523_2043 498
717 3300045976 Ga0466967_0102242 Ga0466967_0102242_747_2291 498
718 3300046517 Ga0495630_0003283 Ga0495630_0003283_8683_10311 498
719 3300046675 Ga0495657_0000013 Ga0495657_0000013_83754_85382 498
720 3300050507 nmdc:mga05p37_14337_c1 nmdc:mga05p37_14337_c1_497_2068 498
721 3300050512 nmdc:mga0n895_2605_c1 nmdc:mga0n895_2605_c1_12042_13613 498
722 3300005937 Ga0081455_10019018 Ga0081455_100190182 499
723 3300009147 Ga0114129_10168988 Ga0114129_101689882 499
724 3300035115 Ga0373941_0001018 Ga0373941_0001018_3584_5131 499
725 3300037853 Ga0436364_0412746 Ga0436364_0412746_96_1655 499
726 3300039437 Ga0436365_0947003 Ga0436365_0947003_1191_2750 499
727 3300046663 Ga0495635_0000016 Ga0495635_0000016_127223_128725 499
728 3300047472 Ga0495686_0001936 Ga0495686_0001936_15962_17497 499
729 3300050492 nmdc:mga0yw44_72501_c1 nmdc:mga0yw44_72501_c1_415_1917 499
730 3300005530 Ga0070679_100063537 Ga0070679_1000635372 500
731 3300005614 Ga0068856_100000577 Ga0068856_10000057734 500
732 3300005981 Ga0081538_10000066 Ga0081538_1000006623 500
733 3300006846 Ga0075430_100046313 Ga0075430_1000463133 500
734 3300006880 Ga0075429_100002308 Ga0075429_1000023083 500
735 3300009098 Ga0105245_10193181 Ga0105245_101931812 500
736 3300026078 Ga0207702_10000060 Ga0207702_1000006068 500
737 3300046461 Ga0495641_0000244 Ga0495641_0000244_12564_14114 500
738 3300049590 Ga0501074_0026492 Ga0501074_0026492_2017_3570 500
739 3300050508 nmdc:mga09592_148082_c1 nmdc:mga09592_148082_c1_115_1665 500
740 3300002074 JGI24748J21848_1001590 JGI24748J21848_10015902 501
741 3300002239 JGI24034J26672_10000104 JGI24034J26672_1000010414 501
742 3300005327 Ga0070658_10004160 Ga0070658_100041605 501
743 3300005329 Ga0070683_100034666 Ga0070683_1000346664 501
744 3300005337 Ga0070682_100000045 Ga0070682_100000045103 501
745 3300005339 Ga0070660_100016628 Ga0070660_1000166283 501
746 3300005340 Ga0070689_100049457 Ga0070689_1000494572 501
747 3300005341 Ga0070691_10008221 Ga0070691_100082214 501
748 3300005344 Ga0070661_100128955 Ga0070661_1001289552 501
749 3300005345 Ga0070692_10019194 Ga0070692_100191943 501
750 3300005354 Ga0070675_100015766 Ga0070675_1000157662 501
751 3300005364 Ga0070673_100006213 Ga0070673_1000062138 501
752 3300005441 Ga0070700_100004038 Ga0070700_1000040384 501
753 3300005539 Ga0068853_100011850 Ga0068853_1000118506 501
754 3300005539 Ga0068853_100050807 Ga0068853_1000508074 501
755 3300005549 Ga0070704_100067316 Ga0070704_1000673162 501
756 3300005564 Ga0070664_100019724 Ga0070664_1000197245 501
757 3300005614 Ga0068856_100082799 Ga0068856_1000827993 501
758 3300005616 Ga0068852_100000184 Ga0068852_1000001849 501
759 3300005616 Ga0068852_100007961 Ga0068852_1000079612 501
760 3300005834 Ga0068851_10018437 Ga0068851_100184372 501
761 3300005840 Ga0068870_10038670 Ga0068870_100386703 501
762 3300006038 Ga0075365_10028757 Ga0075365_100287573 501
763 3300006038 Ga0075365_10034216 Ga0075365_100342162 501
764 3300006175 Ga0070712_100014909 Ga0070712_1000149092 501
765 3300006178 Ga0075367_10073065 Ga0075367_100730652 501
766 3300006847 Ga0075431_100000075 Ga0075431_10000007512 501
767 3300006871 Ga0075434_100003025 Ga0075434_1000030254 501
768 3300009094 Ga0111539_10011787 Ga0111539_100117873 501
769 3300009094 Ga0111539_10044673 Ga0111539_100446733 501
770 3300009094 Ga0111539_10176543 Ga0111539_101765432 501
771 3300009148 Ga0105243_10009266 Ga0105243_100092665 501
772 3300009551 Ga0105238_10205639 Ga0105238_102056392 501
773 3300010375 Ga0105239_10075213 Ga0105239_100752133 501
774 3300013307 Ga0157372_10000129 Ga0157372_1000012949 501
775 3300013307 Ga0157372_10163531 Ga0157372_101635313 501
776 3300013308 Ga0157375_10013338 Ga0157375_100133385 501
777 3300021388 Ga0213875_10029251 Ga0213875_100292512 501
778 3300025321 Ga0207656_10005030 Ga0207656_100050302 501
779 3300025901 Ga0207688_10005824 Ga0207688_100058245 501
780 3300025909 Ga0207705_10060566 Ga0207705_100605661 501
781 3300025915 Ga0207693_10001560 Ga0207693_1000156016 501
782 3300025919 Ga0207657_10000895 Ga0207657_1000089530 501
783 3300025932 Ga0207690_10047230 Ga0207690_100472301 501
784 3300025938 Ga0207704_10030307 Ga0207704_100303072 501
785 3300025940 Ga0207691_10007573 Ga0207691_100075734 501
786 3300025960 Ga0207651_10020147 Ga0207651_100201473 501
787 3300025961 Ga0207712_10037616 Ga0207712_100376162 501
788 3300026041 Ga0207639_10191344 Ga0207639_101913442 501
789 3300026089 Ga0207648_10011873 Ga0207648_100118732 501
790 3300026116 Ga0207674_10073827 Ga0207674_100738272 501
791 3300026121 Ga0207683_10067514 Ga0207683_100675143 501
792 3300026142 Ga0207698_10000012 Ga0207698_1000001231 501
793 3300026142 Ga0207698_10014684 Ga0207698_100146844 501
794 3300026142 Ga0207698_10022568 Ga0207698_100225682 501
795 3300027907 Ga0207428_10026212 Ga0207428_100262122 501
796 3300037312 Ga0395899_0003392 Ga0395899_0003392_341_1882 501
797 3300037418 Ga0395900_0009508 Ga0395900_0009508_5472_7013 501
798 3300037466 Ga0395898_0023168 Ga0395898_0023168_2798_4339 501
799 3300037853 Ga0436364_0674729 Ga0436364_0674729_1038_2597 501
800 3300037853 Ga0436364_1445105 Ga0436364_1445105_576_2135 501
801 3300038443 Ga0395901_0006703 Ga0395901_0006703_6311_7852 501
802 3300039453 Ga0436362_0705873 Ga0436362_0705873_980_2545 501
803 3300045976 Ga0466967_0050647 Ga0466967_0050647_571_2106 501
804 3300046459 Ga0495629_0000272 Ga0495629_0000272_33281_34795 501
805 3300046476 Ga0495662_0000458 Ga0495662_0000458_5274_6782 501
806 3300046517 Ga0495630_0000056 Ga0495630_0000056_36293_37807 501
807 3300046681 Ga0495647_0000169 Ga0495647_0000169_10624_12138 501
808 3300046690 Ga0495624_0000267 Ga0495624_0000267_16336_17850 501
809 3300047321 Ga0495676_0153713 Ga0495676_0153713_50_1585 501
810 3300048903 Ga0496100_0000018 Ga0496100_0000018_83375_84898 501
811 3300048904 Ga0496101_0000062 Ga0496101_0000062_108329_109852 501
812 3300048904 Ga0496101_0040738 Ga0496101_0040738_233_1771 501
813 3300048909 Ga0496106_0000145 Ga0496106_0000145_39600_41123 501
814 3300048909 Ga0496106_0021330 Ga0496106_0021330_1280_2818 501
815 3300048910 Ga0496107_0000006 Ga0496107_0000006_152298_153821 501
816 3300048911 Ga0496108_0015294 Ga0496108_0015294_2240_3754 501
817 3300048911 Ga0496108_0057327 Ga0496108_0057327_1259_2797 501
818 3300048911 Ga0496108_0133462 Ga0496108_0133462_184_1719 501
819 3300048912 Ga0496109_0000129 Ga0496109_0000129_5137_6651 501
820 3300048912 Ga0496109_0001369 Ga0496109_0001369_12459_13997 501
821 3300048913 Ga0496110_0042091 Ga0496110_0042091_249_1787 501
822 3300048913 Ga0496110_0068996 Ga0496110_0068996_1439_2974 501
823 3300048914 Ga0496111_0064421 Ga0496111_0064421_942_2480 501
824 3300048916 Ga0496113_0040460 Ga0496113_0040460_619_2154 501
825 3300048918 Ga0496115_0126385 Ga0496115_0126385_303_1838 501
826 3300050492 nmdc:mga0yw44_4558_c1 nmdc:mga0yw44_4558_c1_2169_3707 501
827 3300050492 nmdc:mga0yw44_87222_c1 nmdc:mga0yw44_87222_c1_163_1704 501
828 3300050510 nmdc:mga06r32_244_c1 nmdc:mga06r32_244_c1_35848_37383 501
829 3300050511 nmdc:mga08y16_131777_c1 nmdc:mga08y16_131777_c1_585_2159 501
830 3300050511 nmdc:mga08y16_30153_c1 nmdc:mga08y16_30153_c1_3129_4664 501
831 3300050512 nmdc:mga0n895_7227_c1 nmdc:mga0n895_7227_c1_2663_4198 501
832 3300050515 nmdc:mga0a205_540_c1 nmdc:mga0a205_540_c1_20775_22283 501
833 3300053078 Ga0495612_0005579 Ga0495612_0005579_1998_3512 501
834 3300053085 Ga0495619_0000031 Ga0495619_0000031_27363_28877 501
835 3300003659 JGI25404J52841_10006407 JGI25404J52841_100064073 502
836 3300005329 Ga0070683_100008910 Ga0070683_1000089106 502
837 3300005329 Ga0070683_100017176 Ga0070683_1000171765 502
838 3300005329 Ga0070683_100052582 Ga0070683_1000525824 502
839 3300005333 Ga0070677_10000004 Ga0070677_1000000427 502
840 3300005335 Ga0070666_10048044 Ga0070666_100480442 502
841 3300005338 Ga0068868_100007612 Ga0068868_1000076124 502
842 3300005356 Ga0070674_100000008 Ga0070674_10000000832 502
843 3300005356 Ga0070674_100000029 Ga0070674_10000002929 502
844 3300005364 Ga0070673_100005926 Ga0070673_1000059261 502
845 3300005365 Ga0070688_100000068 Ga0070688_10000006828 502
846 3300005439 Ga0070711_100003340 Ga0070711_1000033402 502
847 3300005456 Ga0070678_100011655 Ga0070678_1000116555 502
848 3300005466 Ga0070685_10000127 Ga0070685_1000012754 502
849 3300005466 Ga0070685_10005555 Ga0070685_100055552 502
850 3300005530 Ga0070679_100055874 Ga0070679_1000558744 502
851 3300005535 Ga0070684_100040324 Ga0070684_1000403242 502
852 3300005543 Ga0070672_100000027 Ga0070672_1000000276 502
853 3300005548 Ga0070665_100001955 Ga0070665_1000019553 502
854 3300005548 Ga0070665_100038430 Ga0070665_1000384302 502
855 3300005614 Ga0068856_100026071 Ga0068856_1000260713 502
856 3300005718 Ga0068866_10000001 Ga0068866_10000001294 502
857 3300005718 Ga0068866_10000031 Ga0068866_100000312 502
858 3300005842 Ga0068858_100000091 Ga0068858_1000000912 502
859 3300005843 Ga0068860_100028039 Ga0068860_1000280394 502
860 3300005937 Ga0081455_10103892 Ga0081455_101038922 502
861 3300005981 Ga0081538_10000514 Ga0081538_1000051431 502
862 3300005983 Ga0081540_1000139 Ga0081540_100013971 502
863 3300006038 Ga0075365_10020924 Ga0075365_100209243 502
864 3300006048 Ga0075363_100068621 Ga0075363_1000686211 502
865 3300006175 Ga0070712_100003379 Ga0070712_1000033794 502
866 3300006844 Ga0075428_100025755 Ga0075428_1000257557 502
867 3300006846 Ga0075430_100058117 Ga0075430_1000581172 502
868 3300006852 Ga0075433_10001554 Ga0075433_100015547 502
869 3300006881 Ga0068865_100000160 Ga0068865_10000016030 502
870 3300009098 Ga0105245_10000456 Ga0105245_100004567 502
871 3300009148 Ga0105243_10026089 Ga0105243_100260893 502
872 3300009148 Ga0105243_10109557 Ga0105243_101095571 502
873 3300009177 Ga0105248_10000249 Ga0105248_1000024957 502
874 3300013102 Ga0157371_10011147 Ga0157371_100111473 502
875 3300013296 Ga0157374_10006397 Ga0157374_100063978 502
876 3300014326 Ga0157380_10000132 Ga0157380_1000013236 502
877 3300014326 Ga0157380_10006960 Ga0157380_100069604 502
878 3300025893 Ga0207682_10000031 Ga0207682_1000003140 502
879 3300025899 Ga0207642_10000002 Ga0207642_1000000214 502
880 3300025899 Ga0207642_10000122 Ga0207642_1000012218 502
881 3300025903 Ga0207680_10010636 Ga0207680_100106363 502
882 3300025915 Ga0207693_10007247 Ga0207693_100072474 502
883 3300025916 Ga0207663_10005734 Ga0207663_100057342 502
884 3300025927 Ga0207687_10000007 Ga0207687_10000007339 502
885 3300025935 Ga0207709_10012022 Ga0207709_100120223 502
886 3300025937 Ga0207669_10000004 Ga0207669_10000004176 502
887 3300025937 Ga0207669_10000012 Ga0207669_10000012113 502
888 3300025938 Ga0207704_10000236 Ga0207704_100002365 502
889 3300025940 Ga0207691_10000136 Ga0207691_100001365 502
890 3300025941 Ga0207711_10000020 Ga0207711_1000002013 502
891 3300025944 Ga0207661_10000224 Ga0207661_1000022430 502
892 3300025944 Ga0207661_10013702 Ga0207661_100137024 502
893 3300025960 Ga0207651_10000460 Ga0207651_100004602 502
894 3300026035 Ga0207703_10000152 Ga0207703_100001524 502
895 3300026041 Ga0207639_10023349 Ga0207639_100233493 502
896 3300026078 Ga0207702_10003607 Ga0207702_100036073 502
897 3300026121 Ga0207683_10003745 Ga0207683_1000374510 502
898 3300028379 Ga0268266_10000085 Ga0268266_10000085156 502
899 3300028379 Ga0268266_10007839 Ga0268266_100078393 502
900 3300028379 Ga0268266_10055173 Ga0268266_100551733 502
901 3300028381 Ga0268264_10013352 Ga0268264_100133526 502
902 3300028556 Ga0265337_1000231 Ga0265337_100023115 502
903 3300028558 Ga0265326_10000007 Ga0265326_100000077 502
904 3300028654 Ga0265322_10000001 Ga0265322_10000001298 502
905 3300028666 Ga0265336_10005990 Ga0265336_100059903 502
906 3300029957 Ga0265324_10001009 Ga0265324_100010097 502
907 3300031240 Ga0265320_10000002 Ga0265320_10000002297 502
908 3300031242 Ga0265329_10004822 Ga0265329_100048224 502
909 3300031249 Ga0265339_10054152 Ga0265339_100541522 502
910 3300031251 Ga0265327_10000011 Ga0265327_10000011297 502
911 3300031711 Ga0265314_10000062 Ga0265314_1000006231 502
912 3300035398 Ga0316574_0002945 Ga0316574_0002945_5369_6913 502
913 3300041512 Ga0451853_3236511 Ga0451853_3236511_254_1771 502
914 3300044842 Ga0466957_0013544 Ga0466957_0013544_2762_4279 502
915 3300046459 Ga0495629_0034828 Ga0495629_0034828_717_2231 502
916 3300046461 Ga0495641_0000044 Ga0495641_0000044_38343_39854 502
917 3300046462 Ga0495651_0047771 Ga0495651_0047771_925_2442 502
918 3300046462 Ga0495651_0105612 Ga0495651_0105612_92_1609 502
919 3300046476 Ga0495662_0020681 Ga0495662_0020681_216_1727 502
920 3300046500 Ga0495596_0023521 Ga0495596_0023521_257_1813 502
921 3300046517 Ga0495630_0000408 Ga0495630_0000408_26230_27747 502
922 3300046518 Ga0495631_0017942 Ga0495631_0017942_1287_2843 502
923 3300046523 Ga0495644_0000642 Ga0495644_0000642_5477_6988 502
924 3300046523 Ga0495644_0007527 Ga0495644_0007527_2136_3692 502
925 3300046557 Ga0495622_0000180 Ga0495622_0000180_43187_44698 502
926 3300046674 Ga0495588_0000165 Ga0495588_0000165_68179_69696 502
927 3300046690 Ga0495624_0000008 Ga0495624_0000008_61950_63461 502
928 3300047317 Ga0495604_0000019 Ga0495604_0000019_120394_121911 502
929 3300047317 Ga0495604_0000398 Ga0495604_0000398_21_1538 502
930 3300047322 Ga0495680_0002092 Ga0495680_0002092_16182_17699 502
931 3300047469 Ga0495673_0010571 Ga0495673_0010571_2454_4010 502
932 3300047472 Ga0495686_0000020 Ga0495686_0000020_351301_352857 502
933 3300047472 Ga0495686_0004284 Ga0495686_0004284_4751_6307 502
934 3300048088 Ga0495602_0000208 Ga0495602_0000208_23367_24884 502
935 3300048905 Ga0496102_0000039 Ga0496102_0000039_147007_148524 502
936 3300048906 Ga0496103_0000008 Ga0496103_0000008_268262_269779 502
937 3300048908 Ga0496105_0046758 Ga0496105_0046758_257_1771 502
938 3300048909 Ga0496106_0000081 Ga0496106_0000081_61918_63429 502
939 3300048910 Ga0496107_0024708 Ga0496107_0024708_370_1881 502
940 3300048912 Ga0496109_0037796 Ga0496109_0037796_1957_3477 502
941 3300048912 Ga0496109_0084905 Ga0496109_0084905_356_1915 502
942 3300048914 Ga0496111_0057332 Ga0496111_0057332_543_2087 502
943 3300048914 Ga0496111_0083057 Ga0496111_0083057_778_2289 502
944 3300048918 Ga0496115_0003578 Ga0496115_0003578_6207_7724 502
945 3300048919 Ga0496116_0000680 Ga0496116_0000680_35591_37108 502
946 3300048922 Ga0496119_0001947 Ga0496119_0001947_14888_16405 502
947 3300048922 Ga0496119_0053846 Ga0496119_0053846_324_1838 502
948 3300048924 Ga0496121_0082381 Ga0496121_0082381_268_1782 502
949 3300049568 Ga0501031_0000137 Ga0501031_0000137_37235_38749 502
950 3300049569 Ga0501032_0000409 Ga0501032_0000409_12066_13580 502
951 3300049570 Ga0501033_0000223 Ga0501033_0000223_50652_52166 502
952 3300049571 Ga0501034_0023191 Ga0501034_0023191_1235_2758 502
953 3300049571 Ga0501034_0039153 Ga0501034_0039153_2367_3890 502
954 3300049571 Ga0501034_0041516 Ga0501034_0041516_900_2414 502
955 3300049572 Ga0501036_0000395 Ga0501036_0000395_28389_29903 502
956 3300049572 Ga0501036_0093353 Ga0501036_0093353_156_1679 502
957 3300049573 Ga0501037_0000315 Ga0501037_0000315_37242_38756 502
958 3300049574 Ga0501038_0000323 Ga0501038_0000323_37328_38842 502
959 3300049575 Ga0501039_0011591 Ga0501039_0011591_51_1565 502
960 3300049578 Ga0501042_0017883 Ga0501042_0017883_42_1559 502
961 3300049578 Ga0501042_0044566 Ga0501042_0044566_393_1907 502
962 3300049579 Ga0501043_0000587 Ga0501043_0000587_2330_3844 502
963 3300049580 Ga0501046_0000443 Ga0501046_0000443_2635_4149 502
964 3300049581 Ga0501047_0000321 Ga0501047_0000321_37267_38781 502
965 3300049582 Ga0501048_0000336 Ga0501048_0000336_2327_3841 502
966 3300049584 Ga0501068_0025852 Ga0501068_0025852_607_2121 502
967 3300049585 Ga0501069_0043607 Ga0501069_0043607_259_1773 502
968 3300049586 Ga0501070_0000354 Ga0501070_0000354_37484_38998 502
969 3300049587 Ga0501071_0024317 Ga0501071_0024317_1110_2624 502
970 3300049587 Ga0501071_0158450 Ga0501071_0158450_56_1567 502
971 3300049589 Ga0501073_0013645 Ga0501073_0013645_2590_4104 502
972 3300049590 Ga0501074_0008948 Ga0501074_0008948_3706_5220 502
973 3300049590 Ga0501074_0056607 Ga0501074_0056607_290_1807 502
974 3300049741 Ga0501079_0009561 Ga0501079_0009561_916_2430 502
975 3300049742 Ga0501080_0018770 Ga0501080_0018770_2632_4146 502
976 3300049744 Ga0501083_0006159 Ga0501083_0006159_6206_7720 502
977 3300049744 Ga0501083_0032660 Ga0501083_0032660_60_1577 502
978 3300049822 Ga0501035_0000380 Ga0501035_0000380_12070_13584 502
979 3300049823 Ga0501044_0000681 Ga0501044_0000681_2306_3820 502
980 3300049823 Ga0501044_0060609 Ga0501044_0060609_2192_3715 502
981 3300050492 nmdc:mga0yw44_16097_c1 nmdc:mga0yw44_16097_c1_2462_4000 502
982 3300050515 nmdc:mga0a205_24_c2 nmdc:mga0a205_24_c2_6854_8374 502
983 3300053077 Ga0495601_0003210 Ga0495601_0003210_4955_6472 502
984 3300053083 Ga0495655_0000001 Ga0495655_0000001_141247_142761 502
985 3300053083 Ga0495655_0003329 Ga0495655_0003329_1071_2588 502
986 3300053085 Ga0495619_0000021 Ga0495619_0000021_183546_185066 502
987 3300053085 Ga0495619_0013727 Ga0495619_0013727_549_2078 502
988 3300053096 Ga0500641_0011610 Ga0500641_0011610_1194_2711 502
989 3300053123 Ga0500614_005477 Ga0500614_005477_729_2240 502
990 3300053129 Ga0500628_000010 Ga0500628_000010_15448_16962 502
991 3300060353 Ga0501082_0025609 Ga0501082_0025609_2872_4386 502
992 3300003203 JGI25406J46586_10022658 JGI25406J46586_100226582 503
993 3300005329 Ga0070683_100010038 Ga0070683_1000100382 503
994 3300005366 Ga0070659_100004757 Ga0070659_1000047574 503
995 3300005367 Ga0070667_100006419 Ga0070667_1000064197 503
996 3300005455 Ga0070663_100003079 Ga0070663_1000030797 503
997 3300005457 Ga0070662_100000004 Ga0070662_10000000441 503
998 3300005547 Ga0070693_100000376 Ga0070693_1000003767 503
999 3300005548 Ga0070665_100000106 Ga0070665_100000106132 503
1000 3300005578 Ga0068854_100000114 Ga0068854_1000001146 503
1001 3300005834 Ga0068851_10004695 Ga0068851_100046953 503
1002 3300005842 Ga0068858_100000216 Ga0068858_10000021648 503
1003 3300005844 Ga0068862_100000973 Ga0068862_1000009733 503
1004 3300005937 Ga0081455_10149935 Ga0081455_101499352 503
1005 3300005985 Ga0081539_10000791 Ga0081539_1000079112 503
1006 3300005985 Ga0081539_10041810 Ga0081539_100418102 503
1007 3300009098 Ga0105245_10008155 Ga0105245_100081552 503
1008 3300009101 Ga0105247_10000393 Ga0105247_1000039328 503
1009 3300009176 Ga0105242_10025382 Ga0105242_100253824 503
1010 3300009551 Ga0105238_10000011 Ga0105238_10000011111 503
1011 3300013105 Ga0157369_10000110 Ga0157369_1000011060 503
1012 3300014968 Ga0157379_10001717 Ga0157379_100017179 503
1013 3300025321 Ga0207656_10002580 Ga0207656_100025806 503
1014 3300025900 Ga0207710_10000195 Ga0207710_1000019512 503
1015 3300025924 Ga0207694_10000004 Ga0207694_10000004512 503
1016 3300025927 Ga0207687_10000177 Ga0207687_100001775 503
1017 3300025932 Ga0207690_10006892 Ga0207690_100068921 503
1018 3300025933 Ga0207706_10000012 Ga0207706_10000012177 503
1019 3300025934 Ga0207686_10005471 Ga0207686_100054712 503
1020 3300025944 Ga0207661_10003313 Ga0207661_100033137 503
1021 3300025945 Ga0207679_10040804 Ga0207679_100408044 503
1022 3300025961 Ga0207712_10016430 Ga0207712_100164302 503
1023 3300025981 Ga0207640_10000015 Ga0207640_1000001546 503
1024 3300025986 Ga0207658_10057816 Ga0207658_100578162 503
1025 3300026035 Ga0207703_10000023 Ga0207703_10000023194 503
1026 3300026067 Ga0207678_10007745 Ga0207678_100077457 503
1027 3300028379 Ga0268266_10000047 Ga0268266_10000047284 503
1028 3300028380 Ga0268265_10001017 Ga0268265_1000101726 503
1029 3300028381 Ga0268264_10118473 Ga0268264_101184732 503
1030 3300044694 Ga0466963_0000001 Ga0466963_0000001_68719_70239 503
1031 3300045976 Ga0466967_0000065 Ga0466967_0000065_1821_3335 503
1032 3300046455 Ga0495603_0003452 Ga0495603_0003452_1296_2822 503
1033 3300046499 Ga0495594_0000003 Ga0495594_0000003_130243_131760 503
1034 3300046535 Ga0495586_0009241 Ga0495586_0009241_2248_3768 503
1035 3300046660 Ga0495625_0000696 Ga0495625_0000696_5502_7025 503
1036 3300046681 Ga0495647_0000008 Ga0495647_0000008_79154_80668 503
1037 3300046689 Ga0495613_0000113 Ga0495613_0000113_5311_6831 503
1038 3300047322 Ga0495680_0007700 Ga0495680_0007700_5339_6853 503
1039 3300048907 Ga0496104_0000004 Ga0496104_0000004_151861_153387 503
1040 3300048907 Ga0496104_0000009 Ga0496104_0000009_154866_156389 503
1041 3300048908 Ga0496105_0000001 Ga0496105_0000001_488444_489970 503
1042 3300048908 Ga0496105_0000007 Ga0496105_0000007_331667_333190 503
1043 3300048911 Ga0496108_0000062 Ga0496108_0000062_48771_50291 503
1044 3300048912 Ga0496109_0000007 Ga0496109_0000007_56547_58067 503
1045 3300048913 Ga0496110_0000062 Ga0496110_0000062_36644_38164 503
1046 3300048913 Ga0496110_0020943 Ga0496110_0020943_2093_3607 503
1047 3300048914 Ga0496111_0000010 Ga0496111_0000010_64219_65739 503
1048 3300048922 Ga0496119_0022969 Ga0496119_0022969_1179_2705 503
1049 3300049578 Ga0501042_0062756 Ga0501042_0062756_317_1837 503
1050 3300049581 Ga0501047_0028750 Ga0501047_0028750_2386_3900 503
1051 3300049586 Ga0501070_0077285 Ga0501070_0077285_99_1643 503
1052 3300049588 Ga0501072_0126760 Ga0501072_0126760_294_1838 503
1053 3300049591 Ga0501075_0001259 Ga0501075_0001259_4138_5655 503
1054 3300049592 Ga0501076_0035717 Ga0501076_0035717_1670_3190 503
1055 3300049823 Ga0501044_0084578 Ga0501044_0084578_1032_2549 503
1056 3300053077 Ga0495601_0000013 Ga0495601_0000013_145887_147407 503
1057 3300053078 Ga0495612_0002565 Ga0495612_0002565_1507_3021 503
1058 3300005535 Ga0070684_100146242 Ga0070684_1001462421 504
1059 3300005618 Ga0068864_100000045 Ga0068864_100000045127 504
1060 3300006051 Ga0075364_10092093 Ga0075364_100920932 504
1061 3300009098 Ga0105245_10005125 Ga0105245_100051257 504
1062 3300011119 Ga0105246_10036239 Ga0105246_100362393 504
1063 3300013308 Ga0157375_10001152 Ga0157375_100011522 504
1064 3300025927 Ga0207687_10000018 Ga0207687_10000018158 504
1065 3300025927 Ga0207687_10004028 Ga0207687_100040285 504
1066 3300026095 Ga0207676_10000016 Ga0207676_1000001637 504
1067 3300036401 Ga0373937_0142681 Ga0373937_0142681_338_1864 504
1068 3300046663 Ga0495635_0061532 Ga0495635_0061532_1020_2546 504
1069 3300046683 Ga0495658_0013455 Ga0495658_0013455_1899_3422 504
1070 3300046809 Ga0495600_0021081 Ga0495600_0021081_2554_4077 504
1071 3300047321 Ga0495676_0008653 Ga0495676_0008653_5768_7306 504
1072 3300048907 Ga0496104_0000129 Ga0496104_0000129_24104_25630 504
1073 3300048908 Ga0496105_0000846 Ga0496105_0000846_3496_5022 504
1074 3300048914 Ga0496111_0062281 Ga0496111_0062281_645_2189 504
1075 3300048915 Ga0496112_0001122 Ga0496112_0001122_6589_8112 504
1076 3300048915 Ga0496112_0166699 Ga0496112_0166699_327_1853 504
1077 3300048916 Ga0496113_0000014 Ga0496113_0000014_54717_56240 504
1078 3300049572 Ga0501036_0032127 Ga0501036_0032127_1238_2779 504
1079 3300049575 Ga0501039_0037664 Ga0501039_0037664_400_1941 504
1080 3300049578 Ga0501042_0104307 Ga0501042_0104307_468_2009 504
1081 3300049588 Ga0501072_0006920 Ga0501072_0006920_363_1904 504
1082 3300049824 Ga0501045_0096095 Ga0501045_0096095_22_1569 504
1083 3300050507 nmdc:mga05p37_44560_c1 nmdc:mga05p37_44560_c1_860_2404 504
1084 3300054114 Ga0501084_0019930 Ga0501084_0019930_2244_3785 504
1085 3300005329 Ga0070683_100054804 Ga0070683_1000548041 505
1086 3300005338 Ga0068868_100000033 Ga0068868_1000000333 505
1087 3300005354 Ga0070675_100000101 Ga0070675_10000010155 505
1088 3300005436 Ga0070713_100000009 Ga0070713_100000009160 505
1089 3300005615 Ga0070702_100037020 Ga0070702_1000370202 505
1090 3300005841 Ga0068863_100000021 Ga0068863_100000021164 505
1091 3300005983 Ga0081540_1000306 Ga0081540_100030645 505
1092 3300025899 Ga0207642_10019184 Ga0207642_100191841 505
1093 3300025926 Ga0207659_10000010 Ga0207659_10000010147 505
1094 3300025928 Ga0207700_10000081 Ga0207700_1000008163 505
1095 3300026023 Ga0207677_10000338 Ga0207677_100003383 505
1096 3300026088 Ga0207641_10000151 Ga0207641_1000015161 505
1097 3300036401 Ga0373937_0158223 Ga0373937_0158223_37_1566 505
1098 3300046459 Ga0495629_0068316 Ga0495629_0068316_284_1816 505
1099 3300046507 Ga0495606_0000752 Ga0495606_0000752_31162_32688 505
1100 3300046516 Ga0495628_0001219 Ga0495628_0001219_15982_17511 505
1101 3300046533 Ga0495640_0003352 Ga0495640_0003352_9242_10768 505
1102 3300046642 Ga0495634_0000247 Ga0495634_0000247_6136_7668 505
1103 3300046689 Ga0495613_0000203 Ga0495613_0000203_16535_18061 505
1104 3300048088 Ga0495602_0000497 Ga0495602_0000497_21350_22879 505
1105 3300048917 Ga0496114_0000014 Ga0496114_0000014_211621_213144 505
1106 3300048917 Ga0496114_0014859 Ga0496114_0014859_250_1770 505
1107 3300048918 Ga0496115_0000125 Ga0496115_0000125_33280_34803 505
1108 3300053094 Ga0500566_0023867 Ga0500566_0023867_726_2252 505
1109 3300005344 Ga0070661_100000023 Ga0070661_10000002341 506
1110 3300005458 Ga0070681_10021554 Ga0070681_100215544 506
1111 3300005530 Ga0070679_100001522 Ga0070679_1000015228 506
1112 3300009098 Ga0105245_10000016 Ga0105245_1000001666 506
1113 3300009098 Ga0105245_10136902 Ga0105245_101369022 506
1114 3300009553 Ga0105249_10000068 Ga0105249_10000068133 506
1115 3300013297 Ga0157378_10018959 Ga0157378_100189594 506
1116 3300017792 Ga0163161_10000035 Ga0163161_1000003514 506
1117 3300025912 Ga0207707_10006013 Ga0207707_100060134 506
1118 3300025920 Ga0207649_10000063 Ga0207649_1000006316 506
1119 3300025921 Ga0207652_10000349 Ga0207652_100003493 506
1120 3300025961 Ga0207712_10000007 Ga0207712_10000007285 506
1121 3300025981 Ga0207640_10013825 Ga0207640_100138253 506
1122 3300046454 Ga0495592_0000036 Ga0495592_0000036_117391_118920 506
1123 3300046463 Ga0495653_0018382 Ga0495653_0018382_3120_4664 506
1124 3300046463 Ga0495653_0020520 Ga0495653_0020520_1072_2595 506
1125 3300046473 Ga0495582_0000011 Ga0495582_0000011_20695_22224 506
1126 3300046511 Ga0495608_0001071 Ga0495608_0001071_16703_18232 506
1127 3300046514 Ga0495618_0000594 Ga0495618_0000594_15124_16653 506
1128 3300046615 Ga0495656_0000483 Ga0495656_0000483_9778_11301 506
1129 3300046616 Ga0495668_0070338 Ga0495668_0070338_204_1754 506
1130 3300046642 Ga0495634_0000018 Ga0495634_0000018_39434_40963 506
1131 3300046683 Ga0495658_0000005 Ga0495658_0000005_91126_92655 506
1132 3300046809 Ga0495600_0000787 Ga0495600_0000787_86_1615 506
1133 3300048908 Ga0496105_0004668 Ga0496105_0004668_2335_3870 506
1134 3300048911 Ga0496108_0001172 Ga0496108_0001172_15457_16995 506
1135 3300048912 Ga0496109_0001311 Ga0496109_0001311_15537_17075 506
1136 3300048920 Ga0496117_0004578 Ga0496117_0004578_8979_10505 506
1137 3300048921 Ga0496118_0010367 Ga0496118_0010367_4402_5928 506
1138 3300048923 Ga0496120_0018638 Ga0496120_0018638_1698_3224 506
1139 3300053077 Ga0495601_0000326 Ga0495601_0000326_11500_13023 506
1140 3300053077 Ga0495601_0053134 Ga0495601_0053134_221_1753 506
1141 3300053084 Ga0495595_0000172 Ga0495595_0000172_2989_4518 506
1142 3300053085 Ga0495619_0009846 Ga0495619_0009846_3767_5296 506
1143 3300001977 JGI24746J21847_1000167 JGI24746J21847_10001675 507
1144 3300005337 Ga0070682_100000013 Ga0070682_100000013101 507
1145 3300005459 Ga0068867_100006138 Ga0068867_1000061384 507
1146 3300005841 Ga0068863_100073925 Ga0068863_1000739252 507
1147 3300007076 Ga0075435_100115086 Ga0075435_1001150862 507
1148 3300009176 Ga0105242_10000893 Ga0105242_100008933 507
1149 3300014968 Ga0157379_10084278 Ga0157379_100842782 507
1150 3300025934 Ga0207686_10000033 Ga0207686_1000003367 507
1151 3300026089 Ga0207648_10000766 Ga0207648_1000076634 507
1152 3300046455 Ga0495603_0000030 Ga0495603_0000030_7661_9208 507
1153 3300046463 Ga0495653_0012191 Ga0495653_0012191_4441_5991 507
1154 3300046517 Ga0495630_0000541 Ga0495630_0000541_5278_6816 507
1155 3300046529 Ga0495652_0020416 Ga0495652_0020416_2271_3809 507
1156 3300046536 Ga0495587_0002971 Ga0495587_0002971_3072_4622 507
1157 3300046559 Ga0495667_0000032 Ga0495667_0000032_14403_15941 507
1158 3300046642 Ga0495634_0017230 Ga0495634_0017230_3435_4970 507
1159 3300046684 Ga0495669_0000603 Ga0495669_0000603_13649_15226 507
1160 3300046691 Ga0495670_0032167 Ga0495670_0032167_579_2117 507
1161 3300047319 Ga0495674_0001564 Ga0495674_0001564_17699_19243 507
1162 3300047321 Ga0495676_0000299 Ga0495676_0000299_18069_19601 507
1163 3300047322 Ga0495680_0008488 Ga0495680_0008488_5092_6630 507
1164 3300047322 Ga0495680_0041474 Ga0495680_0041474_1282_2817 507
1165 3300047471 Ga0495684_0135647 Ga0495684_0135647_32_1582 507
1166 3300048903 Ga0496100_0000002 Ga0496100_0000002_281135_282661 507
1167 3300048904 Ga0496101_0000001 Ga0496101_0000001_281135_282661 507
1168 3300048909 Ga0496106_0000061 Ga0496106_0000061_68581_70107 507
1169 3300048910 Ga0496107_0000013 Ga0496107_0000013_108179_109705 507
1170 3300048911 Ga0496108_0000001 Ga0496108_0000001_569556_571088 507
1171 3300048912 Ga0496109_0000003 Ga0496109_0000003_244102_245634 507
1172 3300048915 Ga0496112_0000003 Ga0496112_0000003_59777_61315 507
1173 3300048918 Ga0496115_0000003 Ga0496115_0000003_238727_240274 507
1174 3300048928 Ga0496125_0082753 Ga0496125_0082753_454_1983 507
1175 3300049588 Ga0501072_0050104 Ga0501072_0050104_1326_2861 507
1176 3300053085 Ga0495619_0001746 Ga0495619_0001746_8356_9897 507

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01676

Metalloenzyme

Metalloenzyme superfamily

13

493

0.97

PF06415

iPGM_N

BPG-independent PGAM N-terminus (iPGM_N)

91

300

0.95

PF01663

Phosphodiest

Type I phosphodiesterase / nucleotide pyrophosphatase

327

488

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nwx-assembly1.cif.gz_A crystal structure of phosphoglycerate mutase from staphylococcus aureus in 2-phosphoglyceric acid bound form 0.9751 5 503
4nwx-assembly1.cif.gz_A crystal structure of phosphoglycerate mutase from staphylococcus aureus in 2-phosphoglyceric acid bound form 0.9655 5 503
7tl8-assembly1.cif.gz_A 1.95a resolution structure of independent phosphoglycerate mutase from s. aureus in complex with a macrocyclic peptide inhibitor (sa-d3) 0.9505 1 503
7tl8-assembly1.cif.gz_A 1.95a resolution structure of independent phosphoglycerate mutase from s. aureus in complex with a macrocyclic peptide inhibitor (sa-d3) 0.9486 1 503
7kng-assembly1.cif.gz_A 2.10a resolution structure of independent phosphoglycerate mutase from c. elegans in complex with a macrocyclic peptide inhibitor (ce-2 y7f) 0.84 2 503
ID Description Score Start End Superfamily
af_Q2G029_311_465_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.986 309 462 3.40.720.10
1ejjA02 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.9801 4 502 3.40.720.10
1ejjA02 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.973 4 502 3.40.720.10
af_G5EFZ1_349_538_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.9705 318 503 3.40.720.10
af_Q2G029_311_465_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.9672 309 462 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A645FE59-F1-model_v4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC 5.4.2.12) 0.9877 366 504 GO:0005829
GO:0006007
GO:0030145
GO:0046537
AF-A0A841ZKN1-F1-model_v4 deleted 0.9869 301 503
AF-A0A5C8MQN2-F1-model_v4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 0.9847 349 503 GO:0005829
GO:0006007
GO:0030145
GO:0046537
AF-A0A6B0BL53-F1-model_v4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 0.9838 372 503 GO:0005829
GO:0006007
GO:0030145
GO:0046537
AF-A0A357NG31-F1-model_v4 phosphoglycerate mutase (2,3-diphosphoglycerate-independent) (EC 5.4.2.12) 0.9813 65 277 GO:0005829
GO:0006007
GO:0006096
GO:0030145
GO:0046537

Feature Viewer

pLDDT pTM Quality
95.56 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map