F491257
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1176 | 382 | 1176 | 500 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0000273|Ga0466963_0000273_2983_4719 |
| Length | 571 |
| Sequence | MQLSEGPADLPVNAVALIVLDGWGLAPAGPGNAVASAHTPVFDELWSRYPHTSLKTSGRAVGLPEGQMGNSEVGHLNLGAGAVVVQDLTRIDEAIEHGDLASNAVLQEAFSSGERVHLIGLVSDGGVHSGFRHLKALIELAAEIDVPDLVLHAFTDGRDTLPHSGAGYLETAEGWMQSAGKGRIASVVGRYYAMDRDDRWERIQAAYDLLVHGRAEHHASSGVEAAHDAYDRGETDEFITPVLVGEEGRIRAQDIVVAFNFRPDRMREITRALADPEFTEIDRGGAEPVQRYVTMTEYEEGWPHPVAFEPHRPATTLPLELAAKGLHQLHVAETEKYPHVTYFAQEGEDRVLVPSPREVPTYDHKPEMSAHEAARKFVSAWAQERPAFGIINFANPDMVGHTGVVQAAVQAVETVDSCLGEVVEAVHGGGGACVVTADHGNADNMIEPDGSPNTAHSLNPVPLIVTVEGLTLRDGGVLADVAPTVLALLGLEQPEGMTATKLIRAPGAHGRRARPEHVPGGRMTRARRIKARQDAEGAASQWAHAPPRSIYKLDNLRLRFYTGSGTKGFLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 173 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 174 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 177 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 182 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 184 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 190 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 192 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 193 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 194 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 216 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 217 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 218 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 219 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 220 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 221 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 222 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 224 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 225 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 226 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 227 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 228 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 229 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 230 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 231 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 232 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 233 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 234 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 235 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 236 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 237 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 238 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 239 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 240 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 241 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 242 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 306 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 307 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 308 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 309 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 310 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 311 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 314 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 315 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 316 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 317 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 318 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 319 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 320 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 321 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 322 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 323 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 324 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 325 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 326 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 359 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 374 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 375 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 376 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 377 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 378 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 379 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 382 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.91 |
| Metatranscriptomes | 0.09 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.79 |
| Nodule | 0 |
| Rhizoplane | 10.63 |
| Rhizosphere | 84.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000167 | 3300001977 | Bacteria | 8560 |
| 2 | JGI24748J21848_1001590 | 3300002074 | Bacteria | 2527 |
| 3 | JGI24034J26672_10000104 | 3300002239 | Bacteria | 13847 |
| 4 | JGI25406J46586_10022658 | 3300003203 | Bacteria | 2498 |
| 5 | JGI25406J46586_10026917 | 3300003203 | Bacteria | 2211 |
| 6 | JGI25407J50210_10001803 | 3300003373 | Bacteria | 4938 |
| 7 | JGI25407J50210_10001927 | 3300003373 | Bacteria | 4814 |
| 8 | JGI25407J50210_10002817 | 3300003373 | Bacteria | 4138 |
| 9 | JGI25404J52841_10006407 | 3300003659 | Bacteria | 2460 |
| 10 | Ga0070658_10004160 | 3300005327 | Bacteria | 11848 |
| 11 | Ga0070658_10156784 | 3300005327 | Bacteria | 1909 |
| 12 | Ga0070683_100000682 | 3300005329 | Bacteria | 24589 |
| 13 | Ga0070683_100006431 | 3300005329 | Bacteria | 9856 |
| 14 | Ga0070683_100008910 | 3300005329 | Bacteria | 8551 |
| 15 | Ga0070683_100010038 | 3300005329 | Bacteria | 8122 |
| 16 | Ga0070683_100014931 | 3300005329 | Bacteria | 6808 |
| 17 | Ga0070683_100017176 | 3300005329 | Bacteria | 6391 |
| 18 | Ga0070683_100034666 | 3300005329 | Bacteria | 4612 |
| 19 | Ga0070683_100052582 | 3300005329 | Bacteria | 3774 |
| 20 | Ga0070683_100054804 | 3300005329 | Bacteria | 3698 |
| 21 | Ga0070683_100116675 | 3300005329 | Bacteria | 2520 |
| 22 | Ga0070683_100158979 | 3300005329 | Bacteria | 2143 |
| 23 | Ga0070677_10000004 | 3300005333 | Bacteria | 81101 |
| 24 | Ga0070666_10048044 | 3300005335 | Bacteria | 2866 |
| 25 | Ga0070680_100003345 | 3300005336 | Bacteria | 11961 |
| 26 | Ga0070680_100016204 | 3300005336 | Bacteria | 5862 |
| 27 | Ga0070680_100086547 | 3300005336 | Bacteria | 2590 |
| 28 | Ga0070682_100000013 | 3300005337 | Bacteria | 254641 |
| 29 | Ga0070682_100000045 | 3300005337 | Bacteria | 131960 |
| 30 | Ga0070682_100003538 | 3300005337 | Bacteria | 8644 |
| 31 | Ga0068868_100000033 | 3300005338 | Bacteria | 75402 |
| 32 | Ga0068868_100007612 | 3300005338 | Bacteria | 7723 |
| 33 | Ga0070660_100001782 | 3300005339 | Bacteria | 14790 |
| 34 | Ga0070660_100016628 | 3300005339 | Bacteria | 5344 |
| 35 | Ga0070689_100049457 | 3300005340 | Bacteria | 3246 |
| 36 | Ga0070691_10008221 | 3300005341 | Bacteria | 4782 |
| 37 | Ga0070661_100000023 | 3300005344 | Bacteria | 123104 |
| 38 | Ga0070661_100128955 | 3300005344 | Bacteria | 1899 |
| 39 | Ga0070692_10019194 | 3300005345 | Bacteria | 3299 |
| 40 | Ga0070669_100005033 | 3300005353 | Bacteria | 9556 |
| 41 | Ga0070675_100000101 | 3300005354 | Bacteria | 50140 |
| 42 | Ga0070675_100015766 | 3300005354 | Bacteria | 5981 |
| 43 | Ga0070674_100000008 | 3300005356 | Bacteria | 143844 |
| 44 | Ga0070674_100000029 | 3300005356 | Bacteria | 69489 |
| 45 | Ga0070673_100005926 | 3300005364 | Bacteria | 7897 |
| 46 | Ga0070673_100006213 | 3300005364 | Bacteria | 7751 |
| 47 | Ga0070673_100138496 | 3300005364 | Bacteria | 2051 |
| 48 | Ga0070688_100000068 | 3300005365 | Bacteria | 50778 |
| 49 | Ga0070659_100000030 | 3300005366 | Bacteria | 128662 |
| 50 | Ga0070659_100004757 | 3300005366 | Bacteria | 9702 |
| 51 | Ga0070659_100017601 | 3300005366 | Bacteria | 5382 |
| 52 | Ga0070659_100018207 | 3300005366 | Bacteria | 5300 |
| 53 | Ga0070659_100033746 | 3300005366 | Bacteria | 3977 |
| 54 | Ga0070659_100113105 | 3300005366 | Bacteria | 2192 |
| 55 | Ga0070667_100006419 | 3300005367 | Bacteria | 9773 |
| 56 | Ga0070709_10044052 | 3300005434 | Bacteria | 2762 |
| 57 | Ga0070714_100000228 | 3300005435 | Bacteria | 44348 |
| 58 | Ga0070714_100001436 | 3300005435 | Bacteria | 17333 |
| 59 | Ga0070714_100003341 | 3300005435 | Bacteria | 11963 |
| 60 | Ga0070714_100031539 | 3300005435 | Bacteria | 4423 |
| 61 | Ga0070714_100042377 | 3300005435 | Bacteria | 3845 |
| 62 | Ga0070714_100064090 | 3300005435 | Bacteria | 3162 |
| 63 | Ga0070714_100114738 | 3300005435 | Bacteria | 2390 |
| 64 | Ga0070714_100219592 | 3300005435 | Bacteria | 1746 |
| 65 | Ga0070713_100000009 | 3300005436 | Bacteria | 153056 |
| 66 | Ga0070713_100019536 | 3300005436 | Bacteria | 5177 |
| 67 | Ga0070713_100022221 | 3300005436 | Bacteria | 4898 |
| 68 | Ga0070713_100031284 | 3300005436 | Bacteria | 4238 |
| 69 | Ga0070713_100102944 | 3300005436 | Bacteria | 2477 |
| 70 | Ga0070710_10000009 | 3300005437 | Bacteria | 165863 |
| 71 | Ga0070710_10031211 | 3300005437 | Bacteria | 2874 |
| 72 | Ga0070710_10040070 | 3300005437 | Bacteria | 2581 |
| 73 | Ga0070711_100003340 | 3300005439 | Bacteria | 9338 |
| 74 | Ga0070711_100011026 | 3300005439 | Bacteria | 5607 |
| 75 | Ga0070711_100076384 | 3300005439 | Bacteria | 2375 |
| 76 | Ga0070700_100001344 | 3300005441 | Bacteria | 12221 |
| 77 | Ga0070700_100004038 | 3300005441 | Bacteria | 7638 |
| 78 | Ga0070663_100003079 | 3300005455 | Bacteria | 9535 |
| 79 | Ga0070678_100011655 | 3300005456 | Bacteria | 5433 |
| 80 | Ga0070678_100033935 | 3300005456 | Bacteria | 3548 |
| 81 | Ga0070662_100000004 | 3300005457 | Bacteria | 195534 |
| 82 | Ga0070662_100003078 | 3300005457 | Bacteria | 10347 |
| 83 | Ga0070681_10004654 | 3300005458 | Bacteria | 13109 |
| 84 | Ga0070681_10021554 | 3300005458 | Bacteria | 6459 |
| 85 | Ga0070681_10101094 | 3300005458 | Bacteria | 2828 |
| 86 | Ga0068867_100006138 | 3300005459 | Bacteria | 8506 |
| 87 | Ga0070685_10000127 | 3300005466 | Bacteria | 48844 |
| 88 | Ga0070685_10005555 | 3300005466 | Bacteria | 6394 |
| 89 | Ga0070679_100001522 | 3300005530 | Bacteria | 20653 |
| 90 | Ga0070679_100003939 | 3300005530 | Bacteria | 13660 |
| 91 | Ga0070679_100009474 | 3300005530 | Bacteria | 9212 |
| 92 | Ga0070679_100031188 | 3300005530 | Bacteria | 5265 |
| 93 | Ga0070679_100055874 | 3300005530 | Bacteria | 3932 |
| 94 | Ga0070679_100063537 | 3300005530 | Bacteria | 3680 |
| 95 | Ga0070679_100064550 | 3300005530 | Bacteria | 3649 |
| 96 | Ga0070679_100254294 | 3300005530 | Bacteria | 1712 |
| 97 | Ga0070684_100001766 | 3300005535 | Bacteria | 15773 |
| 98 | Ga0070684_100008210 | 3300005535 | Bacteria | 8157 |
| 99 | Ga0070684_100008468 | 3300005535 | Bacteria | 8043 |
| 100 | Ga0070684_100034900 | 3300005535 | Bacteria | 4303 |
| 101 | Ga0070684_100040324 | 3300005535 | Bacteria | 4020 |
| 102 | Ga0070684_100139387 | 3300005535 | Bacteria | 2192 |
| 103 | Ga0070684_100146242 | 3300005535 | Bacteria | 2139 |
| 104 | Ga0068853_100011850 | 3300005539 | Bacteria | 7088 |
| 105 | Ga0068853_100050807 | 3300005539 | Bacteria | 3567 |
| 106 | Ga0070672_100000027 | 3300005543 | Bacteria | 67016 |
| 107 | Ga0070686_100125632 | 3300005544 | Bacteria | 1767 |
| 108 | Ga0070695_100000265 | 3300005545 | Bacteria | 26294 |
| 109 | Ga0070693_100000376 | 3300005547 | Bacteria | 20214 |
| 110 | Ga0070693_100011458 | 3300005547 | Bacteria | 4466 |
| 111 | Ga0070665_100000106 | 3300005548 | Bacteria | 157315 |
| 112 | Ga0070665_100001191 | 3300005548 | Bacteria | 31756 |
| 113 | Ga0070665_100001955 | 3300005548 | Bacteria | 23184 |
| 114 | Ga0070665_100038430 | 3300005548 | Bacteria | 4811 |
| 115 | Ga0070704_100067316 | 3300005549 | Bacteria | 2586 |
| 116 | Ga0068855_100014745 | 3300005563 | Bacteria | 9416 |
| 117 | Ga0070664_100015011 | 3300005564 | Bacteria | 6323 |
| 118 | Ga0070664_100019724 | 3300005564 | Bacteria | 5549 |
| 119 | Ga0068857_100062863 | 3300005577 | Bacteria | 3300 |
| 120 | Ga0068857_100149959 | 3300005577 | Bacteria | 2112 |
| 121 | Ga0068854_100000114 | 3300005578 | Bacteria | 55089 |
| 122 | Ga0068856_100000577 | 3300005614 | Bacteria | 40018 |
| 123 | Ga0068856_100021907 | 3300005614 | Bacteria | 6213 |
| 124 | Ga0068856_100026071 | 3300005614 | Bacteria | 5700 |
| 125 | Ga0068856_100039508 | 3300005614 | Bacteria | 4633 |
| 126 | Ga0068856_100081832 | 3300005614 | Bacteria | 3204 |
| 127 | Ga0068856_100082799 | 3300005614 | Bacteria | 3185 |
| 128 | Ga0068856_100094185 | 3300005614 | Bacteria | 2982 |
| 129 | Ga0070702_100037020 | 3300005615 | Bacteria | 2708 |
| 130 | Ga0070702_100047882 | 3300005615 | Bacteria | 2431 |
| 131 | Ga0068852_100000184 | 3300005616 | Bacteria | 42515 |
| 132 | Ga0068852_100007961 | 3300005616 | Bacteria | 7770 |
| 133 | Ga0068859_100205402 | 3300005617 | Bacteria | 2055 |
| 134 | Ga0068864_100000045 | 3300005618 | Bacteria | 154739 |
| 135 | Ga0068864_100047347 | 3300005618 | Bacteria | 3692 |
| 136 | Ga0068866_10000001 | 3300005718 | Bacteria | 519680 |
| 137 | Ga0068866_10000031 | 3300005718 | Bacteria | 56943 |
| 138 | Ga0068851_10004695 | 3300005834 | Bacteria | 6177 |
| 139 | Ga0068851_10018437 | 3300005834 | Bacteria | 3361 |
| 140 | Ga0068870_10038670 | 3300005840 | Bacteria | 2465 |
| 141 | Ga0068863_100000021 | 3300005841 | Bacteria | 198088 |
| 142 | Ga0068863_100073925 | 3300005841 | Bacteria | 3224 |
| 143 | Ga0068858_100000091 | 3300005842 | Bacteria | 93802 |
| 144 | Ga0068858_100000216 | 3300005842 | Bacteria | 62188 |
| 145 | Ga0068858_100044814 | 3300005842 | Bacteria | 4099 |
| 146 | Ga0068860_100028039 | 3300005843 | Bacteria | 5423 |
| 147 | Ga0068862_100000973 | 3300005844 | Bacteria | 27530 |
| 148 | Ga0081455_10001981 | 3300005937 | Bacteria | 24463 |
| 149 | Ga0081455_10016719 | 3300005937 | Bacteria | 7065 |
| 150 | Ga0081455_10019018 | 3300005937 | Bacteria | 6514 |
| 151 | Ga0081455_10026557 | 3300005937 | Bacteria | 5322 |
| 152 | Ga0081455_10036852 | 3300005937 | Bacteria | 4349 |
| 153 | Ga0081455_10043246 | 3300005937 | Bacteria | 3943 |
| 154 | Ga0081455_10103892 | 3300005937 | Bacteria | 2274 |
| 155 | Ga0081455_10149935 | 3300005937 | Bacteria | 1799 |
| 156 | Ga0081538_10000066 | 3300005981 | Bacteria | 98455 |
| 157 | Ga0081538_10000259 | 3300005981 | Bacteria | 60118 |
| 158 | Ga0081538_10000464 | 3300005981 | Bacteria | 45462 |
| 159 | Ga0081538_10000514 | 3300005981 | Bacteria | 43252 |
| 160 | Ga0081538_10000671 | 3300005981 | Bacteria | 37656 |
| 161 | Ga0081538_10000920 | 3300005981 | Bacteria | 31733 |
| 162 | Ga0081538_10001367 | 3300005981 | Bacteria | 25112 |
| 163 | Ga0081538_10001716 | 3300005981 | Bacteria | 22311 |
| 164 | Ga0081538_10001796 | 3300005981 | Bacteria | 21666 |
| 165 | Ga0081538_10001868 | 3300005981 | Bacteria | 21217 |
| 166 | Ga0081538_10001885 | 3300005981 | Bacteria | 21119 |
| 167 | Ga0081538_10001951 | 3300005981 | Bacteria | 20662 |
| 168 | Ga0081538_10003478 | 3300005981 | Bacteria | 14875 |
| 169 | Ga0081538_10004433 | 3300005981 | Bacteria | 12939 |
| 170 | Ga0081538_10004837 | 3300005981 | Bacteria | 12279 |
| 171 | Ga0081538_10005710 | 3300005981 | Bacteria | 11126 |
| 172 | Ga0081538_10007479 | 3300005981 | Bacteria | 9439 |
| 173 | Ga0081538_10013656 | 3300005981 | Bacteria | 6421 |
| 174 | Ga0081538_10014112 | 3300005981 | Bacteria | 6277 |
| 175 | Ga0081538_10016644 | 3300005981 | Bacteria | 5624 |
| 176 | Ga0081538_10021826 | 3300005981 | Bacteria | 4659 |
| 177 | Ga0081538_10031229 | 3300005981 | Bacteria | 3598 |
| 178 | Ga0081538_10046302 | 3300005981 | Bacteria | 2684 |
| 179 | Ga0081538_10057348 | 3300005981 | Bacteria | 2270 |
| 180 | Ga0081538_10067849 | 3300005981 | Bacteria | 1988 |
| 181 | Ga0081540_1000139 | 3300005983 | Bacteria | 76578 |
| 182 | Ga0081540_1000306 | 3300005983 | Bacteria | 50547 |
| 183 | Ga0081540_1026139 | 3300005983 | Bacteria | 3340 |
| 184 | Ga0081539_10000288 | 3300005985 | Bacteria | 113905 |
| 185 | Ga0081539_10000791 | 3300005985 | Bacteria | 61600 |
| 186 | Ga0081539_10003296 | 3300005985 | Bacteria | 20206 |
| 187 | Ga0081539_10006119 | 3300005985 | Bacteria | 11731 |
| 188 | Ga0081539_10018233 | 3300005985 | Bacteria | 4881 |
| 189 | Ga0081539_10041810 | 3300005985 | Bacteria | 2675 |
| 190 | Ga0070717_10004065 | 3300006028 | Bacteria | 10546 |
| 191 | Ga0070717_10012533 | 3300006028 | Bacteria | 6465 |
| 192 | Ga0070717_10090410 | 3300006028 | Bacteria | 2583 |
| 193 | Ga0070717_10099897 | 3300006028 | Bacteria | 2463 |
| 194 | Ga0075365_10013272 | 3300006038 | Bacteria | 4917 |
| 195 | Ga0075365_10020924 | 3300006038 | Bacteria | 4069 |
| 196 | Ga0075365_10028757 | 3300006038 | Bacteria | 3546 |
| 197 | Ga0075365_10034216 | 3300006038 | Bacteria | 3281 |
| 198 | Ga0075365_10035119 | 3300006038 | Bacteria | 3242 |
| 199 | Ga0075363_100068621 | 3300006048 | Bacteria | 1923 |
| 200 | Ga0075364_10075351 | 3300006051 | Bacteria | 2226 |
| 201 | Ga0075364_10092093 | 3300006051 | Bacteria | 2012 |
| 202 | Ga0075364_10098454 | 3300006051 | Bacteria | 1945 |
| 203 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 204 | Ga0070716_100064474 | 3300006173 | Bacteria | 2130 |
| 205 | Ga0070712_100000003 | 3300006175 | Bacteria | 253696 |
| 206 | Ga0070712_100003339 | 3300006175 | Bacteria | 9862 |
| 207 | Ga0070712_100003379 | 3300006175 | Bacteria | 9812 |
| 208 | Ga0070712_100004441 | 3300006175 | Bacteria | 8657 |
| 209 | Ga0070712_100014909 | 3300006175 | Bacteria | 4996 |
| 210 | Ga0070712_100025707 | 3300006175 | Bacteria | 3915 |
| 211 | Ga0070712_100159453 | 3300006175 | Bacteria | 1741 |
| 212 | Ga0075367_10073065 | 3300006178 | Bacteria | 2066 |
| 213 | Ga0075428_100025755 | 3300006844 | Bacteria | 6515 |
| 214 | Ga0075428_100053256 | 3300006844 | Bacteria | 4433 |
| 215 | Ga0075428_100064842 | 3300006844 | Bacteria | 4000 |
| 216 | Ga0075428_100145148 | 3300006844 | Bacteria | 2579 |
| 217 | Ga0075430_100017889 | 3300006846 | Bacteria | 6033 |
| 218 | Ga0075430_100039029 | 3300006846 | Bacteria | 4021 |
| 219 | Ga0075430_100046313 | 3300006846 | Bacteria | 3673 |
| 220 | Ga0075430_100058117 | 3300006846 | Bacteria | 3252 |
| 221 | Ga0075431_100000075 | 3300006847 | Bacteria | 57994 |
| 222 | Ga0075431_100005144 | 3300006847 | Bacteria | 12873 |
| 223 | Ga0075431_100026586 | 3300006847 | Bacteria | 5937 |
| 224 | Ga0075431_100064714 | 3300006847 | Bacteria | 3776 |
| 225 | Ga0075433_10001554 | 3300006852 | Bacteria | 16977 |
| 226 | Ga0075433_10045006 | 3300006852 | Bacteria | 3835 |
| 227 | Ga0075434_100003025 | 3300006871 | Bacteria | 14950 |
| 228 | Ga0075434_100003679 | 3300006871 | Bacteria | 13696 |
| 229 | Ga0075434_100018375 | 3300006871 | Bacteria | 6753 |
| 230 | Ga0075429_100002308 | 3300006880 | Bacteria | 16014 |
| 231 | Ga0075429_100073357 | 3300006880 | Bacteria | 2981 |
| 232 | Ga0075429_100080839 | 3300006880 | Bacteria | 2834 |
| 233 | Ga0068865_100000160 | 3300006881 | Bacteria | 36781 |
| 234 | Ga0068865_100122247 | 3300006881 | Bacteria | 1938 |
| 235 | Ga0075436_100092306 | 3300006914 | Bacteria | 2105 |
| 236 | Ga0075436_100147263 | 3300006914 | Bacteria | 1656 |
| 237 | Ga0097620_100205407 | 3300006931 | Bacteria | 2055 |
| 238 | Ga0075435_100115086 | 3300007076 | Bacteria | 2239 |
| 239 | Ga0105240_10058261 | 3300009093 | Bacteria | 4822 |
| 240 | Ga0105240_10061141 | 3300009093 | Bacteria | 4694 |
| 241 | Ga0105240_10110181 | 3300009093 | Bacteria | 3333 |
| 242 | Ga0111539_10008241 | 3300009094 | Bacteria | 13268 |
| 243 | Ga0111539_10011787 | 3300009094 | Bacteria | 10960 |
| 244 | Ga0111539_10014997 | 3300009094 | Bacteria | 9657 |
| 245 | Ga0111539_10022251 | 3300009094 | Bacteria | 7792 |
| 246 | Ga0111539_10040504 | 3300009094 | Bacteria | 5608 |
| 247 | Ga0111539_10044673 | 3300009094 | Bacteria | 5306 |
| 248 | Ga0111539_10176543 | 3300009094 | Bacteria | 2495 |
| 249 | Ga0105245_10000016 | 3300009098 | Bacteria | 204372 |
| 250 | Ga0105245_10000456 | 3300009098 | Bacteria | 37383 |
| 251 | Ga0105245_10005125 | 3300009098 | Bacteria | 11514 |
| 252 | Ga0105245_10008155 | 3300009098 | Bacteria | 9161 |
| 253 | Ga0105245_10014206 | 3300009098 | Bacteria | 6940 |
| 254 | Ga0105245_10136902 | 3300009098 | Bacteria | 2302 |
| 255 | Ga0105245_10193181 | 3300009098 | Bacteria | 1951 |
| 256 | Ga0105247_10000393 | 3300009101 | Bacteria | 37140 |
| 257 | Ga0114129_10008963 | 3300009147 | Bacteria | 14264 |
| 258 | Ga0114129_10024279 | 3300009147 | Bacteria | 8589 |
| 259 | Ga0114129_10168988 | 3300009147 | Bacteria | 2982 |
| 260 | Ga0114129_10447196 | 3300009147 | Bacteria | 1695 |
| 261 | Ga0105243_10009266 | 3300009148 | Bacteria | 7515 |
| 262 | Ga0105243_10026089 | 3300009148 | Bacteria | 4471 |
| 263 | Ga0105243_10061148 | 3300009148 | Bacteria | 3011 |
| 264 | Ga0105243_10062605 | 3300009148 | Bacteria | 2979 |
| 265 | Ga0105243_10109557 | 3300009148 | Bacteria | 2307 |
| 266 | Ga0105242_10000893 | 3300009176 | Bacteria | 23179 |
| 267 | Ga0105242_10025382 | 3300009176 | Bacteria | 4690 |
| 268 | Ga0105248_10000249 | 3300009177 | Bacteria | 62662 |
| 269 | Ga0105248_10117921 | 3300009177 | Bacteria | 2994 |
| 270 | Ga0105237_10001661 | 3300009545 | Bacteria | 28883 |
| 271 | Ga0105238_10000011 | 3300009551 | Bacteria | 261080 |
| 272 | Ga0105238_10205639 | 3300009551 | Bacteria | 1945 |
| 273 | Ga0105249_10000068 | 3300009553 | Bacteria | 148594 |
| 274 | Ga0105249_10009291 | 3300009553 | Bacteria | 8598 |
| 275 | Ga0105239_10075213 | 3300010375 | Bacteria | 3713 |
| 276 | Ga0105239_10120285 | 3300010375 | Bacteria | 2916 |
| 277 | Ga0105246_10014139 | 3300011119 | Bacteria | 5016 |
| 278 | Ga0105246_10036239 | 3300011119 | Bacteria | 3304 |
| 279 | Ga0105246_10139585 | 3300011119 | Bacteria | 1821 |
| 280 | Ga0157371_10011147 | 3300013102 | Bacteria | 6956 |
| 281 | Ga0157370_10008024 | 3300013104 | Bacteria | 11436 |
| 282 | Ga0157370_10012340 | 3300013104 | Bacteria | 8867 |
| 283 | Ga0157369_10000110 | 3300013105 | Bacteria | 115514 |
| 284 | Ga0157369_10031554 | 3300013105 | Bacteria | 5833 |
| 285 | Ga0157369_10072870 | 3300013105 | Bacteria | 3686 |
| 286 | Ga0157369_10089867 | 3300013105 | Bacteria | 3279 |
| 287 | Ga0157374_10005737 | 3300013296 | Bacteria | 10475 |
| 288 | Ga0157374_10006397 | 3300013296 | Bacteria | 9999 |
| 289 | Ga0157378_10018959 | 3300013297 | Bacteria | 6048 |
| 290 | Ga0157372_10000129 | 3300013307 | Bacteria | 82491 |
| 291 | Ga0157372_10007044 | 3300013307 | Bacteria | 11976 |
| 292 | Ga0157372_10163531 | 3300013307 | Bacteria | 2573 |
| 293 | Ga0157372_10183659 | 3300013307 | Bacteria | 2422 |
| 294 | Ga0157375_10001152 | 3300013308 | Bacteria | 22842 |
| 295 | Ga0157375_10013338 | 3300013308 | Bacteria | 7309 |
| 296 | Ga0163163_10024319 | 3300014325 | Bacteria | 5764 |
| 297 | Ga0157380_10000132 | 3300014326 | Bacteria | 41696 |
| 298 | Ga0157380_10006960 | 3300014326 | Bacteria | 8003 |
| 299 | Ga0157380_10095379 | 3300014326 | Bacteria | 2464 |
| 300 | Ga0157379_10001717 | 3300014968 | Bacteria | 18137 |
| 301 | Ga0157379_10084278 | 3300014968 | Bacteria | 2849 |
| 302 | Ga0157376_10013180 | 3300014969 | Bacteria | 6160 |
| 303 | Ga0157376_10125257 | 3300014969 | Bacteria | 2284 |
| 304 | Ga0163161_10000035 | 3300017792 | Bacteria | 155979 |
| 305 | Ga0206353_11536562 | 3300020082 | Bacteria | 4877 |
| 306 | Ga0213874_10000263 | 3300021377 | Bacteria | 10106 |
| 307 | Ga0213874_10006555 | 3300021377 | Bacteria | 2759 |
| 308 | Ga0213876_10004900 | 3300021384 | Bacteria | 7421 |
| 309 | Ga0213876_10018870 | 3300021384 | Bacteria | 3642 |
| 310 | Ga0213875_10000095 | 3300021388 | Bacteria | 102332 |
| 311 | Ga0213875_10029251 | 3300021388 | Bacteria | 2613 |
| 312 | Ga0207656_10002580 | 3300025321 | Bacteria | 6127 |
| 313 | Ga0207656_10005030 | 3300025321 | Bacteria | 4645 |
| 314 | Ga0207682_10000031 | 3300025893 | Bacteria | 57806 |
| 315 | Ga0207692_10000005 | 3300025898 | Bacteria | 370169 |
| 316 | Ga0207692_10049620 | 3300025898 | Bacteria | 2119 |
| 317 | Ga0207692_10063646 | 3300025898 | Bacteria | 1918 |
| 318 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 319 | Ga0207642_10000122 | 3300025899 | Bacteria | 21318 |
| 320 | Ga0207642_10019184 | 3300025899 | Bacteria | 2643 |
| 321 | Ga0207710_10000195 | 3300025900 | Bacteria | 57216 |
| 322 | Ga0207688_10000574 | 3300025901 | Bacteria | 18050 |
| 323 | Ga0207688_10005824 | 3300025901 | Bacteria | 6706 |
| 324 | Ga0207688_10010122 | 3300025901 | Bacteria | 5130 |
| 325 | Ga0207688_10032304 | 3300025901 | Bacteria | 2892 |
| 326 | Ga0207680_10010636 | 3300025903 | Bacteria | 4612 |
| 327 | Ga0207680_10050043 | 3300025903 | Bacteria | 2491 |
| 328 | Ga0207685_10000036 | 3300025905 | Bacteria | 65666 |
| 329 | Ga0207705_10011755 | 3300025909 | Bacteria | 6324 |
| 330 | Ga0207705_10017978 | 3300025909 | Bacteria | 5056 |
| 331 | Ga0207705_10060566 | 3300025909 | Bacteria | 2734 |
| 332 | Ga0207707_10006013 | 3300025912 | Bacteria | 10621 |
| 333 | Ga0207707_10006637 | 3300025912 | Bacteria | 10099 |
| 334 | Ga0207707_10010986 | 3300025912 | Bacteria | 7878 |
| 335 | Ga0207707_10041204 | 3300025912 | Bacteria | 4033 |
| 336 | Ga0207707_10042359 | 3300025912 | Bacteria | 3974 |
| 337 | Ga0207707_10116782 | 3300025912 | Bacteria | 2332 |
| 338 | Ga0207671_10002660 | 3300025914 | Bacteria | 18745 |
| 339 | Ga0207671_10090654 | 3300025914 | Bacteria | 2303 |
| 340 | Ga0207693_10000028 | 3300025915 | Bacteria | 120041 |
| 341 | Ga0207693_10000920 | 3300025915 | Bacteria | 26422 |
| 342 | Ga0207693_10001165 | 3300025915 | Bacteria | 23432 |
| 343 | Ga0207693_10001560 | 3300025915 | Bacteria | 20234 |
| 344 | Ga0207693_10007247 | 3300025915 | Bacteria | 9125 |
| 345 | Ga0207693_10008453 | 3300025915 | Bacteria | 8424 |
| 346 | Ga0207693_10010457 | 3300025915 | Bacteria | 7530 |
| 347 | Ga0207693_10014455 | 3300025915 | Bacteria | 6346 |
| 348 | Ga0207693_10019840 | 3300025915 | Bacteria | 5346 |
| 349 | Ga0207663_10005734 | 3300025916 | Bacteria | 6284 |
| 350 | Ga0207663_10058760 | 3300025916 | Bacteria | 2429 |
| 351 | Ga0207663_10065905 | 3300025916 | Bacteria | 2316 |
| 352 | Ga0207660_10004934 | 3300025917 | Bacteria | 8693 |
| 353 | Ga0207657_10000895 | 3300025919 | Bacteria | 31534 |
| 354 | Ga0207657_10005572 | 3300025919 | Bacteria | 13149 |
| 355 | Ga0207657_10008838 | 3300025919 | Bacteria | 10190 |
| 356 | Ga0207657_10021014 | 3300025919 | Bacteria | 6154 |
| 357 | Ga0207649_10000063 | 3300025920 | Bacteria | 96360 |
| 358 | Ga0207652_10000349 | 3300025921 | Bacteria | 47896 |
| 359 | Ga0207652_10008277 | 3300025921 | Bacteria | 8360 |
| 360 | Ga0207652_10081403 | 3300025921 | Bacteria | 2832 |
| 361 | Ga0207652_10224982 | 3300025921 | Bacteria | 1691 |
| 362 | Ga0207681_10011629 | 3300025923 | Bacteria | 5410 |
| 363 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 364 | Ga0207694_10043428 | 3300025924 | Bacteria | 3469 |
| 365 | Ga0207694_10050210 | 3300025924 | Bacteria | 3230 |
| 366 | Ga0207659_10000010 | 3300025926 | Bacteria | 286639 |
| 367 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 368 | Ga0207687_10000018 | 3300025927 | Bacteria | 236159 |
| 369 | Ga0207687_10000177 | 3300025927 | Bacteria | 42164 |
| 370 | Ga0207687_10004028 | 3300025927 | Bacteria | 9845 |
| 371 | Ga0207687_10043291 | 3300025927 | Bacteria | 3102 |
| 372 | Ga0207687_10084038 | 3300025927 | Bacteria | 2307 |
| 373 | Ga0207700_10000081 | 3300025928 | Bacteria | 59083 |
| 374 | Ga0207700_10014327 | 3300025928 | Bacteria | 5193 |
| 375 | Ga0207664_10000060 | 3300025929 | Bacteria | 116764 |
| 376 | Ga0207664_10005856 | 3300025929 | Bacteria | 8405 |
| 377 | Ga0207664_10006739 | 3300025929 | Bacteria | 7934 |
| 378 | Ga0207664_10017802 | 3300025929 | Bacteria | 5220 |
| 379 | Ga0207664_10030175 | 3300025929 | Bacteria | 4139 |
| 380 | Ga0207664_10050301 | 3300025929 | Bacteria | 3286 |
| 381 | Ga0207690_10000094 | 3300025932 | Bacteria | 74114 |
| 382 | Ga0207690_10006892 | 3300025932 | Bacteria | 6740 |
| 383 | Ga0207690_10047230 | 3300025932 | Bacteria | 2855 |
| 384 | Ga0207690_10083172 | 3300025932 | Bacteria | 2241 |
| 385 | Ga0207706_10000012 | 3300025933 | Bacteria | 195475 |
| 386 | Ga0207706_10006002 | 3300025933 | Bacteria | 11295 |
| 387 | Ga0207706_10010294 | 3300025933 | Bacteria | 8551 |
| 388 | Ga0207706_10046641 | 3300025933 | Bacteria | 3837 |
| 389 | Ga0207686_10000033 | 3300025934 | Bacteria | 143602 |
| 390 | Ga0207686_10005471 | 3300025934 | Bacteria | 6817 |
| 391 | Ga0207686_10019818 | 3300025934 | Bacteria | 3833 |
| 392 | Ga0207709_10012022 | 3300025935 | Bacteria | 4773 |
| 393 | Ga0207709_10034179 | 3300025935 | Bacteria | 2994 |
| 394 | Ga0207669_10000004 | 3300025937 | Bacteria | 196828 |
| 395 | Ga0207669_10000012 | 3300025937 | Bacteria | 138242 |
| 396 | Ga0207669_10025626 | 3300025937 | Bacteria | 3192 |
| 397 | Ga0207704_10000236 | 3300025938 | Bacteria | 27317 |
| 398 | Ga0207704_10030307 | 3300025938 | Bacteria | 3032 |
| 399 | Ga0207665_10003251 | 3300025939 | Bacteria | 10879 |
| 400 | Ga0207665_10124725 | 3300025939 | Bacteria | 1822 |
| 401 | Ga0207691_10000136 | 3300025940 | Bacteria | 67179 |
| 402 | Ga0207691_10007573 | 3300025940 | Bacteria | 10450 |
| 403 | Ga0207711_10000020 | 3300025941 | Bacteria | 363325 |
| 404 | Ga0207689_10075688 | 3300025942 | Bacteria | 2767 |
| 405 | Ga0207661_10000224 | 3300025944 | Bacteria | 36954 |
| 406 | Ga0207661_10002814 | 3300025944 | Bacteria | 12013 |
| 407 | Ga0207661_10003313 | 3300025944 | Bacteria | 11175 |
| 408 | Ga0207661_10013702 | 3300025944 | Bacteria | 5921 |
| 409 | Ga0207661_10033341 | 3300025944 | Bacteria | 3996 |
| 410 | Ga0207661_10052959 | 3300025944 | Bacteria | 3245 |
| 411 | Ga0207661_10075262 | 3300025944 | Bacteria | 2770 |
| 412 | Ga0207679_10009479 | 3300025945 | Bacteria | 6239 |
| 413 | Ga0207679_10040804 | 3300025945 | Bacteria | 3325 |
| 414 | Ga0207651_10000460 | 3300025960 | Bacteria | 17106 |
| 415 | Ga0207651_10020147 | 3300025960 | Bacteria | 4018 |
| 416 | Ga0207651_10080053 | 3300025960 | Bacteria | 2350 |
| 417 | Ga0207712_10000007 | 3300025961 | Bacteria | 539589 |
| 418 | Ga0207712_10016430 | 3300025961 | Bacteria | 4792 |
| 419 | Ga0207712_10037616 | 3300025961 | Bacteria | 3303 |
| 420 | Ga0207668_10018553 | 3300025972 | Bacteria | 4382 |
| 421 | Ga0207640_10000015 | 3300025981 | Bacteria | 215411 |
| 422 | Ga0207640_10013825 | 3300025981 | Bacteria | 4634 |
| 423 | Ga0207658_10057816 | 3300025986 | Bacteria | 2883 |
| 424 | Ga0207677_10000338 | 3300026023 | Bacteria | 33505 |
| 425 | Ga0207703_10000023 | 3300026035 | Bacteria | 222018 |
| 426 | Ga0207703_10000152 | 3300026035 | Bacteria | 79658 |
| 427 | Ga0207639_10023349 | 3300026041 | Bacteria | 4466 |
| 428 | Ga0207639_10191344 | 3300026041 | Bacteria | 1748 |
| 429 | Ga0207678_10007745 | 3300026067 | Bacteria | 9489 |
| 430 | Ga0207678_10072220 | 3300026067 | Bacteria | 2957 |
| 431 | Ga0207708_10001047 | 3300026075 | Bacteria | 20695 |
| 432 | Ga0207708_10033916 | 3300026075 | Bacteria | 3881 |
| 433 | Ga0207708_10072952 | 3300026075 | Bacteria | 2630 |
| 434 | Ga0207708_10086924 | 3300026075 | Bacteria | 2406 |
| 435 | Ga0207702_10000060 | 3300026078 | Bacteria | 125473 |
| 436 | Ga0207702_10003607 | 3300026078 | Bacteria | 14060 |
| 437 | Ga0207702_10077475 | 3300026078 | Bacteria | 2875 |
| 438 | Ga0207641_10000151 | 3300026088 | Bacteria | 99225 |
| 439 | Ga0207648_10000766 | 3300026089 | Bacteria | 36117 |
| 440 | Ga0207648_10011873 | 3300026089 | Bacteria | 8185 |
| 441 | Ga0207648_10056680 | 3300026089 | Bacteria | 3419 |
| 442 | Ga0207676_10000016 | 3300026095 | Bacteria | 311561 |
| 443 | Ga0207674_10073827 | 3300026116 | Bacteria | 3424 |
| 444 | Ga0207674_10096118 | 3300026116 | Bacteria | 2948 |
| 445 | Ga0207674_10164679 | 3300026116 | Bacteria | 2171 |
| 446 | Ga0207674_10257859 | 3300026116 | Bacteria | 1691 |
| 447 | Ga0207675_100001704 | 3300026118 | Bacteria | 22024 |
| 448 | Ga0207683_10002374 | 3300026121 | Bacteria | 16445 |
| 449 | Ga0207683_10003745 | 3300026121 | Bacteria | 13186 |
| 450 | Ga0207683_10067514 | 3300026121 | Bacteria | 3155 |
| 451 | Ga0207698_10000012 | 3300026142 | Bacteria | 260061 |
| 452 | Ga0207698_10014684 | 3300026142 | Bacteria | 5215 |
| 453 | Ga0207698_10022568 | 3300026142 | Bacteria | 4377 |
| 454 | Ga0207698_10120357 | 3300026142 | Bacteria | 2220 |
| 455 | Ga0207428_10018799 | 3300027907 | Bacteria | 5896 |
| 456 | Ga0207428_10026212 | 3300027907 | Bacteria | 4866 |
| 457 | Ga0207428_10054977 | 3300027907 | Bacteria | 3167 |
| 458 | Ga0207428_10134202 | 3300027907 | Bacteria | 1893 |
| 459 | Ga0268266_10000047 | 3300028379 | Bacteria | 310996 |
| 460 | Ga0268266_10000085 | 3300028379 | Bacteria | 201288 |
| 461 | Ga0268266_10007839 | 3300028379 | Bacteria | 9568 |
| 462 | Ga0268266_10055173 | 3300028379 | Bacteria | 3415 |
| 463 | Ga0268265_10001017 | 3300028380 | Bacteria | 25271 |
| 464 | Ga0268265_10059034 | 3300028380 | Bacteria | 2933 |
| 465 | Ga0268264_10013352 | 3300028381 | Bacteria | 6759 |
| 466 | Ga0268264_10118473 | 3300028381 | Bacteria | 2330 |
| 467 | Ga0265337_1000231 | 3300028556 | Bacteria | 30088 |
| 468 | Ga0265337_1006811 | 3300028556 | Bacteria | 4349 |
| 469 | Ga0265326_10000007 | 3300028558 | Bacteria | 223057 |
| 470 | Ga0265326_10000024 | 3300028558 | Bacteria | 112928 |
| 471 | Ga0265319_1000015 | 3300028563 | Bacteria | 176382 |
| 472 | Ga0265319_1000025 | 3300028563 | Bacteria | 142639 |
| 473 | Ga0265319_1000144 | 3300028563 | Bacteria | 52606 |
| 474 | Ga0265319_1002445 | 3300028563 | Bacteria | 10147 |
| 475 | Ga0265319_1004984 | 3300028563 | Bacteria | 6466 |
| 476 | Ga0265334_10000151 | 3300028573 | Bacteria | 42917 |
| 477 | Ga0265318_10001571 | 3300028577 | Bacteria | 13227 |
| 478 | Ga0265318_10002150 | 3300028577 | Bacteria | 10707 |
| 479 | Ga0265322_10000001 | 3300028654 | Bacteria | 543854 |
| 480 | Ga0265336_10000002 | 3300028666 | Bacteria | 830172 |
| 481 | Ga0265336_10000622 | 3300028666 | Bacteria | 19519 |
| 482 | Ga0265336_10005990 | 3300028666 | Bacteria | 4431 |
| 483 | Ga0265338_10000001 | 3300028800 | Bacteria | 1177449 |
| 484 | Ga0265338_10000473 | 3300028800 | Bacteria | 71777 |
| 485 | Ga0265338_10036287 | 3300028800 | Bacteria | 4720 |
| 486 | Ga0265338_10048163 | 3300028800 | Bacteria | 3881 |
| 487 | Ga0265324_10001009 | 3300029957 | Bacteria | 17266 |
| 488 | Ga0265320_10000002 | 3300031240 | Bacteria | 542875 |
| 489 | Ga0265320_10005211 | 3300031240 | Bacteria | 8387 |
| 490 | Ga0265325_10006013 | 3300031241 | Bacteria | 7426 |
| 491 | Ga0265329_10004822 | 3300031242 | Bacteria | 5539 |
| 492 | Ga0265340_10000001 | 3300031247 | Bacteria | 1647668 |
| 493 | Ga0265339_10023212 | 3300031249 | Bacteria | 3588 |
| 494 | Ga0265339_10054152 | 3300031249 | Bacteria | 2180 |
| 495 | Ga0265331_10019616 | 3300031250 | Bacteria | 3489 |
| 496 | Ga0265327_10000011 | 3300031251 | Bacteria | 543807 |
| 497 | Ga0265327_10008104 | 3300031251 | Bacteria | 7910 |
| 498 | Ga0265327_10011730 | 3300031251 | Bacteria | 6002 |
| 499 | Ga0265316_10083107 | 3300031344 | Bacteria | 2453 |
| 500 | Ga0265314_10000062 | 3300031711 | Bacteria | 159496 |
| 501 | Ga0316576_10035815 | 3300031727 | Bacteria | 3546 |
| 502 | Ga0307405_10060015 | 3300031731 | Bacteria | 2399 |
| 503 | Ga0307413_10110574 | 3300031824 | Bacteria | 1839 |
| 504 | Ga0307410_10013468 | 3300031852 | Bacteria | 4773 |
| 505 | Ga0307410_10031150 | 3300031852 | Bacteria | 3419 |
| 506 | Ga0307406_10042399 | 3300031901 | Bacteria | 2841 |
| 507 | Ga0307407_10010086 | 3300031903 | Bacteria | 4437 |
| 508 | Ga0307409_100002102 | 3300031995 | Bacteria | 10248 |
| 509 | Ga0307409_100184376 | 3300031995 | Bacteria | 1851 |
| 510 | Ga0307416_100022798 | 3300032002 | Bacteria | 4529 |
| 511 | Ga0307411_10128450 | 3300032005 | Bacteria | 1848 |
| 512 | Ga0307415_100001872 | 3300032126 | Bacteria | 10327 |
| 513 | Ga0307415_100003690 | 3300032126 | Bacteria | 7836 |
| 514 | Ga0307415_100032167 | 3300032126 | Bacteria | 3389 |
| 515 | Ga0373949_0006908 | 3300035090 | Bacteria | 2492 |
| 516 | Ga0373941_0001018 | 3300035115 | Bacteria | 5819 |
| 517 | Ga0373945_0001407 | 3300035116 | Bacteria | 7307 |
| 518 | Ga0373943_0001797 | 3300035170 | Bacteria | 9695 |
| 519 | Ga0316574_0002945 | 3300035398 | Bacteria | 8666 |
| 520 | Ga0373931_0020416 | 3300035691 | Bacteria | 3315 |
| 521 | Ga0373931_0020433 | 3300035691 | Bacteria | 3314 |
| 522 | Ga0373935_0039197 | 3300035692 | Bacteria | 2970 |
| 523 | Ga0373933_0077155 | 3300035724 | Bacteria | 2036 |
| 524 | Ga0373947_0001552 | 3300035725 | Bacteria | 14072 |
| 525 | Ga0373937_0000355 | 3300036401 | Bacteria | 42585 |
| 526 | Ga0373937_0018464 | 3300036401 | Bacteria | 6229 |
| 527 | Ga0373937_0043006 | 3300036401 | Bacteria | 4123 |
| 528 | Ga0373937_0142681 | 3300036401 | Bacteria | 2241 |
| 529 | Ga0373937_0158223 | 3300036401 | Bacteria | 2124 |
| 530 | Ga0316584_0004124 | 3300036712 | Bacteria | 9584 |
| 531 | Ga0373925_0046514 | 3300037068 | Bacteria | 3227 |
| 532 | Ga0395899_0003392 | 3300037312 | Bacteria | 12645 |
| 533 | Ga0395899_0036378 | 3300037312 | Bacteria | 3693 |
| 534 | Ga0395899_0047643 | 3300037312 | Bacteria | 3190 |
| 535 | Ga0395899_0077262 | 3300037312 | Bacteria | 2428 |
| 536 | Ga0395900_0009508 | 3300037418 | Bacteria | 9968 |
| 537 | Ga0395900_0011245 | 3300037418 | Bacteria | 9152 |
| 538 | Ga0395900_0015469 | 3300037418 | Bacteria | 7778 |
| 539 | Ga0395900_0076548 | 3300037418 | Bacteria | 3438 |
| 540 | Ga0395900_0165799 | 3300037418 | Bacteria | 2251 |
| 541 | Ga0395900_0304740 | 3300037418 | Bacteria | 1578 |
| 542 | Ga0395898_0007626 | 3300037466 | Bacteria | 11487 |
| 543 | Ga0395898_0023168 | 3300037466 | Bacteria | 6276 |
| 544 | Ga0395898_0023591 | 3300037466 | Bacteria | 6215 |
| 545 | Ga0395898_0037026 | 3300037466 | Bacteria | 4842 |
| 546 | Ga0395898_0037130 | 3300037466 | Bacteria | 4834 |
| 547 | Ga0395898_0054637 | 3300037466 | Bacteria | 3896 |
| 548 | Ga0395898_0111523 | 3300037466 | Bacteria | 2622 |
| 549 | Ga0395898_0134855 | 3300037466 | Bacteria | 2364 |
| 550 | Ga0395898_0174659 | 3300037466 | Bacteria | 2053 |
| 551 | Ga0395905_0001832 | 3300037471 | Bacteria | 24559 |
| 552 | Ga0395905_0048185 | 3300037471 | Bacteria | 3994 |
| 553 | Ga0395905_0090877 | 3300037471 | Bacteria | 2862 |
| 554 | Ga0395905_0109187 | 3300037471 | Bacteria | 2597 |
| 555 | Ga0436364_0121330 | 3300037853 | Bacteria | 4890 |
| 556 | Ga0436364_0349017 | 3300037853 | Bacteria | 2572 |
| 557 | Ga0436364_0412746 | 3300037853 | Bacteria | 2633 |
| 558 | Ga0436364_0674729 | 3300037853 | Bacteria | 4110 |
| 559 | Ga0436364_0765160 | 3300037853 | Bacteria | 2371 |
| 560 | Ga0436364_1294613 | 3300037853 | Bacteria | 100298 |
| 561 | Ga0436364_1445105 | 3300037853 | Bacteria | 2976 |
| 562 | Ga0395901_0006703 | 3300038443 | Bacteria | 11639 |
| 563 | Ga0395901_0028513 | 3300038443 | Bacteria | 5741 |
| 564 | Ga0395901_0119765 | 3300038443 | Bacteria | 2766 |
| 565 | Ga0395901_0213677 | 3300038443 | Bacteria | 2018 |
| 566 | Ga0436365_0254126 | 3300039437 | Bacteria | 67152 |
| 567 | Ga0436365_0388687 | 3300039437 | Bacteria | 8356 |
| 568 | Ga0436365_0911509 | 3300039437 | Bacteria | 21390 |
| 569 | Ga0436365_0947003 | 3300039437 | Bacteria | 4351 |
| 570 | Ga0436365_1029997 | 3300039437 | Bacteria | 4333 |
| 571 | Ga0436365_1102419 | 3300039437 | Bacteria | 6206 |
| 572 | Ga0436365_1238206 | 3300039437 | Bacteria | 4092 |
| 573 | Ga0436365_1799679 | 3300039437 | Bacteria | 12113 |
| 574 | Ga0436360_0953769 | 3300039438 | Bacteria | 3088 |
| 575 | Ga0436363_0365326 | 3300039450 | Bacteria | 16368 |
| 576 | Ga0436363_1063131 | 3300039450 | Bacteria | 8992 |
| 577 | Ga0436363_1120367 | 3300039450 | Bacteria | 2861 |
| 578 | Ga0436362_0534151 | 3300039453 | Bacteria | 2260 |
| 579 | Ga0436362_0705873 | 3300039453 | Bacteria | 2690 |
| 580 | Ga0439453_0001968 | 3300041408 | Bacteria | 2756 |
| 581 | Ga0451791_0552643 | 3300041451 | Bacteria | 2388 |
| 582 | Ga0451853_3236511 | 3300041512 | Bacteria | 3713 |
| 583 | Ga0450907_007797 | 3300042146 | Bacteria | 1784 |
| 584 | Ga0451577_0015034 | 3300042876 | Bacteria | 7201 |
| 585 | Ga0466969_0006958 | 3300044656 | Bacteria | 6019 |
| 586 | Ga0453683_0031377 | 3300044673 | Bacteria | 3358 |
| 587 | Ga0466966_0011260 | 3300044684 | Bacteria | 5936 |
| 588 | Ga0466966_0023906 | 3300044684 | Bacteria | 3999 |
| 589 | Ga0466961_0005282 | 3300044693 | Bacteria | 8128 |
| 590 | Ga0466961_0010521 | 3300044693 | Bacteria | 5902 |
| 591 | Ga0466961_0013029 | 3300044693 | Bacteria | 5319 |
| 592 | Ga0466961_0049240 | 3300044693 | Bacteria | 2693 |
| 593 | Ga0466963_0000001 | 3300044694 | Bacteria | 110556 |
| 594 | Ga0466963_0000010 | 3300044694 | Bacteria | 68690 |
| 595 | Ga0466963_0000273 | 3300044694 | Bacteria | 22985 |
| 596 | Ga0466963_0000649 | 3300044694 | Bacteria | 16741 |
| 597 | Ga0466963_0001551 | 3300044694 | Bacteria | 12458 |
| 598 | Ga0466963_0002000 | 3300044694 | Bacteria | 11192 |
| 599 | Ga0466963_0003004 | 3300044694 | Bacteria | 9545 |
| 600 | Ga0466963_0008179 | 3300044694 | Bacteria | 6267 |
| 601 | Ga0466963_0009198 | 3300044694 | Bacteria | 5945 |
| 602 | Ga0466963_0026379 | 3300044694 | Bacteria | 3716 |
| 603 | Ga0466963_0026609 | 3300044694 | Bacteria | 3700 |
| 604 | Ga0466963_0037534 | 3300044694 | Bacteria | 3165 |
| 605 | Ga0466963_0038954 | 3300044694 | Bacteria | 3110 |
| 606 | Ga0466963_0076656 | 3300044694 | Bacteria | 2258 |
| 607 | Ga0466963_0106562 | 3300044694 | Bacteria | 1922 |
| 608 | Ga0466964_0000213 | 3300044706 | Bacteria | 16442 |
| 609 | Ga0466964_0008942 | 3300044706 | Bacteria | 3767 |
| 610 | Ga0466964_0012120 | 3300044706 | Bacteria | 3260 |
| 611 | Ga0466964_0024069 | 3300044706 | Bacteria | 2371 |
| 612 | Ga0466964_0045512 | 3300044706 | Bacteria | 1786 |
| 613 | Ga0453684_0002840 | 3300044712 | Bacteria | 40778 |
| 614 | Ga0466971_0001423 | 3300044719 | Bacteria | 10052 |
| 615 | Ga0466971_0004429 | 3300044719 | Bacteria | 6060 |
| 616 | Ga0466971_0010626 | 3300044719 | Bacteria | 4025 |
| 617 | Ga0466971_0014088 | 3300044719 | Bacteria | 3515 |
| 618 | Ga0466971_0019320 | 3300044719 | Bacteria | 3026 |
| 619 | Ga0466971_0086977 | 3300044719 | Bacteria | 1429 |
| 620 | Ga0466968_0002564 | 3300044735 | Bacteria | 6678 |
| 621 | Ga0466968_0023533 | 3300044735 | Bacteria | 2511 |
| 622 | Ga0466970_0004127 | 3300044765 | Bacteria | 7141 |
| 623 | Ga0466970_0060600 | 3300044765 | Bacteria | 2027 |
| 624 | Ga0466970_0077622 | 3300044765 | Bacteria | 1791 |
| 625 | Ga0466957_0007031 | 3300044842 | Bacteria | 6360 |
| 626 | Ga0466957_0008323 | 3300044842 | Bacteria | 5898 |
| 627 | Ga0466957_0013544 | 3300044842 | Bacteria | 4731 |
| 628 | Ga0466957_0014318 | 3300044842 | Bacteria | 4618 |
| 629 | Ga0466957_0027178 | 3300044842 | Bacteria | 3399 |
| 630 | Ga0466957_0035244 | 3300044842 | Bacteria | 3003 |
| 631 | Ga0466957_0052692 | 3300044842 | Bacteria | 2478 |
| 632 | Ga0466957_0083582 | 3300044842 | Bacteria | 1992 |
| 633 | Ga0466957_0097389 | 3300044842 | Bacteria | 1850 |
| 634 | Ga0466960_0000054 | 3300044901 | Bacteria | 38136 |
| 635 | Ga0466960_0009445 | 3300044901 | Bacteria | 4021 |
| 636 | Ga0466960_0014856 | 3300044901 | Bacteria | 3345 |
| 637 | Ga0466959_0002079 | 3300045049 | Bacteria | 12668 |
| 638 | Ga0466959_0003840 | 3300045049 | Bacteria | 9964 |
| 639 | Ga0466959_0004063 | 3300045049 | Bacteria | 9736 |
| 640 | Ga0466959_0004535 | 3300045049 | Bacteria | 9315 |
| 641 | Ga0466959_0012882 | 3300045049 | Bacteria | 6053 |
| 642 | Ga0466959_0050370 | 3300045049 | Bacteria | 3057 |
| 643 | Ga0466959_0083050 | 3300045049 | Bacteria | 2307 |
| 644 | Ga0466959_0085246 | 3300045049 | Bacteria | 2274 |
| 645 | Ga0451576_0012750 | 3300045051 | Bacteria | 9434 |
| 646 | Ga0466958_0001164 | 3300045836 | Bacteria | 12224 |
| 647 | Ga0466958_0002150 | 3300045836 | Bacteria | 9809 |
| 648 | Ga0466958_0003309 | 3300045836 | Bacteria | 8342 |
| 649 | Ga0466958_0003505 | 3300045836 | Bacteria | 8150 |
| 650 | Ga0466958_0026049 | 3300045836 | Bacteria | 3454 |
| 651 | Ga0466958_0050797 | 3300045836 | Bacteria | 2510 |
| 652 | Ga0466958_0053947 | 3300045836 | Bacteria | 2437 |
| 653 | Ga0466958_0076320 | 3300045836 | Bacteria | 2057 |
| 654 | Ga0466958_0103608 | 3300045836 | Bacteria | 1772 |
| 655 | Ga0466967_0000065 | 3300045976 | Bacteria | 39018 |
| 656 | Ga0466967_0000332 | 3300045976 | Bacteria | 21635 |
| 657 | Ga0466967_0001331 | 3300045976 | Bacteria | 14150 |
| 658 | Ga0466967_0002553 | 3300045976 | Bacteria | 11410 |
| 659 | Ga0466967_0004922 | 3300045976 | Bacteria | 9130 |
| 660 | Ga0466967_0008361 | 3300045976 | Bacteria | 7573 |
| 661 | Ga0466967_0010334 | 3300045976 | Bacteria | 6995 |
| 662 | Ga0466967_0013660 | 3300045976 | Bacteria | 6288 |
| 663 | Ga0466967_0019009 | 3300045976 | Bacteria | 5514 |
| 664 | Ga0466967_0021311 | 3300045976 | Bacteria | 5260 |
| 665 | Ga0466967_0026681 | 3300045976 | Bacteria | 4789 |
| 666 | Ga0466967_0034677 | 3300045976 | Bacteria | 4286 |
| 667 | Ga0466967_0041969 | 3300045976 | Bacteria | 3949 |
| 668 | Ga0466967_0050611 | 3300045976 | Bacteria | 3638 |
| 669 | Ga0466967_0050647 | 3300045976 | Bacteria | 3637 |
| 670 | Ga0466967_0054758 | 3300045976 | Bacteria | 3512 |
| 671 | Ga0466967_0055584 | 3300045976 | Bacteria | 3487 |
| 672 | Ga0466967_0070911 | 3300045976 | Bacteria | 3118 |
| 673 | Ga0466967_0094359 | 3300045976 | Bacteria | 2724 |
| 674 | Ga0466967_0098308 | 3300045976 | Bacteria | 2672 |
| 675 | Ga0466967_0102242 | 3300045976 | Bacteria | 2621 |
| 676 | Ga0466967_0109242 | 3300045976 | Bacteria | 2539 |
| 677 | Ga0466967_0130811 | 3300045976 | Bacteria | 2329 |
| 678 | Ga0466967_0164310 | 3300045976 | Bacteria | 2085 |
| 679 | Ga0466967_0312490 | 3300045976 | Bacteria | 1514 |
| 680 | Ga0495592_0000036 | 3300046454 | Bacteria | 125461 |
| 681 | Ga0495592_0000732 | 3300046454 | Bacteria | 22931 |
| 682 | Ga0495603_0000030 | 3300046455 | Bacteria | 60760 |
| 683 | Ga0495603_0003452 | 3300046455 | Bacteria | 9401 |
| 684 | Ga0495629_0000272 | 3300046459 | Bacteria | 44883 |
| 685 | Ga0495629_0016715 | 3300046459 | Bacteria | 5265 |
| 686 | Ga0495629_0034828 | 3300046459 | Bacteria | 3559 |
| 687 | Ga0495629_0068316 | 3300046459 | Bacteria | 2480 |
| 688 | Ga0495638_0015309 | 3300046460 | Bacteria | 5153 |
| 689 | Ga0495641_0000044 | 3300046461 | Bacteria | 77415 |
| 690 | Ga0495641_0000244 | 3300046461 | Bacteria | 42830 |
| 691 | Ga0495641_0003908 | 3300046461 | Bacteria | 10839 |
| 692 | Ga0495641_0087717 | 3300046461 | Bacteria | 1392 |
| 693 | Ga0495651_0000029 | 3300046462 | Bacteria | 105042 |
| 694 | Ga0495651_0014666 | 3300046462 | Bacteria | 6060 |
| 695 | Ga0495651_0047771 | 3300046462 | Bacteria | 3307 |
| 696 | Ga0495651_0105612 | 3300046462 | Bacteria | 2089 |
| 697 | Ga0495651_0174542 | 3300046462 | Bacteria | 1527 |
| 698 | Ga0495653_0000718 | 3300046463 | Bacteria | 25191 |
| 699 | Ga0495653_0001363 | 3300046463 | Bacteria | 18977 |
| 700 | Ga0495653_0008307 | 3300046463 | Bacteria | 8509 |
| 701 | Ga0495653_0012191 | 3300046463 | Bacteria | 7014 |
| 702 | Ga0495653_0018382 | 3300046463 | Bacteria | 5679 |
| 703 | Ga0495653_0020520 | 3300046463 | Bacteria | 5357 |
| 704 | Ga0495653_0030477 | 3300046463 | Bacteria | 4296 |
| 705 | Ga0495653_0062262 | 3300046463 | Bacteria | 2819 |
| 706 | Ga0495653_0108363 | 3300046463 | Bacteria | 2000 |
| 707 | Ga0495650_0000055 | 3300046471 | Bacteria | 308438 |
| 708 | Ga0495580_0015952 | 3300046472 | Bacteria | 5653 |
| 709 | Ga0495582_0000011 | 3300046473 | Bacteria | 113352 |
| 710 | Ga0495639_0003274 | 3300046475 | Bacteria | 7035 |
| 711 | Ga0495662_0000458 | 3300046476 | Bacteria | 18383 |
| 712 | Ga0495662_0020681 | 3300046476 | Bacteria | 3183 |
| 713 | Ga0495664_0000007 | 3300046477 | Bacteria | 386710 |
| 714 | Ga0495664_0043944 | 3300046477 | Bacteria | 2647 |
| 715 | Ga0495664_0102031 | 3300046477 | Bacteria | 1729 |
| 716 | Ga0495594_0000003 | 3300046499 | Bacteria | 199267 |
| 717 | Ga0495596_0023521 | 3300046500 | Bacteria | 2499 |
| 718 | Ga0495606_0000752 | 3300046507 | Bacteria | 50099 |
| 719 | Ga0495608_0000068 | 3300046511 | Bacteria | 79694 |
| 720 | Ga0495608_0000294 | 3300046511 | Bacteria | 35070 |
| 721 | Ga0495608_0001071 | 3300046511 | Bacteria | 19292 |
| 722 | Ga0495608_0003047 | 3300046511 | Bacteria | 11967 |
| 723 | Ga0495618_0000478 | 3300046514 | Bacteria | 28566 |
| 724 | Ga0495618_0000594 | 3300046514 | Bacteria | 25841 |
| 725 | Ga0495618_0006493 | 3300046514 | Bacteria | 7098 |
| 726 | Ga0495618_0008047 | 3300046514 | Bacteria | 6382 |
| 727 | Ga0495618_0022141 | 3300046514 | Bacteria | 3923 |
| 728 | Ga0495618_0069294 | 3300046514 | Bacteria | 2242 |
| 729 | Ga0495620_0000144 | 3300046515 | Bacteria | 58204 |
| 730 | Ga0495628_0000016 | 3300046516 | Bacteria | 170260 |
| 731 | Ga0495628_0001219 | 3300046516 | Bacteria | 23555 |
| 732 | Ga0495628_0043822 | 3300046516 | Bacteria | 3562 |
| 733 | Ga0495628_0049354 | 3300046516 | Bacteria | 3333 |
| 734 | Ga0495630_0000056 | 3300046517 | Bacteria | 91477 |
| 735 | Ga0495630_0000408 | 3300046517 | Bacteria | 33471 |
| 736 | Ga0495630_0000505 | 3300046517 | Bacteria | 28893 |
| 737 | Ga0495630_0000541 | 3300046517 | Bacteria | 27642 |
| 738 | Ga0495630_0003283 | 3300046517 | Bacteria | 11285 |
| 739 | Ga0495630_0087042 | 3300046517 | Bacteria | 2359 |
| 740 | Ga0495631_0017942 | 3300046518 | Bacteria | 3339 |
| 741 | Ga0495644_0000642 | 3300046523 | Bacteria | 14607 |
| 742 | Ga0495644_0007527 | 3300046523 | Bacteria | 4198 |
| 743 | Ga0495666_0001576 | 3300046526 | Bacteria | 11217 |
| 744 | Ga0495652_0000019 | 3300046529 | Bacteria | 190248 |
| 745 | Ga0495652_0000045 | 3300046529 | Bacteria | 122469 |
| 746 | Ga0495652_0020416 | 3300046529 | Bacteria | 5889 |
| 747 | Ga0495652_0031934 | 3300046529 | Bacteria | 4608 |
| 748 | Ga0495665_0019672 | 3300046531 | Bacteria | 3631 |
| 749 | Ga0495640_0003352 | 3300046533 | Bacteria | 12891 |
| 750 | Ga0495640_0019226 | 3300046533 | Bacteria | 5046 |
| 751 | Ga0495640_0039081 | 3300046533 | Bacteria | 3332 |
| 752 | Ga0495586_0009241 | 3300046535 | Bacteria | 5241 |
| 753 | Ga0495586_0022930 | 3300046535 | Bacteria | 3332 |
| 754 | Ga0495587_0000083 | 3300046536 | Bacteria | 73166 |
| 755 | Ga0495587_0002971 | 3300046536 | Bacteria | 11337 |
| 756 | Ga0495587_0013955 | 3300046536 | Bacteria | 5045 |
| 757 | Ga0495587_0014131 | 3300046536 | Bacteria | 5013 |
| 758 | Ga0495645_0000051 | 3300046543 | Bacteria | 87212 |
| 759 | Ga0495645_0000558 | 3300046543 | Bacteria | 25592 |
| 760 | Ga0495645_0001902 | 3300046543 | Bacteria | 14187 |
| 761 | Ga0495645_0077688 | 3300046543 | Bacteria | 2386 |
| 762 | Ga0495622_0000180 | 3300046557 | Bacteria | 51095 |
| 763 | Ga0495667_0000032 | 3300046559 | Bacteria | 143493 |
| 764 | Ga0495667_0004076 | 3300046559 | Bacteria | 9816 |
| 765 | Ga0495667_0007846 | 3300046559 | Bacteria | 7234 |
| 766 | Ga0495667_0034052 | 3300046559 | Bacteria | 3406 |
| 767 | Ga0495667_0053041 | 3300046559 | Bacteria | 2671 |
| 768 | Ga0495656_0000483 | 3300046615 | Bacteria | 12964 |
| 769 | Ga0495668_0070338 | 3300046616 | Bacteria | 1924 |
| 770 | Ga0495634_0000018 | 3300046642 | Bacteria | 121323 |
| 771 | Ga0495634_0000247 | 3300046642 | Bacteria | 50931 |
| 772 | Ga0495634_0003355 | 3300046642 | Bacteria | 12860 |
| 773 | Ga0495634_0013196 | 3300046642 | Bacteria | 5972 |
| 774 | Ga0495634_0017230 | 3300046642 | Bacteria | 5158 |
| 775 | Ga0495634_0045320 | 3300046642 | Bacteria | 2974 |
| 776 | Ga0495625_0000696 | 3300046660 | Bacteria | 47763 |
| 777 | Ga0495635_0000016 | 3300046663 | Bacteria | 214088 |
| 778 | Ga0495635_0008356 | 3300046663 | Bacteria | 7227 |
| 779 | Ga0495635_0009815 | 3300046663 | Bacteria | 6694 |
| 780 | Ga0495635_0012397 | 3300046663 | Bacteria | 5973 |
| 781 | Ga0495635_0015687 | 3300046663 | Bacteria | 5292 |
| 782 | Ga0495635_0061532 | 3300046663 | Bacteria | 2578 |
| 783 | Ga0495588_0000165 | 3300046674 | Bacteria | 85841 |
| 784 | Ga0495657_0000004 | 3300046675 | Bacteria | 266465 |
| 785 | Ga0495657_0000013 | 3300046675 | Bacteria | 195590 |
| 786 | Ga0495657_0011595 | 3300046675 | Bacteria | 6586 |
| 787 | Ga0495599_0000187 | 3300046678 | Bacteria | 40807 |
| 788 | Ga0495599_0024325 | 3300046678 | Bacteria | 3788 |
| 789 | Ga0495599_0043015 | 3300046678 | Bacteria | 2835 |
| 790 | Ga0495623_0000121 | 3300046679 | Bacteria | 47882 |
| 791 | Ga0495646_0001537 | 3300046680 | Bacteria | 13770 |
| 792 | Ga0495646_0029254 | 3300046680 | Bacteria | 3445 |
| 793 | Ga0495646_0030054 | 3300046680 | Bacteria | 3394 |
| 794 | Ga0495647_0000008 | 3300046681 | Bacteria | 101193 |
| 795 | Ga0495647_0000169 | 3300046681 | Bacteria | 17284 |
| 796 | Ga0495647_0000468 | 3300046681 | Bacteria | 11697 |
| 797 | Ga0495658_0000005 | 3300046683 | Bacteria | 149839 |
| 798 | Ga0495658_0012335 | 3300046683 | Bacteria | 4324 |
| 799 | Ga0495658_0013455 | 3300046683 | Bacteria | 4165 |
| 800 | Ga0495658_0036522 | 3300046683 | Bacteria | 2711 |
| 801 | Ga0495669_0000603 | 3300046684 | Bacteria | 15735 |
| 802 | Ga0495613_0000113 | 3300046689 | Bacteria | 79559 |
| 803 | Ga0495613_0000203 | 3300046689 | Bacteria | 58232 |
| 804 | Ga0495624_0000008 | 3300046690 | Bacteria | 145035 |
| 805 | Ga0495624_0000267 | 3300046690 | Bacteria | 41318 |
| 806 | Ga0495624_0005932 | 3300046690 | Bacteria | 8730 |
| 807 | Ga0495624_0108268 | 3300046690 | Bacteria | 1709 |
| 808 | Ga0495670_0032167 | 3300046691 | Bacteria | 2608 |
| 809 | Ga0495649_0001624 | 3300046694 | Bacteria | 16726 |
| 810 | Ga0495600_0000787 | 3300046809 | Bacteria | 16744 |
| 811 | Ga0495600_0018373 | 3300046809 | Bacteria | 4454 |
| 812 | Ga0495600_0021081 | 3300046809 | Bacteria | 4171 |
| 813 | Ga0495600_0042473 | 3300046809 | Bacteria | 2964 |
| 814 | Ga0495604_0000019 | 3300047317 | Bacteria | 175064 |
| 815 | Ga0495604_0000072 | 3300047317 | Bacteria | 88631 |
| 816 | Ga0495604_0000398 | 3300047317 | Bacteria | 39366 |
| 817 | Ga0495604_0000824 | 3300047317 | Bacteria | 25900 |
| 818 | Ga0495604_0000917 | 3300047317 | Bacteria | 24518 |
| 819 | Ga0495674_0001564 | 3300047319 | Bacteria | 22423 |
| 820 | Ga0495674_0012591 | 3300047319 | Bacteria | 7969 |
| 821 | Ga0495674_0014198 | 3300047319 | Bacteria | 7459 |
| 822 | Ga0495674_0033320 | 3300047319 | Bacteria | 4668 |
| 823 | Ga0495674_0083367 | 3300047319 | Bacteria | 2741 |
| 824 | Ga0495674_0119007 | 3300047319 | Bacteria | 2233 |
| 825 | Ga0495676_0000299 | 3300047321 | Bacteria | 40098 |
| 826 | Ga0495676_0008653 | 3300047321 | Bacteria | 9317 |
| 827 | Ga0495676_0058227 | 3300047321 | Bacteria | 3041 |
| 828 | Ga0495676_0059321 | 3300047321 | Bacteria | 3005 |
| 829 | Ga0495676_0153713 | 3300047321 | Bacteria | 1634 |
| 830 | Ga0495680_0002092 | 3300047322 | Bacteria | 20739 |
| 831 | Ga0495680_0004810 | 3300047322 | Bacteria | 12812 |
| 832 | Ga0495680_0007700 | 3300047322 | Bacteria | 9831 |
| 833 | Ga0495680_0008488 | 3300047322 | Bacteria | 9332 |
| 834 | Ga0495680_0041474 | 3300047322 | Bacteria | 3660 |
| 835 | Ga0495675_0000031 | 3300047444 | Bacteria | 99240 |
| 836 | Ga0495675_0000107 | 3300047444 | Bacteria | 59970 |
| 837 | Ga0495673_0010571 | 3300047469 | Bacteria | 5010 |
| 838 | Ga0495684_0006217 | 3300047471 | Bacteria | 9286 |
| 839 | Ga0495684_0018384 | 3300047471 | Bacteria | 5386 |
| 840 | Ga0495684_0021987 | 3300047471 | Bacteria | 4909 |
| 841 | Ga0495684_0062533 | 3300047471 | Bacteria | 2831 |
| 842 | Ga0495684_0135647 | 3300047471 | Bacteria | 1847 |
| 843 | Ga0495686_0000020 | 3300047472 | Bacteria | 429191 |
| 844 | Ga0495686_0001936 | 3300047472 | Bacteria | 20622 |
| 845 | Ga0495686_0004284 | 3300047472 | Bacteria | 11817 |
| 846 | Ga0495593_0000333 | 3300047673 | Bacteria | 26121 |
| 847 | Ga0495602_0000133 | 3300048088 | Bacteria | 69392 |
| 848 | Ga0495602_0000208 | 3300048088 | Bacteria | 54818 |
| 849 | Ga0495602_0000497 | 3300048088 | Bacteria | 36490 |
| 850 | Ga0495602_0025389 | 3300048088 | Bacteria | 5736 |
| 851 | Ga0495614_0000165 | 3300048089 | Bacteria | 24279 |
| 852 | Ga0496100_0000002 | 3300048903 | Bacteria | 489057 |
| 853 | Ga0496100_0000018 | 3300048903 | Bacteria | 162451 |
| 854 | Ga0496100_0000463 | 3300048903 | Bacteria | 19446 |
| 855 | Ga0496100_0005719 | 3300048903 | Bacteria | 6726 |
| 856 | Ga0496101_0000001 | 3300048904 | Bacteria | 489057 |
| 857 | Ga0496101_0000062 | 3300048904 | Bacteria | 126595 |
| 858 | Ga0496101_0001372 | 3300048904 | Bacteria | 14597 |
| 859 | Ga0496101_0003568 | 3300048904 | Bacteria | 9707 |
| 860 | Ga0496101_0040738 | 3300048904 | Bacteria | 3309 |
| 861 | Ga0496101_0111615 | 3300048904 | Bacteria | 2059 |
| 862 | Ga0496102_0000002 | 3300048905 | Bacteria | 814588 |
| 863 | Ga0496102_0000039 | 3300048905 | Bacteria | 198306 |
| 864 | Ga0496102_0003661 | 3300048905 | Bacteria | 12988 |
| 865 | Ga0496102_0005815 | 3300048905 | Bacteria | 10487 |
| 866 | Ga0496102_0029803 | 3300048905 | Bacteria | 4883 |
| 867 | Ga0496102_0064989 | 3300048905 | Bacteria | 3343 |
| 868 | Ga0496102_0115856 | 3300048905 | Bacteria | 2500 |
| 869 | Ga0496103_0000008 | 3300048906 | Bacteria | 340474 |
| 870 | Ga0496103_0000017 | 3300048906 | Bacteria | 244768 |
| 871 | Ga0496103_0100974 | 3300048906 | Bacteria | 1826 |
| 872 | Ga0496104_0000001 | 3300048907 | Bacteria | 711867 |
| 873 | Ga0496104_0000004 | 3300048907 | Bacteria | 641830 |
| 874 | Ga0496104_0000009 | 3300048907 | Bacteria | 488055 |
| 875 | Ga0496104_0000129 | 3300048907 | Bacteria | 69982 |
| 876 | Ga0496104_0005543 | 3300048907 | Bacteria | 11055 |
| 877 | Ga0496104_0030115 | 3300048907 | Bacteria | 5041 |
| 878 | Ga0496104_0039390 | 3300048907 | Bacteria | 4425 |
| 879 | Ga0496104_0116657 | 3300048907 | Bacteria | 2562 |
| 880 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 881 | Ga0496105_0000007 | 3300048908 | Bacteria | 339658 |
| 882 | Ga0496105_0000846 | 3300048908 | Bacteria | 20846 |
| 883 | Ga0496105_0004668 | 3300048908 | Bacteria | 10329 |
| 884 | Ga0496105_0010632 | 3300048908 | Bacteria | 7240 |
| 885 | Ga0496105_0011882 | 3300048908 | Bacteria | 6894 |
| 886 | Ga0496105_0026130 | 3300048908 | Bacteria | 4759 |
| 887 | Ga0496105_0046758 | 3300048908 | Bacteria | 3572 |
| 888 | Ga0496105_0064643 | 3300048908 | Bacteria | 3019 |
| 889 | Ga0496105_0134719 | 3300048908 | Bacteria | 2035 |
| 890 | Ga0496105_0144987 | 3300048908 | Bacteria | 1953 |
| 891 | Ga0496105_0153315 | 3300048908 | Bacteria | 1893 |
| 892 | Ga0496106_0000061 | 3300048909 | Bacteria | 86524 |
| 893 | Ga0496106_0000081 | 3300048909 | Bacteria | 76468 |
| 894 | Ga0496106_0000145 | 3300048909 | Bacteria | 52447 |
| 895 | Ga0496106_0021330 | 3300048909 | Bacteria | 4809 |
| 896 | Ga0496107_0000006 | 3300048910 | Bacteria | 258746 |
| 897 | Ga0496107_0000013 | 3300048910 | Bacteria | 178284 |
| 898 | Ga0496107_0021675 | 3300048910 | Bacteria | 4540 |
| 899 | Ga0496107_0024708 | 3300048910 | Bacteria | 4251 |
| 900 | Ga0496107_0032767 | 3300048910 | Bacteria | 3715 |
| 901 | Ga0496107_0033560 | 3300048910 | Bacteria | 3672 |
| 902 | Ga0496107_0044880 | 3300048910 | Bacteria | 3178 |
| 903 | Ga0496107_0118878 | 3300048910 | Bacteria | 1946 |
| 904 | Ga0496107_0154467 | 3300048910 | Bacteria | 1699 |
| 905 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 906 | Ga0496108_0000062 | 3300048911 | Bacteria | 122391 |
| 907 | Ga0496108_0000747 | 3300048911 | Bacteria | 25332 |
| 908 | Ga0496108_0001172 | 3300048911 | Bacteria | 20452 |
| 909 | Ga0496108_0015294 | 3300048911 | Bacteria | 6261 |
| 910 | Ga0496108_0025893 | 3300048911 | Bacteria | 4837 |
| 911 | Ga0496108_0036442 | 3300048911 | Bacteria | 4092 |
| 912 | Ga0496108_0057327 | 3300048911 | Bacteria | 3273 |
| 913 | Ga0496108_0102782 | 3300048911 | Bacteria | 2439 |
| 914 | Ga0496108_0133462 | 3300048911 | Bacteria | 2134 |
| 915 | Ga0496108_0271139 | 3300048911 | Bacteria | 1477 |
| 916 | Ga0496109_0000003 | 3300048912 | Bacteria | 420862 |
| 917 | Ga0496109_0000007 | 3300048912 | Bacteria | 247554 |
| 918 | Ga0496109_0000129 | 3300048912 | Bacteria | 77469 |
| 919 | Ga0496109_0001311 | 3300048912 | Bacteria | 20538 |
| 920 | Ga0496109_0001369 | 3300048912 | Bacteria | 20218 |
| 921 | Ga0496109_0002916 | 3300048912 | Bacteria | 14294 |
| 922 | Ga0496109_0004496 | 3300048912 | Bacteria | 11655 |
| 923 | Ga0496109_0009062 | 3300048912 | Bacteria | 8475 |
| 924 | Ga0496109_0037796 | 3300048912 | Bacteria | 4363 |
| 925 | Ga0496109_0076768 | 3300048912 | Bacteria | 3073 |
| 926 | Ga0496109_0079598 | 3300048912 | Bacteria | 3019 |
| 927 | Ga0496109_0084905 | 3300048912 | Bacteria | 2921 |
| 928 | Ga0496109_0116828 | 3300048912 | Bacteria | 2483 |
| 929 | Ga0496109_0239826 | 3300048912 | Bacteria | 1706 |
| 930 | Ga0496110_0000039 | 3300048913 | Bacteria | 63169 |
| 931 | Ga0496110_0000062 | 3300048913 | Bacteria | 53333 |
| 932 | Ga0496110_0002594 | 3300048913 | Bacteria | 13596 |
| 933 | Ga0496110_0013117 | 3300048913 | Bacteria | 6840 |
| 934 | Ga0496110_0020943 | 3300048913 | Bacteria | 5525 |
| 935 | Ga0496110_0042091 | 3300048913 | Bacteria | 3987 |
| 936 | Ga0496110_0068996 | 3300048913 | Bacteria | 3129 |
| 937 | Ga0496110_0108325 | 3300048913 | Bacteria | 2494 |
| 938 | Ga0496110_0224326 | 3300048913 | Bacteria | 1709 |
| 939 | Ga0496111_0000010 | 3300048914 | Bacteria | 92600 |
| 940 | Ga0496111_0001293 | 3300048914 | Bacteria | 14032 |
| 941 | Ga0496111_0016015 | 3300048914 | Bacteria | 5160 |
| 942 | Ga0496111_0032766 | 3300048914 | Bacteria | 3705 |
| 943 | Ga0496111_0052833 | 3300048914 | Bacteria | 2935 |
| 944 | Ga0496111_0057332 | 3300048914 | Bacteria | 2820 |
| 945 | Ga0496111_0062281 | 3300048914 | Bacteria | 2705 |
| 946 | Ga0496111_0064421 | 3300048914 | Bacteria | 2659 |
| 947 | Ga0496111_0083057 | 3300048914 | Bacteria | 2340 |
| 948 | Ga0496111_0114457 | 3300048914 | Bacteria | 1988 |
| 949 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 950 | Ga0496112_0001122 | 3300048915 | Bacteria | 19906 |
| 951 | Ga0496112_0016477 | 3300048915 | Bacteria | 6925 |
| 952 | Ga0496112_0017549 | 3300048915 | Bacteria | 6727 |
| 953 | Ga0496112_0053133 | 3300048915 | Bacteria | 3978 |
| 954 | Ga0496112_0072829 | 3300048915 | Bacteria | 3396 |
| 955 | Ga0496112_0166699 | 3300048915 | Bacteria | 2169 |
| 956 | Ga0496112_0175849 | 3300048915 | Bacteria | 2106 |
| 957 | Ga0496112_0203834 | 3300048915 | Bacteria | 1936 |
| 958 | Ga0496113_0000014 | 3300048916 | Bacteria | 79850 |
| 959 | Ga0496113_0010329 | 3300048916 | Bacteria | 6170 |
| 960 | Ga0496113_0024605 | 3300048916 | Bacteria | 4282 |
| 961 | Ga0496113_0028372 | 3300048916 | Bacteria | 4025 |
| 962 | Ga0496113_0040460 | 3300048916 | Bacteria | 3435 |
| 963 | Ga0496113_0098660 | 3300048916 | Bacteria | 2261 |
| 964 | Ga0496113_0164147 | 3300048916 | Bacteria | 1757 |
| 965 | Ga0496114_0000014 | 3300048917 | Bacteria | 297902 |
| 966 | Ga0496114_0014859 | 3300048917 | Bacteria | 6256 |
| 967 | Ga0496115_0000003 | 3300048918 | Bacteria | 354994 |
| 968 | Ga0496115_0000075 | 3300048918 | Bacteria | 90155 |
| 969 | Ga0496115_0000121 | 3300048918 | Bacteria | 71105 |
| 970 | Ga0496115_0000125 | 3300048918 | Bacteria | 69936 |
| 971 | Ga0496115_0002542 | 3300048918 | Bacteria | 13124 |
| 972 | Ga0496115_0003578 | 3300048918 | Bacteria | 11174 |
| 973 | Ga0496115_0022547 | 3300048918 | Bacteria | 4880 |
| 974 | Ga0496115_0082399 | 3300048918 | Bacteria | 2621 |
| 975 | Ga0496115_0126385 | 3300048918 | Bacteria | 2106 |
| 976 | Ga0496116_0000680 | 3300048919 | Bacteria | 44185 |
| 977 | Ga0496117_0004578 | 3300048920 | Bacteria | 15133 |
| 978 | Ga0496118_0010367 | 3300048921 | Bacteria | 9235 |
| 979 | Ga0496119_0001947 | 3300048922 | Bacteria | 23515 |
| 980 | Ga0496119_0022969 | 3300048922 | Bacteria | 4442 |
| 981 | Ga0496119_0045690 | 3300048922 | Bacteria | 2743 |
| 982 | Ga0496119_0053846 | 3300048922 | Bacteria | 2454 |
| 983 | Ga0496120_0018638 | 3300048923 | Bacteria | 4465 |
| 984 | Ga0496121_0012140 | 3300048924 | Bacteria | 9454 |
| 985 | Ga0496121_0082381 | 3300048924 | Bacteria | 2544 |
| 986 | Ga0496125_0082753 | 3300048928 | Bacteria | 2445 |
| 987 | Ga0501031_0000137 | 3300049568 | Bacteria | 40779 |
| 988 | Ga0501031_0028123 | 3300049568 | Bacteria | 3665 |
| 989 | Ga0501032_0000409 | 3300049569 | Bacteria | 35358 |
| 990 | Ga0501033_0000223 | 3300049570 | Bacteria | 54471 |
| 991 | Ga0501034_0023191 | 3300049571 | Bacteria | 6324 |
| 992 | Ga0501034_0039153 | 3300049571 | Bacteria | 4802 |
| 993 | Ga0501034_0041516 | 3300049571 | Bacteria | 4654 |
| 994 | Ga0501036_0000395 | 3300049572 | Bacteria | 30754 |
| 995 | Ga0501036_0005110 | 3300049572 | Bacteria | 10610 |
| 996 | Ga0501036_0032127 | 3300049572 | Bacteria | 4435 |
| 997 | Ga0501036_0039770 | 3300049572 | Bacteria | 3979 |
| 998 | Ga0501036_0076136 | 3300049572 | Bacteria | 2839 |
| 999 | Ga0501036_0093353 | 3300049572 | Bacteria | 2543 |
| 1000 | Ga0501037_0000315 | 3300049573 | Bacteria | 41061 |
| 1001 | Ga0501038_0000323 | 3300049574 | Bacteria | 41119 |
| 1002 | Ga0501038_0029084 | 3300049574 | Bacteria | 4901 |
| 1003 | Ga0501038_0031807 | 3300049574 | Bacteria | 4661 |
| 1004 | Ga0501038_0119381 | 3300049574 | Bacteria | 2176 |
| 1005 | Ga0501038_0133977 | 3300049574 | Bacteria | 2031 |
| 1006 | Ga0501039_0001294 | 3300049575 | Bacteria | 18277 |
| 1007 | Ga0501039_0008934 | 3300049575 | Bacteria | 7635 |
| 1008 | Ga0501039_0011591 | 3300049575 | Bacteria | 6713 |
| 1009 | Ga0501039_0037664 | 3300049575 | Bacteria | 3734 |
| 1010 | Ga0501039_0187606 | 3300049575 | Bacteria | 1626 |
| 1011 | Ga0501040_0007295 | 3300049576 | Bacteria | 7163 |
| 1012 | Ga0501040_0020937 | 3300049576 | Bacteria | 4361 |
| 1013 | Ga0501040_0094803 | 3300049576 | Bacteria | 2077 |
| 1014 | Ga0501040_0112454 | 3300049576 | Bacteria | 1905 |
| 1015 | Ga0501041_0003440 | 3300049577 | Bacteria | 9111 |
| 1016 | Ga0501041_0134828 | 3300049577 | Bacteria | 1539 |
| 1017 | Ga0501042_0010330 | 3300049578 | Bacteria | 6251 |
| 1018 | Ga0501042_0017883 | 3300049578 | Bacteria | 4898 |
| 1019 | Ga0501042_0044566 | 3300049578 | Bacteria | 3161 |
| 1020 | Ga0501042_0062756 | 3300049578 | Bacteria | 2655 |
| 1021 | Ga0501042_0081726 | 3300049578 | Bacteria | 2316 |
| 1022 | Ga0501042_0104307 | 3300049578 | Bacteria | 2040 |
| 1023 | Ga0501042_0112166 | 3300049578 | Bacteria | 1963 |
| 1024 | Ga0501043_0000587 | 3300049579 | Bacteria | 32215 |
| 1025 | Ga0501046_0000443 | 3300049580 | Bacteria | 41637 |
| 1026 | Ga0501046_0002209 | 3300049580 | Bacteria | 18390 |
| 1027 | Ga0501047_0000321 | 3300049581 | Bacteria | 55420 |
| 1028 | Ga0501047_0028750 | 3300049581 | Bacteria | 5361 |
| 1029 | Ga0501048_0000336 | 3300049582 | Bacteria | 32387 |
| 1030 | Ga0501048_0037368 | 3300049582 | Bacteria | 3487 |
| 1031 | Ga0501068_0025852 | 3300049584 | Bacteria | 3455 |
| 1032 | Ga0501069_0013225 | 3300049585 | Bacteria | 4398 |
| 1033 | Ga0501069_0015723 | 3300049585 | Bacteria | 4057 |
| 1034 | Ga0501069_0034529 | 3300049585 | Bacteria | 2786 |
| 1035 | Ga0501069_0043607 | 3300049585 | Bacteria | 2483 |
| 1036 | Ga0501069_0060934 | 3300049585 | Bacteria | 2107 |
| 1037 | Ga0501069_0089268 | 3300049585 | Bacteria | 1742 |
| 1038 | Ga0501070_0000354 | 3300049586 | Bacteria | 41627 |
| 1039 | Ga0501070_0019793 | 3300049586 | Bacteria | 5644 |
| 1040 | Ga0501070_0069408 | 3300049586 | Bacteria | 2918 |
| 1041 | Ga0501070_0077285 | 3300049586 | Bacteria | 2755 |
| 1042 | Ga0501070_0167828 | 3300049586 | Bacteria | 1808 |
| 1043 | Ga0501071_0009527 | 3300049587 | Bacteria | 6473 |
| 1044 | Ga0501071_0010306 | 3300049587 | Bacteria | 6259 |
| 1045 | Ga0501071_0024317 | 3300049587 | Bacteria | 4237 |
| 1046 | Ga0501071_0158450 | 3300049587 | Bacteria | 1691 |
| 1047 | Ga0501072_0000517 | 3300049588 | Bacteria | 27742 |
| 1048 | Ga0501072_0006920 | 3300049588 | Bacteria | 8609 |
| 1049 | Ga0501072_0050104 | 3300049588 | Bacteria | 3288 |
| 1050 | Ga0501072_0086008 | 3300049588 | Bacteria | 2495 |
| 1051 | Ga0501072_0123020 | 3300049588 | Bacteria | 2067 |
| 1052 | Ga0501072_0126760 | 3300049588 | Bacteria | 2034 |
| 1053 | Ga0501073_0013645 | 3300049589 | Bacteria | 5911 |
| 1054 | Ga0501073_0029719 | 3300049589 | Bacteria | 3905 |
| 1055 | Ga0501074_0008948 | 3300049590 | Bacteria | 7262 |
| 1056 | Ga0501074_0016482 | 3300049590 | Bacteria | 5364 |
| 1057 | Ga0501074_0021021 | 3300049590 | Bacteria | 4740 |
| 1058 | Ga0501074_0026492 | 3300049590 | Bacteria | 4203 |
| 1059 | Ga0501074_0048043 | 3300049590 | Bacteria | 3083 |
| 1060 | Ga0501074_0056607 | 3300049590 | Bacteria | 2826 |
| 1061 | Ga0501074_0129296 | 3300049590 | Bacteria | 1807 |
| 1062 | Ga0501075_0001259 | 3300049591 | Bacteria | 16393 |
| 1063 | Ga0501075_0007340 | 3300049591 | Bacteria | 7645 |
| 1064 | Ga0501075_0016242 | 3300049591 | Bacteria | 5359 |
| 1065 | Ga0501076_0000710 | 3300049592 | Bacteria | 21481 |
| 1066 | Ga0501076_0020736 | 3300049592 | Bacteria | 5033 |
| 1067 | Ga0501076_0035717 | 3300049592 | Bacteria | 3889 |
| 1068 | Ga0501076_0103370 | 3300049592 | Bacteria | 2298 |
| 1069 | Ga0501077_0004020 | 3300049593 | Bacteria | 8874 |
| 1070 | Ga0501079_0009561 | 3300049741 | Bacteria | 7351 |
| 1071 | Ga0501079_0052330 | 3300049741 | Bacteria | 3151 |
| 1072 | Ga0501080_0008519 | 3300049742 | Bacteria | 9298 |
| 1073 | Ga0501080_0018770 | 3300049742 | Bacteria | 6401 |
| 1074 | Ga0501081_0019127 | 3300049743 | Bacteria | 4555 |
| 1075 | Ga0501081_0035346 | 3300049743 | Bacteria | 3401 |
| 1076 | Ga0501081_0039587 | 3300049743 | Bacteria | 3227 |
| 1077 | Ga0501083_0006159 | 3300049744 | Bacteria | 8510 |
| 1078 | Ga0501083_0032660 | 3300049744 | Bacteria | 3568 |
| 1079 | Ga0501035_0000380 | 3300049822 | Bacteria | 51102 |
| 1080 | Ga0501035_0036377 | 3300049822 | Bacteria | 4462 |
| 1081 | Ga0501044_0000681 | 3300049823 | Bacteria | 41084 |
| 1082 | Ga0501044_0060609 | 3300049823 | Bacteria | 3874 |
| 1083 | Ga0501044_0084578 | 3300049823 | Bacteria | 3206 |
| 1084 | Ga0501044_0087319 | 3300049823 | Bacteria | 3150 |
| 1085 | Ga0501045_0002778 | 3300049824 | Bacteria | 11955 |
| 1086 | Ga0501045_0023645 | 3300049824 | Bacteria | 4408 |
| 1087 | Ga0501045_0024403 | 3300049824 | Bacteria | 4341 |
| 1088 | Ga0501045_0051616 | 3300049824 | Bacteria | 3001 |
| 1089 | Ga0501045_0096095 | 3300049824 | Bacteria | 2192 |
| 1090 | nmdc:mga0yw44_16097_c1 | 3300050492 | Bacteria | 4031 |
| 1091 | nmdc:mga0yw44_4558_c1 | 3300050492 | Bacteria | 6382 |
| 1092 | nmdc:mga0yw44_72501_c1 | 3300050492 | Bacteria | 2141 |
| 1093 | nmdc:mga0yw44_87222_c1 | 3300050492 | Bacteria | 1967 |
| 1094 | nmdc:mga05p37_14337_c1 | 3300050507 | Bacteria | 9516 |
| 1095 | nmdc:mga05p37_162575_c1 | 3300050507 | Bacteria | 2726 |
| 1096 | nmdc:mga05p37_21167_c2 | 3300050507 | Bacteria | 7331 |
| 1097 | nmdc:mga05p37_22716_c2 | 3300050507 | Bacteria | 5879 |
| 1098 | nmdc:mga05p37_246215_c1 | 3300050507 | Bacteria | 2146 |
| 1099 | nmdc:mga05p37_407674_c1 | 3300050507 | Bacteria | 1585 |
| 1100 | nmdc:mga05p37_44560_c1 | 3300050507 | Bacteria | 5457 |
| 1101 | nmdc:mga09592_148082_c1 | 3300050508 | Bacteria | 2025 |
| 1102 | nmdc:mga09592_59299_c1 | 3300050508 | Bacteria | 3235 |
| 1103 | nmdc:mga09592_5985_c1 | 3300050508 | Bacteria | 9918 |
| 1104 | nmdc:mga09592_6374_c1 | 3300050508 | Bacteria | 9611 |
| 1105 | nmdc:mga0qj67_15405_c1 | 3300050509 | Bacteria | 5790 |
| 1106 | nmdc:mga0qj67_18969_c1 | 3300050509 | Bacteria | 5248 |
| 1107 | nmdc:mga06r32_126845_c1 | 3300050510 | Bacteria | 2521 |
| 1108 | nmdc:mga06r32_244_c1 | 3300050510 | Bacteria | 44802 |
| 1109 | nmdc:mga06r32_68265_c1 | 3300050510 | Bacteria | 3434 |
| 1110 | nmdc:mga08y16_131777_c1 | 3300050511 | Bacteria | 2599 |
| 1111 | nmdc:mga08y16_173159_c1 | 3300050511 | Bacteria | 2241 |
| 1112 | nmdc:mga08y16_22986_c1 | 3300050511 | Bacteria | 6582 |
| 1113 | nmdc:mga08y16_23135_c1 | 3300050511 | Bacteria | 6560 |
| 1114 | nmdc:mga08y16_30153_c1 | 3300050511 | Bacteria | 5709 |
| 1115 | nmdc:mga08y16_84929_c1 | 3300050511 | Bacteria | 3299 |
| 1116 | nmdc:mga0n895_206876_c1 | 3300050512 | Bacteria | 1993 |
| 1117 | nmdc:mga0n895_2605_c1 | 3300050512 | Bacteria | 14183 |
| 1118 | nmdc:mga0n895_28347_c1 | 3300050512 | Bacteria | 5325 |
| 1119 | nmdc:mga0n895_7227_c1 | 3300050512 | Bacteria | 9509 |
| 1120 | nmdc:mga0rr50_28018_c1 | 3300050513 | Bacteria | 3954 |
| 1121 | nmdc:mga08x19_18157_c1 | 3300050514 | Bacteria | 4309 |
| 1122 | nmdc:mga08x19_55413_c1 | 3300050514 | Bacteria | 2555 |
| 1123 | nmdc:mga0a205_189767_c1 | 3300050515 | Bacteria | 1948 |
| 1124 | nmdc:mga0a205_24_c2 | 3300050515 | Bacteria | 81894 |
| 1125 | nmdc:mga0a205_540_c1 | 3300050515 | Bacteria | 29856 |
| 1126 | nmdc:mga0a205_67562_c1 | 3300050515 | Bacteria | 3453 |
| 1127 | Ga0495601_0000013 | 3300053077 | Bacteria | 226476 |
| 1128 | Ga0495601_0000304 | 3300053077 | Bacteria | 26118 |
| 1129 | Ga0495601_0000326 | 3300053077 | Bacteria | 25282 |
| 1130 | Ga0495601_0003210 | 3300053077 | Bacteria | 9356 |
| 1131 | Ga0495601_0053134 | 3300053077 | Bacteria | 2560 |
| 1132 | Ga0495601_0068164 | 3300053077 | Bacteria | 2267 |
| 1133 | Ga0495612_0000136 | 3300053078 | Bacteria | 31282 |
| 1134 | Ga0495612_0000312 | 3300053078 | Bacteria | 19614 |
| 1135 | Ga0495612_0002565 | 3300053078 | Bacteria | 7492 |
| 1136 | Ga0495612_0005159 | 3300053078 | Bacteria | 5399 |
| 1137 | Ga0495612_0005579 | 3300053078 | Bacteria | 5201 |
| 1138 | Ga0495655_0000001 | 3300053083 | Bacteria | 419518 |
| 1139 | Ga0495655_0003329 | 3300053083 | Bacteria | 2642 |
| 1140 | Ga0495595_0000003 | 3300053084 | Bacteria | 266465 |
| 1141 | Ga0495595_0000172 | 3300053084 | Bacteria | 25608 |
| 1142 | Ga0495619_0000021 | 3300053085 | Bacteria | 187095 |
| 1143 | Ga0495619_0000031 | 3300053085 | Bacteria | 145508 |
| 1144 | Ga0495619_0000106 | 3300053085 | Bacteria | 62413 |
| 1145 | Ga0495619_0000836 | 3300053085 | Bacteria | 20199 |
| 1146 | Ga0495619_0001746 | 3300053085 | Bacteria | 14440 |
| 1147 | Ga0495619_0002472 | 3300053085 | Bacteria | 12091 |
| 1148 | Ga0495619_0009846 | 3300053085 | Bacteria | 6024 |
| 1149 | Ga0495619_0013727 | 3300053085 | Bacteria | 5108 |
| 1150 | Ga0495619_0030485 | 3300053085 | Bacteria | 3492 |
| 1151 | Ga0495619_0035066 | 3300053085 | Bacteria | 3263 |
| 1152 | Ga0495619_0066584 | 3300053085 | Bacteria | 2404 |
| 1153 | Ga0495619_0084158 | 3300053085 | Bacteria | 2146 |
| 1154 | Ga0500566_0023867 | 3300053094 | Bacteria | 3591 |
| 1155 | Ga0500641_0011610 | 3300053096 | Bacteria | 3200 |
| 1156 | Ga0500556_0000771 | 3300053104 | Bacteria | 18957 |
| 1157 | Ga0500614_005477 | 3300053123 | Bacteria | 2665 |
| 1158 | Ga0500628_000010 | 3300053129 | Bacteria | 122210 |
| 1159 | Ga0500616_0003419 | 3300053153 | Bacteria | 12157 |
| 1160 | Ga0500616_0009210 | 3300053153 | Bacteria | 6022 |
| 1161 | Ga0501084_0000440 | 3300054114 | Bacteria | 31982 |
| 1162 | Ga0501084_0014400 | 3300054114 | Bacteria | 6554 |
| 1163 | Ga0501084_0019930 | 3300054114 | Bacteria | 5590 |
| 1164 | Ga0501084_0043094 | 3300054114 | Bacteria | 3775 |
| 1165 | Ga0501084_0043250 | 3300054114 | Bacteria | 3769 |
| 1166 | Ga0501084_0177549 | 3300054114 | Bacteria | 1798 |
| 1167 | Ga0501082_0002337 | 3300060353 | Bacteria | 16599 |
| 1168 | Ga0501082_0025609 | 3300060353 | Bacteria | 5083 |
| 1169 | Ga0466962_0003445 | 3300061719 | Bacteria | 7536 |
| 1170 | Ga0466962_0018114 | 3300061719 | Bacteria | 3387 |
| 1171 | Ga0466962_0035137 | 3300061719 | Bacteria | 2399 |
| 1172 | Ga0466962_0038642 | 3300061719 | Bacteria | 2285 |
| 1173 | Ga0466962_0062945 | 3300061719 | Bacteria | 1771 |
| 1174 | Ga0530510_0006663 | 3300061734 | Bacteria | 8055 |
| 1175 | Ga0530510_0013146 | 3300061734 | Bacteria | 5822 |
| 1176 | Ga0530510_0082617 | 3300061734 | Bacteria | 2339 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0164310 | Ga0466967_0164310_22_1224 | 388 |
| 2 | 3300048914 | Ga0496111_0032766 | Ga0496111_0032766_2464_3663 | 388 |
| 3 | 3300048911 | Ga0496108_0102782 | Ga0496108_0102782_199_1617 | 404 |
| 4 | 3300046461 | Ga0495641_0087717 | Ga0495641_0087717_35_1303 | 411 |
| 5 | 3300048905 | Ga0496102_0064989 | Ga0496102_0064989_2026_3318 | 414 |
| 6 | 3300048910 | Ga0496107_0021675 | Ga0496107_0021675_52_1344 | 414 |
| 7 | 3300048911 | Ga0496108_0271139 | Ga0496108_0271139_173_1453 | 419 |
| 8 | 3300048904 | Ga0496101_0111615 | Ga0496101_0111615_12_1307 | 420 |
| 9 | 3300044735 | Ga0466968_0023533 | Ga0466968_0023533_1186_2472 | 421 |
| 10 | 3300009147 | Ga0114129_10447196 | Ga0114129_104471961 | 424 |
| 11 | 3300046463 | Ga0495653_0062262 | Ga0495653_0062262_43_1347 | 426 |
| 12 | 3300048908 | Ga0496105_0064643 | Ga0496105_0064643_1681_2985 | 426 |
| 13 | 3300048913 | Ga0496110_0224326 | Ga0496110_0224326_325_1647 | 433 |
| 14 | 3300049824 | Ga0501045_0024403 | Ga0501045_0024403_2986_4302 | 434 |
| 15 | 3300039453 | Ga0436362_0534151 | Ga0436362_0534151_15_1349 | 437 |
| 16 | 3300048910 | Ga0496107_0118878 | Ga0496107_0118878_17_1351 | 437 |
| 17 | 3300044694 | Ga0466963_0003004 | Ga0466963_0003004_8128_9468 | 438 |
| 18 | 3300044719 | Ga0466971_0086977 | Ga0466971_0086977_18_1355 | 438 |
| 19 | 3300053085 | Ga0495619_0084158 | Ga0495619_0084158_760_2097 | 438 |
| 20 | 3300045836 | Ga0466958_0053947 | Ga0466958_0053947_1069_2409 | 439 |
| 21 | 3300046462 | Ga0495651_0174542 | Ga0495651_0174542_24_1481 | 440 |
| 22 | 3300046463 | Ga0495653_0108363 | Ga0495653_0108363_289_1746 | 440 |
| 23 | 3300053085 | Ga0495619_0030485 | Ga0495619_0030485_496_1953 | 440 |
| 24 | 3300049588 | Ga0501072_0123020 | Ga0501072_0123020_638_2008 | 441 |
| 25 | 3300049824 | Ga0501045_0051616 | Ga0501045_0051616_1335_2762 | 441 |
| 26 | 3300046678 | Ga0495599_0024325 | Ga0495599_0024325_88_1443 | 443 |
| 27 | 3300010375 | Ga0105239_10120285 | Ga0105239_101202851 | 444 |
| 28 | 3300049586 | Ga0501070_0019793 | Ga0501070_0019793_4265_5608 | 445 |
| 29 | 3300041408 | Ga0439453_0001968 | Ga0439453_0001968_879_2255 | 446 |
| 30 | 3300049577 | Ga0501041_0134828 | Ga0501041_0134828_166_1509 | 446 |
| 31 | 3300049743 | Ga0501081_0019127 | Ga0501081_0019127_57_1400 | 446 |
| 32 | 3300011119 | Ga0105246_10139585 | Ga0105246_101395851 | 448 |
| 33 | 3300049575 | Ga0501039_0187606 | Ga0501039_0187606_127_1575 | 448 |
| 34 | 3300005937 | Ga0081455_10001981 | Ga0081455_100019816 | 454 |
| 35 | 3300037418 | Ga0395900_0011245 | Ga0395900_0011245_985_2424 | 459 |
| 36 | 3300005329 | Ga0070683_100158979 | Ga0070683_1001589792 | 460 |
| 37 | 3300005535 | Ga0070684_100034900 | Ga0070684_1000349003 | 460 |
| 38 | 3300009093 | Ga0105240_10110181 | Ga0105240_101101813 | 460 |
| 39 | 3300020082 | Ga0206353_11536562 | Ga0206353_115365625 | 460 |
| 40 | 3300044656 | Ga0466969_0006958 | Ga0466969_0006958_4288_5709 | 461 |
| 41 | 3300044693 | Ga0466961_0049240 | Ga0466961_0049240_870_2291 | 461 |
| 42 | 3300044694 | Ga0466963_0008179 | Ga0466963_0008179_1444_2865 | 461 |
| 43 | 3300044735 | Ga0466968_0002564 | Ga0466968_0002564_4726_6147 | 461 |
| 44 | 3300044765 | Ga0466970_0004127 | Ga0466970_0004127_423_1844 | 461 |
| 45 | 3300044842 | Ga0466957_0014318 | Ga0466957_0014318_1449_2870 | 461 |
| 46 | 3300045049 | Ga0466959_0004063 | Ga0466959_0004063_7651_9072 | 461 |
| 47 | 3300045976 | Ga0466967_0055584 | Ga0466967_0055584_1723_3144 | 461 |
| 48 | 3300009147 | Ga0114129_10024279 | Ga0114129_100242792 | 462 |
| 49 | 3300044842 | Ga0466957_0035244 | Ga0466957_0035244_1539_2960 | 462 |
| 50 | 3300049582 | Ga0501048_0037368 | Ga0501048_0037368_1113_2576 | 462 |
| 51 | 3300049592 | Ga0501076_0103370 | Ga0501076_0103370_443_1906 | 462 |
| 52 | 3300025912 | Ga0207707_10116782 | Ga0207707_101167822 | 464 |
| 53 | 3300005329 | Ga0070683_100000682 | Ga0070683_10000068210 | 466 |
| 54 | 3300005458 | Ga0070681_10101094 | Ga0070681_101010942 | 466 |
| 55 | 3300005535 | Ga0070684_100008210 | Ga0070684_1000082109 | 466 |
| 56 | 3300025912 | Ga0207707_10010986 | Ga0207707_100109862 | 466 |
| 57 | 3300025944 | Ga0207661_10033341 | Ga0207661_100333412 | 466 |
| 58 | 3300045976 | Ga0466967_0098308 | Ga0466967_0098308_869_2311 | 466 |
| 59 | 3300005435 | Ga0070714_100219592 | Ga0070714_1002195921 | 467 |
| 60 | 3300025909 | Ga0207705_10011755 | Ga0207705_100117554 | 467 |
| 61 | 3300044694 | Ga0466963_0038954 | Ga0466963_0038954_727_2172 | 467 |
| 62 | 3300044694 | Ga0466963_0076656 | Ga0466963_0076656_774_2219 | 467 |
| 63 | 3300044706 | Ga0466964_0024069 | Ga0466964_0024069_98_1543 | 467 |
| 64 | 3300045976 | Ga0466967_0004922 | Ga0466967_0004922_3631_5076 | 467 |
| 65 | 3300049824 | Ga0501045_0023645 | Ga0501045_0023645_1673_3151 | 467 |
| 66 | 3300005336 | Ga0070680_100016204 | Ga0070680_1000162046 | 468 |
| 67 | 3300005364 | Ga0070673_100138496 | Ga0070673_1001384962 | 468 |
| 68 | 3300005434 | Ga0070709_10044052 | Ga0070709_100440523 | 468 |
| 69 | 3300005435 | Ga0070714_100031539 | Ga0070714_1000315393 | 468 |
| 70 | 3300005456 | Ga0070678_100033935 | Ga0070678_1000339353 | 468 |
| 71 | 3300005530 | Ga0070679_100009474 | Ga0070679_1000094744 | 468 |
| 72 | 3300005547 | Ga0070693_100011458 | Ga0070693_1000114582 | 468 |
| 73 | 3300005563 | Ga0068855_100014745 | Ga0068855_1000147458 | 468 |
| 74 | 3300006028 | Ga0070717_10004065 | Ga0070717_100040653 | 468 |
| 75 | 3300006173 | Ga0070716_100064474 | Ga0070716_1000644742 | 468 |
| 76 | 3300006871 | Ga0075434_100018375 | Ga0075434_1000183753 | 468 |
| 77 | 3300006914 | Ga0075436_100147263 | Ga0075436_1001472631 | 468 |
| 78 | 3300013104 | Ga0157370_10008024 | Ga0157370_100080247 | 468 |
| 79 | 3300013105 | Ga0157369_10072870 | Ga0157369_100728703 | 468 |
| 80 | 3300013105 | Ga0157369_10089867 | Ga0157369_100898673 | 468 |
| 81 | 3300025909 | Ga0207705_10017978 | Ga0207705_100179783 | 468 |
| 82 | 3300025915 | Ga0207693_10010457 | Ga0207693_100104572 | 468 |
| 83 | 3300025915 | Ga0207693_10019840 | Ga0207693_100198405 | 468 |
| 84 | 3300025919 | Ga0207657_10005572 | Ga0207657_100055728 | 468 |
| 85 | 3300025921 | Ga0207652_10081403 | Ga0207652_100814033 | 468 |
| 86 | 3300025929 | Ga0207664_10006739 | Ga0207664_100067394 | 468 |
| 87 | 3300025939 | Ga0207665_10003251 | Ga0207665_100032512 | 468 |
| 88 | 3300025944 | Ga0207661_10052959 | Ga0207661_100529593 | 468 |
| 89 | 3300025960 | Ga0207651_10080053 | Ga0207651_100800532 | 468 |
| 90 | 3300026121 | Ga0207683_10002374 | Ga0207683_1000237414 | 468 |
| 91 | 3300035090 | Ga0373949_0006908 | Ga0373949_0006908_331_1773 | 468 |
| 92 | 3300035691 | Ga0373931_0020433 | Ga0373931_0020433_918_2360 | 468 |
| 93 | 3300048905 | Ga0496102_0003661 | Ga0496102_0003661_9580_11022 | 468 |
| 94 | 3300048907 | Ga0496104_0005543 | Ga0496104_0005543_3268_4710 | 468 |
| 95 | 3300048908 | Ga0496105_0011882 | Ga0496105_0011882_158_1600 | 468 |
| 96 | 3300048918 | Ga0496115_0002542 | Ga0496115_0002542_788_2230 | 468 |
| 97 | 3300048918 | Ga0496115_0022547 | Ga0496115_0022547_3406_4848 | 468 |
| 98 | 3300050514 | nmdc:mga08x19_18157_c1 | nmdc:mga08x19_18157_c1_196_1638 | 468 |
| 99 | 3300005336 | Ga0070680_100086547 | Ga0070680_1000865472 | 469 |
| 100 | 3300005366 | Ga0070659_100017601 | Ga0070659_1000176013 | 469 |
| 101 | 3300005435 | Ga0070714_100042377 | Ga0070714_1000423772 | 469 |
| 102 | 3300005436 | Ga0070713_100031284 | Ga0070713_1000312843 | 469 |
| 103 | 3300005530 | Ga0070679_100031188 | Ga0070679_1000311885 | 469 |
| 104 | 3300005530 | Ga0070679_100254294 | Ga0070679_1002542942 | 469 |
| 105 | 3300005535 | Ga0070684_100139387 | Ga0070684_1001393872 | 469 |
| 106 | 3300005545 | Ga0070695_100000265 | Ga0070695_1000002656 | 469 |
| 107 | 3300009093 | Ga0105240_10058261 | Ga0105240_100582612 | 469 |
| 108 | 3300013307 | Ga0157372_10183659 | Ga0157372_101836592 | 469 |
| 109 | 3300025912 | Ga0207707_10041204 | Ga0207707_100412043 | 469 |
| 110 | 3300025915 | Ga0207693_10000920 | Ga0207693_100009207 | 469 |
| 111 | 3300025919 | Ga0207657_10008838 | Ga0207657_100088382 | 469 |
| 112 | 3300025924 | Ga0207694_10043428 | Ga0207694_100434282 | 469 |
| 113 | 3300025927 | Ga0207687_10084038 | Ga0207687_100840382 | 469 |
| 114 | 3300025929 | Ga0207664_10017802 | Ga0207664_100178022 | 469 |
| 115 | 3300025939 | Ga0207665_10124725 | Ga0207665_101247252 | 469 |
| 116 | 3300035724 | Ga0373933_0077155 | Ga0373933_0077155_374_1831 | 469 |
| 117 | 3300036401 | Ga0373937_0000355 | Ga0373937_0000355_11442_12899 | 469 |
| 118 | 3300044693 | Ga0466961_0005282 | Ga0466961_0005282_4839_6296 | 469 |
| 119 | 3300044694 | Ga0466963_0000010 | Ga0466963_0000010_59895_61352 | 469 |
| 120 | 3300044694 | Ga0466963_0000649 | Ga0466963_0000649_5467_6924 | 469 |
| 121 | 3300044694 | Ga0466963_0002000 | Ga0466963_0002000_2614_4071 | 469 |
| 122 | 3300044706 | Ga0466964_0000213 | Ga0466964_0000213_5036_6493 | 469 |
| 123 | 3300044706 | Ga0466964_0008942 | Ga0466964_0008942_1764_3218 | 469 |
| 124 | 3300044706 | Ga0466964_0012120 | Ga0466964_0012120_1634_3091 | 469 |
| 125 | 3300044706 | Ga0466964_0045512 | Ga0466964_0045512_40_1497 | 469 |
| 126 | 3300044719 | Ga0466971_0004429 | Ga0466971_0004429_3874_5331 | 469 |
| 127 | 3300044719 | Ga0466971_0010626 | Ga0466971_0010626_920_2377 | 469 |
| 128 | 3300044842 | Ga0466957_0008323 | Ga0466957_0008323_2448_3905 | 469 |
| 129 | 3300044842 | Ga0466957_0052692 | Ga0466957_0052692_659_2116 | 469 |
| 130 | 3300044901 | Ga0466960_0009445 | Ga0466960_0009445_1161_2618 | 469 |
| 131 | 3300045049 | Ga0466959_0003840 | Ga0466959_0003840_3035_4492 | 469 |
| 132 | 3300045836 | Ga0466958_0002150 | Ga0466958_0002150_8084_9541 | 469 |
| 133 | 3300045976 | Ga0466967_0001331 | Ga0466967_0001331_9429_10886 | 469 |
| 134 | 3300045976 | Ga0466967_0010334 | Ga0466967_0010334_3027_4481 | 469 |
| 135 | 3300045976 | Ga0466967_0070911 | Ga0466967_0070911_474_1931 | 469 |
| 136 | 3300045976 | Ga0466967_0094359 | Ga0466967_0094359_633_2090 | 469 |
| 137 | 3300045976 | Ga0466967_0109242 | Ga0466967_0109242_558_2015 | 469 |
| 138 | 3300046454 | Ga0495592_0000732 | Ga0495592_0000732_7889_9346 | 469 |
| 139 | 3300046462 | Ga0495651_0000029 | Ga0495651_0000029_35746_37203 | 469 |
| 140 | 3300046463 | Ga0495653_0001363 | Ga0495653_0001363_4565_6022 | 469 |
| 141 | 3300046463 | Ga0495653_0030477 | Ga0495653_0030477_2244_3698 | 469 |
| 142 | 3300046477 | Ga0495664_0102031 | Ga0495664_0102031_161_1618 | 469 |
| 143 | 3300046514 | Ga0495618_0022141 | Ga0495618_0022141_656_2113 | 469 |
| 144 | 3300046516 | Ga0495628_0000016 | Ga0495628_0000016_35719_37176 | 469 |
| 145 | 3300046529 | Ga0495652_0000045 | Ga0495652_0000045_113868_115325 | 469 |
| 146 | 3300046536 | Ga0495587_0000083 | Ga0495587_0000083_6521_7978 | 469 |
| 147 | 3300046536 | Ga0495587_0014131 | Ga0495587_0014131_1576_3027 | 469 |
| 148 | 3300046543 | Ga0495645_0001902 | Ga0495645_0001902_4504_5961 | 469 |
| 149 | 3300046559 | Ga0495667_0034052 | Ga0495667_0034052_68_1522 | 469 |
| 150 | 3300046675 | Ga0495657_0011595 | Ga0495657_0011595_3950_5407 | 469 |
| 151 | 3300046678 | Ga0495599_0000187 | Ga0495599_0000187_6190_7647 | 469 |
| 152 | 3300046679 | Ga0495623_0000121 | Ga0495623_0000121_35738_37195 | 469 |
| 153 | 3300046680 | Ga0495646_0001537 | Ga0495646_0001537_7989_9446 | 469 |
| 154 | 3300046683 | Ga0495658_0036522 | Ga0495658_0036522_335_1789 | 469 |
| 155 | 3300046690 | Ga0495624_0108268 | Ga0495624_0108268_137_1591 | 469 |
| 156 | 3300047317 | Ga0495604_0000072 | Ga0495604_0000072_81695_83152 | 469 |
| 157 | 3300047319 | Ga0495674_0083367 | Ga0495674_0083367_109_1566 | 469 |
| 158 | 3300047444 | Ga0495675_0000031 | Ga0495675_0000031_66653_68110 | 469 |
| 159 | 3300047471 | Ga0495684_0018384 | Ga0495684_0018384_1251_2705 | 469 |
| 160 | 3300048088 | Ga0495602_0000133 | Ga0495602_0000133_35746_37203 | 469 |
| 161 | 3300048905 | Ga0496102_0005815 | Ga0496102_0005815_2529_3986 | 469 |
| 162 | 3300048907 | Ga0496104_0039390 | Ga0496104_0039390_45_1499 | 469 |
| 163 | 3300048908 | Ga0496105_0010632 | Ga0496105_0010632_1606_3060 | 469 |
| 164 | 3300048911 | Ga0496108_0036442 | Ga0496108_0036442_12_1466 | 469 |
| 165 | 3300048912 | Ga0496109_0009062 | Ga0496109_0009062_4255_5709 | 469 |
| 166 | 3300048912 | Ga0496109_0116828 | Ga0496109_0116828_402_1850 | 469 |
| 167 | 3300048912 | Ga0496109_0239826 | Ga0496109_0239826_163_1617 | 469 |
| 168 | 3300048915 | Ga0496112_0053133 | Ga0496112_0053133_2354_3811 | 469 |
| 169 | 3300048915 | Ga0496112_0175849 | Ga0496112_0175849_584_2041 | 469 |
| 170 | 3300048922 | Ga0496119_0045690 | Ga0496119_0045690_453_1955 | 469 |
| 171 | 3300050507 | nmdc:mga05p37_21167_c2 | nmdc:mga05p37_21167_c2_5014_6468 | 469 |
| 172 | 3300050512 | nmdc:mga0n895_206876_c1 | nmdc:mga0n895_206876_c1_352_1815 | 469 |
| 173 | 3300050513 | nmdc:mga0rr50_28018_c1 | nmdc:mga0rr50_28018_c1_1253_2716 | 469 |
| 174 | 3300053077 | Ga0495601_0000304 | Ga0495601_0000304_12990_14447 | 469 |
| 175 | 3300053085 | Ga0495619_0000836 | Ga0495619_0000836_13461_14918 | 469 |
| 176 | 3300061719 | Ga0466962_0035137 | Ga0466962_0035137_65_1522 | 469 |
| 177 | 3300061719 | Ga0466962_0038642 | Ga0466962_0038642_653_2110 | 469 |
| 178 | 3300005985 | Ga0081539_10000288 | Ga0081539_1000028875 | 470 |
| 179 | 3300006038 | Ga0075365_10013272 | Ga0075365_100132723 | 470 |
| 180 | 3300006051 | Ga0075364_10075351 | Ga0075364_100753512 | 470 |
| 181 | 3300006846 | Ga0075430_100017889 | Ga0075430_1000178895 | 470 |
| 182 | 3300006880 | Ga0075429_100073357 | Ga0075429_1000733572 | 470 |
| 183 | 3300037471 | Ga0395905_0109187 | Ga0395905_0109187_63_1478 | 470 |
| 184 | 3300053085 | Ga0495619_0066584 | Ga0495619_0066584_743_2197 | 470 |
| 185 | 3300045976 | Ga0466967_0054758 | Ga0466967_0054758_87_1589 | 471 |
| 186 | 3300046514 | Ga0495618_0008047 | Ga0495618_0008047_465_1916 | 471 |
| 187 | 3300046517 | Ga0495630_0087042 | Ga0495630_0087042_860_2311 | 471 |
| 188 | 3300046663 | Ga0495635_0015687 | Ga0495635_0015687_3764_5215 | 471 |
| 189 | 3300053077 | Ga0495601_0068164 | Ga0495601_0068164_78_1529 | 471 |
| 190 | 3300005544 | Ga0070686_100125632 | Ga0070686_1001256322 | 472 |
| 191 | 3300005937 | Ga0081455_10016719 | Ga0081455_100167197 | 472 |
| 192 | 3300005981 | Ga0081538_10001868 | Ga0081538_100018689 | 472 |
| 193 | 3300005981 | Ga0081538_10031229 | Ga0081538_100312293 | 472 |
| 194 | 3300025934 | Ga0207686_10019818 | Ga0207686_100198182 | 472 |
| 195 | 3300031824 | Ga0307413_10110574 | Ga0307413_101105742 | 472 |
| 196 | 3300031995 | Ga0307409_100184376 | Ga0307409_1001843761 | 472 |
| 197 | 3300032126 | Ga0307415_100003690 | Ga0307415_1000036901 | 472 |
| 198 | 3300037418 | Ga0395900_0076548 | Ga0395900_0076548_1756_3207 | 472 |
| 199 | 3300037466 | Ga0395898_0174659 | Ga0395898_0174659_529_1980 | 472 |
| 200 | 3300037471 | Ga0395905_0090877 | Ga0395905_0090877_1121_2572 | 472 |
| 201 | 3300039438 | Ga0436360_0953769 | Ga0436360_0953769_540_2009 | 472 |
| 202 | 3300046642 | Ga0495634_0045320 | Ga0495634_0045320_1494_2933 | 472 |
| 203 | 3300044673 | Ga0453683_0031377 | Ga0453683_0031377_685_2202 | 473 |
| 204 | 3300045051 | Ga0451576_0012750 | Ga0451576_0012750_7221_8738 | 473 |
| 205 | 3300005981 | Ga0081538_10001885 | Ga0081538_1000188512 | 474 |
| 206 | 3300005981 | Ga0081538_10057348 | Ga0081538_100573482 | 474 |
| 207 | 3300049574 | Ga0501038_0029084 | Ga0501038_0029084_2494_3930 | 474 |
| 208 | 3300049576 | Ga0501040_0112454 | Ga0501040_0112454_51_1487 | 474 |
| 209 | 3300049586 | Ga0501070_0069408 | Ga0501070_0069408_374_1810 | 474 |
| 210 | 3300049587 | Ga0501071_0010306 | Ga0501071_0010306_3732_5168 | 474 |
| 211 | 3300049590 | Ga0501074_0129296 | Ga0501074_0129296_59_1495 | 474 |
| 212 | 3300054114 | Ga0501084_0043094 | Ga0501084_0043094_13_1449 | 474 |
| 213 | 3300061734 | Ga0530510_0006663 | Ga0530510_0006663_6106_7542 | 474 |
| 214 | 3300005327 | Ga0070658_10156784 | Ga0070658_101567842 | 475 |
| 215 | 3300005530 | Ga0070679_100064550 | Ga0070679_1000645503 | 475 |
| 216 | 3300009094 | Ga0111539_10008241 | Ga0111539_100082417 | 475 |
| 217 | 3300025921 | Ga0207652_10224982 | Ga0207652_102249822 | 475 |
| 218 | 3300027907 | Ga0207428_10054977 | Ga0207428_100549773 | 475 |
| 219 | 3300042146 | Ga0450907_007797 | Ga0450907_007797_46_1521 | 475 |
| 220 | 3300050511 | nmdc:mga08y16_23135_c1 | nmdc:mga08y16_23135_c1_4138_5631 | 475 |
| 221 | 3300005339 | Ga0070660_100001782 | Ga0070660_10000178215 | 476 |
| 222 | 3300006846 | Ga0075430_100039029 | Ga0075430_1000390292 | 476 |
| 223 | 3300011119 | Ga0105246_10014139 | Ga0105246_100141394 | 476 |
| 224 | 3300025919 | Ga0207657_10021014 | Ga0207657_100210143 | 476 |
| 225 | 3300044684 | Ga0466966_0023906 | Ga0466966_0023906_2369_3826 | 476 |
| 226 | 3300045049 | Ga0466959_0083050 | Ga0466959_0083050_557_2041 | 476 |
| 227 | 3300045836 | Ga0466958_0003505 | Ga0466958_0003505_1624_3108 | 476 |
| 228 | 3300048907 | Ga0496104_0030115 | Ga0496104_0030115_2684_4141 | 476 |
| 229 | 3300048908 | Ga0496105_0026130 | Ga0496105_0026130_92_1549 | 476 |
| 230 | 3300048910 | Ga0496107_0044880 | Ga0496107_0044880_377_1834 | 476 |
| 231 | 3300048912 | Ga0496109_0076768 | Ga0496109_0076768_188_1645 | 476 |
| 232 | 3300048916 | Ga0496113_0010329 | Ga0496113_0010329_3473_4930 | 476 |
| 233 | 3300049585 | Ga0501069_0015723 | Ga0501069_0015723_217_1674 | 476 |
| 234 | 3300050507 | nmdc:mga05p37_407674_c1 | nmdc:mga05p37_407674_c1_17_1528 | 476 |
| 235 | 3300050509 | nmdc:mga0qj67_18969_c1 | nmdc:mga0qj67_18969_c1_2954_4423 | 476 |
| 236 | 3300061719 | Ga0466962_0062945 | Ga0466962_0062945_14_1498 | 476 |
| 237 | 3300003373 | JGI25407J50210_10001927 | JGI25407J50210_100019272 | 477 |
| 238 | 3300005937 | Ga0081455_10043246 | Ga0081455_100432463 | 477 |
| 239 | 3300005981 | Ga0081538_10000920 | Ga0081538_1000092022 | 477 |
| 240 | 3300037312 | Ga0395899_0077262 | Ga0395899_0077262_901_2385 | 477 |
| 241 | 3300037418 | Ga0395900_0165799 | Ga0395900_0165799_45_1529 | 477 |
| 242 | 3300037466 | Ga0395898_0037130 | Ga0395898_0037130_2723_4207 | 477 |
| 243 | 3300044694 | Ga0466963_0026379 | Ga0466963_0026379_1309_2754 | 477 |
| 244 | 3300044719 | Ga0466971_0014088 | Ga0466971_0014088_643_2091 | 477 |
| 245 | 3300045836 | Ga0466958_0050797 | Ga0466958_0050797_999_2447 | 477 |
| 246 | 3300045976 | Ga0466967_0026681 | Ga0466967_0026681_1865_3313 | 477 |
| 247 | 3300045976 | Ga0466967_0050611 | Ga0466967_0050611_2070_3518 | 477 |
| 248 | 3300045976 | Ga0466967_0130811 | Ga0466967_0130811_740_2188 | 477 |
| 249 | 3300045976 | Ga0466967_0312490 | Ga0466967_0312490_38_1483 | 477 |
| 250 | 3300049578 | Ga0501042_0081726 | Ga0501042_0081726_338_1837 | 477 |
| 251 | 3300050509 | nmdc:mga0qj67_15405_c1 | nmdc:mga0qj67_15405_c1_918_2387 | 477 |
| 252 | 3300054114 | Ga0501084_0177549 | Ga0501084_0177549_13_1512 | 477 |
| 253 | 3300005548 | Ga0070665_100001191 | Ga0070665_10000119123 | 478 |
| 254 | 3300009148 | Ga0105243_10062605 | Ga0105243_100626053 | 478 |
| 255 | 3300035116 | Ga0373945_0001407 | Ga0373945_0001407_2889_4373 | 478 |
| 256 | 3300035170 | Ga0373943_0001797 | Ga0373943_0001797_7342_8826 | 478 |
| 257 | 3300035692 | Ga0373935_0039197 | Ga0373935_0039197_1262_2746 | 478 |
| 258 | 3300035725 | Ga0373947_0001552 | Ga0373947_0001552_11757_13241 | 478 |
| 259 | 3300044694 | Ga0466963_0009198 | Ga0466963_0009198_449_1900 | 478 |
| 260 | 3300044694 | Ga0466963_0037534 | Ga0466963_0037534_820_2271 | 478 |
| 261 | 3300045976 | Ga0466967_0000332 | Ga0466967_0000332_7443_8945 | 478 |
| 262 | 3300045976 | Ga0466967_0002553 | Ga0466967_0002553_2230_3681 | 478 |
| 263 | 3300045976 | Ga0466967_0034677 | Ga0466967_0034677_2685_4133 | 478 |
| 264 | 3300046459 | Ga0495629_0016715 | Ga0495629_0016715_1795_3279 | 478 |
| 265 | 3300046461 | Ga0495641_0003908 | Ga0495641_0003908_940_2424 | 478 |
| 266 | 3300046462 | Ga0495651_0014666 | Ga0495651_0014666_782_2266 | 478 |
| 267 | 3300046463 | Ga0495653_0008307 | Ga0495653_0008307_5731_7215 | 478 |
| 268 | 3300046472 | Ga0495580_0015952 | Ga0495580_0015952_3498_4982 | 478 |
| 269 | 3300046475 | Ga0495639_0003274 | Ga0495639_0003274_1749_3233 | 478 |
| 270 | 3300046477 | Ga0495664_0043944 | Ga0495664_0043944_649_2133 | 478 |
| 271 | 3300046514 | Ga0495618_0069294 | Ga0495618_0069294_531_2015 | 478 |
| 272 | 3300046516 | Ga0495628_0049354 | Ga0495628_0049354_928_2412 | 478 |
| 273 | 3300046517 | Ga0495630_0000505 | Ga0495630_0000505_14012_15496 | 478 |
| 274 | 3300046526 | Ga0495666_0001576 | Ga0495666_0001576_9357_10841 | 478 |
| 275 | 3300046531 | Ga0495665_0019672 | Ga0495665_0019672_777_2261 | 478 |
| 276 | 3300046533 | Ga0495640_0039081 | Ga0495640_0039081_228_1712 | 478 |
| 277 | 3300046535 | Ga0495586_0022930 | Ga0495586_0022930_1621_3105 | 478 |
| 278 | 3300046543 | Ga0495645_0077688 | Ga0495645_0077688_124_1608 | 478 |
| 279 | 3300046559 | Ga0495667_0053041 | Ga0495667_0053041_373_1857 | 478 |
| 280 | 3300046642 | Ga0495634_0003355 | Ga0495634_0003355_10600_12084 | 478 |
| 281 | 3300046663 | Ga0495635_0012397 | Ga0495635_0012397_78_1562 | 478 |
| 282 | 3300046678 | Ga0495599_0043015 | Ga0495599_0043015_985_2469 | 478 |
| 283 | 3300046681 | Ga0495647_0000468 | Ga0495647_0000468_9986_11470 | 478 |
| 284 | 3300046683 | Ga0495658_0012335 | Ga0495658_0012335_228_1712 | 478 |
| 285 | 3300046690 | Ga0495624_0005932 | Ga0495624_0005932_391_1875 | 478 |
| 286 | 3300046809 | Ga0495600_0042473 | Ga0495600_0042473_963_2447 | 478 |
| 287 | 3300047319 | Ga0495674_0012591 | Ga0495674_0012591_914_2398 | 478 |
| 288 | 3300047321 | Ga0495676_0059321 | Ga0495676_0059321_519_2003 | 478 |
| 289 | 3300047322 | Ga0495680_0004810 | Ga0495680_0004810_2612_4096 | 478 |
| 290 | 3300047471 | Ga0495684_0021987 | Ga0495684_0021987_2895_4379 | 478 |
| 291 | 3300047673 | Ga0495593_0000333 | Ga0495593_0000333_14567_16051 | 478 |
| 292 | 3300048089 | Ga0495614_0000165 | Ga0495614_0000165_21788_23272 | 478 |
| 293 | 3300048907 | Ga0496104_0000001 | Ga0496104_0000001_640159_641706 | 478 |
| 294 | 3300048913 | Ga0496110_0000039 | Ga0496110_0000039_45806_47353 | 478 |
| 295 | 3300048914 | Ga0496111_0001293 | Ga0496111_0001293_9729_11276 | 478 |
| 296 | 3300053078 | Ga0495612_0005159 | Ga0495612_0005159_959_2443 | 478 |
| 297 | 3300053104 | Ga0500556_0000771 | Ga0500556_0000771_425_1894 | 478 |
| 298 | 3300053153 | Ga0500616_0003419 | Ga0500616_0003419_425_1894 | 478 |
| 299 | 3300003203 | JGI25406J46586_10026917 | JGI25406J46586_100269172 | 479 |
| 300 | 3300005985 | Ga0081539_10003296 | Ga0081539_1000329613 | 479 |
| 301 | 3300005985 | Ga0081539_10006119 | Ga0081539_100061193 | 479 |
| 302 | 3300006844 | Ga0075428_100053256 | Ga0075428_1000532564 | 479 |
| 303 | 3300009094 | Ga0111539_10022251 | Ga0111539_100222514 | 479 |
| 304 | 3300026075 | Ga0207708_10086924 | Ga0207708_100869242 | 479 |
| 305 | 3300027907 | Ga0207428_10018799 | Ga0207428_100187994 | 479 |
| 306 | 3300045836 | Ga0466958_0003309 | Ga0466958_0003309_4489_6003 | 479 |
| 307 | 3300049568 | Ga0501031_0028123 | Ga0501031_0028123_1153_2643 | 479 |
| 308 | 3300049572 | Ga0501036_0005110 | Ga0501036_0005110_1024_2514 | 479 |
| 309 | 3300049574 | Ga0501038_0031807 | Ga0501038_0031807_989_2479 | 479 |
| 310 | 3300049575 | Ga0501039_0001294 | Ga0501039_0001294_8830_10320 | 479 |
| 311 | 3300049576 | Ga0501040_0007295 | Ga0501040_0007295_2224_3714 | 479 |
| 312 | 3300049576 | Ga0501040_0094803 | Ga0501040_0094803_536_2014 | 479 |
| 313 | 3300049577 | Ga0501041_0003440 | Ga0501041_0003440_5090_6580 | 479 |
| 314 | 3300049578 | Ga0501042_0010330 | Ga0501042_0010330_3589_5079 | 479 |
| 315 | 3300049580 | Ga0501046_0002209 | Ga0501046_0002209_14693_16183 | 479 |
| 316 | 3300049585 | Ga0501069_0013225 | Ga0501069_0013225_861_2351 | 479 |
| 317 | 3300049585 | Ga0501069_0060934 | Ga0501069_0060934_463_1944 | 479 |
| 318 | 3300049587 | Ga0501071_0009527 | Ga0501071_0009527_2536_4026 | 479 |
| 319 | 3300049588 | Ga0501072_0000517 | Ga0501072_0000517_19688_21178 | 479 |
| 320 | 3300049588 | Ga0501072_0086008 | Ga0501072_0086008_538_2016 | 479 |
| 321 | 3300049590 | Ga0501074_0016482 | Ga0501074_0016482_2135_3625 | 479 |
| 322 | 3300049591 | Ga0501075_0007340 | Ga0501075_0007340_5432_6922 | 479 |
| 323 | 3300049592 | Ga0501076_0000710 | Ga0501076_0000710_14823_16313 | 479 |
| 324 | 3300049593 | Ga0501077_0004020 | Ga0501077_0004020_3549_5039 | 479 |
| 325 | 3300049743 | Ga0501081_0035346 | Ga0501081_0035346_393_1883 | 479 |
| 326 | 3300049822 | Ga0501035_0036377 | Ga0501035_0036377_1612_3102 | 479 |
| 327 | 3300049824 | Ga0501045_0002778 | Ga0501045_0002778_6581_8071 | 479 |
| 328 | 3300050511 | nmdc:mga08y16_22986_c1 | nmdc:mga08y16_22986_c1_3166_4620 | 479 |
| 329 | 3300054114 | Ga0501084_0000440 | Ga0501084_0000440_28316_29806 | 479 |
| 330 | 3300060353 | Ga0501082_0002337 | Ga0501082_0002337_12566_14056 | 479 |
| 331 | 3300061734 | Ga0530510_0013146 | Ga0530510_0013146_2190_3680 | 479 |
| 332 | 3300005981 | Ga0081538_10001951 | Ga0081538_100019516 | 480 |
| 333 | 3300031852 | Ga0307410_10031150 | Ga0307410_100311503 | 480 |
| 334 | 3300031903 | Ga0307407_10010086 | Ga0307407_100100862 | 480 |
| 335 | 3300031995 | Ga0307409_100002102 | Ga0307409_1000021026 | 480 |
| 336 | 3300032002 | Ga0307416_100022798 | Ga0307416_1000227984 | 480 |
| 337 | 3300032005 | Ga0307411_10128450 | Ga0307411_101284502 | 480 |
| 338 | 3300037312 | Ga0395899_0047643 | Ga0395899_0047643_749_2233 | 480 |
| 339 | 3300037471 | Ga0395905_0001832 | Ga0395905_0001832_10939_12423 | 480 |
| 340 | 3300005329 | Ga0070683_100006431 | Ga0070683_1000064316 | 481 |
| 341 | 3300005336 | Ga0070680_100003345 | Ga0070680_1000033455 | 481 |
| 342 | 3300005366 | Ga0070659_100018207 | Ga0070659_1000182072 | 481 |
| 343 | 3300005457 | Ga0070662_100003078 | Ga0070662_1000030786 | 481 |
| 344 | 3300005458 | Ga0070681_10004654 | Ga0070681_100046549 | 481 |
| 345 | 3300005530 | Ga0070679_100003939 | Ga0070679_1000039398 | 481 |
| 346 | 3300005535 | Ga0070684_100008468 | Ga0070684_1000084684 | 481 |
| 347 | 3300005577 | Ga0068857_100149959 | Ga0068857_1001499592 | 481 |
| 348 | 3300005614 | Ga0068856_100094185 | Ga0068856_1000941852 | 481 |
| 349 | 3300005981 | Ga0081538_10000259 | Ga0081538_1000025923 | 481 |
| 350 | 3300006844 | Ga0075428_100064842 | Ga0075428_1000648422 | 481 |
| 351 | 3300006844 | Ga0075428_100145148 | Ga0075428_1001451483 | 481 |
| 352 | 3300009553 | Ga0105249_10009291 | Ga0105249_100092915 | 481 |
| 353 | 3300013105 | Ga0157369_10031554 | Ga0157369_100315545 | 481 |
| 354 | 3300025912 | Ga0207707_10006637 | Ga0207707_100066374 | 481 |
| 355 | 3300025917 | Ga0207660_10004934 | Ga0207660_100049343 | 481 |
| 356 | 3300025921 | Ga0207652_10008277 | Ga0207652_100082775 | 481 |
| 357 | 3300025933 | Ga0207706_10006002 | Ga0207706_100060029 | 481 |
| 358 | 3300025944 | Ga0207661_10002814 | Ga0207661_100028146 | 481 |
| 359 | 3300025972 | Ga0207668_10018553 | Ga0207668_100185533 | 481 |
| 360 | 3300026116 | Ga0207674_10164679 | Ga0207674_101646792 | 481 |
| 361 | 3300026118 | Ga0207675_100001704 | Ga0207675_1000017042 | 481 |
| 362 | 3300035691 | Ga0373931_0020416 | Ga0373931_0020416_1242_2702 | 481 |
| 363 | 3300038443 | Ga0395901_0213677 | Ga0395901_0213677_509_1969 | 481 |
| 364 | 3300049574 | Ga0501038_0133977 | Ga0501038_0133977_544_2016 | 481 |
| 365 | 3300049585 | Ga0501069_0089268 | Ga0501069_0089268_181_1653 | 481 |
| 366 | 3300049589 | Ga0501073_0029719 | Ga0501073_0029719_2240_3712 | 481 |
| 367 | 3300049590 | Ga0501074_0048043 | Ga0501074_0048043_1233_2705 | 481 |
| 368 | 3300049823 | Ga0501044_0087319 | Ga0501044_0087319_445_1917 | 481 |
| 369 | 3300050507 | nmdc:mga05p37_246215_c1 | nmdc:mga05p37_246215_c1_611_2068 | 481 |
| 370 | 3300054114 | Ga0501084_0043250 | Ga0501084_0043250_292_1764 | 481 |
| 371 | 3300005435 | Ga0070714_100064090 | Ga0070714_1000640903 | 482 |
| 372 | 3300005436 | Ga0070713_100022221 | Ga0070713_1000222213 | 482 |
| 373 | 3300005981 | Ga0081538_10000464 | Ga0081538_1000046425 | 482 |
| 374 | 3300009094 | Ga0111539_10040504 | Ga0111539_100405044 | 482 |
| 375 | 3300025915 | Ga0207693_10014455 | Ga0207693_100144554 | 482 |
| 376 | 3300026142 | Ga0207698_10120357 | Ga0207698_101203572 | 482 |
| 377 | 3300031901 | Ga0307406_10042399 | Ga0307406_100423992 | 482 |
| 378 | 3300049578 | Ga0501042_0112166 | Ga0501042_0112166_62_1525 | 482 |
| 379 | 3300050507 | nmdc:mga05p37_22716_c2 | nmdc:mga05p37_22716_c2_816_2279 | 482 |
| 380 | 3300050511 | nmdc:mga08y16_84929_c1 | nmdc:mga08y16_84929_c1_40_1503 | 482 |
| 381 | 3300003373 | JGI25407J50210_10002817 | JGI25407J50210_100028174 | 483 |
| 382 | 3300005617 | Ga0068859_100205402 | Ga0068859_1002054022 | 483 |
| 383 | 3300005981 | Ga0081538_10001367 | Ga0081538_1000136713 | 483 |
| 384 | 3300006847 | Ga0075431_100064714 | Ga0075431_1000647143 | 483 |
| 385 | 3300006931 | Ga0097620_100205407 | Ga0097620_1002054072 | 483 |
| 386 | 3300009093 | Ga0105240_10061141 | Ga0105240_100611412 | 483 |
| 387 | 3300013104 | Ga0157370_10012340 | Ga0157370_100123407 | 483 |
| 388 | 3300025914 | Ga0207671_10090654 | Ga0207671_100906542 | 483 |
| 389 | 3300026116 | Ga0207674_10257859 | Ga0207674_102578591 | 483 |
| 390 | 3300046514 | Ga0495618_0000478 | Ga0495618_0000478_16283_17854 | 483 |
| 391 | 3300050510 | nmdc:mga06r32_68265_c1 | nmdc:mga06r32_68265_c1_810_2315 | 483 |
| 392 | 3300005615 | Ga0070702_100047882 | Ga0070702_1000478822 | 484 |
| 393 | 3300005981 | Ga0081538_10046302 | Ga0081538_100463023 | 484 |
| 394 | 3300026075 | Ga0207708_10072952 | Ga0207708_100729523 | 484 |
| 395 | 3300031731 | Ga0307405_10060015 | Ga0307405_100600152 | 484 |
| 396 | 3300032126 | Ga0307415_100001872 | Ga0307415_1000018726 | 484 |
| 397 | 3300037312 | Ga0395899_0036378 | Ga0395899_0036378_1654_3129 | 484 |
| 398 | 3300037466 | Ga0395898_0023591 | Ga0395898_0023591_2992_4494 | 484 |
| 399 | 3300037466 | Ga0395898_0054637 | Ga0395898_0054637_1755_3230 | 484 |
| 400 | 3300037471 | Ga0395905_0048185 | Ga0395905_0048185_1213_2688 | 484 |
| 401 | 3300038443 | Ga0395901_0028513 | Ga0395901_0028513_1850_3325 | 484 |
| 402 | 3300048905 | Ga0496102_0000002 | Ga0496102_0000002_454107_455666 | 484 |
| 403 | 3300048906 | Ga0496103_0000017 | Ga0496103_0000017_47324_48883 | 484 |
| 404 | 3300048910 | Ga0496107_0154467 | Ga0496107_0154467_14_1489 | 484 |
| 405 | 3300049742 | Ga0501080_0008519 | Ga0501080_0008519_2380_3936 | 484 |
| 406 | 3300036712 | Ga0316584_0004124 | Ga0316584_0004124_6941_8476 | 485 |
| 407 | 3300037466 | Ga0395898_0111523 | Ga0395898_0111523_342_1847 | 485 |
| 408 | 3300044694 | Ga0466963_0106562 | Ga0466963_0106562_320_1810 | 485 |
| 409 | 3300044719 | Ga0466971_0019320 | Ga0466971_0019320_739_2223 | 485 |
| 410 | 3300044901 | Ga0466960_0000054 | Ga0466960_0000054_10716_12230 | 485 |
| 411 | 3300045976 | Ga0466967_0008361 | Ga0466967_0008361_3555_5075 | 485 |
| 412 | 3300046460 | Ga0495638_0015309 | Ga0495638_0015309_867_2381 | 485 |
| 413 | 3300046471 | Ga0495650_0000055 | Ga0495650_0000055_21090_22586 | 485 |
| 414 | 3300046511 | Ga0495608_0000068 | Ga0495608_0000068_28499_30004 | 485 |
| 415 | 3300046675 | Ga0495657_0000004 | Ga0495657_0000004_72248_73753 | 485 |
| 416 | 3300047444 | Ga0495675_0000107 | Ga0495675_0000107_26034_27539 | 485 |
| 417 | 3300048915 | Ga0496112_0016477 | Ga0496112_0016477_4735_6231 | 485 |
| 418 | 3300048924 | Ga0496121_0012140 | Ga0496121_0012140_3799_5319 | 485 |
| 419 | 3300050510 | nmdc:mga06r32_126845_c1 | nmdc:mga06r32_126845_c1_904_2376 | 485 |
| 420 | 3300053084 | Ga0495595_0000003 | Ga0495595_0000003_72248_73753 | 485 |
| 421 | 3300053085 | Ga0495619_0000106 | Ga0495619_0000106_32420_33925 | 485 |
| 422 | 3300053153 | Ga0500616_0009210 | Ga0500616_0009210_1808_3301 | 485 |
| 423 | 3300061719 | Ga0466962_0018114 | Ga0466962_0018114_1637_3121 | 485 |
| 424 | 3300005981 | Ga0081538_10004433 | Ga0081538_1000443310 | 486 |
| 425 | 3300006880 | Ga0075429_100080839 | Ga0075429_1000808392 | 486 |
| 426 | 3300025903 | Ga0207680_10050043 | Ga0207680_100500431 | 486 |
| 427 | 3300031852 | Ga0307410_10013468 | Ga0307410_100134684 | 486 |
| 428 | 3300050508 | nmdc:mga09592_59299_c1 | nmdc:mga09592_59299_c1_712_2208 | 486 |
| 429 | 3300005439 | Ga0070711_100076384 | Ga0070711_1000763842 | 487 |
| 430 | 3300005577 | Ga0068857_100062863 | Ga0068857_1000628632 | 487 |
| 431 | 3300005937 | Ga0081455_10026557 | Ga0081455_100265574 | 487 |
| 432 | 3300005981 | Ga0081538_10000671 | Ga0081538_1000067128 | 487 |
| 433 | 3300005981 | Ga0081538_10005710 | Ga0081538_100057106 | 487 |
| 434 | 3300025916 | Ga0207663_10058760 | Ga0207663_100587602 | 487 |
| 435 | 3300026116 | Ga0207674_10096118 | Ga0207674_100961183 | 487 |
| 436 | 3300046477 | Ga0495664_0000007 | Ga0495664_0000007_337263_338870 | 487 |
| 437 | 3300046680 | Ga0495646_0030054 | Ga0495646_0030054_1147_2643 | 487 |
| 438 | 3300047317 | Ga0495604_0000824 | Ga0495604_0000824_3138_4634 | 487 |
| 439 | 3300048918 | Ga0496115_0000121 | Ga0496115_0000121_19851_21401 | 487 |
| 440 | 3300049592 | Ga0501076_0020736 | Ga0501076_0020736_807_2282 | 487 |
| 441 | 3300049743 | Ga0501081_0039587 | Ga0501081_0039587_973_2448 | 487 |
| 442 | 3300005329 | Ga0070683_100014931 | Ga0070683_1000149314 | 488 |
| 443 | 3300005435 | Ga0070714_100114738 | Ga0070714_1001147383 | 488 |
| 444 | 3300005437 | Ga0070710_10040070 | Ga0070710_100400702 | 488 |
| 445 | 3300005981 | Ga0081538_10016644 | Ga0081538_100166444 | 488 |
| 446 | 3300006028 | Ga0070717_10099897 | Ga0070717_100998972 | 488 |
| 447 | 3300025898 | Ga0207692_10063646 | Ga0207692_100636462 | 488 |
| 448 | 3300041451 | Ga0451791_0552643 | Ga0451791_0552643_774_2255 | 488 |
| 449 | 3300049572 | Ga0501036_0039770 | Ga0501036_0039770_2064_3545 | 488 |
| 450 | 3300049575 | Ga0501039_0008934 | Ga0501039_0008934_3659_5140 | 488 |
| 451 | 3300061734 | Ga0530510_0082617 | Ga0530510_0082617_311_1792 | 488 |
| 452 | 3300028563 | Ga0265319_1000015 | Ga0265319_100001563 | 489 |
| 453 | 3300039437 | Ga0436365_1238206 | Ga0436365_1238206_1420_2955 | 489 |
| 454 | 3300044842 | Ga0466957_0007031 | Ga0466957_0007031_47_1582 | 489 |
| 455 | 3300045049 | Ga0466959_0012882 | Ga0466959_0012882_845_2380 | 489 |
| 456 | 3300045836 | Ga0466958_0001164 | Ga0466958_0001164_6493_8028 | 489 |
| 457 | 3300045976 | Ga0466967_0021311 | Ga0466967_0021311_188_1723 | 489 |
| 458 | 3300048918 | Ga0496115_0000075 | Ga0496115_0000075_36805_38421 | 489 |
| 459 | 3300005842 | Ga0068858_100044814 | Ga0068858_1000448143 | 490 |
| 460 | 3300005981 | Ga0081538_10001796 | Ga0081538_1000179612 | 490 |
| 461 | 3300006881 | Ga0068865_100122247 | Ga0068865_1001222472 | 490 |
| 462 | 3300009148 | Ga0105243_10061148 | Ga0105243_100611482 | 490 |
| 463 | 3300025901 | Ga0207688_10010122 | Ga0207688_100101224 | 490 |
| 464 | 3300025924 | Ga0207694_10050210 | Ga0207694_100502103 | 490 |
| 465 | 3300025933 | Ga0207706_10046641 | Ga0207706_100466413 | 490 |
| 466 | 3300025935 | Ga0207709_10034179 | Ga0207709_100341793 | 490 |
| 467 | 3300025942 | Ga0207689_10075688 | Ga0207689_100756882 | 490 |
| 468 | 3300026075 | Ga0207708_10033916 | Ga0207708_100339163 | 490 |
| 469 | 3300027907 | Ga0207428_10134202 | Ga0207428_101342022 | 490 |
| 470 | 3300044842 | Ga0466957_0097389 | Ga0466957_0097389_251_1744 | 490 |
| 471 | 3300046529 | Ga0495652_0000019 | Ga0495652_0000019_37011_38528 | 490 |
| 472 | 3300048911 | Ga0496108_0025893 | Ga0496108_0025893_366_1889 | 490 |
| 473 | 3300048913 | Ga0496110_0108325 | Ga0496110_0108325_598_2121 | 490 |
| 474 | 3300048916 | Ga0496113_0098660 | Ga0496113_0098660_495_2018 | 490 |
| 475 | 3300049572 | Ga0501036_0076136 | Ga0501036_0076136_403_1977 | 490 |
| 476 | 3300049574 | Ga0501038_0119381 | Ga0501038_0119381_354_1928 | 490 |
| 477 | 3300049576 | Ga0501040_0020937 | Ga0501040_0020937_828_2402 | 490 |
| 478 | 3300049590 | Ga0501074_0021021 | Ga0501074_0021021_1133_2707 | 490 |
| 479 | 3300049591 | Ga0501075_0016242 | Ga0501075_0016242_3659_5233 | 490 |
| 480 | 3300049741 | Ga0501079_0052330 | Ga0501079_0052330_1262_2836 | 490 |
| 481 | 3300054114 | Ga0501084_0014400 | Ga0501084_0014400_4239_5813 | 490 |
| 482 | 3300006163 | Ga0070715_10000001 | Ga0070715_10000001268 | 491 |
| 483 | 3300006175 | Ga0070712_100159453 | Ga0070712_1001594532 | 491 |
| 484 | 3300025905 | Ga0207685_10000036 | Ga0207685_1000003655 | 491 |
| 485 | 3300032126 | Ga0307415_100032167 | Ga0307415_1000321672 | 491 |
| 486 | 3300037418 | Ga0395900_0015469 | Ga0395900_0015469_2784_4286 | 491 |
| 487 | 3300037466 | Ga0395898_0007626 | Ga0395898_0007626_9490_10992 | 491 |
| 488 | 3300044765 | Ga0466970_0077622 | Ga0466970_0077622_178_1680 | 491 |
| 489 | 3300045049 | Ga0466959_0004535 | Ga0466959_0004535_3650_5152 | 491 |
| 490 | 3300053085 | Ga0495619_0002472 | Ga0495619_0002472_7839_9371 | 491 |
| 491 | 3300005436 | Ga0070713_100019536 | Ga0070713_1000195366 | 492 |
| 492 | 3300005981 | Ga0081538_10004837 | Ga0081538_100048375 | 492 |
| 493 | 3300005981 | Ga0081538_10007479 | Ga0081538_100074798 | 492 |
| 494 | 3300025928 | Ga0207700_10014327 | Ga0207700_100143272 | 492 |
| 495 | 3300028563 | Ga0265319_1002445 | Ga0265319_10024455 | 492 |
| 496 | 3300028577 | Ga0265318_10001571 | Ga0265318_1000157113 | 492 |
| 497 | 3300028800 | Ga0265338_10048163 | Ga0265338_100481632 | 492 |
| 498 | 3300031240 | Ga0265320_10005211 | Ga0265320_100052116 | 492 |
| 499 | 3300042876 | Ga0451577_0015034 | Ga0451577_0015034_5033_6586 | 492 |
| 500 | 3300044712 | Ga0453684_0002840 | Ga0453684_0002840_14426_15979 | 492 |
| 501 | 3300046515 | Ga0495620_0000144 | Ga0495620_0000144_36779_38296 | 492 |
| 502 | 3300046543 | Ga0495645_0000051 | Ga0495645_0000051_16698_18296 | 492 |
| 503 | 3300050515 | nmdc:mga0a205_189767_c1 | nmdc:mga0a205_189767_c1_46_1569 | 492 |
| 504 | 3300003373 | JGI25407J50210_10001803 | JGI25407J50210_100018034 | 493 |
| 505 | 3300005981 | Ga0081538_10003478 | Ga0081538_100034788 | 493 |
| 506 | 3300005981 | Ga0081538_10013656 | Ga0081538_100136564 | 493 |
| 507 | 3300005981 | Ga0081538_10014112 | Ga0081538_100141123 | 493 |
| 508 | 3300005981 | Ga0081538_10021826 | Ga0081538_100218264 | 493 |
| 509 | 3300005981 | Ga0081538_10067849 | Ga0081538_100678492 | 493 |
| 510 | 3300006847 | Ga0075431_100005144 | Ga0075431_10000514412 | 493 |
| 511 | 3300028563 | Ga0265319_1000025 | Ga0265319_100002531 | 493 |
| 512 | 3300028563 | Ga0265319_1004984 | Ga0265319_10049844 | 493 |
| 513 | 3300028800 | Ga0265338_10000473 | Ga0265338_1000047346 | 493 |
| 514 | 3300031241 | Ga0265325_10006013 | Ga0265325_100060137 | 493 |
| 515 | 3300031250 | Ga0265331_10019616 | Ga0265331_100196163 | 493 |
| 516 | 3300031251 | Ga0265327_10008104 | Ga0265327_100081043 | 493 |
| 517 | 3300037068 | Ga0373925_0046514 | Ga0373925_0046514_588_2123 | 493 |
| 518 | 3300047321 | Ga0495676_0058227 | Ga0495676_0058227_1342_2877 | 493 |
| 519 | 3300050508 | nmdc:mga09592_6374_c1 | nmdc:mga09592_6374_c1_5240_6742 | 493 |
| 520 | 3300053085 | Ga0495619_0035066 | Ga0495619_0035066_1433_2989 | 493 |
| 521 | 3300005981 | Ga0081538_10001716 | Ga0081538_1000171615 | 494 |
| 522 | 3300006051 | Ga0075364_10098454 | Ga0075364_100984541 | 494 |
| 523 | 3300025944 | Ga0207661_10075262 | Ga0207661_100752623 | 494 |
| 524 | 3300028556 | Ga0265337_1006811 | Ga0265337_10068112 | 494 |
| 525 | 3300028563 | Ga0265319_1000144 | Ga0265319_100014419 | 494 |
| 526 | 3300028577 | Ga0265318_10002150 | Ga0265318_100021505 | 494 |
| 527 | 3300028666 | Ga0265336_10000002 | Ga0265336_10000002417 | 494 |
| 528 | 3300028800 | Ga0265338_10000001 | Ga0265338_10000001396 | 494 |
| 529 | 3300031247 | Ga0265340_10000001 | Ga0265340_10000001395 | 494 |
| 530 | 3300031249 | Ga0265339_10023212 | Ga0265339_100232125 | 494 |
| 531 | 3300031344 | Ga0265316_10083107 | Ga0265316_100831072 | 494 |
| 532 | 3300036401 | Ga0373937_0043006 | Ga0373937_0043006_1292_2800 | 494 |
| 533 | 3300037418 | Ga0395900_0304740 | Ga0395900_0304740_32_1519 | 494 |
| 534 | 3300037466 | Ga0395898_0037026 | Ga0395898_0037026_2321_3808 | 494 |
| 535 | 3300044694 | Ga0466963_0000273 | Ga0466963_0000273_2983_4719 | 494 |
| 536 | 3300046511 | Ga0495608_0000294 | Ga0495608_0000294_33107_34615 | 494 |
| 537 | 3300046514 | Ga0495618_0006493 | Ga0495618_0006493_4029_5537 | 494 |
| 538 | 3300046516 | Ga0495628_0043822 | Ga0495628_0043822_1026_2534 | 494 |
| 539 | 3300046529 | Ga0495652_0031934 | Ga0495652_0031934_2202_3710 | 494 |
| 540 | 3300046533 | Ga0495640_0019226 | Ga0495640_0019226_1252_2760 | 494 |
| 541 | 3300046536 | Ga0495587_0013955 | Ga0495587_0013955_1683_3191 | 494 |
| 542 | 3300046559 | Ga0495667_0007846 | Ga0495667_0007846_2111_3619 | 494 |
| 543 | 3300046642 | Ga0495634_0013196 | Ga0495634_0013196_1292_2800 | 494 |
| 544 | 3300046663 | Ga0495635_0008356 | Ga0495635_0008356_1297_2805 | 494 |
| 545 | 3300046680 | Ga0495646_0029254 | Ga0495646_0029254_1032_2540 | 494 |
| 546 | 3300046809 | Ga0495600_0018373 | Ga0495600_0018373_1918_3426 | 494 |
| 547 | 3300047317 | Ga0495604_0000917 | Ga0495604_0000917_21760_23268 | 494 |
| 548 | 3300047319 | Ga0495674_0014198 | Ga0495674_0014198_913_2421 | 494 |
| 549 | 3300047471 | Ga0495684_0062533 | Ga0495684_0062533_1301_2809 | 494 |
| 550 | 3300048088 | Ga0495602_0025389 | Ga0495602_0025389_3046_4554 | 494 |
| 551 | 3300048916 | Ga0496113_0164147 | Ga0496113_0164147_201_1709 | 494 |
| 552 | 3300005329 | Ga0070683_100116675 | Ga0070683_1001166752 | 495 |
| 553 | 3300005353 | Ga0070669_100005033 | Ga0070669_1000050336 | 495 |
| 554 | 3300005366 | Ga0070659_100000030 | Ga0070659_10000003084 | 495 |
| 555 | 3300005366 | Ga0070659_100113105 | Ga0070659_1001131052 | 495 |
| 556 | 3300005435 | Ga0070714_100000228 | Ga0070714_10000022815 | 495 |
| 557 | 3300005437 | Ga0070710_10000009 | Ga0070710_10000009125 | 495 |
| 558 | 3300005614 | Ga0068856_100081832 | Ga0068856_1000818322 | 495 |
| 559 | 3300005937 | Ga0081455_10036852 | Ga0081455_100368522 | 495 |
| 560 | 3300005983 | Ga0081540_1026139 | Ga0081540_10261394 | 495 |
| 561 | 3300005985 | Ga0081539_10018233 | Ga0081539_100182337 | 495 |
| 562 | 3300006175 | Ga0070712_100004441 | Ga0070712_1000044414 | 495 |
| 563 | 3300006914 | Ga0075436_100092306 | Ga0075436_1000923062 | 495 |
| 564 | 3300014969 | Ga0157376_10013180 | Ga0157376_100131802 | 495 |
| 565 | 3300021388 | Ga0213875_10000095 | Ga0213875_1000009537 | 495 |
| 566 | 3300025898 | Ga0207692_10000005 | Ga0207692_10000005202 | 495 |
| 567 | 3300025901 | Ga0207688_10032304 | Ga0207688_100323043 | 495 |
| 568 | 3300025916 | Ga0207663_10065905 | Ga0207663_100659052 | 495 |
| 569 | 3300025923 | Ga0207681_10011629 | Ga0207681_100116295 | 495 |
| 570 | 3300025927 | Ga0207687_10043291 | Ga0207687_100432914 | 495 |
| 571 | 3300025929 | Ga0207664_10000060 | Ga0207664_1000006015 | 495 |
| 572 | 3300025932 | Ga0207690_10000094 | Ga0207690_1000009467 | 495 |
| 573 | 3300025932 | Ga0207690_10083172 | Ga0207690_100831722 | 495 |
| 574 | 3300028558 | Ga0265326_10000024 | Ga0265326_1000002498 | 495 |
| 575 | 3300028573 | Ga0265334_10000151 | Ga0265334_1000015130 | 495 |
| 576 | 3300028666 | Ga0265336_10000622 | Ga0265336_1000062213 | 495 |
| 577 | 3300028800 | Ga0265338_10036287 | Ga0265338_100362872 | 495 |
| 578 | 3300031251 | Ga0265327_10011730 | Ga0265327_100117303 | 495 |
| 579 | 3300037853 | Ga0436364_1294613 | Ga0436364_1294613_63677_65212 | 495 |
| 580 | 3300038443 | Ga0395901_0119765 | Ga0395901_0119765_186_1694 | 495 |
| 581 | 3300044694 | Ga0466963_0026609 | Ga0466963_0026609_196_1737 | 495 |
| 582 | 3300045836 | Ga0466958_0076320 | Ga0466958_0076320_274_1815 | 495 |
| 583 | 3300045976 | Ga0466967_0013660 | Ga0466967_0013660_2241_3749 | 495 |
| 584 | 3300046694 | Ga0495649_0001624 | Ga0495649_0001624_11580_13115 | 495 |
| 585 | 3300048903 | Ga0496100_0005719 | Ga0496100_0005719_4909_6417 | 495 |
| 586 | 3300048904 | Ga0496101_0003568 | Ga0496101_0003568_7805_9313 | 495 |
| 587 | 3300048905 | Ga0496102_0029803 | Ga0496102_0029803_2827_4335 | 495 |
| 588 | 3300048907 | Ga0496104_0116657 | Ga0496104_0116657_371_1879 | 495 |
| 589 | 3300048908 | Ga0496105_0153315 | Ga0496105_0153315_96_1604 | 495 |
| 590 | 3300048910 | Ga0496107_0033560 | Ga0496107_0033560_1608_3116 | 495 |
| 591 | 3300048911 | Ga0496108_0000747 | Ga0496108_0000747_5496_7004 | 495 |
| 592 | 3300048912 | Ga0496109_0002916 | Ga0496109_0002916_11899_13407 | 495 |
| 593 | 3300048912 | Ga0496109_0004496 | Ga0496109_0004496_4742_6325 | 495 |
| 594 | 3300048913 | Ga0496110_0002594 | Ga0496110_0002594_7363_8871 | 495 |
| 595 | 3300048913 | Ga0496110_0013117 | Ga0496110_0013117_385_1893 | 495 |
| 596 | 3300048914 | Ga0496111_0016015 | Ga0496111_0016015_3011_4519 | 495 |
| 597 | 3300048915 | Ga0496112_0203834 | Ga0496112_0203834_402_1910 | 495 |
| 598 | 3300048916 | Ga0496113_0028372 | Ga0496113_0028372_642_2192 | 495 |
| 599 | 3300050508 | nmdc:mga09592_5985_c1 | nmdc:mga09592_5985_c1_879_2429 | 495 |
| 600 | 3300050511 | nmdc:mga08y16_173159_c1 | nmdc:mga08y16_173159_c1_300_1817 | 495 |
| 601 | 3300050514 | nmdc:mga08x19_55413_c1 | nmdc:mga08x19_55413_c1_305_1867 | 495 |
| 602 | 3300053078 | Ga0495612_0000136 | Ga0495612_0000136_18117_19802 | 495 |
| 603 | 3300005337 | Ga0070682_100003538 | Ga0070682_1000035389 | 496 |
| 604 | 3300005366 | Ga0070659_100033746 | Ga0070659_1000337462 | 496 |
| 605 | 3300005435 | Ga0070714_100001436 | Ga0070714_10000143613 | 496 |
| 606 | 3300005436 | Ga0070713_100102944 | Ga0070713_1001029442 | 496 |
| 607 | 3300005437 | Ga0070710_10031211 | Ga0070710_100312111 | 496 |
| 608 | 3300005441 | Ga0070700_100001344 | Ga0070700_1000013442 | 496 |
| 609 | 3300005535 | Ga0070684_100001766 | Ga0070684_1000017663 | 496 |
| 610 | 3300005564 | Ga0070664_100015011 | Ga0070664_1000150112 | 496 |
| 611 | 3300005614 | Ga0068856_100039508 | Ga0068856_1000395083 | 496 |
| 612 | 3300005618 | Ga0068864_100047347 | Ga0068864_1000473473 | 496 |
| 613 | 3300006028 | Ga0070717_10012533 | Ga0070717_100125332 | 496 |
| 614 | 3300006028 | Ga0070717_10090410 | Ga0070717_100904102 | 496 |
| 615 | 3300006038 | Ga0075365_10035119 | Ga0075365_100351192 | 496 |
| 616 | 3300006175 | Ga0070712_100000003 | Ga0070712_10000000384 | 496 |
| 617 | 3300006175 | Ga0070712_100025707 | Ga0070712_1000257073 | 496 |
| 618 | 3300006847 | Ga0075431_100026586 | Ga0075431_1000265863 | 496 |
| 619 | 3300006852 | Ga0075433_10045006 | Ga0075433_100450063 | 496 |
| 620 | 3300009094 | Ga0111539_10014997 | Ga0111539_100149977 | 496 |
| 621 | 3300009098 | Ga0105245_10014206 | Ga0105245_100142064 | 496 |
| 622 | 3300009177 | Ga0105248_10117921 | Ga0105248_101179213 | 496 |
| 623 | 3300013296 | Ga0157374_10005737 | Ga0157374_100057376 | 496 |
| 624 | 3300013307 | Ga0157372_10007044 | Ga0157372_100070446 | 496 |
| 625 | 3300014325 | Ga0163163_10024319 | Ga0163163_100243192 | 496 |
| 626 | 3300014326 | Ga0157380_10095379 | Ga0157380_100953792 | 496 |
| 627 | 3300014969 | Ga0157376_10125257 | Ga0157376_101252572 | 496 |
| 628 | 3300021377 | Ga0213874_10000263 | Ga0213874_100002635 | 496 |
| 629 | 3300021377 | Ga0213874_10006555 | Ga0213874_100065552 | 496 |
| 630 | 3300021384 | Ga0213876_10004900 | Ga0213876_100049004 | 496 |
| 631 | 3300025898 | Ga0207692_10049620 | Ga0207692_100496202 | 496 |
| 632 | 3300025901 | Ga0207688_10000574 | Ga0207688_1000057420 | 496 |
| 633 | 3300025915 | Ga0207693_10000028 | Ga0207693_100000288 | 496 |
| 634 | 3300025915 | Ga0207693_10001165 | Ga0207693_1000116520 | 496 |
| 635 | 3300025929 | Ga0207664_10005856 | Ga0207664_100058562 | 496 |
| 636 | 3300025929 | Ga0207664_10030175 | Ga0207664_100301754 | 496 |
| 637 | 3300025933 | Ga0207706_10010294 | Ga0207706_100102947 | 496 |
| 638 | 3300025945 | Ga0207679_10009479 | Ga0207679_100094796 | 496 |
| 639 | 3300026067 | Ga0207678_10072220 | Ga0207678_100722203 | 496 |
| 640 | 3300026075 | Ga0207708_10001047 | Ga0207708_1000104716 | 496 |
| 641 | 3300026078 | Ga0207702_10077475 | Ga0207702_100774753 | 496 |
| 642 | 3300028380 | Ga0268265_10059034 | Ga0268265_100590342 | 496 |
| 643 | 3300036401 | Ga0373937_0018464 | Ga0373937_0018464_3665_5203 | 496 |
| 644 | 3300037466 | Ga0395898_0134855 | Ga0395898_0134855_802_2337 | 496 |
| 645 | 3300037853 | Ga0436364_0121330 | Ga0436364_0121330_2065_3600 | 496 |
| 646 | 3300037853 | Ga0436364_0349017 | Ga0436364_0349017_633_2168 | 496 |
| 647 | 3300039437 | Ga0436365_0254126 | Ga0436365_0254126_28754_30289 | 496 |
| 648 | 3300039437 | Ga0436365_0388687 | Ga0436365_0388687_6181_7716 | 496 |
| 649 | 3300039437 | Ga0436365_1029997 | Ga0436365_1029997_231_1772 | 496 |
| 650 | 3300039437 | Ga0436365_1102419 | Ga0436365_1102419_2747_4285 | 496 |
| 651 | 3300039450 | Ga0436363_0365326 | Ga0436363_0365326_5164_6699 | 496 |
| 652 | 3300039450 | Ga0436363_1063131 | Ga0436363_1063131_7067_8608 | 496 |
| 653 | 3300044693 | Ga0466961_0010521 | Ga0466961_0010521_267_1811 | 496 |
| 654 | 3300044693 | Ga0466961_0013029 | Ga0466961_0013029_1698_3236 | 496 |
| 655 | 3300044719 | Ga0466971_0001423 | Ga0466971_0001423_2570_4108 | 496 |
| 656 | 3300044765 | Ga0466970_0060600 | Ga0466970_0060600_322_1854 | 496 |
| 657 | 3300044842 | Ga0466957_0027178 | Ga0466957_0027178_340_1878 | 496 |
| 658 | 3300044842 | Ga0466957_0083582 | Ga0466957_0083582_428_1966 | 496 |
| 659 | 3300044901 | Ga0466960_0014856 | Ga0466960_0014856_169_1680 | 496 |
| 660 | 3300045049 | Ga0466959_0002079 | Ga0466959_0002079_10739_12280 | 496 |
| 661 | 3300045049 | Ga0466959_0085246 | Ga0466959_0085246_655_2226 | 496 |
| 662 | 3300045836 | Ga0466958_0026049 | Ga0466958_0026049_985_2523 | 496 |
| 663 | 3300045836 | Ga0466958_0103608 | Ga0466958_0103608_18_1559 | 496 |
| 664 | 3300046511 | Ga0495608_0003047 | Ga0495608_0003047_6765_8303 | 496 |
| 665 | 3300046559 | Ga0495667_0004076 | Ga0495667_0004076_3672_5210 | 496 |
| 666 | 3300046663 | Ga0495635_0009815 | Ga0495635_0009815_2276_3814 | 496 |
| 667 | 3300047319 | Ga0495674_0033320 | Ga0495674_0033320_893_2431 | 496 |
| 668 | 3300048903 | Ga0496100_0000463 | Ga0496100_0000463_16725_18260 | 496 |
| 669 | 3300048904 | Ga0496101_0001372 | Ga0496101_0001372_7287_8822 | 496 |
| 670 | 3300048905 | Ga0496102_0115856 | Ga0496102_0115856_840_2354 | 496 |
| 671 | 3300048908 | Ga0496105_0134719 | Ga0496105_0134719_480_1994 | 496 |
| 672 | 3300048908 | Ga0496105_0144987 | Ga0496105_0144987_44_1582 | 496 |
| 673 | 3300048910 | Ga0496107_0032767 | Ga0496107_0032767_2166_3680 | 496 |
| 674 | 3300048912 | Ga0496109_0079598 | Ga0496109_0079598_1035_2549 | 496 |
| 675 | 3300048914 | Ga0496111_0052833 | Ga0496111_0052833_1179_2696 | 496 |
| 676 | 3300048914 | Ga0496111_0114457 | Ga0496111_0114457_346_1860 | 496 |
| 677 | 3300048915 | Ga0496112_0072829 | Ga0496112_0072829_1288_2826 | 496 |
| 678 | 3300048916 | Ga0496113_0024605 | Ga0496113_0024605_303_1817 | 496 |
| 679 | 3300048918 | Ga0496115_0082399 | Ga0496115_0082399_201_1715 | 496 |
| 680 | 3300050507 | nmdc:mga05p37_162575_c1 | nmdc:mga05p37_162575_c1_577_2112 | 496 |
| 681 | 3300050512 | nmdc:mga0n895_28347_c1 | nmdc:mga0n895_28347_c1_2119_3654 | 496 |
| 682 | 3300050515 | nmdc:mga0a205_67562_c1 | nmdc:mga0a205_67562_c1_1694_3229 | 496 |
| 683 | 3300061719 | Ga0466962_0003445 | Ga0466962_0003445_3943_5481 | 496 |
| 684 | 3300005614 | Ga0068856_100021907 | Ga0068856_1000219075 | 497 |
| 685 | 3300009545 | Ga0105237_10001661 | Ga0105237_100016616 | 497 |
| 686 | 3300025912 | Ga0207707_10042359 | Ga0207707_100423592 | 497 |
| 687 | 3300025914 | Ga0207671_10002660 | Ga0207671_1000266023 | 497 |
| 688 | 3300039450 | Ga0436363_1120367 | Ga0436363_1120367_525_2063 | 497 |
| 689 | 3300044684 | Ga0466966_0011260 | Ga0466966_0011260_1141_2691 | 497 |
| 690 | 3300044694 | Ga0466963_0001551 | Ga0466963_0001551_8966_10519 | 497 |
| 691 | 3300045049 | Ga0466959_0050370 | Ga0466959_0050370_1441_2991 | 497 |
| 692 | 3300046463 | Ga0495653_0000718 | Ga0495653_0000718_19209_20852 | 497 |
| 693 | 3300046543 | Ga0495645_0000558 | Ga0495645_0000558_8686_10269 | 497 |
| 694 | 3300047319 | Ga0495674_0119007 | Ga0495674_0119007_430_1926 | 497 |
| 695 | 3300047471 | Ga0495684_0006217 | Ga0495684_0006217_5582_7174 | 497 |
| 696 | 3300048906 | Ga0496103_0100974 | Ga0496103_0100974_134_1669 | 497 |
| 697 | 3300048915 | Ga0496112_0017549 | Ga0496112_0017549_744_2285 | 497 |
| 698 | 3300049585 | Ga0501069_0034529 | Ga0501069_0034529_77_1621 | 497 |
| 699 | 3300049586 | Ga0501070_0167828 | Ga0501070_0167828_225_1769 | 497 |
| 700 | 3300053078 | Ga0495612_0000312 | Ga0495612_0000312_4637_6133 | 497 |
| 701 | 3300005435 | Ga0070714_100003341 | Ga0070714_1000033419 | 498 |
| 702 | 3300005439 | Ga0070711_100011026 | Ga0070711_1000110265 | 498 |
| 703 | 3300006175 | Ga0070712_100003339 | Ga0070712_1000033395 | 498 |
| 704 | 3300006871 | Ga0075434_100003679 | Ga0075434_10000367910 | 498 |
| 705 | 3300009147 | Ga0114129_10008963 | Ga0114129_100089632 | 498 |
| 706 | 3300021384 | Ga0213876_10018870 | Ga0213876_100188704 | 498 |
| 707 | 3300025915 | Ga0207693_10008453 | Ga0207693_100084533 | 498 |
| 708 | 3300025929 | Ga0207664_10050301 | Ga0207664_100503012 | 498 |
| 709 | 3300025937 | Ga0207669_10025626 | Ga0207669_100256262 | 498 |
| 710 | 3300026089 | Ga0207648_10056680 | Ga0207648_100566802 | 498 |
| 711 | 3300031727 | Ga0316576_10035815 | Ga0316576_100358152 | 498 |
| 712 | 3300037853 | Ga0436364_0765160 | Ga0436364_0765160_20_1567 | 498 |
| 713 | 3300039437 | Ga0436365_0911509 | Ga0436365_0911509_645_2192 | 498 |
| 714 | 3300039437 | Ga0436365_1799679 | Ga0436365_1799679_7024_8571 | 498 |
| 715 | 3300045976 | Ga0466967_0019009 | Ga0466967_0019009_763_2307 | 498 |
| 716 | 3300045976 | Ga0466967_0041969 | Ga0466967_0041969_523_2043 | 498 |
| 717 | 3300045976 | Ga0466967_0102242 | Ga0466967_0102242_747_2291 | 498 |
| 718 | 3300046517 | Ga0495630_0003283 | Ga0495630_0003283_8683_10311 | 498 |
| 719 | 3300046675 | Ga0495657_0000013 | Ga0495657_0000013_83754_85382 | 498 |
| 720 | 3300050507 | nmdc:mga05p37_14337_c1 | nmdc:mga05p37_14337_c1_497_2068 | 498 |
| 721 | 3300050512 | nmdc:mga0n895_2605_c1 | nmdc:mga0n895_2605_c1_12042_13613 | 498 |
| 722 | 3300005937 | Ga0081455_10019018 | Ga0081455_100190182 | 499 |
| 723 | 3300009147 | Ga0114129_10168988 | Ga0114129_101689882 | 499 |
| 724 | 3300035115 | Ga0373941_0001018 | Ga0373941_0001018_3584_5131 | 499 |
| 725 | 3300037853 | Ga0436364_0412746 | Ga0436364_0412746_96_1655 | 499 |
| 726 | 3300039437 | Ga0436365_0947003 | Ga0436365_0947003_1191_2750 | 499 |
| 727 | 3300046663 | Ga0495635_0000016 | Ga0495635_0000016_127223_128725 | 499 |
| 728 | 3300047472 | Ga0495686_0001936 | Ga0495686_0001936_15962_17497 | 499 |
| 729 | 3300050492 | nmdc:mga0yw44_72501_c1 | nmdc:mga0yw44_72501_c1_415_1917 | 499 |
| 730 | 3300005530 | Ga0070679_100063537 | Ga0070679_1000635372 | 500 |
| 731 | 3300005614 | Ga0068856_100000577 | Ga0068856_10000057734 | 500 |
| 732 | 3300005981 | Ga0081538_10000066 | Ga0081538_1000006623 | 500 |
| 733 | 3300006846 | Ga0075430_100046313 | Ga0075430_1000463133 | 500 |
| 734 | 3300006880 | Ga0075429_100002308 | Ga0075429_1000023083 | 500 |
| 735 | 3300009098 | Ga0105245_10193181 | Ga0105245_101931812 | 500 |
| 736 | 3300026078 | Ga0207702_10000060 | Ga0207702_1000006068 | 500 |
| 737 | 3300046461 | Ga0495641_0000244 | Ga0495641_0000244_12564_14114 | 500 |
| 738 | 3300049590 | Ga0501074_0026492 | Ga0501074_0026492_2017_3570 | 500 |
| 739 | 3300050508 | nmdc:mga09592_148082_c1 | nmdc:mga09592_148082_c1_115_1665 | 500 |
| 740 | 3300002074 | JGI24748J21848_1001590 | JGI24748J21848_10015902 | 501 |
| 741 | 3300002239 | JGI24034J26672_10000104 | JGI24034J26672_1000010414 | 501 |
| 742 | 3300005327 | Ga0070658_10004160 | Ga0070658_100041605 | 501 |
| 743 | 3300005329 | Ga0070683_100034666 | Ga0070683_1000346664 | 501 |
| 744 | 3300005337 | Ga0070682_100000045 | Ga0070682_100000045103 | 501 |
| 745 | 3300005339 | Ga0070660_100016628 | Ga0070660_1000166283 | 501 |
| 746 | 3300005340 | Ga0070689_100049457 | Ga0070689_1000494572 | 501 |
| 747 | 3300005341 | Ga0070691_10008221 | Ga0070691_100082214 | 501 |
| 748 | 3300005344 | Ga0070661_100128955 | Ga0070661_1001289552 | 501 |
| 749 | 3300005345 | Ga0070692_10019194 | Ga0070692_100191943 | 501 |
| 750 | 3300005354 | Ga0070675_100015766 | Ga0070675_1000157662 | 501 |
| 751 | 3300005364 | Ga0070673_100006213 | Ga0070673_1000062138 | 501 |
| 752 | 3300005441 | Ga0070700_100004038 | Ga0070700_1000040384 | 501 |
| 753 | 3300005539 | Ga0068853_100011850 | Ga0068853_1000118506 | 501 |
| 754 | 3300005539 | Ga0068853_100050807 | Ga0068853_1000508074 | 501 |
| 755 | 3300005549 | Ga0070704_100067316 | Ga0070704_1000673162 | 501 |
| 756 | 3300005564 | Ga0070664_100019724 | Ga0070664_1000197245 | 501 |
| 757 | 3300005614 | Ga0068856_100082799 | Ga0068856_1000827993 | 501 |
| 758 | 3300005616 | Ga0068852_100000184 | Ga0068852_1000001849 | 501 |
| 759 | 3300005616 | Ga0068852_100007961 | Ga0068852_1000079612 | 501 |
| 760 | 3300005834 | Ga0068851_10018437 | Ga0068851_100184372 | 501 |
| 761 | 3300005840 | Ga0068870_10038670 | Ga0068870_100386703 | 501 |
| 762 | 3300006038 | Ga0075365_10028757 | Ga0075365_100287573 | 501 |
| 763 | 3300006038 | Ga0075365_10034216 | Ga0075365_100342162 | 501 |
| 764 | 3300006175 | Ga0070712_100014909 | Ga0070712_1000149092 | 501 |
| 765 | 3300006178 | Ga0075367_10073065 | Ga0075367_100730652 | 501 |
| 766 | 3300006847 | Ga0075431_100000075 | Ga0075431_10000007512 | 501 |
| 767 | 3300006871 | Ga0075434_100003025 | Ga0075434_1000030254 | 501 |
| 768 | 3300009094 | Ga0111539_10011787 | Ga0111539_100117873 | 501 |
| 769 | 3300009094 | Ga0111539_10044673 | Ga0111539_100446733 | 501 |
| 770 | 3300009094 | Ga0111539_10176543 | Ga0111539_101765432 | 501 |
| 771 | 3300009148 | Ga0105243_10009266 | Ga0105243_100092665 | 501 |
| 772 | 3300009551 | Ga0105238_10205639 | Ga0105238_102056392 | 501 |
| 773 | 3300010375 | Ga0105239_10075213 | Ga0105239_100752133 | 501 |
| 774 | 3300013307 | Ga0157372_10000129 | Ga0157372_1000012949 | 501 |
| 775 | 3300013307 | Ga0157372_10163531 | Ga0157372_101635313 | 501 |
| 776 | 3300013308 | Ga0157375_10013338 | Ga0157375_100133385 | 501 |
| 777 | 3300021388 | Ga0213875_10029251 | Ga0213875_100292512 | 501 |
| 778 | 3300025321 | Ga0207656_10005030 | Ga0207656_100050302 | 501 |
| 779 | 3300025901 | Ga0207688_10005824 | Ga0207688_100058245 | 501 |
| 780 | 3300025909 | Ga0207705_10060566 | Ga0207705_100605661 | 501 |
| 781 | 3300025915 | Ga0207693_10001560 | Ga0207693_1000156016 | 501 |
| 782 | 3300025919 | Ga0207657_10000895 | Ga0207657_1000089530 | 501 |
| 783 | 3300025932 | Ga0207690_10047230 | Ga0207690_100472301 | 501 |
| 784 | 3300025938 | Ga0207704_10030307 | Ga0207704_100303072 | 501 |
| 785 | 3300025940 | Ga0207691_10007573 | Ga0207691_100075734 | 501 |
| 786 | 3300025960 | Ga0207651_10020147 | Ga0207651_100201473 | 501 |
| 787 | 3300025961 | Ga0207712_10037616 | Ga0207712_100376162 | 501 |
| 788 | 3300026041 | Ga0207639_10191344 | Ga0207639_101913442 | 501 |
| 789 | 3300026089 | Ga0207648_10011873 | Ga0207648_100118732 | 501 |
| 790 | 3300026116 | Ga0207674_10073827 | Ga0207674_100738272 | 501 |
| 791 | 3300026121 | Ga0207683_10067514 | Ga0207683_100675143 | 501 |
| 792 | 3300026142 | Ga0207698_10000012 | Ga0207698_1000001231 | 501 |
| 793 | 3300026142 | Ga0207698_10014684 | Ga0207698_100146844 | 501 |
| 794 | 3300026142 | Ga0207698_10022568 | Ga0207698_100225682 | 501 |
| 795 | 3300027907 | Ga0207428_10026212 | Ga0207428_100262122 | 501 |
| 796 | 3300037312 | Ga0395899_0003392 | Ga0395899_0003392_341_1882 | 501 |
| 797 | 3300037418 | Ga0395900_0009508 | Ga0395900_0009508_5472_7013 | 501 |
| 798 | 3300037466 | Ga0395898_0023168 | Ga0395898_0023168_2798_4339 | 501 |
| 799 | 3300037853 | Ga0436364_0674729 | Ga0436364_0674729_1038_2597 | 501 |
| 800 | 3300037853 | Ga0436364_1445105 | Ga0436364_1445105_576_2135 | 501 |
| 801 | 3300038443 | Ga0395901_0006703 | Ga0395901_0006703_6311_7852 | 501 |
| 802 | 3300039453 | Ga0436362_0705873 | Ga0436362_0705873_980_2545 | 501 |
| 803 | 3300045976 | Ga0466967_0050647 | Ga0466967_0050647_571_2106 | 501 |
| 804 | 3300046459 | Ga0495629_0000272 | Ga0495629_0000272_33281_34795 | 501 |
| 805 | 3300046476 | Ga0495662_0000458 | Ga0495662_0000458_5274_6782 | 501 |
| 806 | 3300046517 | Ga0495630_0000056 | Ga0495630_0000056_36293_37807 | 501 |
| 807 | 3300046681 | Ga0495647_0000169 | Ga0495647_0000169_10624_12138 | 501 |
| 808 | 3300046690 | Ga0495624_0000267 | Ga0495624_0000267_16336_17850 | 501 |
| 809 | 3300047321 | Ga0495676_0153713 | Ga0495676_0153713_50_1585 | 501 |
| 810 | 3300048903 | Ga0496100_0000018 | Ga0496100_0000018_83375_84898 | 501 |
| 811 | 3300048904 | Ga0496101_0000062 | Ga0496101_0000062_108329_109852 | 501 |
| 812 | 3300048904 | Ga0496101_0040738 | Ga0496101_0040738_233_1771 | 501 |
| 813 | 3300048909 | Ga0496106_0000145 | Ga0496106_0000145_39600_41123 | 501 |
| 814 | 3300048909 | Ga0496106_0021330 | Ga0496106_0021330_1280_2818 | 501 |
| 815 | 3300048910 | Ga0496107_0000006 | Ga0496107_0000006_152298_153821 | 501 |
| 816 | 3300048911 | Ga0496108_0015294 | Ga0496108_0015294_2240_3754 | 501 |
| 817 | 3300048911 | Ga0496108_0057327 | Ga0496108_0057327_1259_2797 | 501 |
| 818 | 3300048911 | Ga0496108_0133462 | Ga0496108_0133462_184_1719 | 501 |
| 819 | 3300048912 | Ga0496109_0000129 | Ga0496109_0000129_5137_6651 | 501 |
| 820 | 3300048912 | Ga0496109_0001369 | Ga0496109_0001369_12459_13997 | 501 |
| 821 | 3300048913 | Ga0496110_0042091 | Ga0496110_0042091_249_1787 | 501 |
| 822 | 3300048913 | Ga0496110_0068996 | Ga0496110_0068996_1439_2974 | 501 |
| 823 | 3300048914 | Ga0496111_0064421 | Ga0496111_0064421_942_2480 | 501 |
| 824 | 3300048916 | Ga0496113_0040460 | Ga0496113_0040460_619_2154 | 501 |
| 825 | 3300048918 | Ga0496115_0126385 | Ga0496115_0126385_303_1838 | 501 |
| 826 | 3300050492 | nmdc:mga0yw44_4558_c1 | nmdc:mga0yw44_4558_c1_2169_3707 | 501 |
| 827 | 3300050492 | nmdc:mga0yw44_87222_c1 | nmdc:mga0yw44_87222_c1_163_1704 | 501 |
| 828 | 3300050510 | nmdc:mga06r32_244_c1 | nmdc:mga06r32_244_c1_35848_37383 | 501 |
| 829 | 3300050511 | nmdc:mga08y16_131777_c1 | nmdc:mga08y16_131777_c1_585_2159 | 501 |
| 830 | 3300050511 | nmdc:mga08y16_30153_c1 | nmdc:mga08y16_30153_c1_3129_4664 | 501 |
| 831 | 3300050512 | nmdc:mga0n895_7227_c1 | nmdc:mga0n895_7227_c1_2663_4198 | 501 |
| 832 | 3300050515 | nmdc:mga0a205_540_c1 | nmdc:mga0a205_540_c1_20775_22283 | 501 |
| 833 | 3300053078 | Ga0495612_0005579 | Ga0495612_0005579_1998_3512 | 501 |
| 834 | 3300053085 | Ga0495619_0000031 | Ga0495619_0000031_27363_28877 | 501 |
| 835 | 3300003659 | JGI25404J52841_10006407 | JGI25404J52841_100064073 | 502 |
| 836 | 3300005329 | Ga0070683_100008910 | Ga0070683_1000089106 | 502 |
| 837 | 3300005329 | Ga0070683_100017176 | Ga0070683_1000171765 | 502 |
| 838 | 3300005329 | Ga0070683_100052582 | Ga0070683_1000525824 | 502 |
| 839 | 3300005333 | Ga0070677_10000004 | Ga0070677_1000000427 | 502 |
| 840 | 3300005335 | Ga0070666_10048044 | Ga0070666_100480442 | 502 |
| 841 | 3300005338 | Ga0068868_100007612 | Ga0068868_1000076124 | 502 |
| 842 | 3300005356 | Ga0070674_100000008 | Ga0070674_10000000832 | 502 |
| 843 | 3300005356 | Ga0070674_100000029 | Ga0070674_10000002929 | 502 |
| 844 | 3300005364 | Ga0070673_100005926 | Ga0070673_1000059261 | 502 |
| 845 | 3300005365 | Ga0070688_100000068 | Ga0070688_10000006828 | 502 |
| 846 | 3300005439 | Ga0070711_100003340 | Ga0070711_1000033402 | 502 |
| 847 | 3300005456 | Ga0070678_100011655 | Ga0070678_1000116555 | 502 |
| 848 | 3300005466 | Ga0070685_10000127 | Ga0070685_1000012754 | 502 |
| 849 | 3300005466 | Ga0070685_10005555 | Ga0070685_100055552 | 502 |
| 850 | 3300005530 | Ga0070679_100055874 | Ga0070679_1000558744 | 502 |
| 851 | 3300005535 | Ga0070684_100040324 | Ga0070684_1000403242 | 502 |
| 852 | 3300005543 | Ga0070672_100000027 | Ga0070672_1000000276 | 502 |
| 853 | 3300005548 | Ga0070665_100001955 | Ga0070665_1000019553 | 502 |
| 854 | 3300005548 | Ga0070665_100038430 | Ga0070665_1000384302 | 502 |
| 855 | 3300005614 | Ga0068856_100026071 | Ga0068856_1000260713 | 502 |
| 856 | 3300005718 | Ga0068866_10000001 | Ga0068866_10000001294 | 502 |
| 857 | 3300005718 | Ga0068866_10000031 | Ga0068866_100000312 | 502 |
| 858 | 3300005842 | Ga0068858_100000091 | Ga0068858_1000000912 | 502 |
| 859 | 3300005843 | Ga0068860_100028039 | Ga0068860_1000280394 | 502 |
| 860 | 3300005937 | Ga0081455_10103892 | Ga0081455_101038922 | 502 |
| 861 | 3300005981 | Ga0081538_10000514 | Ga0081538_1000051431 | 502 |
| 862 | 3300005983 | Ga0081540_1000139 | Ga0081540_100013971 | 502 |
| 863 | 3300006038 | Ga0075365_10020924 | Ga0075365_100209243 | 502 |
| 864 | 3300006048 | Ga0075363_100068621 | Ga0075363_1000686211 | 502 |
| 865 | 3300006175 | Ga0070712_100003379 | Ga0070712_1000033794 | 502 |
| 866 | 3300006844 | Ga0075428_100025755 | Ga0075428_1000257557 | 502 |
| 867 | 3300006846 | Ga0075430_100058117 | Ga0075430_1000581172 | 502 |
| 868 | 3300006852 | Ga0075433_10001554 | Ga0075433_100015547 | 502 |
| 869 | 3300006881 | Ga0068865_100000160 | Ga0068865_10000016030 | 502 |
| 870 | 3300009098 | Ga0105245_10000456 | Ga0105245_100004567 | 502 |
| 871 | 3300009148 | Ga0105243_10026089 | Ga0105243_100260893 | 502 |
| 872 | 3300009148 | Ga0105243_10109557 | Ga0105243_101095571 | 502 |
| 873 | 3300009177 | Ga0105248_10000249 | Ga0105248_1000024957 | 502 |
| 874 | 3300013102 | Ga0157371_10011147 | Ga0157371_100111473 | 502 |
| 875 | 3300013296 | Ga0157374_10006397 | Ga0157374_100063978 | 502 |
| 876 | 3300014326 | Ga0157380_10000132 | Ga0157380_1000013236 | 502 |
| 877 | 3300014326 | Ga0157380_10006960 | Ga0157380_100069604 | 502 |
| 878 | 3300025893 | Ga0207682_10000031 | Ga0207682_1000003140 | 502 |
| 879 | 3300025899 | Ga0207642_10000002 | Ga0207642_1000000214 | 502 |
| 880 | 3300025899 | Ga0207642_10000122 | Ga0207642_1000012218 | 502 |
| 881 | 3300025903 | Ga0207680_10010636 | Ga0207680_100106363 | 502 |
| 882 | 3300025915 | Ga0207693_10007247 | Ga0207693_100072474 | 502 |
| 883 | 3300025916 | Ga0207663_10005734 | Ga0207663_100057342 | 502 |
| 884 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007339 | 502 |
| 885 | 3300025935 | Ga0207709_10012022 | Ga0207709_100120223 | 502 |
| 886 | 3300025937 | Ga0207669_10000004 | Ga0207669_10000004176 | 502 |
| 887 | 3300025937 | Ga0207669_10000012 | Ga0207669_10000012113 | 502 |
| 888 | 3300025938 | Ga0207704_10000236 | Ga0207704_100002365 | 502 |
| 889 | 3300025940 | Ga0207691_10000136 | Ga0207691_100001365 | 502 |
| 890 | 3300025941 | Ga0207711_10000020 | Ga0207711_1000002013 | 502 |
| 891 | 3300025944 | Ga0207661_10000224 | Ga0207661_1000022430 | 502 |
| 892 | 3300025944 | Ga0207661_10013702 | Ga0207661_100137024 | 502 |
| 893 | 3300025960 | Ga0207651_10000460 | Ga0207651_100004602 | 502 |
| 894 | 3300026035 | Ga0207703_10000152 | Ga0207703_100001524 | 502 |
| 895 | 3300026041 | Ga0207639_10023349 | Ga0207639_100233493 | 502 |
| 896 | 3300026078 | Ga0207702_10003607 | Ga0207702_100036073 | 502 |
| 897 | 3300026121 | Ga0207683_10003745 | Ga0207683_1000374510 | 502 |
| 898 | 3300028379 | Ga0268266_10000085 | Ga0268266_10000085156 | 502 |
| 899 | 3300028379 | Ga0268266_10007839 | Ga0268266_100078393 | 502 |
| 900 | 3300028379 | Ga0268266_10055173 | Ga0268266_100551733 | 502 |
| 901 | 3300028381 | Ga0268264_10013352 | Ga0268264_100133526 | 502 |
| 902 | 3300028556 | Ga0265337_1000231 | Ga0265337_100023115 | 502 |
| 903 | 3300028558 | Ga0265326_10000007 | Ga0265326_100000077 | 502 |
| 904 | 3300028654 | Ga0265322_10000001 | Ga0265322_10000001298 | 502 |
| 905 | 3300028666 | Ga0265336_10005990 | Ga0265336_100059903 | 502 |
| 906 | 3300029957 | Ga0265324_10001009 | Ga0265324_100010097 | 502 |
| 907 | 3300031240 | Ga0265320_10000002 | Ga0265320_10000002297 | 502 |
| 908 | 3300031242 | Ga0265329_10004822 | Ga0265329_100048224 | 502 |
| 909 | 3300031249 | Ga0265339_10054152 | Ga0265339_100541522 | 502 |
| 910 | 3300031251 | Ga0265327_10000011 | Ga0265327_10000011297 | 502 |
| 911 | 3300031711 | Ga0265314_10000062 | Ga0265314_1000006231 | 502 |
| 912 | 3300035398 | Ga0316574_0002945 | Ga0316574_0002945_5369_6913 | 502 |
| 913 | 3300041512 | Ga0451853_3236511 | Ga0451853_3236511_254_1771 | 502 |
| 914 | 3300044842 | Ga0466957_0013544 | Ga0466957_0013544_2762_4279 | 502 |
| 915 | 3300046459 | Ga0495629_0034828 | Ga0495629_0034828_717_2231 | 502 |
| 916 | 3300046461 | Ga0495641_0000044 | Ga0495641_0000044_38343_39854 | 502 |
| 917 | 3300046462 | Ga0495651_0047771 | Ga0495651_0047771_925_2442 | 502 |
| 918 | 3300046462 | Ga0495651_0105612 | Ga0495651_0105612_92_1609 | 502 |
| 919 | 3300046476 | Ga0495662_0020681 | Ga0495662_0020681_216_1727 | 502 |
| 920 | 3300046500 | Ga0495596_0023521 | Ga0495596_0023521_257_1813 | 502 |
| 921 | 3300046517 | Ga0495630_0000408 | Ga0495630_0000408_26230_27747 | 502 |
| 922 | 3300046518 | Ga0495631_0017942 | Ga0495631_0017942_1287_2843 | 502 |
| 923 | 3300046523 | Ga0495644_0000642 | Ga0495644_0000642_5477_6988 | 502 |
| 924 | 3300046523 | Ga0495644_0007527 | Ga0495644_0007527_2136_3692 | 502 |
| 925 | 3300046557 | Ga0495622_0000180 | Ga0495622_0000180_43187_44698 | 502 |
| 926 | 3300046674 | Ga0495588_0000165 | Ga0495588_0000165_68179_69696 | 502 |
| 927 | 3300046690 | Ga0495624_0000008 | Ga0495624_0000008_61950_63461 | 502 |
| 928 | 3300047317 | Ga0495604_0000019 | Ga0495604_0000019_120394_121911 | 502 |
| 929 | 3300047317 | Ga0495604_0000398 | Ga0495604_0000398_21_1538 | 502 |
| 930 | 3300047322 | Ga0495680_0002092 | Ga0495680_0002092_16182_17699 | 502 |
| 931 | 3300047469 | Ga0495673_0010571 | Ga0495673_0010571_2454_4010 | 502 |
| 932 | 3300047472 | Ga0495686_0000020 | Ga0495686_0000020_351301_352857 | 502 |
| 933 | 3300047472 | Ga0495686_0004284 | Ga0495686_0004284_4751_6307 | 502 |
| 934 | 3300048088 | Ga0495602_0000208 | Ga0495602_0000208_23367_24884 | 502 |
| 935 | 3300048905 | Ga0496102_0000039 | Ga0496102_0000039_147007_148524 | 502 |
| 936 | 3300048906 | Ga0496103_0000008 | Ga0496103_0000008_268262_269779 | 502 |
| 937 | 3300048908 | Ga0496105_0046758 | Ga0496105_0046758_257_1771 | 502 |
| 938 | 3300048909 | Ga0496106_0000081 | Ga0496106_0000081_61918_63429 | 502 |
| 939 | 3300048910 | Ga0496107_0024708 | Ga0496107_0024708_370_1881 | 502 |
| 940 | 3300048912 | Ga0496109_0037796 | Ga0496109_0037796_1957_3477 | 502 |
| 941 | 3300048912 | Ga0496109_0084905 | Ga0496109_0084905_356_1915 | 502 |
| 942 | 3300048914 | Ga0496111_0057332 | Ga0496111_0057332_543_2087 | 502 |
| 943 | 3300048914 | Ga0496111_0083057 | Ga0496111_0083057_778_2289 | 502 |
| 944 | 3300048918 | Ga0496115_0003578 | Ga0496115_0003578_6207_7724 | 502 |
| 945 | 3300048919 | Ga0496116_0000680 | Ga0496116_0000680_35591_37108 | 502 |
| 946 | 3300048922 | Ga0496119_0001947 | Ga0496119_0001947_14888_16405 | 502 |
| 947 | 3300048922 | Ga0496119_0053846 | Ga0496119_0053846_324_1838 | 502 |
| 948 | 3300048924 | Ga0496121_0082381 | Ga0496121_0082381_268_1782 | 502 |
| 949 | 3300049568 | Ga0501031_0000137 | Ga0501031_0000137_37235_38749 | 502 |
| 950 | 3300049569 | Ga0501032_0000409 | Ga0501032_0000409_12066_13580 | 502 |
| 951 | 3300049570 | Ga0501033_0000223 | Ga0501033_0000223_50652_52166 | 502 |
| 952 | 3300049571 | Ga0501034_0023191 | Ga0501034_0023191_1235_2758 | 502 |
| 953 | 3300049571 | Ga0501034_0039153 | Ga0501034_0039153_2367_3890 | 502 |
| 954 | 3300049571 | Ga0501034_0041516 | Ga0501034_0041516_900_2414 | 502 |
| 955 | 3300049572 | Ga0501036_0000395 | Ga0501036_0000395_28389_29903 | 502 |
| 956 | 3300049572 | Ga0501036_0093353 | Ga0501036_0093353_156_1679 | 502 |
| 957 | 3300049573 | Ga0501037_0000315 | Ga0501037_0000315_37242_38756 | 502 |
| 958 | 3300049574 | Ga0501038_0000323 | Ga0501038_0000323_37328_38842 | 502 |
| 959 | 3300049575 | Ga0501039_0011591 | Ga0501039_0011591_51_1565 | 502 |
| 960 | 3300049578 | Ga0501042_0017883 | Ga0501042_0017883_42_1559 | 502 |
| 961 | 3300049578 | Ga0501042_0044566 | Ga0501042_0044566_393_1907 | 502 |
| 962 | 3300049579 | Ga0501043_0000587 | Ga0501043_0000587_2330_3844 | 502 |
| 963 | 3300049580 | Ga0501046_0000443 | Ga0501046_0000443_2635_4149 | 502 |
| 964 | 3300049581 | Ga0501047_0000321 | Ga0501047_0000321_37267_38781 | 502 |
| 965 | 3300049582 | Ga0501048_0000336 | Ga0501048_0000336_2327_3841 | 502 |
| 966 | 3300049584 | Ga0501068_0025852 | Ga0501068_0025852_607_2121 | 502 |
| 967 | 3300049585 | Ga0501069_0043607 | Ga0501069_0043607_259_1773 | 502 |
| 968 | 3300049586 | Ga0501070_0000354 | Ga0501070_0000354_37484_38998 | 502 |
| 969 | 3300049587 | Ga0501071_0024317 | Ga0501071_0024317_1110_2624 | 502 |
| 970 | 3300049587 | Ga0501071_0158450 | Ga0501071_0158450_56_1567 | 502 |
| 971 | 3300049589 | Ga0501073_0013645 | Ga0501073_0013645_2590_4104 | 502 |
| 972 | 3300049590 | Ga0501074_0008948 | Ga0501074_0008948_3706_5220 | 502 |
| 973 | 3300049590 | Ga0501074_0056607 | Ga0501074_0056607_290_1807 | 502 |
| 974 | 3300049741 | Ga0501079_0009561 | Ga0501079_0009561_916_2430 | 502 |
| 975 | 3300049742 | Ga0501080_0018770 | Ga0501080_0018770_2632_4146 | 502 |
| 976 | 3300049744 | Ga0501083_0006159 | Ga0501083_0006159_6206_7720 | 502 |
| 977 | 3300049744 | Ga0501083_0032660 | Ga0501083_0032660_60_1577 | 502 |
| 978 | 3300049822 | Ga0501035_0000380 | Ga0501035_0000380_12070_13584 | 502 |
| 979 | 3300049823 | Ga0501044_0000681 | Ga0501044_0000681_2306_3820 | 502 |
| 980 | 3300049823 | Ga0501044_0060609 | Ga0501044_0060609_2192_3715 | 502 |
| 981 | 3300050492 | nmdc:mga0yw44_16097_c1 | nmdc:mga0yw44_16097_c1_2462_4000 | 502 |
| 982 | 3300050515 | nmdc:mga0a205_24_c2 | nmdc:mga0a205_24_c2_6854_8374 | 502 |
| 983 | 3300053077 | Ga0495601_0003210 | Ga0495601_0003210_4955_6472 | 502 |
| 984 | 3300053083 | Ga0495655_0000001 | Ga0495655_0000001_141247_142761 | 502 |
| 985 | 3300053083 | Ga0495655_0003329 | Ga0495655_0003329_1071_2588 | 502 |
| 986 | 3300053085 | Ga0495619_0000021 | Ga0495619_0000021_183546_185066 | 502 |
| 987 | 3300053085 | Ga0495619_0013727 | Ga0495619_0013727_549_2078 | 502 |
| 988 | 3300053096 | Ga0500641_0011610 | Ga0500641_0011610_1194_2711 | 502 |
| 989 | 3300053123 | Ga0500614_005477 | Ga0500614_005477_729_2240 | 502 |
| 990 | 3300053129 | Ga0500628_000010 | Ga0500628_000010_15448_16962 | 502 |
| 991 | 3300060353 | Ga0501082_0025609 | Ga0501082_0025609_2872_4386 | 502 |
| 992 | 3300003203 | JGI25406J46586_10022658 | JGI25406J46586_100226582 | 503 |
| 993 | 3300005329 | Ga0070683_100010038 | Ga0070683_1000100382 | 503 |
| 994 | 3300005366 | Ga0070659_100004757 | Ga0070659_1000047574 | 503 |
| 995 | 3300005367 | Ga0070667_100006419 | Ga0070667_1000064197 | 503 |
| 996 | 3300005455 | Ga0070663_100003079 | Ga0070663_1000030797 | 503 |
| 997 | 3300005457 | Ga0070662_100000004 | Ga0070662_10000000441 | 503 |
| 998 | 3300005547 | Ga0070693_100000376 | Ga0070693_1000003767 | 503 |
| 999 | 3300005548 | Ga0070665_100000106 | Ga0070665_100000106132 | 503 |
| 1000 | 3300005578 | Ga0068854_100000114 | Ga0068854_1000001146 | 503 |
| 1001 | 3300005834 | Ga0068851_10004695 | Ga0068851_100046953 | 503 |
| 1002 | 3300005842 | Ga0068858_100000216 | Ga0068858_10000021648 | 503 |
| 1003 | 3300005844 | Ga0068862_100000973 | Ga0068862_1000009733 | 503 |
| 1004 | 3300005937 | Ga0081455_10149935 | Ga0081455_101499352 | 503 |
| 1005 | 3300005985 | Ga0081539_10000791 | Ga0081539_1000079112 | 503 |
| 1006 | 3300005985 | Ga0081539_10041810 | Ga0081539_100418102 | 503 |
| 1007 | 3300009098 | Ga0105245_10008155 | Ga0105245_100081552 | 503 |
| 1008 | 3300009101 | Ga0105247_10000393 | Ga0105247_1000039328 | 503 |
| 1009 | 3300009176 | Ga0105242_10025382 | Ga0105242_100253824 | 503 |
| 1010 | 3300009551 | Ga0105238_10000011 | Ga0105238_10000011111 | 503 |
| 1011 | 3300013105 | Ga0157369_10000110 | Ga0157369_1000011060 | 503 |
| 1012 | 3300014968 | Ga0157379_10001717 | Ga0157379_100017179 | 503 |
| 1013 | 3300025321 | Ga0207656_10002580 | Ga0207656_100025806 | 503 |
| 1014 | 3300025900 | Ga0207710_10000195 | Ga0207710_1000019512 | 503 |
| 1015 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004512 | 503 |
| 1016 | 3300025927 | Ga0207687_10000177 | Ga0207687_100001775 | 503 |
| 1017 | 3300025932 | Ga0207690_10006892 | Ga0207690_100068921 | 503 |
| 1018 | 3300025933 | Ga0207706_10000012 | Ga0207706_10000012177 | 503 |
| 1019 | 3300025934 | Ga0207686_10005471 | Ga0207686_100054712 | 503 |
| 1020 | 3300025944 | Ga0207661_10003313 | Ga0207661_100033137 | 503 |
| 1021 | 3300025945 | Ga0207679_10040804 | Ga0207679_100408044 | 503 |
| 1022 | 3300025961 | Ga0207712_10016430 | Ga0207712_100164302 | 503 |
| 1023 | 3300025981 | Ga0207640_10000015 | Ga0207640_1000001546 | 503 |
| 1024 | 3300025986 | Ga0207658_10057816 | Ga0207658_100578162 | 503 |
| 1025 | 3300026035 | Ga0207703_10000023 | Ga0207703_10000023194 | 503 |
| 1026 | 3300026067 | Ga0207678_10007745 | Ga0207678_100077457 | 503 |
| 1027 | 3300028379 | Ga0268266_10000047 | Ga0268266_10000047284 | 503 |
| 1028 | 3300028380 | Ga0268265_10001017 | Ga0268265_1000101726 | 503 |
| 1029 | 3300028381 | Ga0268264_10118473 | Ga0268264_101184732 | 503 |
| 1030 | 3300044694 | Ga0466963_0000001 | Ga0466963_0000001_68719_70239 | 503 |
| 1031 | 3300045976 | Ga0466967_0000065 | Ga0466967_0000065_1821_3335 | 503 |
| 1032 | 3300046455 | Ga0495603_0003452 | Ga0495603_0003452_1296_2822 | 503 |
| 1033 | 3300046499 | Ga0495594_0000003 | Ga0495594_0000003_130243_131760 | 503 |
| 1034 | 3300046535 | Ga0495586_0009241 | Ga0495586_0009241_2248_3768 | 503 |
| 1035 | 3300046660 | Ga0495625_0000696 | Ga0495625_0000696_5502_7025 | 503 |
| 1036 | 3300046681 | Ga0495647_0000008 | Ga0495647_0000008_79154_80668 | 503 |
| 1037 | 3300046689 | Ga0495613_0000113 | Ga0495613_0000113_5311_6831 | 503 |
| 1038 | 3300047322 | Ga0495680_0007700 | Ga0495680_0007700_5339_6853 | 503 |
| 1039 | 3300048907 | Ga0496104_0000004 | Ga0496104_0000004_151861_153387 | 503 |
| 1040 | 3300048907 | Ga0496104_0000009 | Ga0496104_0000009_154866_156389 | 503 |
| 1041 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_488444_489970 | 503 |
| 1042 | 3300048908 | Ga0496105_0000007 | Ga0496105_0000007_331667_333190 | 503 |
| 1043 | 3300048911 | Ga0496108_0000062 | Ga0496108_0000062_48771_50291 | 503 |
| 1044 | 3300048912 | Ga0496109_0000007 | Ga0496109_0000007_56547_58067 | 503 |
| 1045 | 3300048913 | Ga0496110_0000062 | Ga0496110_0000062_36644_38164 | 503 |
| 1046 | 3300048913 | Ga0496110_0020943 | Ga0496110_0020943_2093_3607 | 503 |
| 1047 | 3300048914 | Ga0496111_0000010 | Ga0496111_0000010_64219_65739 | 503 |
| 1048 | 3300048922 | Ga0496119_0022969 | Ga0496119_0022969_1179_2705 | 503 |
| 1049 | 3300049578 | Ga0501042_0062756 | Ga0501042_0062756_317_1837 | 503 |
| 1050 | 3300049581 | Ga0501047_0028750 | Ga0501047_0028750_2386_3900 | 503 |
| 1051 | 3300049586 | Ga0501070_0077285 | Ga0501070_0077285_99_1643 | 503 |
| 1052 | 3300049588 | Ga0501072_0126760 | Ga0501072_0126760_294_1838 | 503 |
| 1053 | 3300049591 | Ga0501075_0001259 | Ga0501075_0001259_4138_5655 | 503 |
| 1054 | 3300049592 | Ga0501076_0035717 | Ga0501076_0035717_1670_3190 | 503 |
| 1055 | 3300049823 | Ga0501044_0084578 | Ga0501044_0084578_1032_2549 | 503 |
| 1056 | 3300053077 | Ga0495601_0000013 | Ga0495601_0000013_145887_147407 | 503 |
| 1057 | 3300053078 | Ga0495612_0002565 | Ga0495612_0002565_1507_3021 | 503 |
| 1058 | 3300005535 | Ga0070684_100146242 | Ga0070684_1001462421 | 504 |
| 1059 | 3300005618 | Ga0068864_100000045 | Ga0068864_100000045127 | 504 |
| 1060 | 3300006051 | Ga0075364_10092093 | Ga0075364_100920932 | 504 |
| 1061 | 3300009098 | Ga0105245_10005125 | Ga0105245_100051257 | 504 |
| 1062 | 3300011119 | Ga0105246_10036239 | Ga0105246_100362393 | 504 |
| 1063 | 3300013308 | Ga0157375_10001152 | Ga0157375_100011522 | 504 |
| 1064 | 3300025927 | Ga0207687_10000018 | Ga0207687_10000018158 | 504 |
| 1065 | 3300025927 | Ga0207687_10004028 | Ga0207687_100040285 | 504 |
| 1066 | 3300026095 | Ga0207676_10000016 | Ga0207676_1000001637 | 504 |
| 1067 | 3300036401 | Ga0373937_0142681 | Ga0373937_0142681_338_1864 | 504 |
| 1068 | 3300046663 | Ga0495635_0061532 | Ga0495635_0061532_1020_2546 | 504 |
| 1069 | 3300046683 | Ga0495658_0013455 | Ga0495658_0013455_1899_3422 | 504 |
| 1070 | 3300046809 | Ga0495600_0021081 | Ga0495600_0021081_2554_4077 | 504 |
| 1071 | 3300047321 | Ga0495676_0008653 | Ga0495676_0008653_5768_7306 | 504 |
| 1072 | 3300048907 | Ga0496104_0000129 | Ga0496104_0000129_24104_25630 | 504 |
| 1073 | 3300048908 | Ga0496105_0000846 | Ga0496105_0000846_3496_5022 | 504 |
| 1074 | 3300048914 | Ga0496111_0062281 | Ga0496111_0062281_645_2189 | 504 |
| 1075 | 3300048915 | Ga0496112_0001122 | Ga0496112_0001122_6589_8112 | 504 |
| 1076 | 3300048915 | Ga0496112_0166699 | Ga0496112_0166699_327_1853 | 504 |
| 1077 | 3300048916 | Ga0496113_0000014 | Ga0496113_0000014_54717_56240 | 504 |
| 1078 | 3300049572 | Ga0501036_0032127 | Ga0501036_0032127_1238_2779 | 504 |
| 1079 | 3300049575 | Ga0501039_0037664 | Ga0501039_0037664_400_1941 | 504 |
| 1080 | 3300049578 | Ga0501042_0104307 | Ga0501042_0104307_468_2009 | 504 |
| 1081 | 3300049588 | Ga0501072_0006920 | Ga0501072_0006920_363_1904 | 504 |
| 1082 | 3300049824 | Ga0501045_0096095 | Ga0501045_0096095_22_1569 | 504 |
| 1083 | 3300050507 | nmdc:mga05p37_44560_c1 | nmdc:mga05p37_44560_c1_860_2404 | 504 |
| 1084 | 3300054114 | Ga0501084_0019930 | Ga0501084_0019930_2244_3785 | 504 |
| 1085 | 3300005329 | Ga0070683_100054804 | Ga0070683_1000548041 | 505 |
| 1086 | 3300005338 | Ga0068868_100000033 | Ga0068868_1000000333 | 505 |
| 1087 | 3300005354 | Ga0070675_100000101 | Ga0070675_10000010155 | 505 |
| 1088 | 3300005436 | Ga0070713_100000009 | Ga0070713_100000009160 | 505 |
| 1089 | 3300005615 | Ga0070702_100037020 | Ga0070702_1000370202 | 505 |
| 1090 | 3300005841 | Ga0068863_100000021 | Ga0068863_100000021164 | 505 |
| 1091 | 3300005983 | Ga0081540_1000306 | Ga0081540_100030645 | 505 |
| 1092 | 3300025899 | Ga0207642_10019184 | Ga0207642_100191841 | 505 |
| 1093 | 3300025926 | Ga0207659_10000010 | Ga0207659_10000010147 | 505 |
| 1094 | 3300025928 | Ga0207700_10000081 | Ga0207700_1000008163 | 505 |
| 1095 | 3300026023 | Ga0207677_10000338 | Ga0207677_100003383 | 505 |
| 1096 | 3300026088 | Ga0207641_10000151 | Ga0207641_1000015161 | 505 |
| 1097 | 3300036401 | Ga0373937_0158223 | Ga0373937_0158223_37_1566 | 505 |
| 1098 | 3300046459 | Ga0495629_0068316 | Ga0495629_0068316_284_1816 | 505 |
| 1099 | 3300046507 | Ga0495606_0000752 | Ga0495606_0000752_31162_32688 | 505 |
| 1100 | 3300046516 | Ga0495628_0001219 | Ga0495628_0001219_15982_17511 | 505 |
| 1101 | 3300046533 | Ga0495640_0003352 | Ga0495640_0003352_9242_10768 | 505 |
| 1102 | 3300046642 | Ga0495634_0000247 | Ga0495634_0000247_6136_7668 | 505 |
| 1103 | 3300046689 | Ga0495613_0000203 | Ga0495613_0000203_16535_18061 | 505 |
| 1104 | 3300048088 | Ga0495602_0000497 | Ga0495602_0000497_21350_22879 | 505 |
| 1105 | 3300048917 | Ga0496114_0000014 | Ga0496114_0000014_211621_213144 | 505 |
| 1106 | 3300048917 | Ga0496114_0014859 | Ga0496114_0014859_250_1770 | 505 |
| 1107 | 3300048918 | Ga0496115_0000125 | Ga0496115_0000125_33280_34803 | 505 |
| 1108 | 3300053094 | Ga0500566_0023867 | Ga0500566_0023867_726_2252 | 505 |
| 1109 | 3300005344 | Ga0070661_100000023 | Ga0070661_10000002341 | 506 |
| 1110 | 3300005458 | Ga0070681_10021554 | Ga0070681_100215544 | 506 |
| 1111 | 3300005530 | Ga0070679_100001522 | Ga0070679_1000015228 | 506 |
| 1112 | 3300009098 | Ga0105245_10000016 | Ga0105245_1000001666 | 506 |
| 1113 | 3300009098 | Ga0105245_10136902 | Ga0105245_101369022 | 506 |
| 1114 | 3300009553 | Ga0105249_10000068 | Ga0105249_10000068133 | 506 |
| 1115 | 3300013297 | Ga0157378_10018959 | Ga0157378_100189594 | 506 |
| 1116 | 3300017792 | Ga0163161_10000035 | Ga0163161_1000003514 | 506 |
| 1117 | 3300025912 | Ga0207707_10006013 | Ga0207707_100060134 | 506 |
| 1118 | 3300025920 | Ga0207649_10000063 | Ga0207649_1000006316 | 506 |
| 1119 | 3300025921 | Ga0207652_10000349 | Ga0207652_100003493 | 506 |
| 1120 | 3300025961 | Ga0207712_10000007 | Ga0207712_10000007285 | 506 |
| 1121 | 3300025981 | Ga0207640_10013825 | Ga0207640_100138253 | 506 |
| 1122 | 3300046454 | Ga0495592_0000036 | Ga0495592_0000036_117391_118920 | 506 |
| 1123 | 3300046463 | Ga0495653_0018382 | Ga0495653_0018382_3120_4664 | 506 |
| 1124 | 3300046463 | Ga0495653_0020520 | Ga0495653_0020520_1072_2595 | 506 |
| 1125 | 3300046473 | Ga0495582_0000011 | Ga0495582_0000011_20695_22224 | 506 |
| 1126 | 3300046511 | Ga0495608_0001071 | Ga0495608_0001071_16703_18232 | 506 |
| 1127 | 3300046514 | Ga0495618_0000594 | Ga0495618_0000594_15124_16653 | 506 |
| 1128 | 3300046615 | Ga0495656_0000483 | Ga0495656_0000483_9778_11301 | 506 |
| 1129 | 3300046616 | Ga0495668_0070338 | Ga0495668_0070338_204_1754 | 506 |
| 1130 | 3300046642 | Ga0495634_0000018 | Ga0495634_0000018_39434_40963 | 506 |
| 1131 | 3300046683 | Ga0495658_0000005 | Ga0495658_0000005_91126_92655 | 506 |
| 1132 | 3300046809 | Ga0495600_0000787 | Ga0495600_0000787_86_1615 | 506 |
| 1133 | 3300048908 | Ga0496105_0004668 | Ga0496105_0004668_2335_3870 | 506 |
| 1134 | 3300048911 | Ga0496108_0001172 | Ga0496108_0001172_15457_16995 | 506 |
| 1135 | 3300048912 | Ga0496109_0001311 | Ga0496109_0001311_15537_17075 | 506 |
| 1136 | 3300048920 | Ga0496117_0004578 | Ga0496117_0004578_8979_10505 | 506 |
| 1137 | 3300048921 | Ga0496118_0010367 | Ga0496118_0010367_4402_5928 | 506 |
| 1138 | 3300048923 | Ga0496120_0018638 | Ga0496120_0018638_1698_3224 | 506 |
| 1139 | 3300053077 | Ga0495601_0000326 | Ga0495601_0000326_11500_13023 | 506 |
| 1140 | 3300053077 | Ga0495601_0053134 | Ga0495601_0053134_221_1753 | 506 |
| 1141 | 3300053084 | Ga0495595_0000172 | Ga0495595_0000172_2989_4518 | 506 |
| 1142 | 3300053085 | Ga0495619_0009846 | Ga0495619_0009846_3767_5296 | 506 |
| 1143 | 3300001977 | JGI24746J21847_1000167 | JGI24746J21847_10001675 | 507 |
| 1144 | 3300005337 | Ga0070682_100000013 | Ga0070682_100000013101 | 507 |
| 1145 | 3300005459 | Ga0068867_100006138 | Ga0068867_1000061384 | 507 |
| 1146 | 3300005841 | Ga0068863_100073925 | Ga0068863_1000739252 | 507 |
| 1147 | 3300007076 | Ga0075435_100115086 | Ga0075435_1001150862 | 507 |
| 1148 | 3300009176 | Ga0105242_10000893 | Ga0105242_100008933 | 507 |
| 1149 | 3300014968 | Ga0157379_10084278 | Ga0157379_100842782 | 507 |
| 1150 | 3300025934 | Ga0207686_10000033 | Ga0207686_1000003367 | 507 |
| 1151 | 3300026089 | Ga0207648_10000766 | Ga0207648_1000076634 | 507 |
| 1152 | 3300046455 | Ga0495603_0000030 | Ga0495603_0000030_7661_9208 | 507 |
| 1153 | 3300046463 | Ga0495653_0012191 | Ga0495653_0012191_4441_5991 | 507 |
| 1154 | 3300046517 | Ga0495630_0000541 | Ga0495630_0000541_5278_6816 | 507 |
| 1155 | 3300046529 | Ga0495652_0020416 | Ga0495652_0020416_2271_3809 | 507 |
| 1156 | 3300046536 | Ga0495587_0002971 | Ga0495587_0002971_3072_4622 | 507 |
| 1157 | 3300046559 | Ga0495667_0000032 | Ga0495667_0000032_14403_15941 | 507 |
| 1158 | 3300046642 | Ga0495634_0017230 | Ga0495634_0017230_3435_4970 | 507 |
| 1159 | 3300046684 | Ga0495669_0000603 | Ga0495669_0000603_13649_15226 | 507 |
| 1160 | 3300046691 | Ga0495670_0032167 | Ga0495670_0032167_579_2117 | 507 |
| 1161 | 3300047319 | Ga0495674_0001564 | Ga0495674_0001564_17699_19243 | 507 |
| 1162 | 3300047321 | Ga0495676_0000299 | Ga0495676_0000299_18069_19601 | 507 |
| 1163 | 3300047322 | Ga0495680_0008488 | Ga0495680_0008488_5092_6630 | 507 |
| 1164 | 3300047322 | Ga0495680_0041474 | Ga0495680_0041474_1282_2817 | 507 |
| 1165 | 3300047471 | Ga0495684_0135647 | Ga0495684_0135647_32_1582 | 507 |
| 1166 | 3300048903 | Ga0496100_0000002 | Ga0496100_0000002_281135_282661 | 507 |
| 1167 | 3300048904 | Ga0496101_0000001 | Ga0496101_0000001_281135_282661 | 507 |
| 1168 | 3300048909 | Ga0496106_0000061 | Ga0496106_0000061_68581_70107 | 507 |
| 1169 | 3300048910 | Ga0496107_0000013 | Ga0496107_0000013_108179_109705 | 507 |
| 1170 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_569556_571088 | 507 |
| 1171 | 3300048912 | Ga0496109_0000003 | Ga0496109_0000003_244102_245634 | 507 |
| 1172 | 3300048915 | Ga0496112_0000003 | Ga0496112_0000003_59777_61315 | 507 |
| 1173 | 3300048918 | Ga0496115_0000003 | Ga0496115_0000003_238727_240274 | 507 |
| 1174 | 3300048928 | Ga0496125_0082753 | Ga0496125_0082753_454_1983 | 507 |
| 1175 | 3300049588 | Ga0501072_0050104 | Ga0501072_0050104_1326_2861 | 507 |
| 1176 | 3300053085 | Ga0495619_0001746 | Ga0495619_0001746_8356_9897 | 507 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nwx-assembly1.cif.gz_A | crystal structure of phosphoglycerate mutase from staphylococcus aureus in 2-phosphoglyceric acid bound form | 0.9751 | 5 | 503 |
| 4nwx-assembly1.cif.gz_A | crystal structure of phosphoglycerate mutase from staphylococcus aureus in 2-phosphoglyceric acid bound form | 0.9655 | 5 | 503 |
| 7tl8-assembly1.cif.gz_A | 1.95a resolution structure of independent phosphoglycerate mutase from s. aureus in complex with a macrocyclic peptide inhibitor (sa-d3) | 0.9505 | 1 | 503 |
| 7tl8-assembly1.cif.gz_A | 1.95a resolution structure of independent phosphoglycerate mutase from s. aureus in complex with a macrocyclic peptide inhibitor (sa-d3) | 0.9486 | 1 | 503 |
| 7kng-assembly1.cif.gz_A | 2.10a resolution structure of independent phosphoglycerate mutase from c. elegans in complex with a macrocyclic peptide inhibitor (ce-2 y7f) | 0.84 | 2 | 503 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G029_311_465_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.986 | 309 | 462 | 3.40.720.10 |
| 1ejjA02 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.9801 | 4 | 502 | 3.40.720.10 |
| 1ejjA02 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.973 | 4 | 502 | 3.40.720.10 |
| af_G5EFZ1_349_538_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.9705 | 318 | 503 | 3.40.720.10 |
| af_Q2G029_311_465_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.9672 | 309 | 462 | 3.40.720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A645FE59-F1-model_v4 | 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC 5.4.2.12) | 0.9877 | 366 | 504 |
GO:0005829
GO:0006007 GO:0030145 GO:0046537 |
| AF-A0A841ZKN1-F1-model_v4 | deleted | 0.9869 | 301 | 503 |
|
| AF-A0A5C8MQN2-F1-model_v4 | 2,3-bisphosphoglycerate-independent phosphoglycerate mutase | 0.9847 | 349 | 503 |
GO:0005829
GO:0006007 GO:0030145 GO:0046537 |
| AF-A0A6B0BL53-F1-model_v4 | 2,3-bisphosphoglycerate-independent phosphoglycerate mutase | 0.9838 | 372 | 503 |
GO:0005829
GO:0006007 GO:0030145 GO:0046537 |
| AF-A0A357NG31-F1-model_v4 | phosphoglycerate mutase (2,3-diphosphoglycerate-independent) (EC 5.4.2.12) | 0.9813 | 65 | 277 |
GO:0005829
GO:0006007 GO:0006096 GO:0030145 GO:0046537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar