metagRoot

F491214

General Info

Members	Datasets	Scaffolds	Average Seq Length
1173	869	592	233

Family's Representative Sequence

Representative Sequence	iso_pu_bacteria\|2791355253\|2793282920
Length	261
Sequence	GHRAEKWEPVFGKIRCSRGAARFEGTYDMSDEQRGSRSTEAFFGRRKGKPLRPMQAAHLETRLPDLKLDLSTPAPGDLATLFPVPVSRLRLEIGFGGGEHLIHRATTEPDTGFIGVEPFVNSMAKLIGHIEEAGARNIRLYDDDATQVLDWLPEGVIDQIDLLYPDPWPKRKHWKRRFVSSVNLDRFARVLKPGGLFCFASDIDTYVNWTLLHCRDHEAFAWTAKASPDWLTPFENWPSTRYEAKARREGRSSAYLTFKRV

Samples

	Sample ID	Description	Type	Environment
1	2508501122	Ensifer yinggardensis WSM1721	Isolate	Nodule
2	2509276019	Ensifer aridi TW10	Isolate	Nodule
3	2509276021	Rhizobium leguminosarum bv. trifolii WSM597	Isolate	Nodule
4	2509276033	Rhizobium leguminosarum bv. trifolii WSM2012	Isolate	Nodule
5	2510065019	Rhizobium leguminosarum bv. trifolii WSM1689	Isolate	Nodule
6	2510065057	Sinorhizobium meliloti WSM1022	Isolate	Nodule
7	2510461069	Rhizobium sp. PDO1-076	Isolate	Rhizosphere
8	2510461076	Rhizobium leguminosarum bv. trifolii TA1	Isolate	Nodule
9	2510917022	Rhizobium sp. AP16	Isolate	Rhizosphere
10	2510917026	Rhizobium sp. CF80	Isolate	Rhizosphere
11	2510917028	Rhizobium sp. CF122	Isolate	Rhizosphere
12	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
13	2511231052	Sinorhizobium meliloti AK58	Isolate	Nodule
14	2512047086	Sinorhizobium arboris LMG 14919	Isolate	Nodule
15	2512875026	Sinorhizobium medicae WSM1115	Isolate	Nodule
16	2513237084	Rhizobium leguminosarum bv. viciae UPM1131	Isolate	Nodule
17	2513237085	Rhizobium leguminosarum bv. viciae UPM1137	Isolate	Nodule
18	2513237086	Sinorhizobium meliloti MVII-I	Isolate	Nodule
19	2513237088	Rhizobium mesoamericanum STM6155	Isolate	Nodule
20	2513237089	Sinorhizobium medicae DI28	Isolate	Nodule
21	2513237091	Sinorhizobium meliloti RRI128	Isolate	Nodule
22	2513237093	Rhizobium leguminosarum bv. phaseoli FA23	Isolate	Nodule
23	2513237103	Rhizobium leguminosarum bv. viciae VF39	Isolate	Nodule
24	2513237138	Rhizobium favelukesii OR191	Isolate	Nodule
25	2513237140	Sinorhizobium meliloti GVPV12	Isolate	Nodule
26	2513237143	Sinorhizobium meliloti Mlalz-1	Isolate	Nodule
27	2513237144	Rhizobium sullae WSM1592	Isolate	Nodule
28	2513237146	Rhizobium mongolense USDA 1844 (Illumina)	Isolate	Nodule
29	2513237156	Sinorhizobium medicae WSM1369	Isolate	Nodule
30	2513237159	Rhizobium giardinii bv. giardinii H152	Isolate	Nodule
31	2513237160	Sinorhizobium medicae WSM244	Isolate	Nodule
32	2513237162	Rhizobium ruizarguesonis GB30	Isolate	Nodule
33	2515075009	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
34	2515154107	Sinorhizobium meliloti 4H41	Isolate	Nodule
35	2515154113	Rhizobium ruizarguesonis Vc2	Isolate	Nodule
36	2515154114	Rhizobium ruizarguesonis Vh3	Isolate	Nodule
37	2515154116	Rhizobium ruizarguesonis Ps8	Isolate	Nodule
38	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
39	2516143018	Ensifer sp. BR816	Isolate	Nodule
40	2516653046	Sinorhizobium meliloti BO21CC	Isolate	Nodule
41	2516653077	Rhizobium acaciae WSM1481	Isolate	Nodule
42	2516653085	Rhizobium leguminosarum bv. phaseoli 4292	Isolate	Nodule
43	2517093000	Rhizobium leguminosarum bv. trifolii SRDI943	Isolate	Nodule
44	2517287029	Rhizobium leguminosarum bv. trifolii SRDI565	Isolate	Nodule
45	2517487022	Sinorhizobium medicae WSM4191	Isolate	Nodule
46	2519899620	Rhizobium sp. Pop5	Isolate	Nodule
47	2524023207	Ensifer sp. USDA 6670	Isolate	Nodule
48	2524023209	Rhizobium leucaenae USDA 9039	Isolate	Nodule
49	2529292951	Rhizobium sp. CCGE 510	Isolate	Nodule
50	2534681786	Brucella suis 92/29	Isolate	Unclassified
51	2534681796	Rhizobium grahamii CCGE 502	Isolate	Nodule
52	2537561587	Agrobacterium tumefaciens Cherry 2E-2-2	Isolate	Rhizosphere
53	2551306084	Sinorhizobium meliloti 5A14	Isolate	Nodule
54	2551306085	Sinorhizobium meliloti AE608H	Isolate	Nodule
55	2551306086	Sinorhizobium meliloti AK11	Isolate	Nodule
56	2551306087	Sinorhizobium meliloti A0643DD	Isolate	Nodule
57	2551306089	Sinorhizobium meliloti 1A42	Isolate	Nodule
58	2551306090	Sinorhizobium meliloti A0641M	Isolate	Nodule
59	2551306091	Sinorhizobium meliloti C0431A	Isolate	Nodule
60	2551306092	Sinorhizobium meliloti AK75	Isolate	Nodule
61	2551306093	Sinorhizobium meliloti C0438LL	Isolate	Nodule
62	2554235003	Agrobacterium tumefaciens WRT31	Isolate	Rhizosphere
63	2558860100	Sinorhizobium sp. PC2	Isolate	Nodule
64	2558860242	Agrobacterium fabacearum P4	Isolate	Rhizosphere
65	2582581283	Rhizobium sp. OK665	Isolate	Rhizosphere
66	2582581294	Rhizobium sp. CF394	Isolate	Rhizosphere
67	2582581298	Rhizobium alamii YR540	Isolate	Rhizosphere
68	2582581299	Rhizobium leguminosarum OV483	Isolate	Rhizosphere
69	2582581304	Rhizobium sp. YR519	Isolate	Rhizosphere
70	2582581306	Rhizobium sp. YR295	Isolate	Rhizosphere
71	2582581307	Rhizobium sp. YR060	Isolate	Rhizosphere
72	2582581308	Rhizobium sp. OK494	Isolate	Rhizosphere
73	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
74	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
75	2582581865	Rhizobium sp. CF258	Isolate	Rhizosphere
76	2582581866	Rhizobium sp. CF097	Isolate	Rhizosphere
77	2582581867	Rhizobium sp. OV201	Isolate	Rhizosphere
78	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
79	2585427527	Rhizobium lusitanum YR374	Isolate	Rhizosphere
80	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
81	2585427529	Rhizobium alamii YR584	Isolate	Rhizosphere
82	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
83	2585427531	Agrobacterium rhizogenes YR530	Isolate	Rhizosphere
84	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
85	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
86	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
87	2585427608	Agrobacterium rhizogenes OV677	Isolate	Rhizosphere
88	2585427609	Agrobacterium rhizogenes CF263	Isolate	Rhizosphere
89	2585427634	Neorhizobium galegae bv. orientalis HAMBI 540	Isolate	Nodule
90	2585428125	Agrobacterium rhizogenes CF262	Isolate	Rhizosphere
91	2599185156	Rhizobium sp. NFR03	Isolate	Rhizoplane
92	2599185170	Rhizobium mongolense USDA 1844 (PacBio)	Isolate	Nodule
93	2599185210	Rhizobium sp. NFACC06-2	Isolate	Rhizoplane
94	2599185236	Rhizobium sp. NFR07	Isolate	Rhizoplane
95	2599185352	Sinorhizobium sp. NFACC03	Isolate	Rhizoplane
96	2600254933	Rhizobium sp. NFR12	Isolate	Rhizoplane
97	2600255279	Rhizobium sp. NFIX01	Isolate	Rhizoplane
98	2600255308	Rhizobium sp. NFIX02	Isolate	Rhizoplane
99	2615840624	Rhizobium aethiopicum HBR26	Isolate	Nodule
100	2615840626	Rhizobium lusitanum P1-7	Isolate	Nodule
101	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
102	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
103	2643221557	Ensifer sp. Root558	Isolate	Unclassified
104	2643221558	Rhizobium sp. Root149	Isolate	Unclassified
105	2643221568	Rhizobium sp. Root564	Isolate	Unclassified
106	2643221582	Rhizobium sp. Root651	Isolate	Unclassified
107	2643221599	Rhizobium sp. Root708	Isolate	Unclassified
108	2643221607	Rhizobium sp. Root73	Isolate	Unclassified
109	2643221610	Ensifer sp. Root74	Isolate	Unclassified
110	2643221618	Ensifer sp. Root231	Isolate	Unclassified
111	2643221623	Aminobacter sp. DSM 101952 Root100	Isolate	Unclassified
112	2643221626	Ensifer sp. Root31	Isolate	Unclassified
113	2643221634	Rhizobium sp. Root1203	Isolate	Unclassified
114	2643221636	Rhizobium sp. Root1204	Isolate	Unclassified
115	2643221637	Rhizobium sp. Root1212	Isolate	Unclassified
116	2643221643	Rhizobium sp. Root1220	Isolate	Unclassified
117	2643221653	Rhizobium sp. Root1240	Isolate	Unclassified
118	2643221655	Ensifer sp. Root1252	Isolate	Unclassified
119	2643221659	Ensifer sp. Root127	Isolate	Unclassified
120	2643221668	Ensifer sp. Root423	Isolate	Unclassified
121	2643221675	Ensifer sp. Root1298	Isolate	Unclassified
122	2643221680	Ensifer sp. Root1312	Isolate	Unclassified
123	2643221686	Rhizobium sp. Root1334	Isolate	Unclassified
124	2643221688	Rhizobium sp. Root482	Isolate	Unclassified
125	2643221689	Rhizobium sp. Root483D2	Isolate	Unclassified
126	2643221693	Rhizobium sp. Root491	Isolate	Unclassified
127	2643221698	Ensifer sp. Root142	Isolate	Unclassified
128	2643221712	Ensifer sp. Root258	Isolate	Unclassified
129	2643221718	Rhizobium sp. Root268	Isolate	Unclassified
130	2643221719	Rhizobium sp. Root274	Isolate	Unclassified
131	2643221723	Ensifer sp. Root278	Isolate	Unclassified
132	2643221726	Ensifer sp. Root954	Isolate	Unclassified
133	2657244999	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
134	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
135	2690316117	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
136	2718217882	Rhizobium sp. N741	Isolate	Nodule
137	2718217927	Rhizobium sp. N324	Isolate	Nodule
138	2718217997	Rhizobium phaseoli sv. phaseoli R723	Isolate	Nodule
139	2718218009	Rhizobium sp. N561	Isolate	Nodule
140	2718218199	Rhizobium phaseoli sv. phaseoli N261	Isolate	Nodule
141	2718218232	Rhizobium phaseoli sv. phaseoli N161	Isolate	Nodule
142	2718218233	Rhizobium phaseoli sv. phaseoli R744	Isolate	Nodule
143	2718218235	Rhizobium phaseoli sv. phaseoli R620	Isolate	Nodule
144	2718218269	Rhizobium phaseoli sv. phaseoli N671	Isolate	Nodule
145	2718218363	Rhizobium sp. N113	Isolate	Nodule
146	2718218365	Rhizobium sp. N731	Isolate	Nodule
147	2718218366	Rhizobium sp. N621	Isolate	Nodule
148	2718218423	Rhizobium sp. N941	Isolate	Nodule
149	2721755514	Rhizobium sp. N6212	Isolate	Nodule
150	2721755556	Rhizobium phaseoli sv. phaseoli N931	Isolate	Nodule
151	2721755684	Rhizobium phaseoli sv. phaseoli N841	Isolate	Nodule
152	2721755685	Rhizobium phaseoli sv. phaseoli R611	Isolate	Nodule
153	2721755809	Rhizobium sp. N541	Isolate	Nodule
154	2721755810	Rhizobium sp. N871	Isolate	Nodule
155	2721755819	Rhizobium phaseoli sv. phaseoli N771	Isolate	Nodule
156	2721755822	Rhizobium phaseoli sv. phaseoli R650	Isolate	Nodule
157	2721755823	Rhizobium phaseoli sv. phaseoli R630	Isolate	Nodule
158	2724679232	Rhizobium leguminosarum Vaf12	Isolate	Unclassified
159	2728369352	Rhizobium phaseoli sv. phaseoli N831	Isolate	Nodule
160	2728369365	Rhizobium sp. N1341	Isolate	Nodule
161	2728369397	Rhizobium sp. N1314	Isolate	Nodule
162	2738541293	Rhizobium sp. GV031	Isolate	Unclassified
163	2738541317	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
164	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
165	2738543024	Aminobacter sp. AP02	Isolate	Unclassified
166	2751185821	Ensifer shofinae CCBAU 251167	Isolate	Unclassified
167	2765235942	Rhizobium sp. WYCCWR10014	Isolate	Nodule
168	2767802442	Phyllobacterium brassicacearum 29-15	Isolate	Rhizoplane
169	2775507049	Rhizobium sp. ACO-34A	Isolate	Unclassified
170	2775507266	Rhizobium tropici PRF 81	Isolate	Nodule
171	2791355082	Ensifer alkalisoli YIC4027	Isolate	Nodule
172	2791355091	Sinorhizobium sp. FG01	Isolate	Nodule
173	2791355092	Sinorhizobium sp. NG07B	Isolate	Nodule
174	2791355094	Sinorhizobium sp. BJ1	Isolate	Nodule
175	2791355253	Rhizobium rhizosphaerae RD15	Isolate	Rhizosphere
176	2791355256	Rhizobium sp. M10	Isolate	Nodule
177	2791355259	Rhizobium hidalgonense FH14	Isolate	Nodule
178	2791355260	Rhizobium sp. L9	Isolate	Nodule
179	2791355261	Rhizobium sp. J15	Isolate	Nodule
180	2791355262	Rhizobium sp. M1	Isolate	Nodule
181	2791355263	Rhizobium chutanense C5	Isolate	Nodule
182	2791355264	Rhizobium sp. S9	Isolate	Nodule
183	2791355265	Rhizobium sp. H4	Isolate	Nodule
184	2791355266	Rhizobium sp. L43	Isolate	Nodule
185	2791355267	Rhizobium sp. L18	Isolate	Nodule
186	2802428858	Sinorhizobium medicae M14-1	Isolate	Nodule
187	2802428859	Sinorhizobium medicae SF3.41	Isolate	Nodule
188	2802428860	Sinorhizobium medicae M19-1	Isolate	Nodule
189	2802428861	Sinorhizobium medicae USDA1037	Isolate	Nodule
190	2802428862	Sinorhizobium medicae M7-4	Isolate	Nodule
191	2802428863	Sinorhizobium medicae M26-2	Isolate	Nodule
192	2802429268	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
193	2802429605	Rhizobium sophoriradicis L101	Isolate	Nodule
194	2802429606	Rhizobium sophoriradicis JJW1	Isolate	Nodule
195	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
196	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
197	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
198	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
199	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
200	2808606387	Rhizobium sp. SJZ105	Isolate	Rhizosphere
201	2818991272	Rhizobium sp. SLBN-4	Isolate	Unclassified
202	2818991439	Agrobacterium tumefaciens 1187	Isolate	Unclassified
203	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
204	2818991453	Rhizobium lusitanum 1158	Isolate	Unclassified
205	2818991461	Neorhizobium alkalisoli 1225	Isolate	Unclassified
206	2821123053	Rhizobium cellulosilyticum 1193	Isolate	Unclassified
207	2837651117	Pseudohoeflea suaedae YC6898	Isolate	Unclassified
208	2838016132	Rhizobium phaseoli SEMIA 4071	Isolate	Nodule
209	2838022645	Rhizobium aethiopicum SEMIA 4074	Isolate	Nodule
210	2838029111	Rhizobium tropici SEMIA 4079	Isolate	Nodule
211	2838035591	Rhizobium mongolense SEMIA 4087	Isolate	Nodule
212	2838042994	Rhizobium esperanzae SEMIA 4089	Isolate	Nodule
213	2838048938	Rhizobium pisi 27/80	Isolate	Nodule
214	2838061910	Rhizobium phaseoli L15	Isolate	Nodule
215	2838068647	Rhizobium esperanzae VC28	Isolate	Nodule
216	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
217	2838661181	Rhizobium mongolense SEMIA 402	Isolate	Nodule
218	2838668709	Rhizobium sophoriradicis SEMIA 403	Isolate	Nodule
219	2838675328	Agrobacterium radiobacter SEMIA 410	Isolate	Nodule
220	2838680041	Rhizobium leguminosarum SEMIA 415	Isolate	Nodule
221	2838686498	Rhizobium leguminosarum SEMIA 416	Isolate	Nodule
222	2838694306	Rhizobium leguminosarum SEMIA 421	Isolate	Nodule
223	2838701080	Rhizobium aethiopicum SEMIA 428	Isolate	Nodule
224	2838707686	Rhizobium leguminosarum SEMIA 430	Isolate	Nodule
225	2838714209	Agrobacterium radiobacter SEMIA 435	Isolate	Nodule
226	2838719591	Agrobacterium radiobacter SEMIA 436	Isolate	Nodule
227	2838724970	Agrobacterium radiobacter SEMIA 437	Isolate	Nodule
228	2838729681	Rhizobium leguminosarum SEMIA 445	Isolate	Nodule
229	2838736955	Rhizobium cellulosilyticum SEMIA 448	Isolate	Nodule
230	2838742623	Rhizobium leguminosarum SEMIA 449	Isolate	Nodule
231	2841840854	Rhizobium cellulosilyticum SEMIA 444	Isolate	Nodule
232	2841846520	Agrobacterium radiobacter SEMIA 440	Isolate	Nodule
233	2841851746	Rhizobium leguminosarum SEMIA 498	Isolate	Nodule
234	2841859092	Agrobacterium radiobacter SEMIA 4026	Isolate	Nodule
235	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
236	2842077413	Rhizobium leguminosarum SEMIA 422	Isolate	Nodule
237	2842110456	Rhizobium esperanzae SEMIA 414	Isolate	Nodule
238	2842118031	Rhizobium esperanzae SEMIA 420	Isolate	Nodule
239	2842124991	Agrobacterium radiobacter SEMIA 434	Isolate	Nodule
240	2842130223	Agrobacterium radiobacter SEMIA 441	Isolate	Nodule
241	2842140634	Rhizobium cellulosilyticum SEMIA 452	Isolate	Nodule
242	2842146304	Rhizobium sophoriradicis SEMIA 454	Isolate	Nodule
243	2842152218	Agrobacterium radiobacter SEMIA 457	Isolate	Nodule
244	2842156927	Rhizobium leguminosarum SEMIA 459	Isolate	Nodule
245	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
246	2842170452	Agrobacterium radiobacter SEMIA 461	Isolate	Nodule
247	2842175837	Agrobacterium radiobacter SEMIA 462	Isolate	Nodule
248	2842180545	Rhizobium leguminosarum SEMIA 463	Isolate	Nodule
249	2842187318	Agrobacterium radiobacter SEMIA 464	Isolate	Nodule
250	2842192696	Rhizobium esperanzae SEMIA 468	Isolate	Nodule
251	2842198810	Rhizobium aethiopicum SEMIA 470	Isolate	Nodule
252	2842205361	Rhizobium etli SEMIA 471	Isolate	Nodule
253	2842211629	Agrobacterium radiobacter SEMIA 472	Isolate	Nodule
254	2842217011	Rhizobium leguminosarum SEMIA 475	Isolate	Nodule
255	2842224351	Agrobacterium radiobacter SEMIA 480	Isolate	Nodule
256	2842229732	Rhizobium leguminosarum SEMIA 481	Isolate	Nodule
257	2842237096	Rhizobium leguminosarum SEMIA 482	Isolate	Nodule
258	2842243621	Rhizobium leguminosarum SEMIA 483	Isolate	Nodule
259	2842250916	Rhizobium etli SEMIA 484	Isolate	Nodule
260	2842257432	Rhizobium leguminosarum SEMIA 485	Isolate	Nodule
261	2842264693	Rhizobium phaseoli SEMIA 487	Isolate	Nodule
262	2842271015	Rhizobium leguminosarum SEMIA 488	Isolate	Nodule
263	2842278818	Rhizobium etli SEMIA 489	Isolate	Nodule
264	2842285085	Rhizobium lentis SEMIA 490	Isolate	Nodule
265	2842291075	Rhizobium leguminosarum SEMIA 491	Isolate	Nodule
266	2842298080	Rhizobium leucaenae SEMIA 492	Isolate	Nodule
267	2842304105	Rhizobium leguminosarum SEMIA 499	Isolate	Nodule
268	2842311132	Rhizobium phaseoli SEMIA 4002	Isolate	Nodule
269	2842317721	Rhizobium etli SEMIA 4004	Isolate	Nodule
270	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
271	2842357229	Rhizobium leucaenae SEMIA 4015	Isolate	Nodule
272	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
273	2842370503	Rhizobium leguminosarum SEMIA 4022	Isolate	Nodule
274	2842377471	Rhizobium leguminosarum SEMIA 4024	Isolate	Nodule
275	2842384541	Rhizobium leguminosarum SEMIA 4025	Isolate	Nodule
276	2842395702	Rhizobium ecuadorense SEMIA 4029	Isolate	Nodule
277	2842402390	Rhizobium lentis SEMIA 4033	Isolate	Nodule
278	2842409023	Rhizobium lentis SEMIA 4034	Isolate	Nodule
279	2842415677	Rhizobium lentis SEMIA 4036	Isolate	Nodule
280	2842422224	Rhizobium esperanzae SEMIA 4042	Isolate	Nodule
281	2842428310	Rhizobium phaseoli SEMIA 4050	Isolate	Nodule
282	2842434925	Rhizobium esperanzae SEMIA 4051	Isolate	Nodule
283	2842441272	Rhizobium esperanzae SEMIA 4053	Isolate	Nodule
284	2842462802	Rhizobium phaseoli SEMIA 4057	Isolate	Nodule
285	2842469257	Rhizobium phaseoli SEMIA 4058	Isolate	Nodule
286	2842475841	Rhizobium tropici SEMIA 4059	Isolate	Nodule
287	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
288	2842489311	Rhizobium sophoriradicis SEMIA 4061	Isolate	Nodule
289	2842495871	Rhizobium etli SEMIA 4062	Isolate	Nodule
290	2842502639	Rhizobium tropici SEMIA 4063	Isolate	Nodule
291	2842509118	Rhizobium paranaense SEMIA 4064	Isolate	Nodule
292	2842515876	Agrobacterium radiobacter SEMIA 4072	Isolate	Nodule
293	2842521101	Rhizobium giardinii SEMIA 4084	Isolate	Nodule
294	2842922631	Pararhizobium sp. R-72066	Isolate	Unclassified
295	2844163670	Ensifer sp. 1H6	Isolate	Unclassified
296	2844454524	Rhizobium leguminosarum bv. viciae BIHB 1217	Isolate	Nodule
297	2847417321	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
298	2848992105	Sinorhizobium fredii CCBAU 25509	Isolate	Unclassified
299	2850079185	Ensifer aridi JNVU TP6	Isolate	Unclassified
300	2852387548	Rhizobium jaguaris CCGE525	Isolate	Unclassified
301	2854896431	Neorhizobium alkalisoli DSM 21826	Isolate	Unclassified
302	2854911287	Brucella lupini LUP21	Isolate	Unclassified
303	2854916844	Neorhizobium huautlense DSM 21817	Isolate	Unclassified
304	2855825444	Sinorhizobium meliloti CXM1-105	Isolate	Nodule
305	2855839649	Sinorhizobium meliloti AK555	Isolate	Unclassified
306	2855872281	Sinorhizobium fredii PCH1	Isolate	Nodule
307	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
308	2857531043	Neorhizobium sp. R-72160	Isolate	Unclassified
309	2858800743	Sinorhizobium meliloti AK170	Isolate	Unclassified
310	2891048133	Martelella lutilitoris GH2-6	Isolate	Rhizosphere
311	2891373044	Shinella sp. AETb1-6	Isolate	Rhizosphere
312	2896384573	Ensifer sp. MPMI2T	Isolate	Unclassified
313	2899792073	Agrobacterium deltaense CNPSo 3391	Isolate	Nodule
314	2899803654	Agrobacterium sp. a22-2	Isolate	Unclassified
315	2899845264	Agrobacterium fabacearum CNPSo 675	Isolate	Unclassified
316	2913295892	Sinorhizobium kostiensis DSM 13372	Isolate	Nodule
317	2913308742	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
318	2915650412	Ochrobactrum sp. CM-21-5	Isolate	Rhizosphere
319	2915980308	Sinorhizobium medicae USDA1149	Isolate	Nodule
320	2915986958	Sinorhizobium meliloti USDA1659	Isolate	Nodule
321	2915993759	Sinorhizobium meliloti USDA1336	Isolate	Nodule
322	2916000859	Sinorhizobium meliloti USDA1562	Isolate	Nodule
323	2916007675	Sinorhizobium meliloti USDA1289	Isolate	Nodule
324	2916014648	Sinorhizobium meliloti USDA1583	Isolate	Nodule
325	2916021584	Sinorhizobium meliloti USDA1550	Isolate	Nodule
326	2916028427	Sinorhizobium meliloti USDA1613	Isolate	Nodule
327	2916035215	Sinorhizobium meliloti 3011	Isolate	Nodule
328	2916041962	Sinorhizobium meliloti USDA1795	Isolate	Nodule
329	2916048683	Sinorhizobium meliloti USDA1796	Isolate	Nodule
330	2916055098	Sinorhizobium meliloti USDA1770	Isolate	Nodule
331	2916061851	Sinorhizobium medicae USDA1638	Isolate	Nodule
332	2916068649	Sinorhizobium meliloti USDA1220	Isolate	Nodule
333	2916076590	Sinorhizobium meliloti USDA1661	Isolate	Nodule
334	2919100787	Rhizobium sp. 1399	Isolate	Rhizosphere
335	2919114240	Agrobacterium tumefaciens 1457	Isolate	Rhizosphere
336	2919166419	Agrobacterium cavarae 2074	Isolate	Unclassified
337	2919171160	Neorhizobium sp. 2083	Isolate	Unclassified
338	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
339	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
340	2920822456	Ensifer sesbaniae CCBAU 65729	Isolate	Unclassified
341	2921201388	Sinorhizobium meliloti USDA1692	Isolate	Nodule
342	2921208531	Sinorhizobium meliloti USDA1660	Isolate	Nodule
343	2921237296	Sinorhizobium meliloti USDA1508	Isolate	Nodule
344	2921244191	Sinorhizobium meliloti 2119	Isolate	Nodule
345	2921250672	Sinorhizobium medicae USDA1169	Isolate	Nodule
346	2921257292	Sinorhizobium meliloti USDA1320	Isolate	Nodule
347	2921263974	Sinorhizobium meliloti USDA1107	Isolate	Nodule
348	2921282425	Sinorhizobium meliloti USDA1203	Isolate	Nodule
349	2921289301	Sinorhizobium meliloti USDA1730	Isolate	Nodule
350	2921296804	Sinorhizobium meliloti USDA1200	Isolate	Nodule
351	2923556063	Rhizobium tibeticum 3740	Isolate	Unclassified
352	2924144063	Sinorhizobium meliloti USDA1022	Isolate	Nodule
353	2924150972	Sinorhizobium meliloti USDA1700	Isolate	Nodule
354	2924158325	Sinorhizobium meliloti USDA1146	Isolate	Nodule
355	2924165586	Sinorhizobium meliloti USDA1264	Isolate	Nodule
356	2924172951	Sinorhizobium meliloti USDA1626	Isolate	Nodule
357	2924179722	Sinorhizobium meliloti USDA1280	Isolate	Nodule
358	2924186466	Sinorhizobium meliloti USDA1389	Isolate	Nodule
359	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
360	2924200457	Sinorhizobium meliloti USDA1007	Isolate	Nodule
361	2924207177	Sinorhizobium meliloti USDA1589	Isolate	Nodule
362	2924214083	Sinorhizobium meliloti USDA1702	Isolate	Nodule
363	2924221636	Sinorhizobium meliloti USDA1416	Isolate	Nodule
364	2924228884	Sinorhizobium meliloti USDA1581	Isolate	Nodule
365	2926754445	Agrobacterium radiobacter SLBN-94	Isolate	Rhizosphere
366	2926760298	Agrobacterium tumefaciens SLBN-170	Isolate	Rhizosphere
367	2929138655	Agrobacterium sp. R-72433 Hybrid assembly	Isolate	Unclassified
368	2933006813	Rhizobium sp. SEMIA 439	Isolate	Unclassified
369	2933011516	Rhizobium sp. SEMIA 4032	Isolate	Unclassified
370	2933016740	Rhizobium sp. SEMIA 4085	Isolate	Nodule
371	2933570622	Rhizobium leguminosarum SEMIA 409	Isolate	Nodule
372	2933586486	Rhizobium leguminosarum SEMIA 4039	Isolate	Nodule
373	2933594066	Agrobacterium fabrum 35/80	Isolate	Nodule
374	2933599457	Rhizobium phaseoli M3	Isolate	Nodule
375	2935894831	Rhizobium leguminosarum SEMIA 419	Isolate	Nodule
376	2935901341	Rhizobium leguminosarum SEMIA 4082	Isolate	Nodule
377	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
378	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
379	2936381700	Rhizobium chutanense C16	Isolate	Unclassified
380	2936996657	Sinorhizobium meliloti USDA1025	Isolate	Nodule
381	2937002841	Sinorhizobium meliloti USDA1006	Isolate	Nodule
382	2937009748	Sinorhizobium meliloti USDA1162	Isolate	Nodule
383	2937016420	Sinorhizobium meliloti USDA1027	Isolate	Nodule
384	2937023124	Sinorhizobium meliloti USDA1335	Isolate	Nodule
385	2937029754	Sinorhizobium medicae USDA1624	Isolate	Nodule
386	2937036028	Sinorhizobium medicae USDA1608	Isolate	Nodule
387	2937042894	Sinorhizobium meliloti USDA1687	Isolate	Nodule
388	2937049772	Sinorhizobium meliloti USDA1691	Isolate	Nodule
389	2937056579	Sinorhizobium meliloti USDA1357	Isolate	Nodule
390	2937063883	Sinorhizobium meliloti USDA1808	Isolate	Nodule
391	2937071275	Sinorhizobium meliloti USDA1623	Isolate	Nodule
392	2937078374	Sinorhizobium medicae USDA1004	Isolate	Nodule
393	2937084907	Sinorhizobium medicae USDA1664	Isolate	Nodule
394	2937091812	Sinorhizobium meliloti USDA1221	Isolate	Nodule
395	2937098957	Sinorhizobium meliloti USDA1519	Isolate	Nodule
396	2937106411	Sinorhizobium meliloti USDA1214	Isolate	Nodule
397	2937113482	Sinorhizobium meliloti USDA1180	Isolate	Nodule
398	2937119839	Sinorhizobium meliloti USDA1790	Isolate	Nodule
399	2937126314	Sinorhizobium meliloti USDA1612	Isolate	Nodule
400	2937843397	Mesorhizobium xinjiangense lm94	Isolate	Rhizosphere
401	2941499720	Ensifer sp. 4252	Isolate	Rhizosphere
402	2957375807	Sinorhizobium medicae USDA1632	Isolate	Nodule
403	2957382221	Sinorhizobium meliloti USDA1919	Isolate	Nodule
404	2957388812	Sinorhizobium meliloti USDA1195	Isolate	Nodule
405	2957395598	Sinorhizobium meliloti USDA1237	Isolate	Nodule
406	2957402308	Sinorhizobium meliloti USDA1794	Isolate	Nodule
407	2957408893	Sinorhizobium meliloti USDA1163	Isolate	Nodule
408	2957415311	Sinorhizobium meliloti USDA1724	Isolate	Nodule
409	2957422303	Sinorhizobium meliloti USDA1497	Isolate	Nodule
410	2957430029	Sinorhizobium meliloti USDA1590	Isolate	Nodule
411	2957437181	Sinorhizobium medicae USDA1694	Isolate	Nodule
412	2957443900	Sinorhizobium meliloti USDA1734	Isolate	Nodule
413	2957450854	Sinorhizobium meliloti USDA1655	Isolate	Nodule
414	2957457609	Sinorhizobium meliloti USDA1751	Isolate	Nodule
415	2957464669	Sinorhizobium meliloti USDA1520	Isolate	Nodule
416	2957471148	Sinorhizobium meliloti USDA1204	Isolate	Nodule
417	2957478035	Sinorhizobium meliloti USDA1171	Isolate	Nodule
418	2957484790	Sinorhizobium meliloti USDA1464	Isolate	Nodule
419	2957491536	Sinorhizobium meliloti USDA1804	Isolate	Nodule
420	2957498199	Sinorhizobium meliloti USDA1561	Isolate	Nodule
421	2957505466	Sinorhizobium meliloti USDA1696	Isolate	Nodule
422	2960584000	Sinorhizobium meliloti USDA1530	Isolate	Nodule
423	2960591022	Sinorhizobium medicae USDA1066	Isolate	Nodule
424	2960597568	Sinorhizobium meliloti 3085	Isolate	Nodule
425	2960603979	Sinorhizobium meliloti USDA1580	Isolate	Nodule
426	2960610863	Sinorhizobium meliloti USDA1792	Isolate	Nodule
427	2960617483	Sinorhizobium meliloti USDA1719	Isolate	Nodule
428	2960624210	Sinorhizobium meliloti USDA1415	Isolate	Nodule
429	2960631154	Sinorhizobium medicae USDA1629	Isolate	Nodule
430	2960637947	Sinorhizobium meliloti USDA1202	Isolate	Nodule
431	2960645483	Sinorhizobium meliloti USDA1703	Isolate	Nodule
432	2960652885	Sinorhizobium meliloti USDA1199	Isolate	Nodule
433	2960660292	Sinorhizobium meliloti USDA1883	Isolate	Nodule
434	2960667422	Sinorhizobium meliloti USDA1170	Isolate	Nodule
435	2960674078	Sinorhizobium meliloti USDA1666	Isolate	Nodule
436	2960680706	Sinorhizobium medicae USDA1150	Isolate	Nodule
437	2960687367	Sinorhizobium meliloti USDA1462	Isolate	Nodule
438	2960693952	Sinorhizobium medicae USDA1630	Isolate	Nodule
439	2964607997	Sinorhizobium meliloti USDA1212	Isolate	Nodule
440	2964615318	Sinorhizobium meliloti USDA1248	Isolate	Nodule
441	2964621998	Sinorhizobium meliloti USDA1235	Isolate	Nodule
442	2964628898	Sinorhizobium meliloti USDA1191	Isolate	Nodule
443	2964636051	Sinorhizobium meliloti USDA1594	Isolate	Nodule
444	2964643177	Sinorhizobium meliloti USDA1760	Isolate	Nodule
445	2964649959	Sinorhizobium meliloti USDA1591	Isolate	Nodule
446	2964656573	Sinorhizobium meliloti USDA1308	Isolate	Nodule
447	2964663802	Sinorhizobium meliloti USDA1688	Isolate	Nodule
448	2964670856	Sinorhizobium meliloti USDA1211	Isolate	Nodule
449	2964678106	Sinorhizobium meliloti USDA1210	Isolate	Nodule
450	2964685014	Sinorhizobium meliloti USDA1232	Isolate	Nodule
451	2964691889	Sinorhizobium meliloti USDA1379	Isolate	Nodule
452	2964698721	Sinorhizobium meliloti USDA1656	Isolate	Nodule
453	2964705432	Sinorhizobium meliloti USDA1614	Isolate	Nodule
454	2964712639	Sinorhizobium meliloti USDA1616	Isolate	Nodule
455	2964719344	Sinorhizobium meliloti USDA1456	Isolate	Nodule
456	2967664464	Sinorhizobium meliloti USDA1208	Isolate	Nodule
457	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
458	2967678726	Sinorhizobium meliloti USDA1467	Isolate	Nodule
459	2967686174	Sinorhizobium medicae USDA1641	Isolate	Nodule
460	2967693043	Sinorhizobium meliloti USDA1183	Isolate	Nodule
461	2967699805	Sinorhizobium meliloti USDA1695	Isolate	Nodule
462	2967706974	Sinorhizobium meliloti USDA1206	Isolate	Nodule
463	2967714385	Sinorhizobium meliloti USDA1023	Isolate	Nodule
464	2967721400	Sinorhizobium meliloti USDA1742	Isolate	Nodule
465	2967728569	Sinorhizobium medicae USDA1607	Isolate	Nodule
466	2967735183	Sinorhizobium meliloti USDA1710	Isolate	Nodule
467	2967742019	Sinorhizobium meliloti USDA1676	Isolate	Nodule
468	2967748971	Sinorhizobium meliloti USDA1024A	Isolate	Nodule
469	2967755722	Sinorhizobium meliloti USDA1302	Isolate	Nodule
470	2967762386	Sinorhizobium meliloti USDA1397	Isolate	Nodule
471	2967769361	Sinorhizobium meliloti USDA1005	Isolate	Nodule
472	2967775926	Sinorhizobium meliloti USDA1678	Isolate	Nodule
473	2970019648	Sinorhizobium meliloti USDA1603	Isolate	Nodule
474	2970026789	Sinorhizobium medicae USDA1611	Isolate	Nodule
475	2970033650	Sinorhizobium meliloti USDA1565	Isolate	Nodule
476	2970040964	Sinorhizobium meliloti USDA1501	Isolate	Nodule
477	2970047711	Sinorhizobium meliloti USDA1793	Isolate	Nodule
478	2970054988	Sinorhizobium meliloti USDA1031	Isolate	Nodule
479	2970061556	Sinorhizobium meliloti USDA1810	Isolate	Nodule
480	2970068827	Sinorhizobium meliloti USDA1227	Isolate	Nodule
481	2970076120	Sinorhizobium meliloti USDA1706	Isolate	Nodule
482	2970082768	Sinorhizobium meliloti USDA1803	Isolate	Nodule
483	2970088815	Sinorhizobium meliloti USDA1819	Isolate	Nodule
484	2970095765	Sinorhizobium meliloti USDA1225	Isolate	Nodule
485	2970102677	Sinorhizobium meliloti USDA1325	Isolate	Nodule
486	2970109326	Sinorhizobium meliloti USDA1186	Isolate	Nodule
487	2970116247	Sinorhizobium meliloti USDA1566	Isolate	Nodule
488	2970122695	Sinorhizobium medicae 3082	Isolate	Nodule
489	2970129317	Sinorhizobium meliloti USDA1008	Isolate	Nodule
490	2970136068	Sinorhizobium meliloti USDA1699	Isolate	Nodule
491	2970143518	Sinorhizobium medicae USDA1652	Isolate	Nodule
492	2970149975	Sinorhizobium meliloti USDA1215	Isolate	Nodule
493	2970156795	Sinorhizobium meliloti USDA1491	Isolate	Nodule
494	2970164137	Sinorhizobium meliloti USDA1018	Isolate	Nodule
495	2970170962	Sinorhizobium meliloti USDA1571	Isolate	Nodule
496	2970177841	Sinorhizobium meliloti USDA1533	Isolate	Nodule
497	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
498	2970191845	Sinorhizobium meliloti USDA1187	Isolate	Nodule
499	2977516862	Sinorhizobium meliloti USDA1791	Isolate	Nodule
500	2977523885	Sinorhizobium meliloti USDA1777	Isolate	Nodule
501	2977530762	Sinorhizobium medicae USDA1606	Isolate	Nodule
502	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
503	2977544691	Sinorhizobium medicae USDA1631	Isolate	Nodule
504	2977551784	Sinorhizobium meliloti USDA1035	Isolate	Nodule
505	2977558990	Sinorhizobium meliloti USDA1222	Isolate	Nodule
506	2977565890	Sinorhizobium meliloti USDA1617	Isolate	Nodule
507	2977572785	Sinorhizobium meliloti USDA1767	Isolate	Nodule
508	2977579622	Sinorhizobium meliloti USDA1161	Isolate	Nodule
509	2978969890	Agrobacterium sp. SORGH_AS 787	Isolate	Unclassified
510	2979089926	Agrobacterium sp. SORGH_AS 745	Isolate	Unclassified
511	2979095461	Agrobacterium tumefaciens SORGH_AS 749	Isolate	Unclassified
512	2979100975	Agrobacterium pusense SORGH_AS 755	Isolate	Unclassified
513	2984509177	Agrobacterium pusense SORGH_AS260	Isolate	Aerial Root
514	2984518228	Agrobacterium pusense SORGH_AS285	Isolate	Aerial Root
515	2984537506	Agrobacterium sp. SORGH_AS440	Isolate	Aerial Root
516	2984587000	Agrobacterium larrymoorei SORGH_AS974	Isolate	Aerial Root
517	2984601300	Rhizobium pusense SORGH_AS1083	Isolate	Aerial Root
518	2989349275	Shinella kummerowiae CCBAU 25048	Isolate	Unclassified
519	2989771324	Rhizobium rhizolycopersici DBTS2	Isolate	Rhizosphere
520	2989776772	Rhizobium glycinendophyticum CL12	Isolate	Unclassified
521	2995392953	Martelella limonii NBRC 109441	Isolate	Unclassified
522	2996887358	Rhizobium sp. R711	Isolate	Nodule
523	2996893221	Rhizobium sp. R635	Isolate	Nodule
524	3003930520	Sinorhizobium sp. BG8	Isolate	Unclassified
525	3005409236	Rhizobium sp. P32RR-XVIII	Isolate	Rhizosphere
526	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
527	3005445848	Rhizobium sp. WYJ-E13	Isolate	Unclassified
528	3005452660	Rhizobium grahamii BG7	Isolate	Unclassified
529	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
530	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
531	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
532	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
533	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
534	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
535	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
536	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
537	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
538	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
539	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
540	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
541	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
542	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
543	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
544	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
545	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
546	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
547	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
548	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
549	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
550	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
551	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
552	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
553	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
554	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
555	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
556	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
557	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
558	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
559	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
560	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
561	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
562	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
563	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
564	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
565	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
566	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
567	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
568	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
569	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
570	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
571	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
572	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
573	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
574	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
575	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
576	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
577	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
578	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
579	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
580	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
581	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
582	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
583	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
584	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
585	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
586	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
587	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
588	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
589	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
590	3300009765	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule	Metagenome	Nodule
591	3300009766	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule	Metagenome	Nodule
592	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
593	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
594	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
595	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
596	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
597	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
598	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
599	3300013249	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06	Metagenome	Rhizosphere
600	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
601	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
602	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
603	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
604	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
605	3300015690	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05	Metagenome	Rhizosphere
606	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
607	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
608	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
609	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
610	3300022739	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules	Metagenome	Nodule
611	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
612	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
613	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
614	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
615	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
616	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
617	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
618	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
619	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
620	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
621	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
622	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
623	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
624	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
625	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
626	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
627	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
628	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
629	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
630	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
631	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
632	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
633	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
634	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
635	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
636	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
637	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
638	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
639	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
640	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
641	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
642	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
643	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
644	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
645	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
646	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
647	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
648	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
649	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
650	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
651	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
652	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
653	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
654	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
655	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
656	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
657	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
658	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
659	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
660	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
661	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
662	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
663	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
664	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
665	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
666	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
667	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
668	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
669	3300031967	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules	Metagenome	Nodule
670	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
671	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
672	3300033430	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules	Metagenome	Nodule
673	3300033464	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules	Metagenome	Nodule
674	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
675	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
676	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
677	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
678	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
679	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
680	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
681	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
682	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
683	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
684	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
685	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
686	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
687	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
688	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
689	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
690	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
691	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
692	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
693	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
694	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
695	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
696	3300041502	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT	Metatranscriptome	Unclassified
697	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
698	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
699	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
700	3300041510	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT	Metatranscriptome	Unclassified
701	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
702	3300041916	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run	Metatranscriptome	Unclassified
703	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
704	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
705	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
706	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
707	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
708	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
709	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
710	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
711	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
712	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
713	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
714	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
715	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
716	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
717	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
718	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
719	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
720	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
721	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
722	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
723	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
724	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
725	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
726	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
727	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
728	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
729	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
730	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
731	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
732	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
733	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
734	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
735	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
736	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
737	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
738	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
739	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
740	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
741	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
742	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
743	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
744	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
745	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
746	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
747	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
748	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
749	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
750	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
751	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
752	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
753	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
754	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
755	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
756	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
757	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
758	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
759	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
760	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
761	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
762	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
763	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
764	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
765	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
766	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
767	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
768	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
769	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
770	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
771	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
772	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
773	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
774	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
775	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
776	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
777	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
778	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
779	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
780	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
781	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
782	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
783	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
784	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
785	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
786	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
787	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
788	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
789	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
790	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
791	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
792	3300053107	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere	Metagenome	Endosphere
793	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
794	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
795	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
796	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
797	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
798	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
799	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
800	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
801	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
802	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
803	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
804	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
805	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
806	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
807	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
808	3300059492	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
809	3300059503	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
810	3300059507	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
811	3300059508	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
812	3300059639	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
813	3300059640	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
814	3300059643	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
815	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
816	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
817	639633055	Rhizobium leguminosarum bv. viciae 3841	Isolate	Unclassified
818	643692032	Sinorhizobium fredii NGR234	Isolate	Nodule
819	648276728	Sinorhizobium meliloti BL225C	Isolate	Nodule
820	650716007	Agrobacterium fabacearum H13-3	Isolate	Rhizosphere
821	8003570095	Agrobacterium rhizogenes GBBC3284	Isolate	Unclassified
822	8003992118	Sinorhizobium meliloti RRI128	Isolate	Nodule
823	8003999396	Sinorhizobium medicae WSM1115	Isolate	Nodule
824	8005246636	Rhizobium wuzhouense W44	Isolate	Rhizosphere
825	8005258706	Rhizobium sp. R693	Isolate	Nodule
826	8005275841	Rhizobium sp. N4311	Isolate	Nodule
827	8005282627	Rhizobium phaseoli NC1	Isolate	Nodule
828	8005289223	Rhizobium bangladeshense 1002	Isolate	Nodule
829	8005301065	Rhizobium bangladeshense 1017	Isolate	Nodule
830	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
831	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
832	8005321885	Rhizobium sp. R72	Isolate	Nodule
833	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
834	8005382845	Rhizobium sp. R634	Isolate	Nodule
835	8005395548	Rhizobium sp. R339	Isolate	Nodule
836	8005430974	Rhizobium phaseoli Y20	Isolate	Nodule
837	8005460587	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
838	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
839	8005497431	Rhizobium phaseoli CCGM8	Isolate	Unclassified
840	8005542996	Rhizobium grahamii CCGM3	Isolate	Unclassified
841	8005556819	Rhizobium sp. WYCCWR 11128	Isolate	Nodule
842	8005563573	Rhizobium sp. WYCCWR 11152	Isolate	Nodule
843	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
844	8005619151	Rhizobium phaseoli CCGM2	Isolate	Unclassified
845	8005626139	Rhizobium phaseoli Y18	Isolate	Nodule
846	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
847	8005658619	Rhizobium terrae CC-HIH110	Isolate	Unclassified
848	8005668836	Rhizobium phaseoli CCGM9	Isolate	Unclassified
849	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
850	8005688590	Rhizobium bangladeshense 1024	Isolate	Nodule
851	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
852	8018127388	Rhizobium aegyptiacum 950	Isolate	Nodule
853	8018150411	Rhizobium straminoryzae SM12	Isolate	Rhizosphere
854	8018163183	Rhizobium sp. WYCCWR 11146	Isolate	Nodule
855	8018176218	Rhizobium sp. N122	Isolate	Nodule
856	8023680758	Rhizobium leguminosarum SARCC-132	Isolate	Nodule
857	8024479707	Rhizobium leguminosarum Tri-43	Isolate	Nodule
858	8024486573	Rhizobium tubonense CCBAU 85046	Isolate	Nodule
859	8024501048	Rhizobium sp. H4	Isolate	Nodule
860	8046767195	Rhizobium calliandrae CCGE524	Isolate	Unclassified
861	8049293176	Ensifer alkalisoli YIC4027	Isolate	Nodule
862	8054460903	Agrobacterium vaccinii B7.6	Isolate	Unclassified
863	8054558443	Rhizobium alarense TRM95111	Isolate	Nodule
864	8055431914	Allorhizobium sonneratiae BGMRC 0089	Isolate	Unclassified
865	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
866	8056382006	Rhizobium croatiense 13T	Isolate	Nodule
867	8056875544	Rhizobium halophilum TRM95001	Isolate	Rhizosphere
868	8057575449	Rhizobium mayense CCGE526	Isolate	Nodule
869	8057874678	Rhizobium acaciae 1AS12	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	49.53
Metatranscriptomes	0.94
Isolates	49.53

Biome Distribution

Category	Percentage (%)
Aerial Root	0.43
Bulb	0
Endosphere	20.29
Nodule	37.34
Rhizoplane	1.88
Rhizosphere	22.25
Stem	0
Stem Tuber	0
Unclassified	17.82

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10000551	3300001979	Bacteria	16036
2	JGI25155J39150_1000013	3300002704	Bacteria	198215
3	JGI25156J39149_1000011	3300002705	Bacteria	198215
4	JGI25162J39368_1000423	3300002737	Bacteria	34193
5	JGI25162J39368_1002103	3300002737	Bacteria	8485
6	JGI25154J39366_1000030	3300002738	Bacteria	191444
7	JGI25154J39366_1014318	3300002738	Bacteria	836
8	JGI25157J39369_1000013	3300002741	Bacteria	198211
9	JGI25152J39213_1000443	3300002773	Bacteria	24608
10	JGI25152J39213_1001399	3300002773	Bacteria	10438
11	JGI25152J39213_1006537	3300002773	Bacteria	3153
12	JGI25152J39213_1006577	3300002773	Bacteria	3134
13	JGI25152J39213_1012497	3300002773	Bacteria	1817
14	JGI25150J39212_1000178	3300002774	Bacteria	35657
15	JGI25150J39212_1017924	3300002774	Bacteria	1136
16	JGI25159J45721_1000003	3300002987	Bacteria	274069
17	JGI25159J45721_1001009	3300002987	Bacteria	12125
18	JGI25159J45721_1004497	3300002987	Bacteria	4615
19	JGI25151J46595_10000529	3300003187	Bacteria	35657
20	JGI25151J46595_10001346	3300003187	Bacteria	17063
21	JGI25151J46595_10009883	3300003187	Bacteria	4481
22	JGI25151J46595_10024162	3300003187	Bacteria	2490
23	JGI25151J46595_10041702	3300003187	Bacteria	1664
24	JGI25151J46595_10052323	3300003187	Bacteria	1374
25	JGI25165J46597_1000506	3300003214	Bacteria	37362
26	JGI25165J46597_1000605	3300003214	Bacteria	30559
27	JGI25165J46597_1002361	3300003214	Bacteria	6320
28	JGI25153J46596_10001384	3300003215	Bacteria	14509
29	JGI25153J46596_10014807	3300003215	Bacteria	3220
30	JGI25153J46596_10015131	3300003215	Bacteria	3163
31	JGI25153J46596_10015185	3300003215	Bacteria	3154
32	rootH1_10094694	3300003316	Bacteria	3166
33	rootL2_10037071	3300003322	Bacteria	3281
34	rootH1_10029540	3300003323	Bacteria	1376
35	rootH1_10092021	3300003323	Bacteria	2542
36	rootH1_10133046	3300003323	Bacteria	1058
37	JGI25160J50197_1000003	3300003354	Bacteria	482719
38	JGI25160J50197_1000012	3300003354	Bacteria	267582
39	JGI25160J50197_1006200	3300003354	Bacteria	4866
40	JGI25160J50197_1018439	3300003354	Bacteria	2175
41	JGI25161J50226_1000002	3300003374	Bacteria	420324
42	JGI25161J50226_1000186	3300003374	Bacteria	40917
43	JGI25161J50226_1000368	3300003374	Bacteria	23037
44	JGI25161J50226_1006335	3300003374	Bacteria	2157
45	Ga0055529_1001413	3300003763	Bacteria	7601
46	Ga0055526_1000453	3300003771	Bacteria	32668
47	Ga0055526_1001274	3300003771	Bacteria	18065
48	Ga0055526_1004435	3300003771	Bacteria	8432
49	Ga0055526_1030293	3300003771	Bacteria	1582
50	Ga0055526_1039897	3300003771	Bacteria	1190
51	Ga0055524_1002738	3300003775	Bacteria	8904
52	Ga0055524_1004879	3300003775	Bacteria	6092
53	Ga0055524_1007143	3300003775	Bacteria	4781
54	Ga0055524_1012309	3300003775	Bacteria	3289
55	Ga0055524_1050653	3300003775	Bacteria	945
56	Ga0055536_1001918	3300003781	Bacteria	12049
57	Ga0055536_1002021	3300003781	Bacteria	11627
58	Ga0055536_1006238	3300003781	Bacteria	5621
59	Ga0055528_1000285	3300003790	Bacteria	43196
60	Ga0055528_1005258	3300003790	Bacteria	6070
61	Ga0055528_1011455	3300003790	Bacteria	3518
62	Ga0055528_1014058	3300003790	Bacteria	2988
63	Ga0055528_1015462	3300003790	Bacteria	2755
64	Ga0055528_1034961	3300003790	Bacteria	1228
65	Ga0055528_1042964	3300003790	Bacteria	988
66	Ga0055530_10043210	3300003791	Bacteria	1088
67	Ga0055540_1004310	3300003792	Bacteria	6482
68	Ga0055540_1004507	3300003792	Bacteria	6240
69	Ga0055540_1013036	3300003792	Bacteria	2565
70	Ga0055540_1018111	3300003792	Bacteria	1940
71	Ga0055540_1030408	3300003792	Bacteria	1254
72	Ga0055531_10002877	3300003794	Bacteria	11221
73	Ga0055531_10007297	3300003794	Bacteria	6063
74	Ga0058692_1008378	3300003856	Bacteria	2669
75	Ga0055543_1000043	3300004625	Bacteria	116599
76	Ga0055543_1000050	3300004625	Bacteria	107366
77	Ga0055543_1000073	3300004625	Bacteria	88583
78	Ga0055543_1001723	3300004625	Bacteria	8208
79	Ga0065165_1000025	3300005262	Bacteria	246909
80	Ga0065165_1000867	3300005262	Bacteria	39442
81	Ga0065165_1015349	3300005262	Bacteria	2923
82	Ga0065165_1016068	3300005262	Bacteria	2821
83	Ga0065165_1019441	3300005262	Bacteria	2425
84	Ga0070670_100003791	3300005331	Bacteria	12587
85	Ga0070668_100423483	3300005347	Bacteria	1140
86	Ga0070668_100873734	3300005347	Bacteria	802
87	Ga0070671_100302306	3300005355	Bacteria	1362
88	Ga0070667_100317372	3300005367	Bacteria	1406
89	Ga0070713_100207739	3300005436	Bacteria	1771
90	Ga0070710_10029557	3300005437	Bacteria	2942
91	Ga0070698_100022470	3300005471	Bacteria	6598
92	Ga0070699_100013844	3300005518	Bacteria	6938
93	Ga0070665_100003127	3300005548	Bacteria	17829
94	Ga0070665_100029215	3300005548	Bacteria	5549
95	Ga0070665_100208900	3300005548	Bacteria	1953
96	Ga0070665_100270956	3300005548	Bacteria	1699
97	Ga0070665_100297662	3300005548	Bacteria	1616
98	Ga0070664_100334262	3300005564	Bacteria	1375
99	Ga0068856_100087166	3300005614	Bacteria	3103
100	Ga0068852_100240130	3300005616	Bacteria	1731
101	Ga0068851_10108959	3300005834	Bacteria	1477
102	Ga0075365_10000863	3300006038	Bacteria	12619
103	Ga0075365_10049221	3300006038	Bacteria	2776
104	Ga0075365_10102306	3300006038	Bacteria	1963
105	Ga0075365_10186572	3300006038	Bacteria	1450
106	Ga0075368_10001989	3300006042	Bacteria	6590
107	Ga0075363_100082330	3300006048	Bacteria	1761
108	Ga0075363_100147820	3300006048	Bacteria	1325
109	Ga0075364_10001230	3300006051	Bacteria	13772
110	Ga0070712_100332315	3300006175	Bacteria	1239
111	Ga0075362_10014260	3300006177	Bacteria	3203
112	Ga0075362_10213770	3300006177	Bacteria	941
113	Ga0075367_10014306	3300006178	Bacteria	4293
114	Ga0075367_10091290	3300006178	Bacteria	1853
115	Ga0075367_10142178	3300006178	Bacteria	1487
116	Ga0075369_10000259	3300006186	Bacteria	15576
117	Ga0075369_10021106	3300006186	Bacteria	2672
118	Ga0075369_10037149	3300006186	Bacteria	2074
119	Ga0075366_10017386	3300006195	Bacteria	4138
120	Ga0075366_10060101	3300006195	Bacteria	2258
121	Ga0075370_10008148	3300006353	Bacteria	5378
122	Ga0075370_10047542	3300006353	Bacteria	2430
123	Ga0075370_10290204	3300006353	Bacteria	972
124	Ga0079104_1000033	3300006946	Bacteria	202636
125	Ga0079104_1005670	3300006946	Bacteria	4926
126	Ga0079104_1018229	3300006946	Bacteria	1995
127	Ga0099826_10000213	3300006948	Bacteria	25224
128	Ga0099826_10149411	3300006948	Bacteria	1338
129	Ga0099795_10176424	3300007788	Bacteria	890
130	Ga0105251_10013403	3300009011	Bacteria	4589
131	Ga0105244_10170532	3300009036	Bacteria	1035
132	Ga0105240_10000024	3300009093	Bacteria	375919
133	Ga0105247_10180122	3300009101	Bacteria	1410
134	Ga0105243_10050972	3300009148	Bacteria	3271
135	Ga0105243_10062496	3300009148	Bacteria	2981
136	Ga0105248_10189261	3300009177	Bacteria	2319
137	Ga0105237_10002258	3300009545	Bacteria	23981
138	Ga0123341_1000036	3300009765	Bacteria	61619
139	Ga0123342_1005726	3300009766	Bacteria	17776
140	Ga0123342_1008198	3300009766	Bacteria	13323
141	Ga0099796_10010327	3300010159	Bacteria	2563
142	Ga0099796_10053715	3300010159	Bacteria	1406
143	Ga0105239_10006225	3300010375	Bacteria	13886
144	Ga0105239_10638886	3300010375	Bacteria	1215
145	Ga0105246_10193117	3300011119	Bacteria	1577
146	Ga0105246_10272820	3300011119	Bacteria	1353
147	Ga0157373_10034267	3300013100	Bacteria	3647
148	Ga0157371_10000004	3300013102	Bacteria	512593
149	Ga0157371_10007430	3300013102	Bacteria	8873
150	Ga0157370_10004075	3300013104	Bacteria	16934
151	Ga0157370_10009491	3300013104	Bacteria	10383
152	Ga0157369_10083521	3300013105	Bacteria	3416
153	Ga0157369_10154184	3300013105	Bacteria	2427
154	Ga0171463_1001	3300013249	Bacteria	1406070
155	Ga0163163_10592298	3300014325	Bacteria	1172
156	Ga0182008_10026065	3300014497	Bacteria	2966
157	Ga0182008_10061681	3300014497	Bacteria	1848
158	Ga0182006_1070890	3300015261	Bacteria	1293
159	Ga0182007_10009720	3300015262	Bacteria	3855
160	Ga0182005_1001337	3300015265	Bacteria	10072
161	Ga0183363_1214	3300015690	Bacteria	11685
162	Ga0214544_1000105	3300021320	Bacteria	114109
163	Ga0214542_1000029	3300021321	Bacteria	174097
164	Ga0214542_1034148	3300021321	Bacteria	1666
165	Ga0214543_1000027	3300021327	Bacteria	215065
166	Ga0214543_1000040	3300021327	Bacteria	174142
167	Ga0213875_10001711	3300021388	Bacteria	13771
168	Ga0228711_1000013	3300022739	Bacteria	132585
169	Ga0228710_1000008	3300022740	Bacteria	174306
170	Ga0209435_100026	3300025206	Bacteria	198295
171	Ga0209436_100048	3300025208	Bacteria	66177
172	Ga0209436_106879	3300025208	Bacteria	2437
173	Ga0209672_110680	3300025228	Bacteria	1228
174	Ga0209563_101834	3300025230	Bacteria	5229
175	Ga0209437_100050	3300025233	Bacteria	394010
176	Ga0209437_100056	3300025233	Bacteria	363071
177	Ga0209437_116442	3300025233	Bacteria	992
178	Ga0207425_1000305	3300025245	Bacteria	35759
179	Ga0207425_1000800	3300025245	Bacteria	16000
180	Ga0207425_1015048	3300025245	Bacteria	1744
181	Ga0207425_1029928	3300025245	Bacteria	1095
182	Ga0207425_1031095	3300025245	Bacteria	1065
183	Ga0209646_1000084	3300025246	Bacteria	198295
184	Ga0209646_1016213	3300025246	Bacteria	1107
185	Ga0209026_1000080	3300025250	Bacteria	198295
186	Ga0209677_101467	3300025253	Bacteria	10175
187	Ga0209148_1000032	3300025254	Bacteria	557660
188	Ga0209148_1004126	3300025254	Bacteria	3668
189	Ga0209759_1000061	3300025256	Bacteria	198295
190	Ga0209129_1000381	3300025258	Bacteria	35759
191	Ga0209129_1000412	3300025258	Bacteria	33521
192	Ga0209129_1000500	3300025258	Bacteria	28495
193	Ga0209129_1000789	3300025258	Bacteria	19973
194	Ga0209129_1001951	3300025258	Bacteria	10771
195	Ga0209129_1002630	3300025258	Bacteria	8541
196	Ga0209129_1003855	3300025258	Bacteria	6249
197	Ga0209129_1025481	3300025258	Bacteria	1030
198	Ga0209233_1000037	3300025261	Bacteria	554620
199	Ga0209233_1000071	3300025261	Bacteria	363290
200	Ga0209233_1000234	3300025261	Bacteria	95145
201	Ga0209565_1015636	3300025263	Bacteria	1706
202	Ga0209455_1000098	3300025272	Bacteria	213890
203	Ga0209455_1013484	3300025272	Bacteria	1894
204	Ga0209673_1000024	3300025273	Bacteria	409632
205	Ga0209673_1000135	3300025273	Bacteria	160333
206	Ga0209673_1000677	3300025273	Bacteria	49184
207	Ga0209673_1001830	3300025273	Bacteria	17406
208	Ga0209673_1002722	3300025273	Bacteria	11658
209	Ga0209673_1012261	3300025273	Bacteria	3465
210	Ga0209673_1017075	3300025273	Bacteria	2686
211	Ga0209673_1031600	3300025273	Bacteria	1645
212	Ga0209130_1000002	3300025284	Bacteria	722648
213	Ga0209130_1000005	3300025284	Bacteria	599620
214	Ga0209130_1000028	3300025284	Bacteria	325668
215	Ga0209130_1021502	3300025284	Bacteria	1455
216	Ga0209675_1020323	3300025291	Bacteria	1803
217	Ga0209676_1004355	3300025292	Bacteria	7930
218	Ga0209676_1005618	3300025292	Bacteria	6470
219	Ga0209676_1013521	3300025292	Bacteria	3134
220	Ga0209025_1000037	3300025294	Bacteria	383429
221	Ga0209025_1000060	3300025294	Bacteria	305017
222	Ga0209025_1000105	3300025294	Bacteria	224157
223	Ga0209025_1000235	3300025294	Bacteria	129981
224	Ga0209025_1000748	3300025294	Bacteria	54646
225	Ga0209025_1001229	3300025294	Bacteria	35759
226	Ga0209025_1006675	3300025294	Bacteria	8862
227	Ga0209025_1013070	3300025294	Bacteria	5248
228	Ga0209025_1025318	3300025294	Bacteria	3025
229	Ga0209025_1047371	3300025294	Bacteria	1756
230	Ga0209564_1000093	3300025295	Bacteria	245793
231	Ga0209564_1000138	3300025295	Bacteria	181512
232	Ga0209564_1000746	3300025295	Bacteria	46142
233	Ga0209564_1001016	3300025295	Bacteria	34616
234	Ga0209564_1007119	3300025295	Bacteria	5842
235	Ga0209564_1030516	3300025295	Bacteria	1668
236	Ga0209758_1000170	3300025297	Bacteria	149476
237	Ga0209758_1001066	3300025297	Bacteria	35697
238	Ga0209758_1001135	3300025297	Bacteria	34249
239	Ga0209758_1001253	3300025297	Bacteria	31421
240	Ga0209758_1001373	3300025297	Bacteria	29051
241	Ga0209758_1001628	3300025297	Bacteria	25562
242	Ga0209758_1004403	3300025297	Bacteria	11752
243	Ga0209758_1011108	3300025297	Bacteria	5265
244	Ga0209758_1012839	3300025297	Bacteria	4640
245	Ga0209758_1020415	3300025297	Bacteria	3135
246	Ga0209758_1048699	3300025297	Bacteria	1503
247	Ga0209050_1003709	3300025298	Bacteria	10993
248	Ga0209050_1008168	3300025298	Bacteria	5666
249	Ga0209050_1010198	3300025298	Bacteria	4664
250	Ga0209256_1000027	3300025299	Bacteria	423283
251	Ga0209256_1001094	3300025299	Bacteria	31181
252	Ga0209256_1001547	3300025299	Bacteria	22929
253	Ga0209256_1002449	3300025299	Bacteria	15133
254	Ga0209256_1003628	3300025299	Bacteria	10572
255	Ga0209256_1008150	3300025299	Bacteria	4930
256	Ga0209256_1009975	3300025299	Bacteria	4065
257	Ga0209256_1010577	3300025299	Bacteria	3836
258	Ga0209256_1016057	3300025299	Bacteria	2577
259	Ga0207426_1000012	3300025302	Bacteria	730942
260	Ga0207426_1000013	3300025302	Bacteria	721897
261	Ga0207426_1000015	3300025302	Bacteria	599316
262	Ga0207426_1000070	3300025302	Bacteria	331559
263	Ga0207426_1001333	3300025302	Bacteria	20976
264	Ga0209051_1000197	3300025303	Bacteria	106822
265	Ga0209051_1001552	3300025303	Bacteria	19016
266	Ga0209051_1004161	3300025303	Bacteria	9045
267	Ga0209051_1005073	3300025303	Bacteria	7827
268	Ga0209051_1005149	3300025303	Bacteria	7755
269	Ga0209051_1005927	3300025303	Bacteria	7013
270	Ga0209051_1007931	3300025303	Bacteria	5719
271	Ga0209051_1040070	3300025303	Bacteria	1683
272	Ga0209257_1001770	3300025304	Bacteria	23909
273	Ga0209257_1002467	3300025304	Bacteria	18307
274	Ga0209257_1006514	3300025304	Bacteria	7477
275	Ga0207656_10070633	3300025321	Bacteria	1551
276	Ga0207680_10039921	3300025903	Bacteria	2727
277	Ga0207695_10000036	3300025913	Bacteria	477897
278	Ga0207671_10000354	3300025914	Bacteria	66092
279	Ga0207671_10064842	3300025914	Bacteria	2716
280	Ga0207693_10013141	3300025915	Bacteria	6679
281	Ga0207650_10001835	3300025925	Bacteria	14991
282	Ga0207700_10005637	3300025928	Bacteria	7515
283	Ga0207664_10162447	3300025929	Bacteria	1906
284	Ga0207644_10153218	3300025931	Bacteria	1785
285	Ga0207709_10025213	3300025935	Bacteria	3403
286	Ga0207709_10049246	3300025935	Bacteria	2571
287	Ga0207711_10196377	3300025941	Bacteria	1840
288	Ga0207711_10695024	3300025941	Bacteria	949
289	Ga0207712_10381786	3300025961	Bacteria	1179
290	Ga0207668_10054946	3300025972	Bacteria	2766
291	Ga0207668_10420606	3300025972	Bacteria	1134
292	Ga0207658_10163001	3300025986	Bacteria	1829
293	Ga0207658_10357046	3300025986	Bacteria	1274
294	Ga0207702_10102437	3300026078	Bacteria	2530
295	Ga0207702_10381686	3300026078	Bacteria	1355
296	Ga0207702_10437561	3300026078	Bacteria	1267
297	Ga0207698_10006733	3300026142	Bacteria	7180
298	Ga0209281_1000043	3300027111	Bacteria	341543
299	Ga0209281_1000134	3300027111	Bacteria	185406
300	Ga0209281_1000319	3300027111	Bacteria	84764
301	Ga0209371_1000009	3300027312	Bacteria	963030
302	Ga0209371_1000350	3300027312	Bacteria	50342
303	Ga0209371_1002880	3300027312	Bacteria	9047
304	Ga0209282_1000029	3300027666	Bacteria	157883
305	Ga0209282_1001443	3300027666	Bacteria	13073
306	Ga0209813_10035755	3300027866	Bacteria	1489
307	Ga0268266_10012373	3300028379	Bacteria	7376
308	Ga0268266_10202715	3300028379	Bacteria	1816
309	Ga0268266_10249833	3300028379	Bacteria	1640
310	Ga0268266_10283377	3300028379	Bacteria	1541
311	Ga0268266_10382120	3300028379	Bacteria	1328
312	Ga0307515_10000029	3300028794	Bacteria	365410
313	Ga0307515_10000112	3300028794	Bacteria	195015
314	Ga0307515_10010814	3300028794	Bacteria	17415
315	Ga0307515_10024665	3300028794	Bacteria	10461
316	Ga0268256_1000010	3300030500	Bacteria	963034
317	Ga0268256_1005076	3300030500	Bacteria	5261
318	Ga0268256_1015551	3300030500	Bacteria	2216
319	Ga0316181_1224363	3300030744	Bacteria	7629
320	Ga0307513_10000338	3300031456	Bacteria	67781
321	Ga0307513_10234256	3300031456	Bacteria	1647
322	Ga0307408_100214430	3300031548	Bacteria	1567
323	Ga0307408_100438882	3300031548	Bacteria	1130
324	Ga0307405_10000925	3300031731	Bacteria	11679
325	Ga0307405_10064837	3300031731	Bacteria	2323
326	Ga0307405_10425658	3300031731	Bacteria	1046
327	Ga0307405_10524482	3300031731	Bacteria	954
328	Ga0307410_10184503	3300031852	Bacteria	1582
329	Ga0307406_10009787	3300031901	Bacteria	5392
330	Ga0307406_10044166	3300031901	Bacteria	2792
331	Ga0307412_10004224	3300031911	Bacteria	8010
332	Ga0315914_1000021	3300031967	Bacteria	119592
333	Ga0307409_100478335	3300031995	Bacteria	1208
334	Ga0307416_100632957	3300032002	Bacteria	1153
335	Ga0315913_1000014	3300033430	Bacteria	120114
336	Ga0315915_1000003	3300033464	Bacteria	407996
337	Ga0373929_0022491	3300035085	Bacteria	1287
338	Ga0373944_0035779	3300035089	Bacteria	1515
339	Ga0373941_0008024	3300035115	Bacteria	2608
340	Ga0373946_0268634	3300035171	Bacteria	836
341	Ga0373931_0050239	3300035691	Bacteria	2218
342	Ga0373935_0030290	3300035692	Bacteria	3353
343	Ga0373927_0142899	3300035695	Bacteria	1566
344	Ga0316582_0059458	3300036647	Bacteria	2448
345	Ga0373925_0112229	3300037068	Bacteria	2107
346	Ga0395905_0006166	3300037471	Bacteria	12100
347	Ga0395905_0106953	3300037471	Bacteria	2626
348	Ga0436364_0409254	3300037853	Bacteria	19401
349	Ga0395901_0321180	3300038443	Bacteria	1602
350	Ga0395901_0550777	3300038443	Bacteria	1169
351	Ga0436361_0598646	3300039447	Unclassified	952
352	Ga0439447_030194	3300041407	Bacteria	1367
353	Ga0439466_0027946	3300041411	Bacteria	1950
354	Ga0439465_0004773	3300041413	Bacteria	4364
355	Ga0439465_0009462	3300041413	Bacteria	3069
356	Ga0451791_1903792	3300041451	Bacteria	1954
357	Ga0451797_1171676	3300041453	Bacteria	1200
358	Ga0451833_1293275	3300041491	Bacteria	1363
359	Ga0451835_0488130	3300041492	Bacteria	1383
360	Ga0451839_1420443	3300041496	Bacteria	1232
361	Ga0451841_1091507	3300041498	Bacteria	1607
362	Ga0451846_40457	3300041502	Bacteria	963
363	Ga0451847_0189618	3300041503	Bacteria	1273
364	Ga0451849_0229890	3300041505	Bacteria	1152
365	Ga0451849_0827053	3300041505	Bacteria	2262
366	Ga0451851_1323304	3300041507	Bacteria	1486
367	Ga0451854_25381	3300041510	Bacteria	1728
368	Ga0451853_0400516	3300041512	Bacteria	1192
369	Ga0452271_15394	3300041916	Bacteria	1083
370	Ga0439449_0044343	3300042007	Bacteria	1650
371	Ga0439449_0054790	3300042007	Bacteria	1473
372	Ga0450906_002034	3300042145	Bacteria	4412
373	Ga0450907_011300	3300042146	Bacteria	1484
374	Ga0450910_002356	3300042147	Bacteria	2475
375	Ga0439434_0016669	3300042435	Bacteria	2196
376	Ga0450918_002770	3300042531	Bacteria	3286
377	Ga0466965_0334959	3300044683	Bacteria	826
378	Ga0466963_0000912	3300044694	Bacteria	15041
379	Ga0466970_0001692	3300044765	Bacteria	10600
380	Ga0495627_067535	3300046453	Bacteria	1048
381	Ga0495629_0024932	3300046459	Bacteria	4254
382	Ga0495580_0085763	3300046472	Bacteria	2193
383	Ga0495605_0037231	3300046474	Bacteria	2449
384	Ga0495662_0010133	3300046476	Bacteria	4621
385	Ga0495585_0016114	3300046492	Bacteria	4332
386	Ga0495585_0042144	3300046492	Bacteria	2558
387	Ga0495607_0049008	3300046501	Bacteria	2466
388	Ga0495607_0147499	3300046501	Bacteria	1207
389	Ga0495583_0066236	3300046506	Bacteria	1598
390	Ga0495606_0006039	3300046507	Bacteria	11329
391	Ga0495606_0067299	3300046507	Bacteria	2268
392	Ga0495610_0000420	3300046512	Bacteria	43578
393	Ga0495610_0020650	3300046512	Bacteria	3651
394	Ga0495610_0023004	3300046512	Bacteria	3395
395	Ga0495616_0150806	3300046513	Bacteria	1052
396	Ga0495620_0023336	3300046515	Bacteria	2960
397	Ga0495620_0027713	3300046515	Bacteria	2647
398	Ga0495631_0007672	3300046518	Bacteria	5479
399	Ga0495631_0128006	3300046518	Bacteria	1091
400	Ga0495632_0007814	3300046519	Bacteria	6660
401	Ga0495632_0064838	3300046519	Bacteria	1765
402	Ga0495643_0013894	3300046522	Bacteria	4802
403	Ga0495643_0026738	3300046522	Bacteria	3250
404	Ga0495643_0036112	3300046522	Bacteria	2717
405	Ga0495643_0100960	3300046522	Bacteria	1479
406	Ga0495644_0071838	3300046523	Bacteria	1301
407	Ga0495648_0097357	3300046524	Bacteria	1632
408	Ga0495654_0000392	3300046530	Bacteria	37521
409	Ga0495654_0014160	3300046530	Bacteria	4251
410	Ga0495587_0034133	3300046536	Bacteria	3069
411	Ga0495609_0106881	3300046538	Bacteria	1210
412	Ga0495597_0009904	3300046542	Bacteria	4685
413	Ga0495622_0070019	3300046557	Bacteria	1619
414	Ga0495633_0105905	3300046558	Bacteria	1304
415	Ga0495668_0006843	3300046616	Bacteria	7390
416	Ga0495625_0002334	3300046660	Bacteria	20741
417	Ga0495625_0162142	3300046660	Bacteria	1497
418	Ga0495588_0000475	3300046674	Bacteria	19892
419	Ga0495588_0039403	3300046674	Bacteria	2407
420	Ga0495588_0147778	3300046674	Bacteria	1242
421	Ga0495657_0010598	3300046675	Bacteria	6928
422	Ga0495624_0062129	3300046690	Bacteria	2338
423	Ga0495670_0090709	3300046691	Bacteria	1564
424	Ga0495649_0022435	3300046694	Bacteria	3533
425	Ga0495649_0084444	3300046694	Bacteria	1695
426	Ga0495600_0005212	3300046809	Bacteria	7816
427	Ga0495660_0012554	3300046810	Bacteria	4919
428	Ga0495660_0073476	3300046810	Bacteria	1808
429	Ga0495687_061757	3300047443	Bacteria	1540
430	Ga0495673_0087757	3300047469	Bacteria	1276
431	Ga0495681_0005503	3300047470	Bacteria	8469
432	Ga0495686_0004895	3300047472	Bacteria	10800
433	Ga0495686_0011525	3300047472	Bacteria	6228
434	Ga0495686_0109018	3300047472	Bacteria	1662
435	Ga0496100_0493633	3300048903	Bacteria	943
436	Ga0496102_0044102	3300048905	Bacteria	4046
437	Ga0496103_0031907	3300048906	Bacteria	3213
438	Ga0496104_0502233	3300048907	Bacteria	1124
439	Ga0496106_0004153	3300048909	Bacteria	10794
440	Ga0496110_0060656	3300048913	Bacteria	3337
441	Ga0496110_0215204	3300048913	Bacteria	1747
442	Ga0496111_0001325	3300048914	Bacteria	13925
443	Ga0496111_0426841	3300048914	Bacteria	979
444	Ga0496112_0124051	3300048915	Bacteria	2553
445	Ga0496112_0206691	3300048915	Bacteria	1921
446	Ga0496116_0000240	3300048919	Bacteria	100232
447	Ga0496116_0022824	3300048919	Bacteria	4676
448	Ga0496116_0029111	3300048919	Bacteria	3987
449	Ga0496116_0067451	3300048919	Bacteria	2284
450	Ga0496116_0086389	3300048919	Bacteria	1924
451	Ga0496116_0099895	3300048919	Bacteria	1736
452	Ga0496116_0102714	3300048919	Bacteria	1703
453	Ga0496117_0000002	3300048920	Bacteria	2483758
454	Ga0496117_0001876	3300048920	Bacteria	28300
455	Ga0496117_0002649	3300048920	Bacteria	22191
456	Ga0496117_0030737	3300048920	Bacteria	4114
457	Ga0496117_0055141	3300048920	Bacteria	2779
458	Ga0496117_0108196	3300048920	Bacteria	1739
459	Ga0496118_0000651	3300048921	Bacteria	56681
460	Ga0496118_0018009	3300048921	Bacteria	6397
461	Ga0496118_0041385	3300048921	Bacteria	3648
462	Ga0496118_0044731	3300048921	Bacteria	3464
463	Ga0496118_0071384	3300048921	Bacteria	2500
464	Ga0496118_0296133	3300048921	Bacteria	891
465	Ga0496119_0029382	3300048922	Bacteria	3729
466	Ga0496119_0072581	3300048922	Bacteria	2010
467	Ga0496119_0094538	3300048922	Bacteria	1690
468	Ga0496120_0000034	3300048923	Bacteria	215228
469	Ga0496120_0060031	3300048923	Bacteria	2129
470	Ga0496120_0073523	3300048923	Bacteria	1870
471	Ga0496120_0133641	3300048923	Bacteria	1267
472	Ga0496121_0000220	3300048924	Bacteria	123930
473	Ga0496121_0000806	3300048924	Bacteria	57063
474	Ga0496121_0003514	3300048924	Bacteria	22266
475	Ga0496121_0009177	3300048924	Bacteria	11433
476	Ga0496121_0027587	3300048924	Bacteria	5311
477	Ga0496121_0062425	3300048924	Bacteria	3052
478	Ga0496121_0092679	3300048924	Bacteria	2354
479	Ga0496121_0187842	3300048924	Bacteria	1484
480	Ga0496121_0309420	3300048924	Bacteria	1069
481	Ga0496122_0000001	3300048925	Bacteria	1827766
482	Ga0496122_0000018	3300048925	Bacteria	426350
483	Ga0496122_0000309	3300048925	Bacteria	107844
484	Ga0496122_0004849	3300048925	Bacteria	16382
485	Ga0496122_0011288	3300048925	Bacteria	9073
486	Ga0496122_0020008	3300048925	Bacteria	6082
487	Ga0496122_0034803	3300048925	Bacteria	4112
488	Ga0496122_0213146	3300048925	Bacteria	1116
489	Ga0496123_0000001	3300048926	Bacteria	1831497
490	Ga0496123_0000015	3300048926	Bacteria	426088
491	Ga0496123_0000396	3300048926	Bacteria	81106
492	Ga0496123_0011715	3300048926	Bacteria	7563
493	Ga0496123_0019904	3300048926	Bacteria	5268
494	Ga0496123_0084992	3300048926	Bacteria	1905
495	Ga0496124_0000083	3300048927	Bacteria	207798
496	Ga0496124_0000532	3300048927	Bacteria	64777
497	Ga0496124_0007911	3300048927	Bacteria	11196
498	Ga0496124_0018158	3300048927	Bacteria	6599
499	Ga0496124_0021456	3300048927	Bacteria	5950
500	Ga0496124_0050475	3300048927	Bacteria	3544
501	Ga0496124_0068424	3300048927	Bacteria	2951
502	Ga0496124_0087269	3300048927	Bacteria	2552
503	Ga0496124_0096011	3300048927	Bacteria	2409
504	Ga0496124_0122087	3300048927	Bacteria	2080
505	Ga0496124_0357081	3300048927	Bacteria	1031
506	Ga0496124_0358102	3300048927	Bacteria	1029
507	Ga0496124_0373889	3300048927	Bacteria	999
508	Ga0496125_0000001	3300048928	Bacteria	1766138
509	Ga0496125_0000393	3300048928	Bacteria	81258
510	Ga0496125_0013499	3300048928	Bacteria	8025
511	Ga0496125_0043758	3300048928	Bacteria	3795
512	Ga0496125_0082978	3300048928	Bacteria	2440
513	Ga0496125_0107967	3300048928	Bacteria	2026
514	Ga0496125_0248956	3300048928	Bacteria	1123
515	Ga0496126_0000322	3300048929	Bacteria	102330
516	Ga0496126_0001032	3300048929	Bacteria	47122
517	Ga0496126_0026423	3300048929	Bacteria	5567
518	Ga0496126_0058100	3300048929	Bacteria	3488
519	Ga0496126_0063045	3300048929	Bacteria	3323
520	Ga0496126_0167296	3300048929	Bacteria	1875
521	Ga0501031_0076707	3300049568	Bacteria	2177
522	Ga0501032_0196189	3300049569	Bacteria	1318
523	Ga0501033_0000120	3300049570	Bacteria	75504
524	Ga0501034_0013329	3300049571	Bacteria	8466
525	Ga0501034_0253795	3300049571	Bacteria	1703
526	Ga0501038_0216669	3300049574	Bacteria	1529
527	Ga0501039_0552563	3300049575	Bacteria	903
528	Ga0501043_0146223	3300049579	Bacteria	1850
529	Ga0501043_0208380	3300049579	Bacteria	1515
530	Ga0501047_0123646	3300049581	Bacteria	2468
531	Ga0501068_0164756	3300049584	Bacteria	1398
532	Ga0501073_0220294	3300049589	Bacteria	1311
533	Ga0501080_0626327	3300049742	Bacteria	953
534	Ga0501035_0000479	3300049822	Bacteria	44840
535	Ga0501044_0148964	3300049823	Bacteria	2323
536	Ga0501044_0556257	3300049823	Bacteria	1044
537	nmdc:mga03683_54274_c1	3300050489	Bacteria	1680
538	nmdc:mga03n38_178624_c1	3300050490	Bacteria	1086
539	nmdc:mga00v17_228088_c1	3300050491	Bacteria	1206
540	nmdc:mga00v17_288_c1	3300050491	Bacteria	29437
541	nmdc:mga00v17_31065_c1	3300050491	Bacteria	3147
542	nmdc:mga0yw44_194309_c1	3300050492	Bacteria	1339
543	nmdc:mga0yw44_2890_c1	3300050492	Bacteria	7465
544	nmdc:mga0yw44_38069_c1	3300050492	Bacteria	2843
545	nmdc:mga0k408_227007_c1	3300050493	Bacteria	1115
546	nmdc:mga0k408_5264_c1	3300050493	Bacteria	6870
547	nmdc:mga0k408_79204_c1	3300050493	Bacteria	1923
548	nmdc:mga06z11_103479_c1	3300050494	Bacteria	1566
549	nmdc:mga06z11_2782_c1	3300050494	Bacteria	6705
550	nmdc:mga06z11_48425_c1	3300050494	Bacteria	2163
551	nmdc:mga04h51_63259_c1	3300050495	Bacteria	1274
552	nmdc:mga07m45_211533_c1	3300050496	Bacteria	1128
553	nmdc:mga07m45_4289_c1	3300050496	Bacteria	6981
554	nmdc:mga08x19_171943_c1	3300050514	Bacteria	1476
555	nmdc:mga0sz30_154_c1	3300050516	Bacteria	25435
556	nmdc:mga0sz30_21312_c1	3300050516	Bacteria	2622
557	nmdc:mga0sz30_87976_c1	3300050516	Bacteria	1349
558	Ga0500578_0106617	3300053086	Bacteria	1769
559	Ga0500644_0165418	3300053088	Bacteria	896
560	Ga0500560_002067	3300053107	Bacteria	3727
561	Ga0500560_040569	3300053107	Bacteria	1458
562	Ga0500569_008622	3300053109	Bacteria	2339
563	Ga0500572_000904	3300053111	Bacteria	9168
564	Ga0500608_022089	3300053122	Bacteria	2948
565	Ga0500608_070006	3300053122	Bacteria	1668
566	Ga0500618_005643	3300053125	Bacteria	3774
567	Ga0500618_013121	3300053125	Bacteria	2151
568	Ga0500658_0015730	3300053134	Bacteria	2812
569	Ga0500559_0011680	3300053136	Bacteria	3746
570	Ga0500561_0000396	3300053137	Bacteria	7198
571	Ga0500568_0010541	3300053139	Bacteria	4320
572	Ga0500573_0000445	3300053140	Bacteria	17775
573	Ga0500590_004719	3300053148	Bacteria	6471
574	Ga0500604_0073162	3300053151	Bacteria	1096
575	Ga0500616_0000503	3300053153	Bacteria	49936
576	Ga0500616_0013651	3300053153	Bacteria	4706
577	Ga0500622_0000446	3300053156	Bacteria	39340
578	Ga0500622_0003265	3300053156	Bacteria	10999
579	Ga0500624_000330	3300053157	Bacteria	15997
580	Ga0500624_008607	3300053157	Bacteria	1433
581	Ga0500636_0000022	3300053177	Bacteria	93090
582	Ga0500636_0003976	3300053177	Bacteria	8329
583	Ga0587073_0007907	3300059492	Bacteria	1702
584	Ga0587080_007965	3300059503	Bacteria	1503
585	Ga0587086_015927	3300059507	Bacteria	976
586	Ga0587088_001976	3300059508	Bacteria	2240
587	Ga0587088_028112	3300059508	Bacteria	987
588	Ga0587062_013020	3300059639	Bacteria	1076
589	Ga0587067_017920	3300059640	Bacteria	1182
590	Ga0587072_038957	3300059643	Bacteria	917
591	Ga0501082_0175143	3300060353	Bacteria	1865
592	Ga0466962_0160356	3300061719	Bacteria	1093

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300007788	Ga0099795_10176424	Ga0099795_101764242	211
2	3300025915	Ga0207693_10013141	Ga0207693_100131417	211
3	3300050493	nmdc:mga0k408_227007_c1	nmdc:mga0k408_227007_c1_459_1100	211
4	3300039447	Ga0436361_0598646	Ga0436361_0598646_61_708	212
5	3300049568	Ga0501031_0076707	Ga0501031_0076707_150_848	215
6	3300010159	Ga0099796_10010327	Ga0099796_100103272	224
7	3300014497	Ga0182008_10061681	Ga0182008_100616812	224
8	3300035085	Ga0373929_0022491	Ga0373929_0022491_216_902	224
9	3300035115	Ga0373941_0008024	Ga0373941_0008024_1353_2039	224
10	3300035691	Ga0373931_0050239	Ga0373931_0050239_282_968	224
11	3300048915	Ga0496112_0206691	Ga0496112_0206691_214_900	224
12	3300050514	nmdc:mga08x19_171943_c1	nmdc:mga08x19_171943_c1_721_1407	224
13	3300021388	Ga0213875_10001711	Ga0213875_1000171110	226
14	3300037853	Ga0436364_0409254	Ga0436364_0409254_17487_18179	226
15	3300005471	Ga0070698_100022470	Ga0070698_1000224707	228
16	3300005518	Ga0070699_100013844	Ga0070699_1000138445	228
17	iso_pu_bacteria	2508501122	2509108980	228
18	iso_pu_bacteria	2509276019	2509375298	228
19	iso_pu_bacteria	2512875026	2512973024	228
20	iso_pu_bacteria	2513237089	2513604394	228
21	iso_pu_bacteria	2513237156	2513983086	228
22	iso_pu_bacteria	2513237159	2513996465	228
23	iso_pu_bacteria	2513237160	2514007094	228
24	iso_pu_bacteria	2516143018	2516204606	228
25	iso_pu_bacteria	2517487022	2517568358	228
26	iso_pu_bacteria	2537561587	2537873350	228
27	iso_pu_bacteria	2554235003	2554246392	228
28	iso_pu_bacteria	2558860100	2558866386	228
29	iso_pu_bacteria	2558860242	2559293614	228
30	iso_pu_bacteria	2582581283	2585164614	228
31	iso_pu_bacteria	2582581306	2585264959	228
32	iso_pu_bacteria	2582581865	2585385983	228
33	iso_pu_bacteria	2582581866	2585394597	228
34	iso_pu_bacteria	2599185210	2599605813	228
35	iso_pu_bacteria	2599185352	2600195030	228
36	iso_pu_bacteria	2600255279	2601609364	228
37	iso_pu_bacteria	2600255308	2601746139	228
38	iso_pu_bacteria	2643221557	2643806004	228
39	iso_pu_bacteria	2643221558	2643812685	228
40	iso_pu_bacteria	2643221568	2643857370	228
41	iso_pu_bacteria	2643221582	2643920776	228
42	iso_pu_bacteria	2643221607	2644051438	228
43	iso_pu_bacteria	2643221610	2644066180	228
44	iso_pu_bacteria	2643221618	2644103577	228
45	iso_pu_bacteria	2643221626	2644144456	228
46	iso_pu_bacteria	2643221636	2644199935	228
47	iso_pu_bacteria	2643221637	2644207110	228
48	iso_pu_bacteria	2643221655	2644306507	228
49	iso_pu_bacteria	2643221659	2644330697	228
50	iso_pu_bacteria	2643221668	2644377264	228
51	iso_pu_bacteria	2643221675	2644417511	228
52	iso_pu_bacteria	2643221680	2644450907	228
53	iso_pu_bacteria	2643221686	2644480307	228
54	iso_pu_bacteria	2643221688	2644495569	228
55	iso_pu_bacteria	2643221689	2644498949	228
56	iso_pu_bacteria	2643221693	2644519419	228
57	iso_pu_bacteria	2643221698	2644542498	228
58	iso_pu_bacteria	2643221712	2644612118	228
59	iso_pu_bacteria	2643221718	2644650758	228
60	iso_pu_bacteria	2643221723	2644671688	228
61	iso_pu_bacteria	2643221726	2644692670	228
62	iso_pu_bacteria	2657244999	2657682954	228
63	iso_pu_bacteria	2690316117	2692317560	228
64	iso_pu_bacteria	2751185821	2753459761	228
65	iso_pu_bacteria	2791355082	2792583168	228
66	iso_pu_bacteria	2791355091	2792621153	228
67	iso_pu_bacteria	2791355092	2792625367	228
68	iso_pu_bacteria	2791355094	2792637798	228
69	iso_pu_bacteria	2802428858	2802718591	228
70	iso_pu_bacteria	2802428859	2802724272	228
71	iso_pu_bacteria	2802428860	2802730066	228
72	iso_pu_bacteria	2802428861	2802737409	228
73	iso_pu_bacteria	2802428862	2802742325	228
74	iso_pu_bacteria	2802428863	2802749008	228
75	iso_pu_bacteria	2802429268	2804750672	228
76	iso_pu_bacteria	2808606387	2808986615	228
77	iso_pu_bacteria	2818991439	2819556687	228
78	iso_pu_bacteria	2837651117	2837651616	228
79	iso_pu_bacteria	2838074704	2838075068	228
80	iso_pu_bacteria	2838675328	2838677422	228
81	iso_pu_bacteria	2838714209	2838716310	228
82	iso_pu_bacteria	2838719591	2838719890	228
83	iso_pu_bacteria	2838724970	2838727062	228
84	iso_pu_bacteria	2841846520	2841846821	228
85	iso_pu_bacteria	2841859092	2841860650	228
86	iso_pu_bacteria	2842124991	2842127150	228
87	iso_pu_bacteria	2842130223	2842132315	228
88	iso_pu_bacteria	2842152218	2842152516	228
89	iso_pu_bacteria	2842170452	2842172555	228
90	iso_pu_bacteria	2842175837	2842176135	228
91	iso_pu_bacteria	2842187318	2842189417	228
92	iso_pu_bacteria	2842211629	2842213731	228
93	iso_pu_bacteria	2842224351	2842224651	228
94	iso_pu_bacteria	2842515876	2842517435	228
95	iso_pu_bacteria	2842521101	2842521388	228
96	iso_pu_bacteria	2844163670	2844170150	228
97	iso_pu_bacteria	2847417321	2847417370	228
98	iso_pu_bacteria	2848992105	2848992156	228
99	iso_pu_bacteria	2850079185	2850079637	228
100	iso_pu_bacteria	2855825444	2855827936	228
101	iso_pu_bacteria	2855839649	2855839693	228
102	iso_pu_bacteria	2855872281	2855875204	228
103	iso_pu_bacteria	2858800743	2858803032	228
104	iso_pu_bacteria	2891048133	2891049147	228
105	iso_pu_bacteria	2896384573	2896384778	228
106	iso_pu_bacteria	2899792073	2899794558	228
107	iso_pu_bacteria	2899803654	2899805604	228
108	iso_pu_bacteria	2899845264	2899845903	228
109	iso_pu_bacteria	2913295892	2913298238	228
110	iso_pu_bacteria	2915980308	2915986516	228
111	iso_pu_bacteria	2915986958	2915993176	228
112	iso_pu_bacteria	2915993759	2915997283	228
113	iso_pu_bacteria	2916000859	2916002379	228
114	iso_pu_bacteria	2916007675	2916008224	228
115	iso_pu_bacteria	2916014648	2916016451	228
116	iso_pu_bacteria	2916021584	2916027689	228
117	iso_pu_bacteria	2916028427	2916031532	228
118	iso_pu_bacteria	2916035215	2916036010	228
119	iso_pu_bacteria	2916041962	2916044630	228
120	iso_pu_bacteria	2916048683	2916051990	228
121	iso_pu_bacteria	2916055098	2916057083	228
122	iso_pu_bacteria	2916061851	2916068488	228
123	iso_pu_bacteria	2916068649	2916074106	228
124	iso_pu_bacteria	2916076590	2916081197	228
125	iso_pu_bacteria	2919114240	2919116514	228
126	iso_pu_bacteria	2919166419	2919166653	228
127	iso_pu_bacteria	2920760137	2920763674	228
128	iso_pu_bacteria	2920822456	2920823041	228
129	iso_pu_bacteria	2921201388	2921207423	228
130	iso_pu_bacteria	2921208531	2921212339	228
131	iso_pu_bacteria	2921237296	2921243237	228
132	iso_pu_bacteria	2921244191	2921248487	228
133	iso_pu_bacteria	2921250672	2921252636	228
134	iso_pu_bacteria	2921257292	2921259892	228
135	iso_pu_bacteria	2921263974	2921267402	228
136	iso_pu_bacteria	2921282425	2921287845	228
137	iso_pu_bacteria	2921289301	2921292219	228
138	iso_pu_bacteria	2921296804	2921296987	228
139	iso_pu_bacteria	2924144063	2924146227	228
140	iso_pu_bacteria	2924150972	2924156380	228
141	iso_pu_bacteria	2924158325	2924164630	228
142	iso_pu_bacteria	2924165586	2924172228	228
143	iso_pu_bacteria	2924172951	2924177136	228
144	iso_pu_bacteria	2924179722	2924181143	228
145	iso_pu_bacteria	2924186466	2924189422	228
146	iso_pu_bacteria	2924193448	2924200203	228
147	iso_pu_bacteria	2924200457	2924202522	228
148	iso_pu_bacteria	2924207177	2924209549	228
149	iso_pu_bacteria	2924214083	2924216942	228
150	iso_pu_bacteria	2924221636	2924227850	228
151	iso_pu_bacteria	2924228884	2924230054	228
152	iso_pu_bacteria	2926754445	2926754536	228
153	iso_pu_bacteria	2926760298	2926761707	228
154	iso_pu_bacteria	2933006813	2933007163	228
155	iso_pu_bacteria	2933011516	2933015246	228
156	iso_pu_bacteria	2933594066	2933594366	228
157	iso_pu_bacteria	2937029754	2937031609	228
158	iso_pu_bacteria	2937036028	2937037707	228
159	iso_pu_bacteria	2937042894	2937048798	228
160	iso_pu_bacteria	2937049772	2937053234	228
161	iso_pu_bacteria	2937078374	2937081702	228
162	iso_pu_bacteria	2937084907	2937089428	228
163	iso_pu_bacteria	2937091812	2937097048	228
164	iso_pu_bacteria	2937098957	2937105545	228
165	iso_pu_bacteria	2937106411	2937106529	228
166	iso_pu_bacteria	2937113482	2937116419	228
167	iso_pu_bacteria	2937843397	2937844738	228
168	iso_pu_bacteria	2941499720	2941501001	228
169	iso_pu_bacteria	2957375807	2957377822	228
170	iso_pu_bacteria	2957388812	2957393266	228
171	iso_pu_bacteria	2957415311	2957417389	228
172	iso_pu_bacteria	2957437181	2957443296	228
173	iso_pu_bacteria	2957443900	2957446788	228
174	iso_pu_bacteria	2957478035	2957481188	228
175	iso_pu_bacteria	2960591022	2960593345	228
176	iso_pu_bacteria	2960617483	2960620436	228
177	iso_pu_bacteria	2960631154	2960637131	228
178	iso_pu_bacteria	2960660292	2960660695	228
179	iso_pu_bacteria	2960680706	2960684590	228
180	iso_pu_bacteria	2960693952	2960697456	228
181	iso_pu_bacteria	2964649959	2964650032	228
182	iso_pu_bacteria	2964656573	2964659566	228
183	iso_pu_bacteria	2967664464	2967667526	228
184	iso_pu_bacteria	2967678726	2967682100	228
185	iso_pu_bacteria	2967686174	2967688106	228
186	iso_pu_bacteria	2967693043	2967695368	228
187	iso_pu_bacteria	2967714385	2967717930	228
188	iso_pu_bacteria	2967721400	2967723705	228
189	iso_pu_bacteria	2967728569	2967731116	228
190	iso_pu_bacteria	2967735183	2967738143	228
191	iso_pu_bacteria	2967762386	2967768761	228
192	iso_pu_bacteria	2967775926	2967781552	228
193	iso_pu_bacteria	2970019648	2970021220	228
194	iso_pu_bacteria	2970026789	2970027342	228
195	iso_pu_bacteria	2970040964	2970040981	228
196	iso_pu_bacteria	2970116247	2970116682	228
197	iso_pu_bacteria	2970122695	2970126155	228
198	iso_pu_bacteria	2970129317	2970131285	228
199	iso_pu_bacteria	2970143518	2970146339	228
200	iso_pu_bacteria	2970164137	2970169589	228
201	iso_pu_bacteria	2970184632	2970187760	228
202	iso_pu_bacteria	2977523885	2977529422	228
203	iso_pu_bacteria	2977530762	2977531077	228
204	iso_pu_bacteria	2977544691	2977545819	228
205	iso_pu_bacteria	2977551784	2977554127	228
206	iso_pu_bacteria	2977579622	2977584110	228
207	iso_pu_bacteria	2978969890	2978973042	228
208	iso_pu_bacteria	2979089926	2979093029	228
209	iso_pu_bacteria	2979095461	2979099582	228
210	iso_pu_bacteria	2979100975	2979104998	228
211	iso_pu_bacteria	2984509177	2984513199	228
212	iso_pu_bacteria	2984518228	2984520431	228
213	iso_pu_bacteria	2984537506	2984539728	228
214	iso_pu_bacteria	2984587000	2984591288	228
215	iso_pu_bacteria	2984601300	2984601953	228
216	iso_pu_bacteria	2989771324	2989772562	228
217	iso_pu_bacteria	2995392953	2995397102	228
218	iso_pu_bacteria	3003930520	3003931654	228
219	iso_pu_bacteria	643692032	643824258	228
220	iso_pu_bacteria	650716007	650738853	228
221	iso_pu_bacteria	8003570095	8003572401	228
222	iso_pu_bacteria	8003999396	8003999440	228
223	iso_pu_bacteria	8018150411	8018155091	228
224	iso_pu_bacteria	8049293176	8049293221	228
225	3300005436	Ga0070713_100207739	Ga0070713_1002077392	229
226	3300005437	Ga0070710_10029557	Ga0070710_100295572	229
227	3300005564	Ga0070664_100334262	Ga0070664_1003342622	229
228	3300006175	Ga0070712_100332315	Ga0070712_1003323152	229
229	3300010159	Ga0099796_10053715	Ga0099796_100537152	229
230	3300025928	Ga0207700_10005637	Ga0207700_100056372	229
231	3300025929	Ga0207664_10162447	Ga0207664_101624472	229
232	3300026078	Ga0207702_10381686	Ga0207702_103816862	229
233	3300035089	Ga0373944_0035779	Ga0373944_0035779_494_1207	229
234	3300035171	Ga0373946_0268634	Ga0373946_0268634_97_810	229
235	3300035695	Ga0373927_0142899	Ga0373927_0142899_400_1113	229
236	3300037068	Ga0373925_0112229	Ga0373925_0112229_904_1617	229
237	3300046472	Ga0495580_0085763	Ga0495580_0085763_752_1465	229
238	iso_pu_bacteria	2509276021	2509388817	229
239	iso_pu_bacteria	2509276033	2509444404	229
240	iso_pu_bacteria	2510065019	2510131030	229
241	iso_pu_bacteria	2510461069	2510839046	229
242	iso_pu_bacteria	2510461076	2510897338	229
243	iso_pu_bacteria	2510917022	2511134630	229
244	iso_pu_bacteria	2510917026	2511170995	229
245	iso_pu_bacteria	2510917028	2511182223	229
246	iso_pu_bacteria	2510917030	2511194761	229
247	iso_pu_bacteria	2513237084	2513571023	229
248	iso_pu_bacteria	2513237085	2513574774	229
249	iso_pu_bacteria	2513237088	2513595339	229
250	iso_pu_bacteria	2513237093	2513634024	229
251	iso_pu_bacteria	2513237103	2513707393	229
252	iso_pu_bacteria	2513237138	2513866566	229
253	iso_pu_bacteria	2513237144	2513911328	229
254	iso_pu_bacteria	2513237146	2513924473	229
255	iso_pu_bacteria	2513237162	2514022155	229
256	iso_pu_bacteria	2515075009	2515109963	229
257	iso_pu_bacteria	2515154113	2515633957	229
258	iso_pu_bacteria	2515154114	2515641223	229
259	iso_pu_bacteria	2515154116	2515659770	229
260	iso_pu_bacteria	2515154134	2515740961	229
261	iso_pu_bacteria	2516653077	2517038654	229
262	iso_pu_bacteria	2516653085	2517078907	229
263	iso_pu_bacteria	2517093000	2517097696	229
264	iso_pu_bacteria	2517287029	2517409127	229
265	iso_pu_bacteria	2519899620	2520375783	229
266	iso_pu_bacteria	2524023209	2524458128	229
267	iso_pu_bacteria	2529292951	2530648175	229
268	iso_pu_bacteria	2534681786	2535485596	229
269	iso_pu_bacteria	2534681796	2535514762	229
270	iso_pu_bacteria	2582581294	2585201095	229
271	iso_pu_bacteria	2582581298	2585223443	229
272	iso_pu_bacteria	2582581299	2585232455	229
273	iso_pu_bacteria	2582581304	2585256225	229
274	iso_pu_bacteria	2582581307	2585273711	229
275	iso_pu_bacteria	2582581308	2585280013	229
276	iso_pu_bacteria	2582581315	2585326210	229
277	iso_pu_bacteria	2582581316	2585330374	229
278	iso_pu_bacteria	2582581867	2585398898	229
279	iso_pu_bacteria	2585427526	2585523760	229
280	iso_pu_bacteria	2585427527	2585533733	229
281	iso_pu_bacteria	2585427528	2585541843	229
282	iso_pu_bacteria	2585427529	2585545961	229
283	iso_pu_bacteria	2585427530	2585553326	229
284	iso_pu_bacteria	2585427531	2585559885	229
285	iso_pu_bacteria	2585427590	2585818982	229
286	iso_pu_bacteria	2585427593	2585840509	229
287	iso_pu_bacteria	2585427594	2585843899	229
288	iso_pu_bacteria	2585427608	2585900562	229
289	iso_pu_bacteria	2585427609	2585905937	229
290	iso_pu_bacteria	2585427634	2585998669	229
291	iso_pu_bacteria	2585428125	2587978948	229
292	iso_pu_bacteria	2599185170	2599419564	229
293	iso_pu_bacteria	2599185236	2599718989	229
294	iso_pu_bacteria	2600254933	2600376580	229
295	iso_pu_bacteria	2615840624	2616293775	229
296	iso_pu_bacteria	2615840626	2616309349	229
297	iso_pu_bacteria	2615840698	2616556325	229
298	iso_pu_bacteria	2617270742	2617380483	229
299	iso_pu_bacteria	2643221599	2644004596	229
300	iso_pu_bacteria	2643221623	2644133663	229
301	iso_pu_bacteria	2643221634	2644196894	229
302	iso_pu_bacteria	2643221643	2644237495	229
303	iso_pu_bacteria	2643221653	2644297897	229
304	iso_pu_bacteria	2643221719	2644656150	229
305	iso_pu_bacteria	2667528174	2671113895	229
306	iso_pu_bacteria	2718217882	2719179198	229
307	iso_pu_bacteria	2718217927	2719383766	229
308	iso_pu_bacteria	2718217997	2719663561	229
309	iso_pu_bacteria	2718218009	2719729868	229
310	iso_pu_bacteria	2718218199	2720489980	229
311	iso_pu_bacteria	2718218232	2720611356	229
312	iso_pu_bacteria	2718218233	2720618206	229
313	iso_pu_bacteria	2718218235	2720629609	229
314	iso_pu_bacteria	2718218269	2720773305	229
315	iso_pu_bacteria	2718218363	2721145291	229
316	iso_pu_bacteria	2718218365	2721156807	229
317	iso_pu_bacteria	2718218366	2721162186	229
318	iso_pu_bacteria	2718218423	2721397524	229
319	iso_pu_bacteria	2721755514	2722838356	229
320	iso_pu_bacteria	2721755556	2723024984	229
321	iso_pu_bacteria	2721755684	2723558562	229
322	iso_pu_bacteria	2721755685	2723565131	229
323	iso_pu_bacteria	2721755809	2724036334	229
324	iso_pu_bacteria	2721755810	2724042624	229
325	iso_pu_bacteria	2721755819	2724087912	229
326	iso_pu_bacteria	2721755822	2724102396	229
327	iso_pu_bacteria	2721755823	2724108300	229
328	iso_pu_bacteria	2724679232	2725946643	229
329	iso_pu_bacteria	2728369352	2730105920	229
330	iso_pu_bacteria	2728369365	2730162435	229
331	iso_pu_bacteria	2728369397	2730296439	229
332	iso_pu_bacteria	2738541293	2738805795	229
333	iso_pu_bacteria	2738541333	2739036932	229
334	iso_pu_bacteria	2738543024	2739308376	229
335	iso_pu_bacteria	2765235942	2766063345	229
336	iso_pu_bacteria	2775507049	2776911726	229
337	iso_pu_bacteria	2775507266	2778177088	229
338	iso_pu_bacteria	2791355256	2793296791	229
339	iso_pu_bacteria	2791355259	2793314039	229
340	iso_pu_bacteria	2791355260	2793322324	229
341	iso_pu_bacteria	2791355261	2793328969	229
342	iso_pu_bacteria	2791355262	2793336285	229
343	iso_pu_bacteria	2791355263	2793343882	229
344	iso_pu_bacteria	2791355264	2793349489	229
345	iso_pu_bacteria	2791355265	2793352656	229
346	iso_pu_bacteria	2791355266	2793358335	229
347	iso_pu_bacteria	2791355267	2793365514	229
348	iso_pu_bacteria	2802429605	2805928188	229
349	iso_pu_bacteria	2802429606	2805935539	229
350	iso_pu_bacteria	2802429633	2806046656	229
351	iso_pu_bacteria	2802429634	2806051417	229
352	iso_pu_bacteria	2802429635	2806059406	229
353	iso_pu_bacteria	2802429636	2806066629	229
354	iso_pu_bacteria	2802429637	2806073687	229
355	iso_pu_bacteria	2818991272	2819245144	229
356	iso_pu_bacteria	2818991448	2819608636	229
357	iso_pu_bacteria	2818991453	2819640744	229
358	iso_pu_bacteria	2818991461	2819686011	229
359	iso_pu_bacteria	2838016132	2838020636	229
360	iso_pu_bacteria	2838022645	2838026393	229
361	iso_pu_bacteria	2838029111	2838029525	229
362	iso_pu_bacteria	2838035591	2838039901	229
363	iso_pu_bacteria	2838042994	2838044683	229
364	iso_pu_bacteria	2838048938	2838053144	229
365	iso_pu_bacteria	2838061910	2838065842	229
366	iso_pu_bacteria	2838068647	2838070710	229
367	iso_pu_bacteria	2838661181	2838664185	229
368	iso_pu_bacteria	2838668709	2838674382	229
369	iso_pu_bacteria	2838680041	2838680207	229
370	iso_pu_bacteria	2838686498	2838689661	229
371	iso_pu_bacteria	2838694306	2838695762	229
372	iso_pu_bacteria	2838701080	2838706708	229
373	iso_pu_bacteria	2838707686	2838709137	229
374	iso_pu_bacteria	2838729681	2838731644	229
375	iso_pu_bacteria	2838742623	2838744585	229
376	iso_pu_bacteria	2841851746	2841853126	229
377	iso_pu_bacteria	2841864319	2841868933	229
378	iso_pu_bacteria	2842077413	2842079627	229
379	iso_pu_bacteria	2842110456	2842112558	229
380	iso_pu_bacteria	2842118031	2842120245	229
381	iso_pu_bacteria	2842146304	2842151361	229
382	iso_pu_bacteria	2842156927	2842160452	229
383	iso_pu_bacteria	2842163707	2842165568	229
384	iso_pu_bacteria	2842180545	2842183882	229
385	iso_pu_bacteria	2842192696	2842198187	229
386	iso_pu_bacteria	2842198810	2842202154	229
387	iso_pu_bacteria	2842205361	2842211206	229
388	iso_pu_bacteria	2842217011	2842219232	229
389	iso_pu_bacteria	2842229732	2842231463	229
390	iso_pu_bacteria	2842237096	2842238548	229
391	iso_pu_bacteria	2842243621	2842246067	229
392	iso_pu_bacteria	2842250916	2842256499	229
393	iso_pu_bacteria	2842257432	2842260445	229
394	iso_pu_bacteria	2842264693	2842268336	229
395	iso_pu_bacteria	2842271015	2842273855	229
396	iso_pu_bacteria	2842278818	2842284659	229
397	iso_pu_bacteria	2842285085	2842286456	229
398	iso_pu_bacteria	2842291075	2842293288	229
399	iso_pu_bacteria	2842298080	2842299688	229
400	iso_pu_bacteria	2842304105	2842308917	229
401	iso_pu_bacteria	2842311132	2842312407	229
402	iso_pu_bacteria	2842317721	2842321985	229
403	iso_pu_bacteria	2842341865	2842344463	229
404	iso_pu_bacteria	2842357229	2842359790	229
405	iso_pu_bacteria	2842363717	2842367505	229
406	iso_pu_bacteria	2842370503	2842370669	229
407	iso_pu_bacteria	2842377471	2842379685	229
408	iso_pu_bacteria	2842384541	2842386756	229
409	iso_pu_bacteria	2842395702	2842397665	229
410	iso_pu_bacteria	2842402390	2842403991	229
411	iso_pu_bacteria	2842409023	2842410306	229
412	iso_pu_bacteria	2842415677	2842416954	229
413	iso_pu_bacteria	2842422224	2842424325	229
414	iso_pu_bacteria	2842428310	2842432308	229
415	iso_pu_bacteria	2842434925	2842438612	229
416	iso_pu_bacteria	2842441272	2842445242	229
417	iso_pu_bacteria	2842462802	2842466357	229
418	iso_pu_bacteria	2842469257	2842473177	229
419	iso_pu_bacteria	2842475841	2842476045	229
420	iso_pu_bacteria	2842482326	2842486132	229
421	iso_pu_bacteria	2842489311	2842494650	229
422	iso_pu_bacteria	2842495871	2842499891	229
423	iso_pu_bacteria	2842502639	2842503053	229
424	iso_pu_bacteria	2842509118	2842512913	229
425	iso_pu_bacteria	2844454524	2844456408	229
426	iso_pu_bacteria	2852387548	2852388190	229
427	iso_pu_bacteria	2854896431	2854897985	229
428	iso_pu_bacteria	2854911287	2854913810	229
429	iso_pu_bacteria	2854916844	2854919685	229
430	iso_pu_bacteria	2857516855	2857522002	229
431	iso_pu_bacteria	2891373044	2891375267	229
432	iso_pu_bacteria	2915650412	2915650692	229
433	iso_pu_bacteria	2919100787	2919101679	229
434	iso_pu_bacteria	2919171160	2919172290	229
435	iso_pu_bacteria	2919408235	2919408561	229
436	iso_pu_bacteria	2923556063	2923556374	229
437	iso_pu_bacteria	2933016740	2933023449	229
438	iso_pu_bacteria	2933570622	2933575361	229
439	iso_pu_bacteria	2933586486	2933588553	229
440	iso_pu_bacteria	2933599457	2933601514	229
441	iso_pu_bacteria	2935894831	2935896282	229
442	iso_pu_bacteria	2935901341	2935902513	229
443	iso_pu_bacteria	2936367885	2936369329	229
444	iso_pu_bacteria	2936375103	2936380025	229
445	iso_pu_bacteria	2936381700	2936385732	229
446	iso_pu_bacteria	2989349275	2989351733	229
447	iso_pu_bacteria	2989776772	2989777152	229
448	iso_pu_bacteria	2996887358	2996888176	229
449	iso_pu_bacteria	2996893221	2996897778	229
450	iso_pu_bacteria	3005409236	3005410827	229
451	iso_pu_bacteria	3005416602	3005423045	229
452	iso_pu_bacteria	3005445848	3005445861	229
453	iso_pu_bacteria	3005452660	3005456551	229
454	iso_pu_bacteria	639633055	639646258	229
455	iso_pu_bacteria	8005246636	8005247697	229
456	iso_pu_bacteria	8005258706	8005261273	229
457	iso_pu_bacteria	8005275841	8005278468	229
458	iso_pu_bacteria	8005282627	8005282988	229
459	iso_pu_bacteria	8005289223	8005291467	229
460	iso_pu_bacteria	8005301065	8005305651	229
461	iso_pu_bacteria	8005307578	8005310438	229
462	iso_pu_bacteria	8005314921	8005315372	229
463	iso_pu_bacteria	8005321885	8005322703	229
464	iso_pu_bacteria	8005376324	8005377836	229
465	iso_pu_bacteria	8005382845	8005385132	229
466	iso_pu_bacteria	8005395548	8005399788	229
467	iso_pu_bacteria	8005430974	8005432575	229
468	iso_pu_bacteria	8005460587	8005460600	229
469	iso_pu_bacteria	8005484373	8005484715	229
470	iso_pu_bacteria	8005497431	8005498296	229
471	iso_pu_bacteria	8005542996	8005543432	229
472	iso_pu_bacteria	8005556819	8005560212	229
473	iso_pu_bacteria	8005563573	8005564332	229
474	iso_pu_bacteria	8005570704	8005573890	229
475	iso_pu_bacteria	8005619151	8005619489	229
476	iso_pu_bacteria	8005626139	8005628056	229
477	iso_pu_bacteria	8005645114	8005649408	229
478	iso_pu_bacteria	8005668836	8005669705	229
479	iso_pu_bacteria	8005682033	8005685352	229
480	iso_pu_bacteria	8005688590	8005692595	229
481	iso_pu_bacteria	8005695170	8005699670	229
482	iso_pu_bacteria	8018127388	8018132742	229
483	iso_pu_bacteria	8018163183	8018167410	229
484	iso_pu_bacteria	8018176218	8018181880	229
485	iso_pu_bacteria	8023680758	8023684655	229
486	iso_pu_bacteria	8024479707	8024479887	229
487	iso_pu_bacteria	8024486573	8024491642	229
488	iso_pu_bacteria	8024501048	8024502166	229
489	iso_pu_bacteria	8046767195	8046769522	229
490	iso_pu_bacteria	8054558443	8054563250	229
491	iso_pu_bacteria	8056375014	8056376105	229
492	iso_pu_bacteria	8056382006	8056384152	229
493	iso_pu_bacteria	8056875544	8056878833	229
494	iso_pu_bacteria	8057575449	8057580441	229
495	iso_pu_bacteria	8057874678	8057877560	229
496	3300009036	Ga0105244_10170532	Ga0105244_101705322	230
497	3300009765	Ga0123341_1000036	Ga0123341_100003622	230
498	3300021320	Ga0214544_1000105	Ga0214544_100010555	230
499	3300021321	Ga0214542_1000029	Ga0214542_1000029114	230
500	3300021327	Ga0214543_1000040	Ga0214543_1000040114	230
501	3300038443	Ga0395901_0321180	Ga0395901_0321180_502_1212	230
502	3300041451	Ga0451791_1903792	Ga0451791_1903792_402_1094	230
503	3300041491	Ga0451833_1293275	Ga0451833_1293275_444_1136	230
504	3300048903	Ga0496100_0493633	Ga0496100_0493633_218_910	230
505	3300048919	Ga0496116_0067451	Ga0496116_0067451_1462_2154	230
506	3300048920	Ga0496117_0055141	Ga0496117_0055141_2064_2756	230
507	3300048920	Ga0496117_0108196	Ga0496117_0108196_727_1419	230
508	3300048921	Ga0496118_0071384	Ga0496118_0071384_1477_2169	230
509	3300048925	Ga0496122_0213146	Ga0496122_0213146_107_799	230
510	3300048927	Ga0496124_0007911	Ga0496124_0007911_1025_1717	230
511	3300048927	Ga0496124_0018158	Ga0496124_0018158_3184_3876	230
512	3300048928	Ga0496125_0043758	Ga0496125_0043758_2003_2695	230
513	3300049584	Ga0501068_0164756	Ga0501068_0164756_468_1160	230
514	3300049742	Ga0501080_0626327	Ga0501080_0626327_61_753	230
515	3300049823	Ga0501044_0148964	Ga0501044_0148964_1299_1991	230
516	iso_pu_bacteria	2599185156	2599332765	230
517	iso_pu_bacteria	2767802442	2770196827	230
518	iso_pu_bacteria	2821123053	2821123413	230
519	iso_pu_bacteria	2838736955	2838739564	230
520	iso_pu_bacteria	2841840854	2841844312	230
521	iso_pu_bacteria	2842140634	2842144033	230
522	iso_pu_bacteria	2842922631	2842923040	230
523	iso_pu_bacteria	2857531043	2857533637	230
524	iso_pu_bacteria	2929138655	2929142170	230
525	3300005548	Ga0070665_100270956	Ga0070665_1002709562	231
526	3300006038	Ga0075365_10049221	Ga0075365_100492212	231
527	3300006038	Ga0075365_10186572	Ga0075365_101865722	231
528	3300028379	Ga0268266_10283377	Ga0268266_102833772	231
529	3300049823	Ga0501044_0556257	Ga0501044_0556257_169_864	231
530	3300050491	nmdc:mga00v17_31065_c1	nmdc:mga00v17_31065_c1_1785_2489	231
531	3300050492	nmdc:mga0yw44_38069_c1	nmdc:mga0yw44_38069_c1_337_1047	231
532	iso_pu_bacteria	2738541317	2738947831	231
533	iso_pu_bacteria	2913308742	2913311513	231
534	iso_pu_bacteria	8005658619	8005662637	231
535	3300002987	JGI25159J45721_1000003	JGI25159J45721_100000368	232
536	3300003354	JGI25160J50197_1000003	JGI25160J50197_1000003249	232
537	3300003374	JGI25161J50226_1000368	JGI25161J50226_10003684	232
538	3300003763	Ga0055529_1001413	Ga0055529_10014136	232
539	3300003771	Ga0055526_1000453	Ga0055526_100045330	232
540	3300003775	Ga0055524_1004879	Ga0055524_10048794	232
541	3300003781	Ga0055536_1002021	Ga0055536_10020214	232
542	3300003781	Ga0055536_1006238	Ga0055536_10062384	232
543	3300003791	Ga0055530_10043210	Ga0055530_100432101	232
544	3300003794	Ga0055531_10002877	Ga0055531_100028774	232
545	3300003856	Ga0058692_1008378	Ga0058692_10083782	232
546	3300004625	Ga0055543_1000043	Ga0055543_100004337	232
547	3300005262	Ga0065165_1000025	Ga0065165_100002582	232
548	3300005262	Ga0065165_1019441	Ga0065165_10194413	232
549	3300005347	Ga0070668_100423483	Ga0070668_1004234832	232
550	3300005548	Ga0070665_100003127	Ga0070665_1000031272	232
551	3300005548	Ga0070665_100029215	Ga0070665_1000292152	232
552	3300006042	Ga0075368_10001989	Ga0075368_100019894	232
553	3300006048	Ga0075363_100147820	Ga0075363_1001478201	232
554	3300006178	Ga0075367_10142178	Ga0075367_101421782	232
555	3300006186	Ga0075369_10021106	Ga0075369_100211061	232
556	3300006186	Ga0075369_10037149	Ga0075369_100371492	232
557	3300006195	Ga0075366_10060101	Ga0075366_100601013	232
558	3300006946	Ga0079104_1005670	Ga0079104_10056704	232
559	3300006946	Ga0079104_1018229	Ga0079104_10182291	232
560	3300006948	Ga0099826_10000213	Ga0099826_1000021324	232
561	3300006948	Ga0099826_10149411	Ga0099826_101494112	232
562	3300009148	Ga0105243_10050972	Ga0105243_100509724	232
563	3300010375	Ga0105239_10638886	Ga0105239_106388862	232
564	3300011119	Ga0105246_10193117	Ga0105246_101931172	232
565	3300013100	Ga0157373_10034267	Ga0157373_100342672	232
566	3300013102	Ga0157371_10000004	Ga0157371_10000004293	232
567	3300013102	Ga0157371_10007430	Ga0157371_100074305	232
568	3300013104	Ga0157370_10004075	Ga0157370_1000407510	232
569	3300013105	Ga0157369_10083521	Ga0157369_100835212	232
570	3300013249	Ga0171463_1001	Ga0171463_10011038	232
571	3300014325	Ga0163163_10592298	Ga0163163_105922982	232
572	3300015261	Ga0182006_1070890	Ga0182006_10708902	232
573	3300015690	Ga0183363_1214	Ga0183363_12143	232
574	3300021321	Ga0214542_1034148	Ga0214542_10341482	232
575	3300021327	Ga0214543_1000027	Ga0214543_100002738	232
576	3300022739	Ga0228711_1000013	Ga0228711_100001353	232
577	3300022740	Ga0228710_1000008	Ga0228710_100000876	232
578	3300025254	Ga0209148_1000032	Ga0209148_100003224	232
579	3300025272	Ga0209455_1000098	Ga0209455_1000098115	232
580	3300025284	Ga0209130_1000005	Ga0209130_1000005232	232
581	3300025292	Ga0209676_1004355	Ga0209676_10043556	232
582	3300025294	Ga0209025_1000060	Ga0209025_1000060155	232
583	3300025294	Ga0209025_1000105	Ga0209025_1000105184	232
584	3300025294	Ga0209025_1025318	Ga0209025_10253184	232
585	3300025295	Ga0209564_1000093	Ga0209564_1000093234	232
586	3300025298	Ga0209050_1003709	Ga0209050_10037099	232
587	3300025299	Ga0209256_1000027	Ga0209256_1000027180	232
588	3300025299	Ga0209256_1010577	Ga0209256_10105772	232
589	3300025302	Ga0207426_1000015	Ga0207426_1000015367	232
590	3300025303	Ga0209051_1005073	Ga0209051_10050734	232
591	3300025304	Ga0209257_1002467	Ga0209257_100246711	232
592	3300025914	Ga0207671_10064842	Ga0207671_100648423	232
593	3300025935	Ga0207709_10025213	Ga0207709_100252133	232
594	3300025941	Ga0207711_10695024	Ga0207711_106950241	232
595	3300027111	Ga0209281_1000134	Ga0209281_1000134138	232
596	3300027111	Ga0209281_1000319	Ga0209281_100031974	232
597	3300027312	Ga0209371_1000009	Ga0209371_1000009703	232
598	3300027312	Ga0209371_1000350	Ga0209371_100035021	232
599	3300027666	Ga0209282_1000029	Ga0209282_1000029106	232
600	3300027666	Ga0209282_1001443	Ga0209282_10014436	232
601	3300027866	Ga0209813_10035755	Ga0209813_100357552	232
602	3300028379	Ga0268266_10012373	Ga0268266_100123738	232
603	3300028379	Ga0268266_10382120	Ga0268266_103821202	232
604	3300028794	Ga0307515_10000029	Ga0307515_10000029278	232
605	3300028794	Ga0307515_10010814	Ga0307515_100108145	232
606	3300030500	Ga0268256_1000010	Ga0268256_1000010702	232
607	3300030500	Ga0268256_1005076	Ga0268256_10050763	232
608	3300030744	Ga0316181_1224363	Ga0316181_12243638	232
609	3300031456	Ga0307513_10000338	Ga0307513_1000033853	232
610	3300031548	Ga0307408_100214430	Ga0307408_1002144303	232
611	3300031548	Ga0307408_100438882	Ga0307408_1004388822	232
612	3300031731	Ga0307405_10524482	Ga0307405_105244821	232
613	3300031852	Ga0307410_10184503	Ga0307410_101845031	232
614	3300031901	Ga0307406_10044166	Ga0307406_100441662	232
615	3300031967	Ga0315914_1000021	Ga0315914_100002139	232
616	3300031995	Ga0307409_100478335	Ga0307409_1004783352	232
617	3300032002	Ga0307416_100632957	Ga0307416_1006329571	232
618	3300033430	Ga0315913_1000014	Ga0315913_100001471	232
619	3300033464	Ga0315915_1000003	Ga0315915_100000339	232
620	3300035692	Ga0373935_0030290	Ga0373935_0030290_2184_2897	232
621	3300036647	Ga0316582_0059458	Ga0316582_0059458_781_1482	232
622	3300041407	Ga0439447_030194	Ga0439447_030194_102_800	232
623	3300041411	Ga0439466_0027946	Ga0439466_0027946_695_1393	232
624	3300041413	Ga0439465_0004773	Ga0439465_0004773_2850_3548	232
625	3300042007	Ga0439449_0054790	Ga0439449_0054790_420_1133	232
626	3300042145	Ga0450906_002034	Ga0450906_002034_1021_1719	232
627	3300042146	Ga0450907_011300	Ga0450907_011300_220_918	232
628	3300042147	Ga0450910_002356	Ga0450910_002356_160_858	232
629	3300042435	Ga0439434_0016669	Ga0439434_0016669_1475_2173	232
630	3300042531	Ga0450918_002770	Ga0450918_002770_899_1597	232
631	3300044683	Ga0466965_0334959	Ga0466965_0334959_36_737	232
632	3300046453	Ga0495627_067535	Ga0495627_067535_36_734	232
633	3300046674	Ga0495588_0000475	Ga0495588_0000475_1216_1914	232
634	3300047470	Ga0495681_0005503	Ga0495681_0005503_1034_1732	232
635	3300048907	Ga0496104_0502233	Ga0496104_0502233_246_944	232
636	3300048913	Ga0496110_0215204	Ga0496110_0215204_14_715	232
637	3300048914	Ga0496111_0426841	Ga0496111_0426841_212_952	232
638	3300048915	Ga0496112_0124051	Ga0496112_0124051_244_984	232
639	3300048919	Ga0496116_0000240	Ga0496116_0000240_42568_43266	232
640	3300048919	Ga0496116_0022824	Ga0496116_0022824_307_1005	232
641	3300048920	Ga0496117_0000002	Ga0496117_0000002_2166095_2166793	232
642	3300048921	Ga0496118_0000651	Ga0496118_0000651_23688_24386	232
643	3300048921	Ga0496118_0296133	Ga0496118_0296133_110_808	232
644	3300048922	Ga0496119_0029382	Ga0496119_0029382_384_1082	232
645	3300048922	Ga0496119_0094538	Ga0496119_0094538_661_1359	232
646	3300048923	Ga0496120_0000034	Ga0496120_0000034_99402_100100	232
647	3300048923	Ga0496120_0133641	Ga0496120_0133641_263_961	232
648	3300048924	Ga0496121_0062425	Ga0496121_0062425_222_920	232
649	3300048925	Ga0496122_0000001	Ga0496122_0000001_1536891_1537589	232
650	3300048925	Ga0496122_0000018	Ga0496122_0000018_113676_114374	232
651	3300048925	Ga0496122_0011288	Ga0496122_0011288_6884_7582	232
652	3300048926	Ga0496123_0000001	Ga0496123_0000001_1540622_1541320	232
653	3300048926	Ga0496123_0000015	Ga0496123_0000015_113676_114374	232
654	3300048927	Ga0496124_0000083	Ga0496124_0000083_125302_126000	232
655	3300048927	Ga0496124_0021456	Ga0496124_0021456_483_1181	232
656	3300048927	Ga0496124_0096011	Ga0496124_0096011_839_1537	232
657	3300048927	Ga0496124_0358102	Ga0496124_0358102_203_901	232
658	3300048928	Ga0496125_0013499	Ga0496125_0013499_846_1544	232
659	3300048929	Ga0496126_0000322	Ga0496126_0000322_44585_45283	232
660	3300048929	Ga0496126_0063045	Ga0496126_0063045_2335_3033	232
661	3300049571	Ga0501034_0013329	Ga0501034_0013329_6199_6906	232
662	3300050491	nmdc:mga00v17_228088_c1	nmdc:mga00v17_228088_c1_260_958	232
663	3300050492	nmdc:mga0yw44_2890_c1	nmdc:mga0yw44_2890_c1_3566_4264	232
664	3300050493	nmdc:mga0k408_79204_c1	nmdc:mga0k408_79204_c1_273_971	232
665	3300050494	nmdc:mga06z11_103479_c1	nmdc:mga06z11_103479_c1_368_1066	232
666	3300050494	nmdc:mga06z11_2782_c1	nmdc:mga06z11_2782_c1_226_924	232
667	3300050495	nmdc:mga04h51_63259_c1	nmdc:mga04h51_63259_c1_233_931	232
668	3300050516	nmdc:mga0sz30_154_c1	nmdc:mga0sz30_154_c1_11354_12052	232
669	3300050516	nmdc:mga0sz30_21312_c1	nmdc:mga0sz30_21312_c1_1439_2137	232
670	3300050516	nmdc:mga0sz30_87976_c1	nmdc:mga0sz30_87976_c1_634_1332	232
671	3300053107	Ga0500560_002067	Ga0500560_002067_2347_3045	232
672	3300053107	Ga0500560_040569	Ga0500560_040569_406_1104	232
673	3300053111	Ga0500572_000904	Ga0500572_000904_1754_2452	232
674	3300053137	Ga0500561_0000396	Ga0500561_0000396_5318_6016	232
675	3300053151	Ga0500604_0073162	Ga0500604_0073162_382_1080	232
676	3300053157	Ga0500624_000330	Ga0500624_000330_14556_15254	232
677	3300053157	Ga0500624_008607	Ga0500624_008607_178_876	232
678	3300053177	Ga0500636_0000022	Ga0500636_0000022_34835_35533	232
679	3300053177	Ga0500636_0003976	Ga0500636_0003976_7392_8090	232
680	3300059508	Ga0587088_001976	Ga0587088_001976_1446_2144	232
681	3300059508	Ga0587088_028112	Ga0587088_028112_97_795	232
682	3300059639	Ga0587062_013020	Ga0587062_013020_61_759	232
683	3300059640	Ga0587067_017920	Ga0587067_017920_238_936	232
684	3300059643	Ga0587072_038957	Ga0587072_038957_60_758	232
685	iso_pu_bacteria	2510065057	2510307183	232
686	iso_pu_bacteria	2511231052	2511499024	232
687	iso_pu_bacteria	2512047086	2512531623	232
688	iso_pu_bacteria	2513237086	2513582414	232
689	iso_pu_bacteria	2513237091	2513616119	232
690	iso_pu_bacteria	2513237140	2513884680	232
691	iso_pu_bacteria	2513237143	2513905075	232
692	iso_pu_bacteria	2515154107	2515607444	232
693	iso_pu_bacteria	2516653046	2516895299	232
694	iso_pu_bacteria	2524023207	2524450818	232
695	iso_pu_bacteria	2551306084	2551679973	232
696	iso_pu_bacteria	2551306085	2551683672	232
697	iso_pu_bacteria	2551306086	2551692228	232
698	iso_pu_bacteria	2551306087	2551701071	232
699	iso_pu_bacteria	2551306089	2551710553	232
700	iso_pu_bacteria	2551306090	2551718551	232
701	iso_pu_bacteria	2551306091	2551730273	232
702	iso_pu_bacteria	2551306092	2551735438	232
703	iso_pu_bacteria	2551306093	2551742798	232
704	iso_pu_bacteria	2936996657	2936998570	232
705	iso_pu_bacteria	2937002841	2937008678	232
706	iso_pu_bacteria	2937009748	2937011767	232
707	iso_pu_bacteria	2937016420	2937018473	232
708	iso_pu_bacteria	2937023124	2937023487	232
709	iso_pu_bacteria	2937056579	2937060772	232
710	iso_pu_bacteria	2937063883	2937066763	232
711	iso_pu_bacteria	2937071275	2937072958	232
712	iso_pu_bacteria	2937119839	2937124714	232
713	iso_pu_bacteria	2937126314	2937131871	232
714	iso_pu_bacteria	2957382221	2957384418	232
715	iso_pu_bacteria	2957395598	2957396735	232
716	iso_pu_bacteria	2957402308	2957403415	232
717	iso_pu_bacteria	2957408893	2957413436	232
718	iso_pu_bacteria	2957422303	2957425440	232
719	iso_pu_bacteria	2957430029	2957436416	232
720	iso_pu_bacteria	2957450854	2957452911	232
721	iso_pu_bacteria	2957457609	2957459510	232
722	iso_pu_bacteria	2957464669	2957467251	232
723	iso_pu_bacteria	2957471148	2957476144	232
724	iso_pu_bacteria	2957484790	2957486640	232
725	iso_pu_bacteria	2957491536	2957494015	232
726	iso_pu_bacteria	2957498199	2957504582	232
727	iso_pu_bacteria	2957505466	2957512444	232
728	iso_pu_bacteria	2960584000	2960588660	232
729	iso_pu_bacteria	2960597568	2960600819	232
730	iso_pu_bacteria	2960603979	2960604365	232
731	iso_pu_bacteria	2960610863	2960613788	232
732	iso_pu_bacteria	2960624210	2960625961	232
733	iso_pu_bacteria	2960637947	2960644807	232
734	iso_pu_bacteria	2960645483	2960652294	232
735	iso_pu_bacteria	2960652885	2960657597	232
736	iso_pu_bacteria	2960667422	2960670260	232
737	iso_pu_bacteria	2960674078	2960679442	232
738	iso_pu_bacteria	2960687367	2960687387	232
739	iso_pu_bacteria	2964607997	2964613431	232
740	iso_pu_bacteria	2964615318	2964618314	232
741	iso_pu_bacteria	2964621998	2964627543	232
742	iso_pu_bacteria	2964628898	2964635146	232
743	iso_pu_bacteria	2964636051	2964639991	232
744	iso_pu_bacteria	2964643177	2964645047	232
745	iso_pu_bacteria	2964663802	2964670262	232
746	iso_pu_bacteria	2964670856	2964677955	232
747	iso_pu_bacteria	2964678106	2964684241	232
748	iso_pu_bacteria	2964685014	2964685261	232
749	iso_pu_bacteria	2964691889	2964698177	232
750	iso_pu_bacteria	2964698721	2964704629	232
751	iso_pu_bacteria	2964705432	2964708252	232
752	iso_pu_bacteria	2964712639	2964712973	232
753	iso_pu_bacteria	2964719344	2964719898	232
754	iso_pu_bacteria	2967671571	2967677431	232
755	iso_pu_bacteria	2967699805	2967701077	232
756	iso_pu_bacteria	2967706974	2967709869	232
757	iso_pu_bacteria	2967742019	2967745230	232
758	iso_pu_bacteria	2967748971	2967749510	232
759	iso_pu_bacteria	2967755722	2967757260	232
760	iso_pu_bacteria	2967769361	2967771323	232
761	iso_pu_bacteria	2970033650	2970037494	232
762	iso_pu_bacteria	2970047711	2970050922	232
763	iso_pu_bacteria	2970054988	2970058319	232
764	iso_pu_bacteria	2970061556	2970068281	232
765	iso_pu_bacteria	2970068827	2970072510	232
766	iso_pu_bacteria	2970076120	2970079369	232
767	iso_pu_bacteria	2970082768	2970088072	232
768	iso_pu_bacteria	2970088815	2970092266	232
769	iso_pu_bacteria	2970095765	2970099387	232
770	iso_pu_bacteria	2970102677	2970106099	232
771	iso_pu_bacteria	2970109326	2970111557	232
772	iso_pu_bacteria	2970136068	2970143046	232
773	iso_pu_bacteria	2970149975	2970151894	232
774	iso_pu_bacteria	2970156795	2970159341	232
775	iso_pu_bacteria	2970170962	2970173675	232
776	iso_pu_bacteria	2970177841	2970179402	232
777	iso_pu_bacteria	2970191845	2970194932	232
778	iso_pu_bacteria	2977516862	2977522804	232
779	iso_pu_bacteria	2977537788	2977538529	232
780	iso_pu_bacteria	2977558990	2977559454	232
781	iso_pu_bacteria	2977565890	2977570056	232
782	iso_pu_bacteria	2977572785	2977575598	232
783	iso_pu_bacteria	648276728	648736760	232
784	iso_pu_bacteria	8003992118	8003992163	232
785	iso_pu_bacteria	8054460903	8054460946	232
786	iso_pu_bacteria	8055431914	8055433624	232
787	3300001979	JGI24740J21852_10000551	JGI24740J21852_1000055116	233
788	3300002704	JGI25155J39150_1000013	JGI25155J39150_1000013146	233
789	3300002705	JGI25156J39149_1000011	JGI25156J39149_1000011146	233
790	3300002737	JGI25162J39368_1000423	JGI25162J39368_10004237	233
791	3300002737	JGI25162J39368_1002103	JGI25162J39368_10021037	233
792	3300002738	JGI25154J39366_1000030	JGI25154J39366_1000030146	233
793	3300002738	JGI25154J39366_1014318	JGI25154J39366_10143181	233
794	3300002741	JGI25157J39369_1000013	JGI25157J39369_1000013146	233
795	3300002773	JGI25152J39213_1000443	JGI25152J39213_100044321	233
796	3300002773	JGI25152J39213_1001399	JGI25152J39213_10013992	233
797	3300002773	JGI25152J39213_1006537	JGI25152J39213_10065372	233
798	3300002773	JGI25152J39213_1006577	JGI25152J39213_10065772	233
799	3300002773	JGI25152J39213_1012497	JGI25152J39213_10124971	233
800	3300002774	JGI25150J39212_1000178	JGI25150J39212_100017814	233
801	3300002774	JGI25150J39212_1017924	JGI25150J39212_10179242	233
802	3300002987	JGI25159J45721_1001009	JGI25159J45721_10010099	233
803	3300002987	JGI25159J45721_1004497	JGI25159J45721_10044973	233
804	3300003187	JGI25151J46595_10000529	JGI25151J46595_1000052922	233
805	3300003187	JGI25151J46595_10001346	JGI25151J46595_100013466	233
806	3300003187	JGI25151J46595_10009883	JGI25151J46595_100098832	233
807	3300003187	JGI25151J46595_10024162	JGI25151J46595_100241623	233
808	3300003187	JGI25151J46595_10041702	JGI25151J46595_100417023	233
809	3300003187	JGI25151J46595_10052323	JGI25151J46595_100523232	233
810	3300003214	JGI25165J46597_1000506	JGI25165J46597_10005067	233
811	3300003214	JGI25165J46597_1000605	JGI25165J46597_10006056	233
812	3300003214	JGI25165J46597_1002361	JGI25165J46597_10023613	233
813	3300003215	JGI25153J46596_10001384	JGI25153J46596_1000138415	233
814	3300003215	JGI25153J46596_10014807	JGI25153J46596_100148072	233
815	3300003215	JGI25153J46596_10015131	JGI25153J46596_100151312	233
816	3300003215	JGI25153J46596_10015185	JGI25153J46596_100151852	233
817	3300003316	rootH1_10094694	rootH1_100946942	233
818	3300003322	rootL2_10037071	rootL2_100370714	233
819	3300003323	rootH1_10029540	rootH1_100295401	233
820	3300003323	rootH1_10092021	rootH1_100920212	233
821	3300003323	rootH1_10133046	rootH1_101330462	233
822	3300003354	JGI25160J50197_1000012	JGI25160J50197_100001275	233
823	3300003354	JGI25160J50197_1006200	JGI25160J50197_10062004	233
824	3300003354	JGI25160J50197_1018439	JGI25160J50197_10184392	233
825	3300003374	JGI25161J50226_1000002	JGI25161J50226_1000002227	233
826	3300003374	JGI25161J50226_1000186	JGI25161J50226_10001864	233
827	3300003374	JGI25161J50226_1006335	JGI25161J50226_10063352	233
828	3300003771	Ga0055526_1001274	Ga0055526_100127414	233
829	3300003771	Ga0055526_1004435	Ga0055526_10044355	233
830	3300003771	Ga0055526_1030293	Ga0055526_10302932	233
831	3300003771	Ga0055526_1039897	Ga0055526_10398971	233
832	3300003775	Ga0055524_1002738	Ga0055524_10027383	233
833	3300003775	Ga0055524_1007143	Ga0055524_10071434	233
834	3300003775	Ga0055524_1012309	Ga0055524_10123093	233
835	3300003775	Ga0055524_1050653	Ga0055524_10506532	233
836	3300003781	Ga0055536_1001918	Ga0055536_10019184	233
837	3300003790	Ga0055528_1000285	Ga0055528_100028535	233
838	3300003790	Ga0055528_1005258	Ga0055528_10052582	233
839	3300003790	Ga0055528_1011455	Ga0055528_10114554	233
840	3300003790	Ga0055528_1014058	Ga0055528_10140582	233
841	3300003790	Ga0055528_1015462	Ga0055528_10154623	233
842	3300003790	Ga0055528_1034961	Ga0055528_10349612	233
843	3300003790	Ga0055528_1042964	Ga0055528_10429642	233
844	3300003792	Ga0055540_1004310	Ga0055540_10043104	233
845	3300003792	Ga0055540_1004507	Ga0055540_10045074	233
846	3300003792	Ga0055540_1013036	Ga0055540_10130362	233
847	3300003792	Ga0055540_1018111	Ga0055540_10181112	233
848	3300003792	Ga0055540_1030408	Ga0055540_10304082	233
849	3300003794	Ga0055531_10007297	Ga0055531_100072974	233
850	3300004625	Ga0055543_1000050	Ga0055543_100005022	233
851	3300004625	Ga0055543_1000073	Ga0055543_100007376	233
852	3300004625	Ga0055543_1001723	Ga0055543_10017238	233
853	3300005262	Ga0065165_1000867	Ga0065165_100086713	233
854	3300005262	Ga0065165_1015349	Ga0065165_10153492	233
855	3300005262	Ga0065165_1016068	Ga0065165_10160682	233
856	3300005331	Ga0070670_100003791	Ga0070670_1000037919	233
857	3300005347	Ga0070668_100873734	Ga0070668_1008737341	233
858	3300005355	Ga0070671_100302306	Ga0070671_1003023062	233
859	3300005367	Ga0070667_100317372	Ga0070667_1003173721	233
860	3300005548	Ga0070665_100208900	Ga0070665_1002089002	233
861	3300005548	Ga0070665_100297662	Ga0070665_1002976622	233
862	3300005614	Ga0068856_100087166	Ga0068856_1000871662	233
863	3300005616	Ga0068852_100240130	Ga0068852_1002401302	233
864	3300005834	Ga0068851_10108959	Ga0068851_101089592	233
865	3300006038	Ga0075365_10000863	Ga0075365_100008638	233
866	3300006038	Ga0075365_10102306	Ga0075365_101023062	233
867	3300006048	Ga0075363_100082330	Ga0075363_1000823302	233
868	3300006051	Ga0075364_10001230	Ga0075364_100012305	233
869	3300006177	Ga0075362_10014260	Ga0075362_100142603	233
870	3300006177	Ga0075362_10213770	Ga0075362_102137702	233
871	3300006178	Ga0075367_10014306	Ga0075367_100143062	233
872	3300006178	Ga0075367_10091290	Ga0075367_100912902	233
873	3300006186	Ga0075369_10000259	Ga0075369_100002595	233
874	3300006195	Ga0075366_10017386	Ga0075366_100173862	233
875	3300006353	Ga0075370_10008148	Ga0075370_100081482	233
876	3300006353	Ga0075370_10047542	Ga0075370_100475424	233
877	3300006353	Ga0075370_10290204	Ga0075370_102902041	233
878	3300006946	Ga0079104_1000033	Ga0079104_1000033144	233
879	3300009011	Ga0105251_10013403	Ga0105251_100134035	233
880	3300009093	Ga0105240_10000024	Ga0105240_10000024113	233
881	3300009101	Ga0105247_10180122	Ga0105247_101801222	233
882	3300009148	Ga0105243_10062496	Ga0105243_100624962	233
883	3300009177	Ga0105248_10189261	Ga0105248_101892614	233
884	3300009545	Ga0105237_10002258	Ga0105237_1000225811	233
885	3300009766	Ga0123342_1005726	Ga0123342_100572617	233
886	3300009766	Ga0123342_1008198	Ga0123342_100819816	233
887	3300010375	Ga0105239_10006225	Ga0105239_100062255	233
888	3300011119	Ga0105246_10272820	Ga0105246_102728202	233
889	3300013104	Ga0157370_10009491	Ga0157370_1000949111	233
890	3300013105	Ga0157369_10154184	Ga0157369_101541843	233
891	3300014497	Ga0182008_10026065	Ga0182008_100260652	233
892	3300015262	Ga0182007_10009720	Ga0182007_100097204	233
893	3300015265	Ga0182005_1001337	Ga0182005_10013372	233
894	3300025206	Ga0209435_100026	Ga0209435_100026143	233
895	3300025208	Ga0209436_100048	Ga0209436_10004833	233
896	3300025208	Ga0209436_106879	Ga0209436_1068792	233
897	3300025228	Ga0209672_110680	Ga0209672_1106802	233
898	3300025230	Ga0209563_101834	Ga0209563_1018344	233
899	3300025233	Ga0209437_100050	Ga0209437_100050311	233
900	3300025233	Ga0209437_100056	Ga0209437_100056203	233
901	3300025233	Ga0209437_116442	Ga0209437_1164421	233
902	3300025245	Ga0207425_1000305	Ga0207425_100030523	233
903	3300025245	Ga0207425_1000800	Ga0207425_100080016	233
904	3300025245	Ga0207425_1015048	Ga0207425_10150482	233
905	3300025245	Ga0207425_1029928	Ga0207425_10299282	233
906	3300025245	Ga0207425_1031095	Ga0207425_10310952	233
907	3300025246	Ga0209646_1000084	Ga0209646_1000084143	233
908	3300025246	Ga0209646_1016213	Ga0209646_10162131	233
909	3300025250	Ga0209026_1000080	Ga0209026_1000080143	233
910	3300025253	Ga0209677_101467	Ga0209677_1014675	233
911	3300025254	Ga0209148_1004126	Ga0209148_10041262	233
912	3300025256	Ga0209759_1000061	Ga0209759_1000061143	233
913	3300025258	Ga0209129_1000381	Ga0209129_100038123	233
914	3300025258	Ga0209129_1000412	Ga0209129_10004129	233
915	3300025258	Ga0209129_1000500	Ga0209129_10005005	233
916	3300025258	Ga0209129_1000789	Ga0209129_100078919	233
917	3300025258	Ga0209129_1001951	Ga0209129_10019514	233
918	3300025258	Ga0209129_1002630	Ga0209129_10026307	233
919	3300025258	Ga0209129_1003855	Ga0209129_10038555	233
920	3300025258	Ga0209129_1025481	Ga0209129_10254812	233
921	3300025261	Ga0209233_1000037	Ga0209233_1000037353	233
922	3300025261	Ga0209233_1000071	Ga0209233_1000071203	233
923	3300025261	Ga0209233_1000234	Ga0209233_100023465	233
924	3300025263	Ga0209565_1015636	Ga0209565_10156362	233
925	3300025272	Ga0209455_1013484	Ga0209455_10134842	233
926	3300025273	Ga0209673_1000024	Ga0209673_1000024273	233
927	3300025273	Ga0209673_1000135	Ga0209673_1000135158	233
928	3300025273	Ga0209673_1000677	Ga0209673_10006771	233
929	3300025273	Ga0209673_1001830	Ga0209673_10018302	233
930	3300025273	Ga0209673_1002722	Ga0209673_100272211	233
931	3300025273	Ga0209673_1012261	Ga0209673_10122615	233
932	3300025273	Ga0209673_1017075	Ga0209673_10170752	233
933	3300025273	Ga0209673_1031600	Ga0209673_10316002	233
934	3300025284	Ga0209130_1000002	Ga0209130_1000002407	233
935	3300025284	Ga0209130_1000028	Ga0209130_1000028223	233
936	3300025284	Ga0209130_1021502	Ga0209130_10215023	233
937	3300025291	Ga0209675_1020323	Ga0209675_10203232	233
938	3300025292	Ga0209676_1005618	Ga0209676_10056185	233
939	3300025292	Ga0209676_1013521	Ga0209676_10135212	233
940	3300025294	Ga0209025_1000037	Ga0209025_100003766	233
941	3300025294	Ga0209025_1000235	Ga0209025_100023540	233
942	3300025294	Ga0209025_1000748	Ga0209025_100074836	233
943	3300025294	Ga0209025_1001229	Ga0209025_100122923	233
944	3300025294	Ga0209025_1006675	Ga0209025_100667511	233
945	3300025294	Ga0209025_1013070	Ga0209025_10130705	233
946	3300025294	Ga0209025_1047371	Ga0209025_10473712	233
947	3300025295	Ga0209564_1000138	Ga0209564_1000138140	233
948	3300025295	Ga0209564_1000746	Ga0209564_10007469	233
949	3300025295	Ga0209564_1001016	Ga0209564_10010161	233
950	3300025295	Ga0209564_1007119	Ga0209564_10071194	233
951	3300025295	Ga0209564_1030516	Ga0209564_10305162	233
952	3300025297	Ga0209758_1000170	Ga0209758_100017068	233
953	3300025297	Ga0209758_1001066	Ga0209758_100106623	233
954	3300025297	Ga0209758_1001135	Ga0209758_10011355	233
955	3300025297	Ga0209758_1001253	Ga0209758_100125319	233
956	3300025297	Ga0209758_1001373	Ga0209758_10013738	233
957	3300025297	Ga0209758_1001628	Ga0209758_100162819	233
958	3300025297	Ga0209758_1004403	Ga0209758_100440310	233
959	3300025297	Ga0209758_1011108	Ga0209758_10111087	233
960	3300025297	Ga0209758_1012839	Ga0209758_10128393	233
961	3300025297	Ga0209758_1020415	Ga0209758_10204152	233
962	3300025297	Ga0209758_1048699	Ga0209758_10486992	233
963	3300025298	Ga0209050_1008168	Ga0209050_10081684	233
964	3300025298	Ga0209050_1010198	Ga0209050_10101983	233
965	3300025299	Ga0209256_1001094	Ga0209256_100109426	233
966	3300025299	Ga0209256_1001547	Ga0209256_100154722	233
967	3300025299	Ga0209256_1002449	Ga0209256_100244914	233
968	3300025299	Ga0209256_1003628	Ga0209256_10036285	233
969	3300025299	Ga0209256_1008150	Ga0209256_10081504	233
970	3300025299	Ga0209256_1009975	Ga0209256_10099752	233
971	3300025299	Ga0209256_1016057	Ga0209256_10160572	233
972	3300025302	Ga0207426_1000012	Ga0207426_1000012358	233
973	3300025302	Ga0207426_1000013	Ga0207426_1000013407	233
974	3300025302	Ga0207426_1000070	Ga0207426_10000703	233
975	3300025302	Ga0207426_1001333	Ga0207426_100133321	233
976	3300025303	Ga0209051_1000197	Ga0209051_10001975	233
977	3300025303	Ga0209051_1001552	Ga0209051_10015525	233
978	3300025303	Ga0209051_1004161	Ga0209051_10041619	233
979	3300025303	Ga0209051_1005149	Ga0209051_10051494	233
980	3300025303	Ga0209051_1005927	Ga0209051_10059277	233
981	3300025303	Ga0209051_1007931	Ga0209051_10079315	233
982	3300025303	Ga0209051_1040070	Ga0209051_10400703	233
983	3300025304	Ga0209257_1001770	Ga0209257_100177012	233
984	3300025304	Ga0209257_1006514	Ga0209257_10065142	233
985	3300025321	Ga0207656_10070633	Ga0207656_100706332	233
986	3300025903	Ga0207680_10039921	Ga0207680_100399214	233
987	3300025913	Ga0207695_10000036	Ga0207695_10000036183	233
988	3300025914	Ga0207671_10000354	Ga0207671_1000035457	233
989	3300025925	Ga0207650_10001835	Ga0207650_100018356	233
990	3300025931	Ga0207644_10153218	Ga0207644_101532183	233
991	3300025935	Ga0207709_10049246	Ga0207709_100492462	233
992	3300025941	Ga0207711_10196377	Ga0207711_101963774	233
993	3300025961	Ga0207712_10381786	Ga0207712_103817862	233
994	3300025972	Ga0207668_10054946	Ga0207668_100549462	233
995	3300025972	Ga0207668_10420606	Ga0207668_104206062	233
996	3300025986	Ga0207658_10163001	Ga0207658_101630011	233
997	3300025986	Ga0207658_10357046	Ga0207658_103570463	233
998	3300026078	Ga0207702_10102437	Ga0207702_101024372	233
999	3300026078	Ga0207702_10437561	Ga0207702_104375612	233
1000	3300026142	Ga0207698_10006733	Ga0207698_100067337	233
1001	3300027111	Ga0209281_1000043	Ga0209281_1000043279	233
1002	3300027312	Ga0209371_1002880	Ga0209371_10028802	233
1003	3300028379	Ga0268266_10202715	Ga0268266_102027152	233
1004	3300028379	Ga0268266_10249833	Ga0268266_102498332	233
1005	3300028794	Ga0307515_10000112	Ga0307515_10000112155	233
1006	3300028794	Ga0307515_10024665	Ga0307515_1002466511	233
1007	3300030500	Ga0268256_1015551	Ga0268256_10155513	233
1008	3300031456	Ga0307513_10234256	Ga0307513_102342562	233
1009	3300031731	Ga0307405_10000925	Ga0307405_100009259	233
1010	3300031731	Ga0307405_10064837	Ga0307405_100648374	233
1011	3300031731	Ga0307405_10425658	Ga0307405_104256582	233
1012	3300031901	Ga0307406_10009787	Ga0307406_100097873	233
1013	3300031911	Ga0307412_10004224	Ga0307412_100042244	233
1014	3300037471	Ga0395905_0006166	Ga0395905_0006166_8933_9691	233
1015	3300037471	Ga0395905_0106953	Ga0395905_0106953_380_1102	233
1016	3300038443	Ga0395901_0550777	Ga0395901_0550777_108_821	233
1017	3300041413	Ga0439465_0009462	Ga0439465_0009462_217_918	233
1018	3300041453	Ga0451797_1171676	Ga0451797_1171676_221_922	233
1019	3300041492	Ga0451835_0488130	Ga0451835_0488130_606_1307	233
1020	3300041496	Ga0451839_1420443	Ga0451839_1420443_411_1112	233
1021	3300041498	Ga0451841_1091507	Ga0451841_1091507_475_1176	233
1022	3300041502	Ga0451846_40457	Ga0451846_40457_182_883	233
1023	3300041503	Ga0451847_0189618	Ga0451847_0189618_405_1106	233
1024	3300041505	Ga0451849_0229890	Ga0451849_0229890_77_778	233
1025	3300041505	Ga0451849_0827053	Ga0451849_0827053_77_778	233
1026	3300041507	Ga0451851_1323304	Ga0451851_1323304_577_1278	233
1027	3300041510	Ga0451854_25381	Ga0451854_25381_272_973	233
1028	3300041512	Ga0451853_0400516	Ga0451853_0400516_121_822	233
1029	3300041916	Ga0452271_15394	Ga0452271_15394_270_971	233
1030	3300042007	Ga0439449_0044343	Ga0439449_0044343_748_1449	233
1031	3300044694	Ga0466963_0000912	Ga0466963_0000912_14239_14940	233
1032	3300044765	Ga0466970_0001692	Ga0466970_0001692_9807_10508	233
1033	3300046459	Ga0495629_0024932	Ga0495629_0024932_2716_3417	233
1034	3300046474	Ga0495605_0037231	Ga0495605_0037231_316_1017	233
1035	3300046476	Ga0495662_0010133	Ga0495662_0010133_1025_1726	233
1036	3300046492	Ga0495585_0016114	Ga0495585_0016114_3521_4222	233
1037	3300046492	Ga0495585_0042144	Ga0495585_0042144_1796_2497	233
1038	3300046501	Ga0495607_0049008	Ga0495607_0049008_1245_1946	233
1039	3300046501	Ga0495607_0147499	Ga0495607_0147499_178_879	233
1040	3300046506	Ga0495583_0066236	Ga0495583_0066236_526_1227	233
1041	3300046507	Ga0495606_0006039	Ga0495606_0006039_4651_5352	233
1042	3300046507	Ga0495606_0067299	Ga0495606_0067299_596_1297	233
1043	3300046512	Ga0495610_0000420	Ga0495610_0000420_41963_42664	233
1044	3300046512	Ga0495610_0020650	Ga0495610_0020650_2777_3478	233
1045	3300046512	Ga0495610_0023004	Ga0495610_0023004_204_905	233
1046	3300046513	Ga0495616_0150806	Ga0495616_0150806_106_807	233
1047	3300046515	Ga0495620_0023336	Ga0495620_0023336_291_992	233
1048	3300046515	Ga0495620_0027713	Ga0495620_0027713_1242_1943	233
1049	3300046518	Ga0495631_0007672	Ga0495631_0007672_478_1179	233
1050	3300046518	Ga0495631_0128006	Ga0495631_0128006_67_768	233
1051	3300046519	Ga0495632_0007814	Ga0495632_0007814_4925_5626	233
1052	3300046519	Ga0495632_0064838	Ga0495632_0064838_720_1421	233
1053	3300046522	Ga0495643_0013894	Ga0495643_0013894_67_768	233
1054	3300046522	Ga0495643_0026738	Ga0495643_0026738_612_1313	233
1055	3300046522	Ga0495643_0036112	Ga0495643_0036112_689_1390	233
1056	3300046522	Ga0495643_0100960	Ga0495643_0100960_638_1339	233
1057	3300046523	Ga0495644_0071838	Ga0495644_0071838_83_784	233
1058	3300046524	Ga0495648_0097357	Ga0495648_0097357_33_734	233
1059	3300046530	Ga0495654_0000392	Ga0495654_0000392_8617_9318	233
1060	3300046530	Ga0495654_0014160	Ga0495654_0014160_556_1257	233
1061	3300046536	Ga0495587_0034133	Ga0495587_0034133_958_1659	233
1062	3300046538	Ga0495609_0106881	Ga0495609_0106881_275_976	233
1063	3300046542	Ga0495597_0009904	Ga0495597_0009904_936_1637	233
1064	3300046557	Ga0495622_0070019	Ga0495622_0070019_548_1249	233
1065	3300046558	Ga0495633_0105905	Ga0495633_0105905_177_878	233
1066	3300046616	Ga0495668_0006843	Ga0495668_0006843_938_1639	233
1067	3300046660	Ga0495625_0002334	Ga0495625_0002334_16013_16714	233
1068	3300046660	Ga0495625_0162142	Ga0495625_0162142_429_1130	233
1069	3300046674	Ga0495588_0039403	Ga0495588_0039403_803_1504	233
1070	3300046674	Ga0495588_0147778	Ga0495588_0147778_57_758	233
1071	3300046675	Ga0495657_0010598	Ga0495657_0010598_5456_6157	233
1072	3300046690	Ga0495624_0062129	Ga0495624_0062129_781_1482	233
1073	3300046691	Ga0495670_0090709	Ga0495670_0090709_710_1411	233
1074	3300046694	Ga0495649_0022435	Ga0495649_0022435_453_1154	233
1075	3300046694	Ga0495649_0084444	Ga0495649_0084444_894_1595	233
1076	3300046809	Ga0495600_0005212	Ga0495600_0005212_2546_3247	233
1077	3300046810	Ga0495660_0012554	Ga0495660_0012554_2569_3270	233
1078	3300046810	Ga0495660_0073476	Ga0495660_0073476_35_736	233
1079	3300047443	Ga0495687_061757	Ga0495687_061757_377_1078	233
1080	3300047469	Ga0495673_0087757	Ga0495673_0087757_218_919	233
1081	3300047472	Ga0495686_0004895	Ga0495686_0004895_9205_9906	233
1082	3300047472	Ga0495686_0011525	Ga0495686_0011525_992_1693	233
1083	3300047472	Ga0495686_0109018	Ga0495686_0109018_687_1388	233
1084	3300048905	Ga0496102_0044102	Ga0496102_0044102_2509_3210	233
1085	3300048906	Ga0496103_0031907	Ga0496103_0031907_2029_2730	233
1086	3300048909	Ga0496106_0004153	Ga0496106_0004153_247_948	233
1087	3300048913	Ga0496110_0060656	Ga0496110_0060656_2620_3321	233
1088	3300048914	Ga0496111_0001325	Ga0496111_0001325_12482_13183	233
1089	3300048919	Ga0496116_0029111	Ga0496116_0029111_2971_3672	233
1090	3300048919	Ga0496116_0086389	Ga0496116_0086389_562_1266	233
1091	3300048919	Ga0496116_0099895	Ga0496116_0099895_1006_1710	233
1092	3300048919	Ga0496116_0102714	Ga0496116_0102714_907_1611	233
1093	3300048920	Ga0496117_0001876	Ga0496117_0001876_10743_11444	233
1094	3300048920	Ga0496117_0002649	Ga0496117_0002649_20780_21481	233
1095	3300048920	Ga0496117_0030737	Ga0496117_0030737_949_1653	233
1096	3300048921	Ga0496118_0018009	Ga0496118_0018009_4986_5687	233
1097	3300048921	Ga0496118_0041385	Ga0496118_0041385_372_1073	233
1098	3300048921	Ga0496118_0044731	Ga0496118_0044731_770_1471	233
1099	3300048922	Ga0496119_0072581	Ga0496119_0072581_655_1359	233
1100	3300048923	Ga0496120_0060031	Ga0496120_0060031_956_1657	233
1101	3300048923	Ga0496120_0073523	Ga0496120_0073523_374_1075	233
1102	3300048924	Ga0496121_0000220	Ga0496121_0000220_91778_92482	233
1103	3300048924	Ga0496121_0000806	Ga0496121_0000806_7755_8507	233
1104	3300048924	Ga0496121_0003514	Ga0496121_0003514_807_1508	233
1105	3300048924	Ga0496121_0009177	Ga0496121_0009177_9367_10086	233
1106	3300048924	Ga0496121_0027587	Ga0496121_0027587_3640_4341	233
1107	3300048924	Ga0496121_0092679	Ga0496121_0092679_306_1007	233
1108	3300048924	Ga0496121_0187842	Ga0496121_0187842_515_1216	233
1109	3300048924	Ga0496121_0309420	Ga0496121_0309420_137_838	233
1110	3300048925	Ga0496122_0000309	Ga0496122_0000309_80371_81072	233
1111	3300048925	Ga0496122_0004849	Ga0496122_0004849_14964_15665	233
1112	3300048925	Ga0496122_0020008	Ga0496122_0020008_266_967	233
1113	3300048925	Ga0496122_0034803	Ga0496122_0034803_396_1097	233
1114	3300048926	Ga0496123_0000396	Ga0496123_0000396_65699_66400	233
1115	3300048926	Ga0496123_0011715	Ga0496123_0011715_749_1450	233
1116	3300048926	Ga0496123_0019904	Ga0496123_0019904_4101_4802	233
1117	3300048926	Ga0496123_0084992	Ga0496123_0084992_225_929	233
1118	3300048927	Ga0496124_0000532	Ga0496124_0000532_7984_8685	233
1119	3300048927	Ga0496124_0050475	Ga0496124_0050475_1875_2579	233
1120	3300048927	Ga0496124_0068424	Ga0496124_0068424_1798_2499	233
1121	3300048927	Ga0496124_0087269	Ga0496124_0087269_1603_2304	233
1122	3300048927	Ga0496124_0122087	Ga0496124_0122087_355_1056	233
1123	3300048927	Ga0496124_0357081	Ga0496124_0357081_89_790	233
1124	3300048927	Ga0496124_0373889	Ga0496124_0373889_125_826	233
1125	3300048928	Ga0496125_0000001	Ga0496125_0000001_91926_92630	233
1126	3300048928	Ga0496125_0000393	Ga0496125_0000393_17940_18641	233
1127	3300048928	Ga0496125_0082978	Ga0496125_0082978_1335_2036	233
1128	3300048928	Ga0496125_0107967	Ga0496125_0107967_1039_1740	233
1129	3300048928	Ga0496125_0248956	Ga0496125_0248956_117_818	233
1130	3300048929	Ga0496126_0001032	Ga0496126_0001032_40652_41353	233
1131	3300048929	Ga0496126_0026423	Ga0496126_0026423_395_1096	233
1132	3300048929	Ga0496126_0058100	Ga0496126_0058100_2569_3270	233
1133	3300048929	Ga0496126_0167296	Ga0496126_0167296_947_1651	233
1134	3300049569	Ga0501032_0196189	Ga0501032_0196189_512_1213	233
1135	3300049570	Ga0501033_0000120	Ga0501033_0000120_57504_58208	233
1136	3300049571	Ga0501034_0253795	Ga0501034_0253795_363_1100	233
1137	3300049574	Ga0501038_0216669	Ga0501038_0216669_728_1429	233
1138	3300049575	Ga0501039_0552563	Ga0501039_0552563_62_763	233
1139	3300049579	Ga0501043_0146223	Ga0501043_0146223_255_956	233
1140	3300049579	Ga0501043_0208380	Ga0501043_0208380_235_936	233
1141	3300049581	Ga0501047_0123646	Ga0501047_0123646_103_804	233
1142	3300049589	Ga0501073_0220294	Ga0501073_0220294_569_1270	233
1143	3300049822	Ga0501035_0000479	Ga0501035_0000479_816_1520	233
1144	3300050489	nmdc:mga03683_54274_c1	nmdc:mga03683_54274_c1_738_1439	233
1145	3300050490	nmdc:mga03n38_178624_c1	nmdc:mga03n38_178624_c1_45_746	233
1146	3300050491	nmdc:mga00v17_288_c1	nmdc:mga00v17_288_c1_27913_28614	233
1147	3300050492	nmdc:mga0yw44_194309_c1	nmdc:mga0yw44_194309_c1_407_1108	233
1148	3300050493	nmdc:mga0k408_5264_c1	nmdc:mga0k408_5264_c1_1483_2184	233
1149	3300050494	nmdc:mga06z11_48425_c1	nmdc:mga06z11_48425_c1_787_1488	233
1150	3300050496	nmdc:mga07m45_211533_c1	nmdc:mga07m45_211533_c1_281_982	233
1151	3300050496	nmdc:mga07m45_4289_c1	nmdc:mga07m45_4289_c1_11_712	233
1152	3300053086	Ga0500578_0106617	Ga0500578_0106617_819_1520	233
1153	3300053088	Ga0500644_0165418	Ga0500644_0165418_169_882	233
1154	3300053109	Ga0500569_008622	Ga0500569_008622_416_1117	233
1155	3300053122	Ga0500608_022089	Ga0500608_022089_718_1431	233
1156	3300053122	Ga0500608_070006	Ga0500608_070006_176_877	233
1157	3300053125	Ga0500618_005643	Ga0500618_005643_2407_3108	233
1158	3300053125	Ga0500618_013121	Ga0500618_013121_921_1622	233
1159	3300053134	Ga0500658_0015730	Ga0500658_0015730_261_962	233
1160	3300053136	Ga0500559_0011680	Ga0500559_0011680_2866_3579	233
1161	3300053139	Ga0500568_0010541	Ga0500568_0010541_3512_4213	233
1162	3300053140	Ga0500573_0000445	Ga0500573_0000445_8488_9195	233
1163	3300053148	Ga0500590_004719	Ga0500590_004719_748_1449	233
1164	3300053153	Ga0500616_0000503	Ga0500616_0000503_44434_45135	233
1165	3300053153	Ga0500616_0013651	Ga0500616_0013651_1718_2419	233
1166	3300053156	Ga0500622_0000446	Ga0500622_0000446_38287_39000	233
1167	3300053156	Ga0500622_0003265	Ga0500622_0003265_10245_10946	233
1168	3300059492	Ga0587073_0007907	Ga0587073_0007907_210_911	233
1169	3300059503	Ga0587080_007965	Ga0587080_007965_58_759	233
1170	3300059507	Ga0587086_015927	Ga0587086_015927_36_737	233
1171	3300060353	Ga0501082_0175143	Ga0501082_0175143_148_849	233
1172	3300061719	Ga0466962_0160356	Ga0466962_0160356_155_856	233
1173	iso_pu_bacteria	2791355253	2793282920	233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02390

Methyltransf_4

Putative methyltransferase

87

256

0.92 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3dxz-assembly1.cif.gz_A	crystal structure of ectrmb in complex with sah	0.8873	31	233
3dxy-assembly1.cif.gz_A	crystal structure of ectrmb in complex with sam	0.8815	31	233
3dxz-assembly1.cif.gz_A	crystal structure of ectrmb in complex with sah	0.8625	31	233
3dxy-assembly1.cif.gz_A	crystal structure of ectrmb in complex with sam	0.8533	31	233
7nzj-assembly3.cif.gz_E	structure of bstrmb apo	0.8474	28	233

ID	Description	Score	Start	End	Superfamily
3dxzA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8873	31	233	3.40.50.150
af_Q8I3G1_737_866_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8758	57	137	3.40.50.150
3dxzA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8625	31	233	3.40.50.150
af_P9WFY9_38_258_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8585	23	232	3.40.50.150
af_A4HSE1_104_298_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8575	57	200	3.40.50.150

ID	Description	Score	Start	End	GO Terms
AF-A0A166EXN6-F1-model_v4	tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase)	0.9707	36	233	GO:0008176 GO:0043527
AF-A0A1G6E0H6-F1-model_v4	tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase)	0.97	32	233	GO:0008176 GO:0043527
AF-A0A1M3BV46-F1-model_v4	tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33)	0.9692	35	233	GO:0008176 GO:0043527
AF-A0A530A2L5-F1-model_v4	deleted	0.966	44	233
AF-A0A527GHS0-F1-model_v4	tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33)	0.9606	84	233	GO:0008176 GO:0043527

Feature Viewer

pLDDT	pTM	Quality
86.64	0.85	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F491214

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02390

Methyltransf_4

Putative methyltransferase

87

256

0.92

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map