F491172

General Info

Members Datasets Scaffolds Average Seq Length
1171 547 1016 221

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10120427|Ga0207683_101204272
Length 263
Sequence MNTPYGGLQVPGPSSRYILPQFEERTSYGMKRTDPYTKLFEDRIIFLGVQVDDASADDIIAQLIVLESQDPDRDILMYINSPGGSFTAMTAIYDTMQYVRPDVQTFVIGQAASAAAVLLGAGAPGKRFALPNARILIHQPALAGGDYGQASDIEIQANEVLRMRTWLEETWADHSGRTVEQVRNDIERDKILSAAEAKEYGLIDEVLASRKASTRTEHPLAARHGMPRARLGHAASALSALSGQRRLRRDAGDSMERMKGSGR

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
3 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
4 2643221546 Microbacterium sp. Root53 Isolate Unclassified
5 2643221549 Agromyces sp. Root1464 Isolate Unclassified
6 2643221566 Microbacterium sp. Root166 Isolate Unclassified
7 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
8 2643221572 Leifsonia sp. Root60 Isolate Unclassified
9 2643221575 Microbacterium sp. Root61 Isolate Unclassified
10 2643221597 Microbacterium sp. Root180 Isolate Unclassified
11 2643221613 Oerskovia sp. Root22 Isolate Unclassified
12 2643221616 Leifsonia sp. Root227 Isolate Unclassified
13 2643221619 Agromyces sp. Root81 Isolate Unclassified
14 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
15 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
16 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
17 2643221679 Angustibacter sp. Root456 Isolate Unclassified
18 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
19 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
20 2643221711 Terrabacter sp. Root85 Isolate Unclassified
21 2643221721 Oerskovia sp. Root918 Isolate Unclassified
22 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
23 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
24 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
25 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
26 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
27 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
28 2739367653 Kocuria sp. OV113 Isolate Unclassified
29 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
30 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
31 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
32 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
33 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
34 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
35 2773857759 Microbacterium sp. 1294 Isolate Unclassified
36 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
37 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
38 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
39 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
40 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
41 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
42 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
43 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
44 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
45 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
46 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
47 2808606372 Agromyces sp. 23-23 Isolate Unclassified
48 2808606394 Promicromonospora sp. C35 Isolate Unclassified
49 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
50 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
51 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
52 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
53 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
54 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
55 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
56 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
57 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
58 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
59 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
60 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
61 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
62 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
63 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
64 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
65 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
66 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
67 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
68 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
69 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
70 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
71 2857727296 Kocuria sp. R-72562 Isolate Unclassified
72 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
73 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
74 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
75 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
76 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
77 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
78 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
79 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
80 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
81 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
82 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
83 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
84 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
85 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
86 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
87 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
88 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
89 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
90 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
91 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
92 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
93 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
94 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
95 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
96 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
97 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
98 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
99 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
100 2919069694 Microbacterium sp. 1154 Isolate Unclassified
101 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
102 2919395869 Microbacterium resistens 2980 Isolate Unclassified
103 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
104 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
105 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
106 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
107 2920879853 Kocuria salina CV6 Isolate Unclassified
108 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
109 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
110 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
111 2928153084 Leifsonia sp. 563 Isolate Unclassified
112 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
113 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
114 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
115 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
116 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
117 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
118 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
119 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
120 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
121 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
122 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
123 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
124 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
125 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
126 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
127 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
128 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
129 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
130 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
131 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
132 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
133 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
134 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
135 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
136 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
137 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
138 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
139 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
140 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
141 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
142 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
143 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
144 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
145 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
146 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
147 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
148 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
149 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
150 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
151 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
152 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
153 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
154 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
155 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
156 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
157 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
158 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
159 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
160 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
161 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
162 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
163 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
164 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
165 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
166 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
167 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
168 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
169 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
170 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
171 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
172 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
173 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
174 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
175 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
176 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
177 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
178 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
179 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
180 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
181 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
182 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
183 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
184 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
185 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
186 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
187 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
188 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
189 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
190 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
191 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
192 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
193 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
194 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
195 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
196 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
197 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
198 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
199 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
200 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
201 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
202 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
203 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
204 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
205 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
206 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
207 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
208 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
209 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
210 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
211 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
212 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
213 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
214 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
215 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
216 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
217 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
218 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
219 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
220 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
221 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
222 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
223 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
224 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
225 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
226 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
227 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
228 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
229 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
230 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
231 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
232 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
233 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
234 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
235 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
236 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
237 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
238 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
239 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
240 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
241 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
242 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
243 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
244 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
245 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
246 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
247 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
248 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
249 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
250 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
251 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
252 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
253 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
254 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
260 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
261 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
262 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
263 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
264 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
267 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
268 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
270 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
314 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
315 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
317 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
318 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
319 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
320 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
321 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
322 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
323 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
324 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
325 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
326 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
327 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
328 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
329 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
330 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
331 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
332 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
333 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
334 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
335 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
336 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
337 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
338 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
339 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
345 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
346 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
347 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
348 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
349 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
350 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
351 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
352 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
353 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
354 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
355 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
356 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
357 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
358 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
359 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
360 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
361 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
362 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
363 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
364 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
365 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
366 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
367 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
368 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
369 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
370 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
371 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
372 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
373 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
374 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
375 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
376 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
377 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
378 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
379 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
380 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
381 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
382 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
383 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
384 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
385 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
386 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
387 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
388 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
389 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
390 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
391 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
392 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
393 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
394 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
395 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
396 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
397 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
398 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
399 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
400 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
401 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
402 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
403 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
404 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
405 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
406 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
407 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
408 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
409 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
410 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
411 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
412 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
413 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
414 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
415 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
416 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
417 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
418 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
419 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
420 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
421 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
422 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
423 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
424 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
425 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
426 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
427 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
428 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
429 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
430 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
431 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
432 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
433 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
434 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
435 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
436 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
437 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
438 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
439 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
440 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
441 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
442 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
443 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
444 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
445 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
446 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
447 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
448 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
449 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
450 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
451 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
452 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
453 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
454 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
455 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
456 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
457 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
477 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
479 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
481 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
482 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
483 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
484 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
487 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
488 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
489 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
490 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
491 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
492 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
493 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
494 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
495 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
496 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
497 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
498 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
499 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
500 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
501 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
502 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
503 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
504 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
505 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
506 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
507 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
508 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
509 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
510 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
511 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
512 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
513 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
514 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
515 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
516 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
517 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
518 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
519 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
520 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
521 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
522 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
523 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
524 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
525 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
526 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
527 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
528 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
535 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
536 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
537 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
538 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
539 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
540 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
541 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
542 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
543 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
544 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
545 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
546 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
547 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.5
Metatranscriptomes 7.26
Isolates 13.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 7.69
Nodule 0
Rhizoplane 6.92
Rhizosphere 69.94
Stem 0
Stem Tuber 0.09
Unclassified 15.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10022415 3300001979 Bacteria 2174
2 JGI24739J22299_10021486 3300001989 Bacteria 2296
3 JGI24739J22299_10114563 3300001989 Bacteria 808
4 JGI24737J22298_10010405 3300001990 Bacteria 3071
5 JGI24735J21928_10001156 3300002067 Bacteria 9433
6 JGI25162J39368_1010229 3300002737 Bacteria 1200
7 JGI25154J39366_1001355 3300002738 Bacteria 8957
8 JGI25164J39214_1001493 3300002772 Bacteria 5325
9 JGI25152J39213_1000287 3300002773 Bacteria 33449
10 Ga0006778J45830_1078606 3300003162 Bacteria 995
11 JGI25406J46586_10024934 3300003203 Bacteria 2332
12 JGI25406J46586_10066406 3300003203 Bacteria 1146
13 JGI25165J46597_1000002 3300003214 Bacteria 765387
14 Ga0007423J48922_100143 3300003285 Bacteria 4930
15 Ga0006562J51391_1016339 3300003578 Bacteria 2720
16 Ga0006562J51391_1037714 3300003578 Bacteria 9110
17 Ga0055539_1000008 3300003752 Bacteria 537665
18 Ga0055539_1000058 3300003752 Bacteria 149354
19 Ga0055533_1000001 3300003756 Bacteria 1863437
20 Ga0055525_1000638 3300003759 Bacteria 14203
21 Ga0055527_1000001 3300003760 Bacteria 850044
22 Ga0055542_1008543 3300003762 Bacteria 1998
23 Ga0055529_1000065 3300003763 Bacteria 173112
24 Ga0055529_1023094 3300003763 Bacteria 770
25 Ga0055541_1015138 3300003841 Bacteria 1034
26 Ga0065714_10006408 3300005288 Bacteria 3652
27 Ga0065714_10006667 3300005288 Bacteria 3462
28 Ga0065714_10018258 3300005288 Bacteria 1949
29 Ga0065714_10079388 3300005288 Bacteria 2519
30 Ga0065712_10142570 3300005290 Bacteria 1437
31 Ga0070658_10000249 3300005327 Bacteria 47842
32 Ga0070658_10051427 3300005327 Bacteria 3339
33 Ga0070676_10050823 3300005328 Bacteria 2431
34 Ga0070683_100282242 3300005329 Bacteria 1579
35 Ga0070670_100207901 3300005331 Bacteria 1701
36 Ga0070677_10016041 3300005333 Bacteria 2662
37 Ga0070666_10080484 3300005335 Bacteria 2227
38 Ga0070680_100144028 3300005336 Bacteria 1999
39 Ga0070682_100652979 3300005337 Bacteria 838
40 Ga0068868_100260290 3300005338 Bacteria 1463
41 Ga0070660_100035616 3300005339 Bacteria 3768
42 Ga0070660_100114343 3300005339 Bacteria 2149
43 Ga0070661_100345153 3300005344 Bacteria 1167
44 Ga0070668_100500479 3300005347 Bacteria 1052
45 Ga0070671_100043398 3300005355 Bacteria 3736
46 Ga0070674_100044006 3300005356 Bacteria 3041
47 Ga0070674_100115343 3300005356 Bacteria 1980
48 Ga0070673_100129609 3300005364 Bacteria 2114
49 Ga0070673_100631903 3300005364 Bacteria 979
50 Ga0070659_100002647 3300005366 Bacteria 12743
51 Ga0070659_100062233 3300005366 Bacteria 2950
52 Ga0070659_100093597 3300005366 Bacteria 2412
53 Ga0070667_100077062 3300005367 Bacteria 2847
54 Ga0070714_100178044 3300005435 Bacteria 1933
55 Ga0070710_10149582 3300005437 Bacteria 1439
56 Ga0070700_100459107 3300005441 Bacteria 971
57 Ga0070663_100586512 3300005455 Bacteria 936
58 Ga0070663_100715651 3300005455 Bacteria 852
59 Ga0070678_100051769 3300005456 Bacteria 2978
60 Ga0070678_100167797 3300005456 Bacteria 1785
61 Ga0070678_100259617 3300005456 Bacteria 1460
62 Ga0070678_100820619 3300005456 Bacteria 845
63 Ga0070679_100279323 3300005530 Bacteria 1623
64 Ga0070684_100305649 3300005535 Bacteria 1460
65 Ga0070684_100819153 3300005535 Bacteria 871
66 Ga0068853_100011613 3300005539 Bacteria 7159
67 Ga0070672_100094056 3300005543 Bacteria 2422
68 Ga0070665_100468732 3300005548 Bacteria 1270
69 Ga0070665_101071564 3300005548 Bacteria 818
70 Ga0068855_100006335 3300005563 Bacteria 14419
71 Ga0070664_100328578 3300005564 Bacteria 1387
72 Ga0070664_100578916 3300005564 Bacteria 1040
73 Ga0068857_100027117 3300005577 Bacteria 5053
74 Ga0068857_100392985 3300005577 Bacteria 1289
75 Ga0068856_100269789 3300005614 Bacteria 1717
76 Ga0068856_100831618 3300005614 Bacteria 943
77 Ga0070702_100872388 3300005615 Bacteria 702
78 Ga0068852_100012619 3300005616 Bacteria 6424
79 Ga0068852_100168306 3300005616 Bacteria 2052
80 Ga0068852_100317723 3300005616 Bacteria 1511
81 Ga0068852_100615067 3300005616 Bacteria 1092
82 Ga0068859_100087486 3300005617 Bacteria 3164
83 Ga0068864_100060125 3300005618 Bacteria 3289
84 Ga0068864_100409715 3300005618 Bacteria 1290
85 Ga0068851_10000014 3300005834 Bacteria 151675
86 Ga0068870_10238337 3300005840 Bacteria 1122
87 Ga0068863_100176649 3300005841 Bacteria 2049
88 Ga0068858_100000846 3300005842 Bacteria 31695
89 Ga0081540_1006340 3300005983 Bacteria 8641
90 Ga0081539_10001179 3300005985 Bacteria 47264
91 Ga0081539_10001475 3300005985 Bacteria 39913
92 Ga0081539_10013397 3300005985 Bacteria 6181
93 Ga0081539_10026528 3300005985 Bacteria 3695
94 Ga0081539_10149056 3300005985 Bacteria 1127
95 Ga0075365_10004127 3300006038 Bacteria 7638
96 Ga0075365_10015407 3300006038 Bacteria 4625
97 Ga0075365_10058685 3300006038 Bacteria 2562
98 Ga0075368_10031679 3300006042 Bacteria 2051
99 Ga0075364_10007016 3300006051 Bacteria 6655
100 Ga0075364_10042559 3300006051 Bacteria 2951
101 Ga0075364_10062263 3300006051 Bacteria 2448
102 Ga0075364_10092681 3300006051 Bacteria 2005
103 Ga0075364_10392738 3300006051 Bacteria 946
104 Ga0075432_10003166 3300006058 Bacteria 5551
105 Ga0075432_10009240 3300006058 Bacteria 3357
106 Ga0075367_10027967 3300006178 Bacteria 3212
107 Ga0075369_10032165 3300006186 Bacteria 2218
108 Ga0075369_10038122 3300006186 Bacteria 2050
109 Ga0075369_10090625 3300006186 Bacteria 1364
110 Ga0097621_101043841 3300006237 Bacteria 766
111 Ga0075370_10244350 3300006353 Bacteria 1063
112 Ga0097620_100087486 3300006931 Bacteria 3164
113 Ga0105251_10021156 3300009011 Bacteria 3401
114 Ga0105251_10216341 3300009011 Bacteria 862
115 Ga0105244_10034792 3300009036 Bacteria 2650
116 Ga0105244_10041596 3300009036 Bacteria 2381
117 Ga0105244_10074082 3300009036 Bacteria 1694
118 Ga0105244_10207337 3300009036 Bacteria 923
119 Ga0105240_10002622 3300009093 Bacteria 28674
120 Ga0105240_10087122 3300009093 Bacteria 3824
121 Ga0111539_10541380 3300009094 Bacteria 1356
122 Ga0105245_10055442 3300009098 Bacteria 3560
123 Ga0105245_10233366 3300009098 Bacteria 1780
124 Ga0105243_10085815 3300009148 Bacteria 2581
125 Ga0105243_10344320 3300009148 Bacteria 1367
126 Ga0105243_10376242 3300009148 Bacteria 1312
127 Ga0105241_10017368 3300009174 Bacteria 5286
128 Ga0105241_10530083 3300009174 Bacteria 1054
129 Ga0105242_10310092 3300009176 Bacteria 1443
130 Ga0105248_10139068 3300009177 Bacteria 2739
131 Ga0105248_10239847 3300009177 Bacteria 2041
132 Ga0105238_10345780 3300009551 Bacteria 1476
133 Ga0105238_10841990 3300009551 Bacteria 934
134 Ga0105249_10131519 3300009553 Bacteria 2390
135 Ga0105249_10341249 3300009553 Bacteria 1515
136 Ga0105239_10560961 3300010375 Bacteria 1301
137 Ga0105239_10671037 3300010375 Bacteria 1184
138 Ga0105246_10001188 3300011119 Bacteria 15160
139 Ga0105246_10009988 3300011119 Bacteria 5856
140 Ga0105246_10035287 3300011119 Bacteria 3341
141 Ga0105246_10108960 3300011119 Bacteria 2031
142 Ga0105246_10123820 3300011119 Bacteria 1920
143 Ga0105246_10328984 3300011119 Bacteria 1245
144 Ga0157373_10156733 3300013100 Bacteria 1602
145 Ga0157371_10041953 3300013102 Bacteria 3263
146 Ga0157371_10135771 3300013102 Bacteria 1751
147 Ga0157371_10141371 3300013102 Bacteria 1714
148 Ga0157370_10087879 3300013104 Bacteria 2919
149 Ga0157370_10150804 3300013104 Bacteria 2163
150 Ga0157370_10446681 3300013104 Bacteria 1189
151 Ga0157369_10000618 3300013105 Bacteria 46223
152 Ga0157369_10030211 3300013105 Bacteria 5977
153 Ga0157369_10076515 3300013105 Bacteria 3587
154 Ga0157369_10163339 3300013105 Bacteria 2350
155 Ga0157369_10166300 3300013105 Bacteria 2326
156 Ga0157369_10170360 3300013105 Bacteria 2294
157 Ga0157369_10777861 3300013105 Bacteria 984
158 Ga0157374_10274188 3300013296 Bacteria 1664
159 Ga0157374_10505194 3300013296 Bacteria 1214
160 Ga0163162_10053915 3300013306 Bacteria 4043
161 Ga0163162_10149421 3300013306 Bacteria 2453
162 Ga0163162_10686217 3300013306 Bacteria 1146
163 Ga0157372_10038848 3300013307 Bacteria 5252
164 Ga0157372_10181282 3300013307 Bacteria 2438
165 Ga0157372_10265624 3300013307 Bacteria 1993
166 Ga0157372_10405206 3300013307 Bacteria 1589
167 Ga0157372_10857396 3300013307 Bacteria 1054
168 Ga0157375_10231427 3300013308 Bacteria 2007
169 Ga0157375_10282007 3300013308 Bacteria 1824
170 Ga0163163_10003789 3300014325 Bacteria 12878
171 Ga0163163_10386062 3300014325 Bacteria 1458
172 Ga0163163_10656644 3300014325 Bacteria 1112
173 Ga0157380_10104980 3300014326 Bacteria 2361
174 Ga0157380_10127393 3300014326 Bacteria 2166
175 Ga0157380_10266014 3300014326 Bacteria 1560
176 Ga0157380_10320617 3300014326 Bacteria 1436
177 Ga0157380_10332630 3300014326 Bacteria 1413
178 Ga0157380_10981385 3300014326 Bacteria 877
179 Ga0182008_10270258 3300014497 Bacteria 882
180 Ga0157377_10104966 3300014745 Bacteria 1690
181 Ga0157377_10258076 3300014745 Bacteria 1133
182 Ga0157379_10025870 3300014968 Bacteria 5218
183 Ga0157376_10799205 3300014969 Bacteria 956
184 Ga0163161_10113591 3300017792 Bacteria 2027
185 Ga0197907_10128035 3300020069 Bacteria 2305
186 Ga0197907_10158780 3300020069 Bacteria 2075
187 Ga0197907_11478864 3300020069 Bacteria 1474
188 Ga0206356_11319510 3300020070 Bacteria 1644
189 Ga0206349_1059080 3300020075 Bacteria 1459
190 Ga0206349_1725218 3300020075 Bacteria 916
191 Ga0206355_1119720 3300020076 Bacteria 993
192 Ga0206352_10956613 3300020078 Bacteria 2143
193 Ga0206350_10550532 3300020080 Bacteria 812
194 Ga0206350_11108628 3300020080 Bacteria 1754
195 Ga0206350_11386828 3300020080 Bacteria 1072
196 Ga0206354_10229204 3300020081 Bacteria 895
197 Ga0206354_10538482 3300020081 Bacteria 795
198 Ga0206354_11039122 3300020081 Bacteria 1817
199 Ga0206354_11106463 3300020081 Bacteria 1279
200 Ga0206353_10901940 3300020082 Bacteria 1670
201 Ga0206353_10948841 3300020082 Bacteria 4552
202 Ga0224712_10053012 3300022467 Bacteria 1586
203 Ga0224712_10080403 3300022467 Bacteria 1344
204 Ga0224712_10187713 3300022467 Bacteria 934
205 Ga0209566_100026 3300025225 Bacteria 367457
206 Ga0209674_100001 3300025226 Bacteria 4013750
207 Ga0209672_100006 3300025228 Bacteria 1004497
208 Ga0209147_102541 3300025229 Bacteria 4408
209 Ga0209563_100001 3300025230 Bacteria 4013775
210 Ga0209563_101613 3300025230 Bacteria 5835
211 Ga0207427_100089 3300025231 Bacteria 135504
212 Ga0209437_100447 3300025233 Bacteria 34224
213 Ga0209258_105429 3300025242 Bacteria 2161
214 Ga0207425_1003632 3300025245 Bacteria 4869
215 Ga0209646_1000071 3300025246 Bacteria 228702
216 Ga0209677_100001 3300025253 Bacteria 4013787
217 Ga0209148_1000015 3300025254 Bacteria 850103
218 Ga0209148_1001968 3300025254 Bacteria 8243
219 Ga0209148_1002255 3300025254 Bacteria 6983
220 Ga0209129_1000129 3300025258 Bacteria 129853
221 Ga0209233_1000001 3300025261 Bacteria 2992747
222 Ga0209455_1000013 3300025272 Bacteria 850103
223 Ga0209455_1003920 3300025272 Bacteria 5069
224 Ga0209025_1000889 3300025294 Bacteria 46705
225 Ga0209051_1002347 3300025303 Bacteria 13695
226 Ga0209051_1005468 3300025303 Bacteria 7412
227 Ga0207697_10004708 3300025315 Bacteria 6468
228 Ga0207697_10007572 3300025315 Bacteria 4829
229 Ga0207656_10000002 3300025321 Bacteria 792178
230 Ga0207655_1006309 3300025728 Bacteria 7882
231 Ga0207655_1009263 3300025728 Bacteria 6138
232 Ga0207655_1013054 3300025728 Bacteria 4795
233 Ga0207655_1021347 3300025728 Bacteria 3289
234 Ga0207655_1118481 3300025728 Bacteria 881
235 Ga0207682_10005480 3300025893 Bacteria 5168
236 Ga0207688_10195848 3300025901 Bacteria 1210
237 Ga0207647_10043060 3300025904 Bacteria 2827
238 Ga0207647_10100842 3300025904 Bacteria 1713
239 Ga0207645_10052524 3300025907 Bacteria 2604
240 Ga0207643_10072497 3300025908 Bacteria 1984
241 Ga0207643_10351379 3300025908 Bacteria 925
242 Ga0207705_10000006 3300025909 Bacteria 657147
243 Ga0207705_10045604 3300025909 Bacteria 3150
244 Ga0207705_10078113 3300025909 Bacteria 2408
245 Ga0207705_10116953 3300025909 Bacteria 1974
246 Ga0207705_10661068 3300025909 Bacteria 813
247 Ga0207654_10000001 3300025911 Bacteria 1816198
248 Ga0207707_10429912 3300025912 Bacteria 1131
249 Ga0207695_10007498 3300025913 Bacteria 13853
250 Ga0207695_10031861 3300025913 Bacteria 5776
251 Ga0207671_10000002 3300025914 Bacteria 1144816
252 Ga0207671_10025057 3300025914 Bacteria 4482
253 Ga0207660_10343982 3300025917 Bacteria 1194
254 Ga0207662_10171044 3300025918 Bacteria 1393
255 Ga0207657_10027565 3300025919 Bacteria 5202
256 Ga0207681_10009275 3300025923 Bacteria 6011
257 Ga0207694_10129609 3300025924 Bacteria 2021
258 Ga0207650_10118003 3300025925 Bacteria 2062
259 Ga0207659_10139703 3300025926 Bacteria 1879
260 Ga0207664_10207061 3300025929 Bacteria 1696
261 Ga0207664_10347955 3300025929 Bacteria 1311
262 Ga0207644_10047230 3300025931 Bacteria 3071
263 Ga0207644_10255908 3300025931 Bacteria 1398
264 Ga0207644_10406705 3300025931 Bacteria 1113
265 Ga0207690_10003349 3300025932 Bacteria 9577
266 Ga0207690_10044222 3300025932 Bacteria 2934
267 Ga0207690_10065410 3300025932 Bacteria 2486
268 Ga0207690_10250828 3300025932 Bacteria 1367
269 Ga0207690_10401060 3300025932 Bacteria 1094
270 Ga0207686_10296358 3300025934 Bacteria 1200
271 Ga0207709_10069523 3300025935 Bacteria 2229
272 Ga0207691_10000576 3300025940 Bacteria 36700
273 Ga0207691_10113899 3300025940 Bacteria 2403
274 Ga0207661_10215847 3300025944 Bacteria 1693
275 Ga0207679_10384111 3300025945 Bacteria 1232
276 Ga0207667_10002778 3300025949 Bacteria 21664
277 Ga0207667_10010019 3300025949 Bacteria 11115
278 Ga0207667_10025868 3300025949 Bacteria 6421
279 Ga0207651_10035401 3300025960 Bacteria 3246
280 Ga0207712_10084607 3300025961 Bacteria 2318
281 Ga0207668_10473086 3300025972 Bacteria 1073
282 Ga0207658_10038526 3300025986 Bacteria 3444
283 Ga0207658_10154852 3300025986 Bacteria 1872
284 Ga0207677_10038884 3300026023 Bacteria 3123
285 Ga0207703_10000031 3300026035 Bacteria 196940
286 Ga0207639_10120853 3300026041 Bacteria 2152
287 Ga0207639_10393337 3300026041 Bacteria 1247
288 Ga0207678_10783237 3300026067 Bacteria 841
289 Ga0207678_10980855 3300026067 Bacteria 748
290 Ga0207708_10187315 3300026075 Bacteria 1645
291 Ga0207648_10063684 3300026089 Bacteria 3213
292 Ga0207676_10105266 3300026095 Bacteria 2348
293 Ga0207676_10619672 3300026095 Bacteria 1041
294 Ga0207683_10002636 3300026121 Bacteria 15674
295 Ga0207683_10021001 3300026121 Bacteria 5589
296 Ga0207683_10066226 3300026121 Bacteria 3185
297 Ga0207683_10120427 3300026121 Bacteria 2355
298 Ga0207698_10009092 3300026142 Bacteria 6313
299 Ga0207698_10059135 3300026142 Bacteria 2974
300 Ga0207698_10424256 3300026142 Bacteria 1277
301 Ga0207698_10512093 3300026142 Bacteria 1170
302 Ga0209813_10091241 3300027866 Bacteria 1023
303 Ga0207428_10005185 3300027907 Bacteria 12196
304 Ga0207428_10083190 3300027907 Bacteria 2497
305 Ga0268266_10254901 3300028379 Bacteria 1624
306 Ga0268266_10410655 3300028379 Bacteria 1282
307 Ga0307515_10163458 3300028794 Bacteria 2257
308 Ga0316180_1163515 3300030736 Bacteria 1517
309 Ga0316181_1187045 3300030744 Bacteria 1302
310 Ga0307408_100020444 3300031548 Bacteria 4469
311 Ga0307408_100046082 3300031548 Bacteria 3117
312 Ga0307408_100140379 3300031548 Bacteria 1896
313 Ga0307408_100151705 3300031548 Bacteria 1830
314 Ga0307408_100171610 3300031548 Bacteria 1732
315 Ga0307408_100518360 3300031548 Bacteria 1046
316 Ga0307408_100545524 3300031548 Bacteria 1022
317 Ga0307408_100603563 3300031548 Bacteria 975
318 Ga0307408_100822727 3300031548 Bacteria 844
319 Ga0307514_10003548 3300031649 Bacteria 14871
320 Ga0307514_10087202 3300031649 Bacteria 2288
321 Ga0316575_10000110 3300031665 Bacteria 20680
322 Ga0316575_10021877 3300031665 Bacteria 2465
323 Ga0316579_10024138 3300031691 Bacteria 2735
324 Ga0316576_10032724 3300031727 Bacteria 3696
325 Ga0307405_10005557 3300031731 Bacteria 6093
326 Ga0307405_10035230 3300031731 Bacteria 2987
327 Ga0307405_10045514 3300031731 Bacteria 2690
328 Ga0307405_10066854 3300031731 Bacteria 2293
329 Ga0307405_10075688 3300031731 Bacteria 2181
330 Ga0307405_10105030 3300031731 Bacteria 1902
331 Ga0307405_10302632 3300031731 Bacteria 1214
332 Ga0307405_10375100 3300031731 Bacteria 1105
333 Ga0316577_10005539 3300031733 Bacteria 6626
334 Ga0307413_10083565 3300031824 Bacteria 2055
335 Ga0307413_10095859 3300031824 Bacteria 1946
336 Ga0307413_10148651 3300031824 Bacteria 1629
337 Ga0307413_10159717 3300031824 Bacteria 1582
338 Ga0307413_10229057 3300031824 Bacteria 1363
339 Ga0307413_10287311 3300031824 Bacteria 1240
340 Ga0307413_10578737 3300031824 Bacteria 915
341 Ga0307410_10000904 3300031852 Bacteria 12655
342 Ga0307410_10010427 3300031852 Bacteria 5261
343 Ga0307410_10013185 3300031852 Bacteria 4812
344 Ga0307410_10014223 3300031852 Bacteria 4675
345 Ga0307410_10016877 3300031852 Bacteria 4367
346 Ga0307410_10064020 3300031852 Bacteria 2525
347 Ga0307410_10086142 3300031852 Bacteria 2219
348 Ga0307410_10105491 3300031852 Bacteria 2029
349 Ga0307410_10150581 3300031852 Bacteria 1731
350 Ga0307410_10478335 3300031852 Bacteria 1021
351 Ga0307410_10485127 3300031852 Bacteria 1014
352 Ga0307410_10499862 3300031852 Bacteria 1000
353 Ga0307406_10000344 3300031901 Bacteria 27059
354 Ga0307406_10000821 3300031901 Bacteria 17418
355 Ga0307406_10009301 3300031901 Bacteria 5506
356 Ga0307406_10107242 3300031901 Bacteria 1915
357 Ga0307406_10137933 3300031901 Bacteria 1722
358 Ga0307406_10146709 3300031901 Bacteria 1678
359 Ga0307406_10182422 3300031901 Bacteria 1529
360 Ga0307406_10345597 3300031901 Bacteria 1160
361 Ga0307406_10632145 3300031901 Bacteria 886
362 Ga0307406_10769419 3300031901 Bacteria 810
363 Ga0307407_10028770 3300031903 Bacteria 2975
364 Ga0307407_10035896 3300031903 Bacteria 2727
365 Ga0307407_10035928 3300031903 Bacteria 2726
366 Ga0307407_10088413 3300031903 Bacteria 1893
367 Ga0307407_10095843 3300031903 Bacteria 1830
368 Ga0307407_10104013 3300031903 Bacteria 1768
369 Ga0307407_10262570 3300031903 Bacteria 1188
370 Ga0307407_10535668 3300031903 Bacteria 863
371 Ga0307412_10005371 3300031911 Bacteria 7190
372 Ga0307412_10021117 3300031911 Bacteria 3972
373 Ga0307412_10035356 3300031911 Bacteria 3191
374 Ga0307412_10048485 3300031911 Bacteria 2794
375 Ga0307412_10066186 3300031911 Bacteria 2448
376 Ga0307412_10103027 3300031911 Bacteria 2022
377 Ga0307412_10171715 3300031911 Bacteria 1622
378 Ga0307412_10205884 3300031911 Bacteria 1497
379 Ga0307412_10239470 3300031911 Bacteria 1402
380 Ga0307412_10350902 3300031911 Bacteria 1184
381 Ga0307412_10864439 3300031911 Bacteria 790
382 Ga0307409_100011105 3300031995 Bacteria 5653
383 Ga0307409_100015608 3300031995 Bacteria 4991
384 Ga0307409_100037678 3300031995 Bacteria 3567
385 Ga0307409_100085802 3300031995 Bacteria 2560
386 Ga0307409_100113904 3300031995 Bacteria 2274
387 Ga0307409_100173532 3300031995 Bacteria 1900
388 Ga0307409_100434738 3300031995 Bacteria 1262
389 Ga0307409_100544677 3300031995 Bacteria 1138
390 Ga0307409_100812253 3300031995 Bacteria 943
391 Ga0307416_100004503 3300032002 Bacteria 8411
392 Ga0307416_100058971 3300032002 Bacteria 3116
393 Ga0307416_100093901 3300032002 Bacteria 2585
394 Ga0307416_100116719 3300032002 Bacteria 2367
395 Ga0307416_100139581 3300032002 Bacteria 2200
396 Ga0307416_100140118 3300032002 Bacteria 2196
397 Ga0307416_100217089 3300032002 Bacteria 1830
398 Ga0307416_100250784 3300032002 Bacteria 1722
399 Ga0307416_100297673 3300032002 Bacteria 1601
400 Ga0307416_100323693 3300032002 Bacteria 1545
401 Ga0307416_100468870 3300032002 Bacteria 1316
402 Ga0307416_100787115 3300032002 Bacteria 1046
403 Ga0307416_100917674 3300032002 Bacteria 976
404 Ga0307416_101018545 3300032002 Bacteria 931
405 Ga0307416_101222280 3300032002 Bacteria 857
406 Ga0307414_10001424 3300032004 Bacteria 12417
407 Ga0307414_10064546 3300032004 Bacteria 2607
408 Ga0307414_10115873 3300032004 Bacteria 2050
409 Ga0307414_10479465 3300032004 Bacteria 1097
410 Ga0307414_10633990 3300032004 Bacteria 962
411 Ga0307414_10693359 3300032004 Bacteria 921
412 Ga0307414_10834767 3300032004 Bacteria 842
413 Ga0307414_10930182 3300032004 Bacteria 798
414 Ga0307411_10001803 3300032005 Bacteria 9068
415 Ga0307411_10116941 3300032005 Bacteria 1920
416 Ga0307411_10145659 3300032005 Bacteria 1753
417 Ga0307415_100016139 3300032126 Bacteria 4443
418 Ga0307415_100027191 3300032126 Bacteria 3621
419 Ga0307415_100105357 3300032126 Bacteria 2079
420 Ga0307415_100248127 3300032126 Bacteria 1445
421 Ga0307415_100428403 3300032126 Bacteria 1137
422 Ga0307415_100497132 3300032126 Bacteria 1065
423 Ga0307415_100673486 3300032126 Bacteria 930
424 Ga0316583_10032635 3300032133 Bacteria 1851
425 Ga0316583_10047527 3300032133 Bacteria 1513
426 Ga0316585_10010464 3300032137 Bacteria 2721
427 Ga0316580_10009328 3300032139 Bacteria 2947
428 Ga0316593_10060972 3300032168 Bacteria 1289
429 Ga0316592_1018983 3300033524 Bacteria 1452
430 Ga0316588_1023421 3300033528 Bacteria 1417
431 Ga0316587_1005667 3300033529 Bacteria 1882
432 Ga0316596_1029083 3300033541 Bacteria 1430
433 Ga0316574_0004218 3300035398 Bacteria 7498
434 Ga0316574_0472121 3300035398 Bacteria 784
435 Ga0316582_0008420 3300036647 Bacteria 5543
436 Ga0316584_0077362 3300036712 Bacteria 2492
437 Ga0395899_0005440 3300037312 Bacteria 9879
438 Ga0395899_0013669 3300037312 Bacteria 6205
439 Ga0395899_0031373 3300037312 Bacteria 3993
440 Ga0395899_0095266 3300037312 Bacteria 2153
441 Ga0395899_0128254 3300037312 Bacteria 1813
442 Ga0395900_0000887 3300037418 Bacteria 39283
443 Ga0395900_0074975 3300037418 Bacteria 3477
444 Ga0395900_0078247 3300037418 Bacteria 3398
445 Ga0395900_0098425 3300037418 Bacteria 3005
446 Ga0395900_0109031 3300037418 Bacteria 2844
447 Ga0395900_0248139 3300037418 Bacteria 1782
448 Ga0395900_0289747 3300037418 Bacteria 1626
449 Ga0395900_0299983 3300037418 Bacteria 1593
450 Ga0395900_0359633 3300037418 Bacteria 1427
451 Ga0395900_0656864 3300037418 Bacteria 985
452 Ga0395898_0000622 3300037466 Bacteria 65033
453 Ga0395898_0004661 3300037466 Bacteria 14945
454 Ga0395898_0017563 3300037466 Bacteria 7302
455 Ga0395898_0030371 3300037466 Bacteria 5407
456 Ga0395898_0032213 3300037466 Bacteria 5232
457 Ga0395898_0085077 3300037466 Bacteria 3048
458 Ga0395898_0267485 3300037466 Bacteria 1630
459 Ga0395898_0284473 3300037466 Bacteria 1577
460 Ga0395898_0330504 3300037466 Bacteria 1453
461 Ga0395905_0029015 3300037471 Bacteria 5215
462 Ga0395901_0010676 3300038443 Bacteria 9311
463 Ga0395901_0031737 3300038443 Bacteria 5446
464 Ga0395901_0037105 3300038443 Bacteria 5041
465 Ga0395901_0038572 3300038443 Bacteria 4942
466 Ga0395901_0044761 3300038443 Bacteria 4590
467 Ga0395901_0048393 3300038443 Bacteria 4415
468 Ga0395901_0106777 3300038443 Bacteria 2939
469 Ga0395901_0109771 3300038443 Bacteria 2896
470 Ga0395901_0111900 3300038443 Bacteria 2867
471 Ga0395901_0201636 3300038443 Bacteria 2085
472 Ga0395901_0380215 3300038443 Bacteria 1453
473 Ga0400485_11442 3300038735 Bacteria 19231
474 Ga0400488_41679 3300038741 Bacteria 3628
475 Ga0400486_30354 3300038742 Bacteria 18891
476 Ga0439436_0013087 3300041404 Bacteria 2512
477 Ga0439436_0022849 3300041404 Bacteria 1852
478 Ga0439438_006435 3300041405 Bacteria 4139
479 Ga0439439_0000385 3300041406 Bacteria 7277
480 Ga0439466_0002897 3300041411 Bacteria 6706
481 Ga0451800_1578277 3300041459 Bacteria 810
482 Ga0451802_0163578 3300041460 Bacteria 787
483 Ga0451807_0001797 3300041486 Bacteria 2102
484 Ga0451851_0285165 3300041507 Bacteria 870
485 Ga0439431_0042954 3300041997 Bacteria 1156
486 Ga0439433_0000411 3300041999 Bacteria 7761
487 Ga0439433_0013199 3300041999 Bacteria 1813
488 Ga0439433_0021715 3300041999 Bacteria 1436
489 Ga0439433_0061707 3300041999 Bacteria 894
490 Ga0439442_000009 3300042002 Bacteria 55693
491 Ga0439442_000111 3300042002 Bacteria 20292
492 Ga0439442_000906 3300042002 Bacteria 6077
493 Ga0439442_044108 3300042002 Bacteria 939
494 Ga0439449_0000879 3300042007 Bacteria 11744
495 Ga0439449_0043751 3300042007 Bacteria 1662
496 Ga0439449_0052709 3300042007 Bacteria 1504
497 Ga0439449_0074337 3300042007 Bacteria 1252
498 Ga0439449_0108529 3300042007 Bacteria 1027
499 Ga0439449_0136439 3300042007 Bacteria 912
500 Ga0439452_002345 3300042010 Bacteria 7059
501 Ga0439452_062261 3300042010 Bacteria 834
502 Ga0439457_003049 3300042014 Bacteria 4637
503 Ga0439457_027800 3300042014 Bacteria 1253
504 Ga0450920_000142 3300042122 Bacteria 10051
505 Ga0450920_001596 3300042122 Bacteria 3772
506 Ga0450920_001738 3300042122 Bacteria 3651
507 Ga0450923_040174 3300042125 Bacteria 981
508 Ga0450907_000098 3300042146 Bacteria 33569
509 Ga0439446_0000569 3300042156 Bacteria 7508
510 Ga0439446_0024758 3300042156 Bacteria 1714
511 Ga0450908_015479 3300042184 Bacteria 1366
512 Ga0450908_025207 3300042184 Bacteria 1039
513 Ga0450909_002920 3300042185 Bacteria 2426
514 Ga0439434_0000038 3300042435 Bacteria 31961
515 Ga0439434_0002125 3300042435 Bacteria 5733
516 Ga0439434_0018392 3300042435 Bacteria 2092
517 Ga0450918_003836 3300042531 Bacteria 2769
518 Ga0450901_014369 3300042533 Bacteria 831
519 Ga0466972_0015798 3300044658 Bacteria 3774
520 Ga0466965_0000002 3300044683 Bacteria 297957
521 Ga0466965_0013299 3300044683 Bacteria 3882
522 Ga0466965_0014135 3300044683 Bacteria 3776
523 Ga0466965_0016847 3300044683 Bacteria 3485
524 Ga0466965_0107781 3300044683 Bacteria 1429
525 Ga0466965_0148321 3300044683 Bacteria 1225
526 Ga0466966_0095564 3300044684 Bacteria 1841
527 Ga0466966_0313684 3300044684 Bacteria 942
528 Ga0466963_0071146 3300044694 Bacteria 2341
529 Ga0466964_0060228 3300044706 Bacteria 1578
530 Ga0466964_0195485 3300044706 Bacteria 968
531 Ga0466971_0025113 3300044719 Bacteria 2661
532 Ga0466968_0145849 3300044735 Bacteria 1085
533 Ga0466970_0000064 3300044765 Bacteria 41779
534 Ga0466970_0018676 3300044765 Bacteria 3591
535 Ga0466970_0039308 3300044765 Bacteria 2510
536 Ga0466970_0081599 3300044765 Bacteria 1749
537 Ga0466970_0170906 3300044765 Bacteria 1204
538 Ga0466970_0196954 3300044765 Bacteria 1120
539 Ga0466957_0034986 3300044842 Bacteria 3014
540 Ga0466957_0160124 3300044842 Bacteria 1461
541 Ga0466960_0022025 3300044901 Bacteria 2844
542 Ga0466960_0046747 3300044901 Bacteria 2073
543 Ga0466960_0154642 3300044901 Bacteria 1228
544 Ga0466959_0013330 3300045049 Bacteria 5957
545 Ga0466959_0026316 3300045049 Bacteria 4312
546 Ga0466959_0540198 3300045049 Bacteria 786
547 Ga0466958_0020668 3300045836 Bacteria 3841
548 Ga0466958_0221724 3300045836 Bacteria 1206
549 Ga0466967_0168047 3300045976 Bacteria 2062
550 Ga0495590_0000097 3300046457 Bacteria 53198
551 Ga0495629_0150900 3300046459 Bacteria 1615
552 Ga0495629_0312903 3300046459 Bacteria 1074
553 Ga0495638_0132749 3300046460 Bacteria 1461
554 Ga0495638_0182255 3300046460 Bacteria 1197
555 Ga0495653_0077904 3300046463 Bacteria 2460
556 Ga0495653_0081953 3300046463 Bacteria 2383
557 Ga0495580_0013953 3300046472 Bacteria 6112
558 Ga0495580_0107901 3300046472 Bacteria 1933
559 Ga0495582_0089775 3300046473 Bacteria 1713
560 Ga0495582_0154450 3300046473 Bacteria 1304
561 Ga0495582_0211236 3300046473 Bacteria 1109
562 Ga0495662_0003321 3300046476 Bacteria 8149
563 Ga0495664_0010276 3300046477 Bacteria 5251
564 Ga0495594_0045205 3300046499 Bacteria 2417
565 Ga0495630_0314574 3300046517 Bacteria 1197
566 Ga0495631_0021142 3300046518 Bacteria 3032
567 Ga0495631_0144609 3300046518 Bacteria 1021
568 Ga0495654_0070481 3300046530 Bacteria 1658
569 Ga0495665_0012151 3300046531 Bacteria 4661
570 Ga0495665_0023162 3300046531 Bacteria 3335
571 Ga0495640_0171032 3300046533 Bacteria 1388
572 Ga0495586_0016686 3300046535 Bacteria 3905
573 Ga0495586_0112706 3300046535 Bacteria 1514
574 Ga0495586_0336386 3300046535 Bacteria 866
575 Ga0495587_0014418 3300046536 Bacteria 4958
576 Ga0495645_0032105 3300046543 Bacteria 3829
577 Ga0495645_0040567 3300046543 Bacteria 3395
578 Ga0495645_0341467 3300046543 Bacteria 967
579 Ga0495633_0029463 3300046558 Bacteria 2671
580 Ga0495667_0007359 3300046559 Bacteria 7465
581 Ga0495656_0015399 3300046615 Bacteria 2886
582 Ga0495656_0064014 3300046615 Bacteria 1613
583 Ga0495656_0246951 3300046615 Bacteria 900
584 Ga0495668_0095685 3300046616 Bacteria 1625
585 Ga0495634_0137921 3300046642 Bacteria 1551
586 Ga0495635_0247938 3300046663 Bacteria 1201
587 Ga0495659_0214278 3300046664 Bacteria 793
588 Ga0495588_0009811 3300046674 Bacteria 4439
589 Ga0495588_0025286 3300046674 Bacteria 2957
590 Ga0495588_0297748 3300046674 Bacteria 849
591 Ga0495658_0246767 3300046683 Bacteria 1122
592 Ga0495624_0468858 3300046690 Bacteria 754
593 Ga0495670_0203279 3300046691 Bacteria 1049
594 Ga0495600_0011932 3300046809 Bacteria 5425
595 Ga0495600_0030987 3300046809 Bacteria 3464
596 Ga0495581_0027133 3300047315 Bacteria 3321
597 Ga0495581_0054617 3300047315 Bacteria 2305
598 Ga0495581_0057699 3300047315 Bacteria 2241
599 Ga0495581_0060619 3300047315 Bacteria 2186
600 Ga0495604_0073108 3300047317 Bacteria 2589
601 Ga0495604_0383114 3300047317 Bacteria 929
602 Ga0495636_0009817 3300047318 Bacteria 3769
603 Ga0495636_0115086 3300047318 Bacteria 1186
604 Ga0495674_0302654 3300047319 Bacteria 1306
605 Ga0495672_0035054 3300047320 Bacteria 3093
606 Ga0495680_0139327 3300047322 Bacteria 1776
607 Ga0495680_0359429 3300047322 Bacteria 1012
608 Ga0495680_0404874 3300047322 Bacteria 941
609 Ga0495675_0086235 3300047444 Bacteria 1973
610 Ga0495684_0160396 3300047471 Bacteria 1678
611 Ga0495686_0048817 3300047472 Bacteria 2667
612 Ga0495686_0120550 3300047472 Bacteria 1564
613 Ga0495686_0137513 3300047472 Bacteria 1444
614 Ga0495602_0119797 3300048088 Bacteria 2120
615 Ga0496100_0009167 3300048903 Bacteria 5552
616 Ga0496100_0035112 3300048903 Bacteria 3152
617 Ga0496100_0037873 3300048903 Bacteria 3052
618 Ga0496100_0544353 3300048903 Bacteria 897
619 Ga0496101_0033137 3300048904 Bacteria 3642
620 Ga0496101_0034464 3300048904 Bacteria 3575
621 Ga0496101_0037430 3300048904 Bacteria 3441
622 Ga0496101_0043466 3300048904 Bacteria 3211
623 Ga0496101_0065191 3300048904 Bacteria 2655
624 Ga0496101_0159712 3300048904 Bacteria 1728
625 Ga0496101_0326683 3300048904 Bacteria 1204
626 Ga0496101_0727733 3300048904 Bacteria 783
627 Ga0496102_0002600 3300048905 Bacteria 15400
628 Ga0496102_0043251 3300048905 Bacteria 4084
629 Ga0496102_0059503 3300048905 Bacteria 3493
630 Ga0496102_0062548 3300048905 Bacteria 3408
631 Ga0496102_0073793 3300048905 Bacteria 3135
632 Ga0496102_0090831 3300048905 Bacteria 2826
633 Ga0496102_0260036 3300048905 Bacteria 1636
634 Ga0496102_0329742 3300048905 Bacteria 1438
635 Ga0496102_0341002 3300048905 Bacteria 1411
636 Ga0496102_0469559 3300048905 Bacteria 1179
637 Ga0496103_0014201 3300048906 Bacteria 4728
638 Ga0496103_0018600 3300048906 Bacteria 4168
639 Ga0496103_0050247 3300048906 Bacteria 2579
640 Ga0496103_0058555 3300048906 Bacteria 2394
641 Ga0496103_0128676 3300048906 Bacteria 1616
642 Ga0496103_0190776 3300048906 Bacteria 1317
643 Ga0496104_0026584 3300048907 Bacteria 5347
644 Ga0496104_0032699 3300048907 Bacteria 4842
645 Ga0496104_0157072 3300048907 Bacteria 2182
646 Ga0496104_0161718 3300048907 Bacteria 2148
647 Ga0496104_0225201 3300048907 Bacteria 1787
648 Ga0496105_0016186 3300048908 Bacteria 5949
649 Ga0496105_0106962 3300048908 Bacteria 2309
650 Ga0496105_0171630 3300048908 Bacteria 1778
651 Ga0496105_0294395 3300048908 Bacteria 1306
652 Ga0496105_0605746 3300048908 Bacteria 849
653 Ga0496106_0044487 3300048909 Bacteria 3333
654 Ga0496106_0255152 3300048909 Bacteria 1402
655 Ga0496106_0377225 3300048909 Bacteria 1140
656 Ga0496107_0085173 3300048910 Bacteria 2306
657 Ga0496107_0089273 3300048910 Bacteria 2251
658 Ga0496107_0089296 3300048910 Bacteria 2250
659 Ga0496107_0212125 3300048910 Bacteria 1440
660 Ga0496107_0357328 3300048910 Bacteria 1087
661 Ga0496108_0074897 3300048911 Bacteria 2859
662 Ga0496108_0160659 3300048911 Bacteria 1941
663 Ga0496108_0246403 3300048911 Bacteria 1554
664 Ga0496109_0014519 3300048912 Bacteria 6851
665 Ga0496109_0055975 3300048912 Bacteria 3598
666 Ga0496109_0471377 3300048912 Bacteria 1185
667 Ga0496109_0844811 3300048912 Bacteria 853
668 Ga0496110_0070348 3300048913 Bacteria 3100
669 Ga0496110_0257181 3300048913 Bacteria 1589
670 Ga0496110_0305164 3300048913 Bacteria 1450
671 Ga0496110_0546730 3300048913 Bacteria 1052
672 Ga0496110_0550298 3300048913 Bacteria 1049
673 Ga0496110_0871358 3300048913 Bacteria 806
674 Ga0496111_0056250 3300048914 Bacteria 2846
675 Ga0496111_0063329 3300048914 Bacteria 2682
676 Ga0496111_0068418 3300048914 Bacteria 2581
677 Ga0496111_0088231 3300048914 Bacteria 2271
678 Ga0496112_0063416 3300048915 Bacteria 3645
679 Ga0496112_0098580 3300048915 Bacteria 2892
680 Ga0496112_0199696 3300048915 Bacteria 1959
681 Ga0496112_0513445 3300048915 Bacteria 1133
682 Ga0496113_0065896 3300048916 Bacteria 2742
683 Ga0496113_0800030 3300048916 Bacteria 749
684 Ga0496114_0008179 3300048917 Bacteria 8292
685 Ga0496114_0027523 3300048917 Bacteria 4658
686 Ga0496114_0066128 3300048917 Bacteria 3030
687 Ga0496114_0220628 3300048917 Bacteria 1664
688 Ga0496114_0387163 3300048917 Bacteria 1238
689 Ga0496114_1001305 3300048917 Bacteria 719
690 Ga0496115_0033812 3300048918 Bacteria 4038
691 Ga0496115_0221435 3300048918 Bacteria 1561
692 Ga0496115_0575736 3300048918 Bacteria 897
693 Ga0496116_0005584 3300048919 Bacteria 11594
694 Ga0496117_0000053 3300048920 Bacteria 279396
695 Ga0496117_0000346 3300048920 Bacteria 81937
696 Ga0496117_0014231 3300048920 Bacteria 6869
697 Ga0496117_0014912 3300048920 Bacteria 6663
698 Ga0496117_0018670 3300048920 Bacteria 5732
699 Ga0496117_0021516 3300048920 Bacteria 5213
700 Ga0496117_0037736 3300048920 Bacteria 3594
701 Ga0496117_0040741 3300048920 Bacteria 3411
702 Ga0496117_0057081 3300048920 Bacteria 2714
703 Ga0496117_0083171 3300048920 Bacteria 2094
704 Ga0496118_0012176 3300048921 Bacteria 8293
705 Ga0496118_0014303 3300048921 Bacteria 7441
706 Ga0496118_0016847 3300048921 Bacteria 6678
707 Ga0496118_0021989 3300048921 Bacteria 5593
708 Ga0496118_0022850 3300048921 Bacteria 5453
709 Ga0496118_0043392 3300048921 Bacteria 3536
710 Ga0496118_0089381 3300048921 Bacteria 2126
711 Ga0496118_0190081 3300048921 Bacteria 1229
712 Ga0496119_0000772 3300048922 Bacteria 42912
713 Ga0496119_0002404 3300048922 Bacteria 20558
714 Ga0496119_0002845 3300048922 Bacteria 18487
715 Ga0496119_0006633 3300048922 Bacteria 10654
716 Ga0496119_0010769 3300048922 Bacteria 7657
717 Ga0496119_0026366 3300048922 Bacteria 4031
718 Ga0496119_0039809 3300048922 Bacteria 3017
719 Ga0496119_0069993 3300048922 Bacteria 2060
720 Ga0496120_0000875 3300048923 Bacteria 42561
721 Ga0496120_0001871 3300048923 Bacteria 23430
722 Ga0496120_0003532 3300048923 Bacteria 14148
723 Ga0496120_0017718 3300048923 Bacteria 4606
724 Ga0496120_0026228 3300048923 Bacteria 3601
725 Ga0496120_0030817 3300048923 Bacteria 3255
726 Ga0496120_0051724 3300048923 Bacteria 2344
727 Ga0496120_0053235 3300048923 Bacteria 2300
728 Ga0496121_0000528 3300048924 Bacteria 72606
729 Ga0496121_0029210 3300048924 Bacteria 5108
730 Ga0496121_0134184 3300048924 Bacteria 1847
731 Ga0496121_0456356 3300048924 Bacteria 822
732 Ga0496122_0000030 3300048925 Bacteria 331586
733 Ga0496122_0000120 3300048925 Bacteria 182539
734 Ga0496122_0001714 3300048925 Bacteria 34008
735 Ga0496122_0003193 3300048925 Bacteria 21866
736 Ga0496122_0004828 3300048925 Bacteria 16430
737 Ga0496122_0004987 3300048925 Bacteria 16062
738 Ga0496122_0007772 3300048925 Bacteria 11795
739 Ga0496122_0020154 3300048925 Bacteria 6048
740 Ga0496122_0035334 3300048925 Bacteria 4068
741 Ga0496122_0090992 3300048925 Bacteria 2079
742 Ga0496122_0162505 3300048925 Bacteria 1359
743 Ga0496122_0248147 3300048925 Bacteria 998
744 Ga0496122_0388344 3300048925 Bacteria 713
745 Ga0496123_0000024 3300048926 Bacteria 331587
746 Ga0496123_0000051 3300048926 Bacteria 237095
747 Ga0496123_0000800 3300048926 Bacteria 50902
748 Ga0496123_0005067 3300048926 Bacteria 13462
749 Ga0496123_0012608 3300048926 Bacteria 7186
750 Ga0496123_0029610 3300048926 Bacteria 4025
751 Ga0496123_0030194 3300048926 Bacteria 3971
752 Ga0496123_0172177 3300048926 Bacteria 1140
753 Ga0496124_0000256 3300048927 Bacteria 102144
754 Ga0496124_0001400 3300048927 Bacteria 36096
755 Ga0496124_0006961 3300048927 Bacteria 12148
756 Ga0496124_0024369 3300048927 Bacteria 5504
757 Ga0496124_0033930 3300048927 Bacteria 4485
758 Ga0496124_0034703 3300048927 Bacteria 4422
759 Ga0496125_0000061 3300048928 Bacteria 262739
760 Ga0496125_0000079 3300048928 Bacteria 230066
761 Ga0496125_0000350 3300048928 Bacteria 87293
762 Ga0496125_0004557 3300048928 Bacteria 15898
763 Ga0496125_0011710 3300048928 Bacteria 8745
764 Ga0496125_0012431 3300048928 Bacteria 8452
765 Ga0496125_0024172 3300048928 Bacteria 5590
766 Ga0496125_0026332 3300048928 Bacteria 5303
767 Ga0496125_0110814 3300048928 Bacteria 1988
768 Ga0496125_0113495 3300048928 Bacteria 1954
769 Ga0496126_0001272 3300048929 Bacteria 40541
770 Ga0496126_0011797 3300048929 Bacteria 8993
771 Ga0496126_0030455 3300048929 Bacteria 5111
772 Ga0496126_0035572 3300048929 Bacteria 4666
773 Ga0496126_0039327 3300048929 Bacteria 4389
774 Ga0496126_0064516 3300048929 Bacteria 3280
775 Ga0496126_0084913 3300048929 Bacteria 2792
776 Ga0496126_0176464 3300048929 Bacteria 1817
777 Ga0496126_0200863 3300048929 Bacteria 1684
778 Ga0496126_0206864 3300048929 Bacteria 1654
779 Ga0496126_0212970 3300048929 Bacteria 1626
780 Ga0496126_0226283 3300048929 Bacteria 1569
781 Ga0501306_000430 3300049127 Bacteria 3171
782 Ga0501306_009070 3300049127 Bacteria 1227
783 Ga0501306_010470 3300049127 Bacteria 1168
784 Ga0501306_025177 3300049127 Bacteria 855
785 Ga0501309_001111 3300049129 Bacteria 2515
786 Ga0501310_001286 3300049130 Bacteria 2255
787 Ga0501310_004884 3300049130 Bacteria 1362
788 Ga0501310_007673 3300049130 Bacteria 1156
789 Ga0501304_004820 3300049160 Bacteria 1036
790 Ga0501305_000363 3300049161 Bacteria 3613
791 Ga0501305_009514 3300049161 Bacteria 1279
792 Ga0501307_002508 3300049162 Bacteria 1718
793 Ga0501307_007168 3300049162 Bacteria 1223
794 Ga0501311_006888 3300049527 Bacteria 1295
795 Ga0501311_017982 3300049527 Bacteria 935
796 Ga0501312_010180 3300049528 Bacteria 1254
797 Ga0501312_014262 3300049528 Bacteria 1115
798 Ga0501312_020076 3300049528 Bacteria 986
799 Ga0501313_004944 3300049529 Bacteria 1390
800 Ga0501314_002523 3300049530 Bacteria 1420
801 Ga0501315_005366 3300049531 Bacteria 1386
802 Ga0501315_007900 3300049531 Bacteria 1224
803 Ga0501315_034431 3300049531 Bacteria 743
804 Ga0501316_009972 3300049532 Bacteria 1075
805 Ga0501316_028444 3300049532 Bacteria 738
806 Ga0501317_000791 3300049533 Bacteria 2438
807 Ga0501317_001278 3300049533 Bacteria 2130
808 Ga0501317_008698 3300049533 Bacteria 1176
809 Ga0501317_009202 3300049533 Bacteria 1155
810 Ga0501317_027486 3300049533 Bacteria 808
811 Ga0501318_000267 3300049534 Bacteria 2992
812 Ga0501318_001622 3300049534 Bacteria 1809
813 Ga0501318_002590 3300049534 Bacteria 1584
814 Ga0501318_024287 3300049534 Bacteria 788
815 Ga0501319_000468 3300049535 Bacteria 1930
816 Ga0501319_003869 3300049535 Bacteria 1022
817 Ga0501321_000167 3300049537 Bacteria 3609
818 Ga0501321_000886 3300049537 Bacteria 2167
819 Ga0501321_002580 3300049537 Bacteria 1586
820 Ga0501321_002598 3300049537 Bacteria 1580
821 Ga0501321_006279 3300049537 Bacteria 1203
822 Ga0501321_010988 3300049537 Bacteria 1003
823 Ga0501321_022175 3300049537 Bacteria 798
824 Ga0501323_001848 3300049539 Bacteria 1959
825 Ga0501323_005348 3300049539 Bacteria 1402
826 Ga0501324_001452 3300049540 Bacteria 1580
827 Ga0501324_009112 3300049540 Bacteria 886
828 Ga0501325_003612 3300049541 Bacteria 1138
829 Ga0501325_005115 3300049541 Bacteria 1032
830 Ga0501325_008593 3300049541 Bacteria 889
831 Ga0501031_0001578 3300049568 Bacteria 14208
832 Ga0501031_0007690 3300049568 Bacteria 7015
833 Ga0501031_0040115 3300049568 Bacteria 3056
834 Ga0501032_0001701 3300049569 Bacteria 17427
835 Ga0501032_0002037 3300049569 Bacteria 15951
836 Ga0501032_0013055 3300049569 Bacteria 5915
837 Ga0501032_0015000 3300049569 Bacteria 5479
838 Ga0501032_0200059 3300049569 Bacteria 1304
839 Ga0501033_0014733 3300049570 Bacteria 5935
840 Ga0501033_0024476 3300049570 Bacteria 4554
841 Ga0501033_0045734 3300049570 Bacteria 3256
842 Ga0501033_0046677 3300049570 Bacteria 3220
843 Ga0501033_0051589 3300049570 Bacteria 3049
844 Ga0501033_0055808 3300049570 Bacteria 2920
845 Ga0501033_0141404 3300049570 Bacteria 1739
846 Ga0501034_0000231 3300049571 Bacteria 104378
847 Ga0501034_0007983 3300049571 Bacteria 11237
848 Ga0501034_0019587 3300049571 Bacteria 6918
849 Ga0501034_0023555 3300049571 Bacteria 6273
850 Ga0501034_0046802 3300049571 Bacteria 4370
851 Ga0501034_0069767 3300049571 Bacteria 3525
852 Ga0501034_0075333 3300049571 Bacteria 3382
853 Ga0501034_0182885 3300049571 Bacteria 2061
854 Ga0501034_0243101 3300049571 Bacteria 1745
855 Ga0501034_0251522 3300049571 Bacteria 1711
856 Ga0501034_0265125 3300049571 Bacteria 1660
857 Ga0501034_0741592 3300049571 Bacteria 878
858 Ga0501034_0763946 3300049571 Bacteria 861
859 Ga0501036_0024010 3300049572 Bacteria 5138
860 Ga0501036_0036436 3300049572 Bacteria 4163
861 Ga0501036_0092580 3300049572 Bacteria 2554
862 Ga0501036_0241592 3300049572 Bacteria 1514
863 Ga0501036_0312068 3300049572 Bacteria 1315
864 Ga0501036_0340037 3300049572 Bacteria 1253
865 Ga0501037_0002217 3300049573 Bacteria 14038
866 Ga0501037_0008820 3300049573 Bacteria 7388
867 Ga0501037_0014222 3300049573 Bacteria 5861
868 Ga0501037_0047012 3300049573 Bacteria 3163
869 Ga0501037_0053136 3300049573 Bacteria 2963
870 Ga0501037_0338476 3300049573 Bacteria 1039
871 Ga0501038_0002939 3300049574 Bacteria 15900
872 Ga0501038_0014926 3300049574 Bacteria 7073
873 Ga0501038_0046047 3300049574 Bacteria 3783
874 Ga0501038_0053268 3300049574 Bacteria 3484
875 Ga0501038_0054563 3300049574 Bacteria 3437
876 Ga0501038_0111969 3300049574 Bacteria 2260
877 Ga0501038_0138128 3300049574 Bacteria 1996
878 Ga0501038_0215013 3300049574 Bacteria 1536
879 Ga0501038_0276632 3300049574 Bacteria 1322
880 Ga0501038_0329329 3300049574 Bacteria 1193
881 Ga0501038_0498350 3300049574 Bacteria 931
882 Ga0501039_0015610 3300049575 Bacteria 5812
883 Ga0501039_0016716 3300049575 Bacteria 5621
884 Ga0501039_0065179 3300049575 Bacteria 2825
885 Ga0501039_0097656 3300049575 Bacteria 2291
886 Ga0501039_0230943 3300049575 Bacteria 1454
887 Ga0501040_0000683 3300049576 Bacteria 20884
888 Ga0501040_0560676 3300049576 Bacteria 825
889 Ga0501041_0037023 3300049577 Bacteria 2955
890 Ga0501042_0002564 3300049578 Bacteria 11176
891 Ga0501042_0232618 3300049578 Bacteria 1329
892 Ga0501042_0460073 3300049578 Bacteria 923
893 Ga0501043_0068271 3300049579 Bacteria 2791
894 Ga0501043_0082166 3300049579 Bacteria 2532
895 Ga0501043_0091245 3300049579 Bacteria 2395
896 Ga0501043_0148585 3300049579 Bacteria 1834
897 Ga0501043_0225195 3300049579 Bacteria 1449
898 Ga0501046_0002882 3300049580 Bacteria 15943
899 Ga0501046_0015068 3300049580 Bacteria 6501
900 Ga0501046_0020765 3300049580 Bacteria 5426
901 Ga0501046_0076706 3300049580 Bacteria 2589
902 Ga0501046_0256754 3300049580 Bacteria 1285
903 Ga0501047_0001693 3300049581 Bacteria 21446
904 Ga0501047_0005206 3300049581 Bacteria 12210
905 Ga0501047_0007489 3300049581 Bacteria 10272
906 Ga0501047_0056740 3300049581 Bacteria 3788
907 Ga0501047_0100219 3300049581 Bacteria 2776
908 Ga0501047_0194687 3300049581 Bacteria 1889
909 Ga0501047_0296047 3300049581 Bacteria 1461
910 Ga0501047_0417418 3300049581 Bacteria 1173
911 Ga0501048_0002200 3300049582 Bacteria 14834
912 Ga0501048_0003317 3300049582 Bacteria 12262
913 Ga0501048_0117290 3300049582 Bacteria 1880
914 Ga0501067_0040560 3300049583 Bacteria 2585
915 Ga0501067_0080920 3300049583 Bacteria 1801
916 Ga0501067_0081677 3300049583 Bacteria 1792
917 Ga0501068_0013268 3300049584 Bacteria 4686
918 Ga0501070_0001115 3300049586 Bacteria 24127
919 Ga0501070_0006252 3300049586 Bacteria 10134
920 Ga0501070_0009418 3300049586 Bacteria 8256
921 Ga0501070_0064274 3300049586 Bacteria 3039
922 Ga0501070_0089176 3300049586 Bacteria 2552
923 Ga0501070_0177426 3300049586 Bacteria 1754
924 Ga0501070_0309761 3300049586 Bacteria 1285
925 Ga0501071_0002381 3300049587 Bacteria 11387
926 Ga0501071_0015332 3300049587 Bacteria 5259
927 Ga0501071_0305139 3300049587 Bacteria 1207
928 Ga0501072_0003741 3300049588 Bacteria 11483
929 Ga0501072_0076228 3300049588 Bacteria 2653
930 Ga0501072_0394247 3300049588 Bacteria 1098
931 Ga0501073_0000089 3300049589 Bacteria 57687
932 Ga0501073_0014799 3300049589 Bacteria 5663
933 Ga0501073_0423795 3300049589 Bacteria 920
934 Ga0501074_0026637 3300049590 Bacteria 4192
935 Ga0501074_0441908 3300049590 Bacteria 922
936 Ga0501075_0002860 3300049591 Bacteria 11571
937 Ga0501076_0012191 3300049592 Bacteria 6427
938 Ga0501206_021971 3300049653 Bacteria 914
939 Ga0501079_0002499 3300049741 Bacteria 13354
940 Ga0501079_0473588 3300049741 Bacteria 984
941 Ga0501080_0030229 3300049742 Bacteria 5046
942 Ga0501080_0056001 3300049742 Bacteria 3672
943 Ga0501083_0000031 3300049744 Bacteria 104819
944 Ga0501083_0016955 3300049744 Bacteria 5086
945 Ga0501083_0072440 3300049744 Bacteria 2290
946 Ga0501035_0009916 3300049822 Bacteria 8844
947 Ga0501035_0020790 3300049822 Bacteria 6031
948 Ga0501035_0048714 3300049822 Bacteria 3799
949 Ga0501035_0088234 3300049822 Bacteria 2733
950 Ga0501035_0169028 3300049822 Bacteria 1889
951 Ga0501035_0188181 3300049822 Bacteria 1776
952 Ga0501044_0004120 3300049823 Bacteria 16310
953 Ga0501044_0008707 3300049823 Bacteria 11106
954 Ga0501044_0009255 3300049823 Bacteria 10759
955 Ga0501044_0037014 3300049823 Bacteria 5102
956 Ga0501044_0053882 3300049823 Bacteria 4136
957 Ga0501044_0196966 3300049823 Bacteria 1974
958 Ga0501044_0289062 3300049823 Bacteria 1571
959 Ga0501044_0422676 3300049823 Bacteria 1242
960 Ga0501045_0001668 3300049824 Bacteria 14924
961 Ga0501045_0042376 3300049824 Bacteria 3313
962 Ga0501212_033242 3300049851 Bacteria 837
963 nmdc:mga00v17_102753_c1 3300050491 Bacteria 1806
964 nmdc:mga00v17_225763_c1 3300050491 Bacteria 1213
965 nmdc:mga00v17_30368_c1 3300050491 Bacteria 2457
966 nmdc:mga00v17_328340_c1 3300050491 Bacteria 994
967 nmdc:mga0yw44_405127_c1 3300050492 Bacteria 922
968 nmdc:mga0yw44_42497_c1 3300050492 Bacteria 2711
969 nmdc:mga0yw44_46291_c1 3300050492 Bacteria 2611
970 nmdc:mga0yw44_465171_c1 3300050492 Bacteria 857
971 nmdc:mga0yw44_4879_c1 3300050492 Bacteria 6241
972 nmdc:mga0yw44_60122_c1 3300050492 Bacteria 2327
973 nmdc:mga04h51_10058_c1 3300050495 Bacteria 2586
974 nmdc:mga07m45_420899_c1 3300050496 Bacteria 775
975 nmdc:mga0sz30_134414_c1 3300050516 Bacteria 1091
976 nmdc:mga0sz30_187692_c1 3300050516 Bacteria 918
977 nmdc:mga0sz30_20756_c1 3300050516 Bacteria 1632
978 nmdc:mga0sz30_37922_c1 3300050516 Bacteria 2018
979 Ga0500635_0000010 3300053080 Bacteria 147500
980 Ga0495619_0130822 3300053085 Bacteria 1725
981 Ga0495619_0631178 3300053085 Bacteria 732
982 Ga0500643_000174 3300053087 Bacteria 63222
983 Ga0500651_0000604 3300053093 Bacteria 17882
984 Ga0500650_0010883 3300053098 Bacteria 3722
985 Ga0500556_0000001 3300053104 Bacteria 1135060
986 Ga0500556_0000095 3300053104 Bacteria 82300
987 Ga0500593_001763 3300053117 Bacteria 7793
988 Ga0500559_0000942 3300053136 Bacteria 18334
989 Ga0500559_0001957 3300053136 Bacteria 11141
990 Ga0500559_0028882 3300053136 Bacteria 2371
991 Ga0500568_0000006 3300053139 Bacteria 522235
992 Ga0500568_0000300 3300053139 Bacteria 40139
993 Ga0500568_0013408 3300053139 Bacteria 3738
994 Ga0500568_0032923 3300053139 Bacteria 2129
995 Ga0500573_0000023 3300053140 Bacteria 152268
996 Ga0500573_0003592 3300053140 Bacteria 8048
997 Ga0500573_0008240 3300053140 Bacteria 5733
998 Ga0500573_0084164 3300053140 Bacteria 1805
999 Ga0500573_0336752 3300053140 Bacteria 738
1000 Ga0500577_0082532 3300053142 Bacteria 1284
1001 Ga0500588_0089350 3300053146 Bacteria 1044
1002 Ga0500590_041647 3300053148 Bacteria 2361
1003 Ga0500616_0000078 3300053153 Bacteria 202009
1004 Ga0500616_0000359 3300053153 Bacteria 64837
1005 Ga0500620_000027 3300053155 Bacteria 30234
1006 Ga0587080_024822 3300059503 Bacteria 1008
1007 Ga0587083_0010084 3300059505 Bacteria 1522
1008 Ga0587088_008720 3300059508 Bacteria 1441
1009 Ga0587090_000258 3300059510 Bacteria 3972
1010 Ga0587072_000361 3300059643 Bacteria 4389
1011 Ga0587124_009055 3300059660 Bacteria 865
1012 Ga0501082_0020703 3300060353 Bacteria 5670
1013 Ga0501082_0350804 3300060353 Bacteria 1286
1014 Ga0501082_0504886 3300060353 Bacteria 1057
1015 Ga0466962_0066760 3300061719 Bacteria 1717
1016 Ga0530510_0004600 3300061734 Bacteria 9542

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049528 Ga0501312_010180 Ga0501312_010180_363_1115 201
2 3300031665 Ga0316575_10000110 Ga0316575_1000011017 203
3 3300033529 Ga0316587_1005667 Ga0316587_10056672 203
4 3300049571 Ga0501034_0182885 Ga0501034_0182885_1397_2038 203
5 iso_pu_bacteria 2857710386 2857713152 205
6 3300003203 JGI25406J46586_10066406 JGI25406J46586_100664063 207
7 3300005985 Ga0081539_10001475 Ga0081539_1000147510 207
8 3300049571 Ga0501034_0763946 Ga0501034_0763946_37_681 207
9 3300045836 Ga0466958_0221724 Ga0466958_0221724_80_718 208
10 3300049541 Ga0501325_008593 Ga0501325_008593_223_861 208
11 iso_pu_bacteria 2728369276 2729905679 208
12 3300025909 Ga0207705_10661068 Ga0207705_106610681 209
13 iso_pu_bacteria 2537561592 2537898471 209
14 iso_pu_bacteria 2690315906 2691514283 209
15 iso_pu_bacteria 2739367653 2739602478 209
16 iso_pu_bacteria 2775506735 2775656607 209
17 iso_pu_bacteria 2808606357 2808831523 209
18 iso_pu_bacteria 2808606360 2808852731 209
19 iso_pu_bacteria 2808606366 2808879011 209
20 iso_pu_bacteria 2808606370 2808891596 209
21 iso_pu_bacteria 2808606371 2808896735 209
22 iso_pu_bacteria 2808606700 2810363939 209
23 iso_pu_bacteria 2811994871 2812320862 209
24 iso_pu_bacteria 2816332305 2817509008 209
25 iso_pu_bacteria 2844849076 2844849197 209
26 iso_pu_bacteria 2857727296 2857728944 209
27 iso_pu_bacteria 2857740372 2857743335 209
28 iso_pu_bacteria 2904497146 2904497982 209
29 iso_pu_bacteria 2904776348 2904777336 209
30 iso_pu_bacteria 2905926851 2905927242 209
31 iso_pu_bacteria 2910809715 2910812816 209
32 iso_pu_bacteria 2919034639 2919034692 209
33 iso_pu_bacteria 2919051321 2919055101 209
34 iso_pu_bacteria 2919059106 2919062331 209
35 iso_pu_bacteria 2919391150 2919393925 209
36 iso_pu_bacteria 2919538618 2919540176 209
37 iso_pu_bacteria 2932426870 2932428007 209
38 iso_pu_bacteria 2933418574 2933421887 209
39 iso_pu_bacteria 2939598168 2939598332 209
40 iso_pu_bacteria 2939647034 2939648424 209
41 iso_pu_bacteria 2939674588 2939675528 209
42 iso_pu_bacteria 2945916053 2945918613 209
43 iso_pu_bacteria 2945920336 2945921107 209
44 iso_pu_bacteria 2945941187 2945942773 209
45 iso_pu_bacteria 2945956166 2945959504 209
46 iso_pu_bacteria 2945968032 2945968076 209
47 iso_pu_bacteria 2946003308 2946004908 209
48 iso_pu_bacteria 2946024296 2946026053 209
49 iso_pu_bacteria 2946037020 2946038651 209
50 iso_pu_bacteria 2946059875 2946062475 209
51 iso_pu_bacteria 2953998280 2953999941 209
52 iso_pu_bacteria 2974302888 2974306635 209
53 iso_pu_bacteria 8004021418 8004021694 209
54 iso_pu_bacteria 8004025490 8004028996 209
55 iso_pu_bacteria 8054107350 8054107996 209
56 3300003762 Ga0055542_1008543 Ga0055542_10085433 210
57 3300005327 Ga0070658_10051427 Ga0070658_100514274 210
58 3300005337 Ga0070682_100652979 Ga0070682_1006529791 210
59 3300005338 Ga0068868_100260290 Ga0068868_1002602902 210
60 3300005339 Ga0070660_100035616 Ga0070660_1000356164 210
61 3300005366 Ga0070659_100002647 Ga0070659_1000026474 210
62 3300005367 Ga0070667_100077062 Ga0070667_1000770621 210
63 3300005539 Ga0068853_100011613 Ga0068853_1000116138 210
64 3300005616 Ga0068852_100168306 Ga0068852_1001683063 210
65 3300005617 Ga0068859_100087486 Ga0068859_1000874862 210
66 3300005618 Ga0068864_100060125 Ga0068864_1000601255 210
67 3300005841 Ga0068863_100176649 Ga0068863_1001766493 210
68 3300005842 Ga0068858_100000846 Ga0068858_10000084630 210
69 3300006931 Ga0097620_100087486 Ga0097620_1000874862 210
70 3300009093 Ga0105240_10002622 Ga0105240_100026226 210
71 3300009093 Ga0105240_10087122 Ga0105240_100871223 210
72 3300009098 Ga0105245_10233366 Ga0105245_102333662 210
73 3300009174 Ga0105241_10017368 Ga0105241_100173684 210
74 3300009177 Ga0105248_10139068 Ga0105248_101390681 210
75 3300013296 Ga0157374_10274188 Ga0157374_102741881 210
76 3300014325 Ga0163163_10003789 Ga0163163_100037894 210
77 3300014968 Ga0157379_10025870 Ga0157379_100258704 210
78 3300025254 Ga0209148_1001968 Ga0209148_10019685 210
79 3300025908 Ga0207643_10072497 Ga0207643_100724972 210
80 3300025909 Ga0207705_10116953 Ga0207705_101169532 210
81 3300025911 Ga0207654_10000001 Ga0207654_100000011584 210
82 3300025913 Ga0207695_10007498 Ga0207695_100074987 210
83 3300025913 Ga0207695_10031861 Ga0207695_100318616 210
84 3300025914 Ga0207671_10025057 Ga0207671_100250575 210
85 3300025919 Ga0207657_10027565 Ga0207657_100275658 210
86 3300025931 Ga0207644_10406705 Ga0207644_104067052 210
87 3300025932 Ga0207690_10003349 Ga0207690_100033495 210
88 3300025949 Ga0207667_10010019 Ga0207667_100100198 210
89 3300026023 Ga0207677_10038884 Ga0207677_100388842 210
90 3300026035 Ga0207703_10000031 Ga0207703_10000031148 210
91 3300026095 Ga0207676_10105266 Ga0207676_101052662 210
92 3300026142 Ga0207698_10512093 Ga0207698_105120931 210
93 3300031649 Ga0307514_10087202 Ga0307514_100872023 210
94 3300041997 Ga0439431_0042954 Ga0439431_0042954_296_943 210
95 3300048923 Ga0496120_0030817 Ga0496120_0030817_2588_3223 210
96 3300048929 Ga0496126_0212970 Ga0496126_0212970_570_1205 210
97 3300053093 Ga0500651_0000604 Ga0500651_0000604_2650_3285 210
98 3300053148 Ga0500590_041647 Ga0500590_041647_610_1245 210
99 3300053155 Ga0500620_000027 Ga0500620_000027_7569_8204 210
100 3300059505 Ga0587083_0010084 Ga0587083_0010084_64_699 210
101 iso_pu_bacteria 2919395869 2919398919 210
102 iso_pu_bacteria 2920879853 2920881951 210
103 3300005329 Ga0070683_100282242 Ga0070683_1002822422 211
104 3300005564 Ga0070664_100328578 Ga0070664_1003285782 211
105 3300005983 Ga0081540_1006340 Ga0081540_10063405 211
106 3300010375 Ga0105239_10560961 Ga0105239_105609612 211
107 3300014325 Ga0163163_10656644 Ga0163163_106566442 211
108 3300014969 Ga0157376_10799205 Ga0157376_107992051 211
109 3300025901 Ga0207688_10195848 Ga0207688_101958481 211
110 3300025908 Ga0207643_10351379 Ga0207643_103513792 211
111 3300025926 Ga0207659_10139703 Ga0207659_101397032 211
112 3300025929 Ga0207664_10347955 Ga0207664_103479552 211
113 3300025932 Ga0207690_10250828 Ga0207690_102508282 211
114 3300031665 Ga0316575_10021877 Ga0316575_100218772 211
115 3300031691 Ga0316579_10024138 Ga0316579_100241383 211
116 3300031727 Ga0316576_10032724 Ga0316576_100327241 211
117 3300031733 Ga0316577_10005539 Ga0316577_100055395 211
118 3300031903 Ga0307407_10104013 Ga0307407_101040132 211
119 3300032002 Ga0307416_100323693 Ga0307416_1003236933 211
120 3300032126 Ga0307415_100016139 Ga0307415_1000161392 211
121 3300032133 Ga0316583_10032635 Ga0316583_100326352 211
122 3300032133 Ga0316583_10047527 Ga0316583_100475273 211
123 3300032137 Ga0316585_10010464 Ga0316585_100104642 211
124 3300032139 Ga0316580_10009328 Ga0316580_100093282 211
125 3300032168 Ga0316593_10060972 Ga0316593_100609722 211
126 3300033524 Ga0316592_1018983 Ga0316592_10189832 211
127 3300033528 Ga0316588_1023421 Ga0316588_10234212 211
128 3300033541 Ga0316596_1029083 Ga0316596_10290832 211
129 3300035398 Ga0316574_0004218 Ga0316574_0004218_1051_1695 211
130 3300036647 Ga0316582_0008420 Ga0316582_0008420_4179_4823 211
131 3300036712 Ga0316584_0077362 Ga0316584_0077362_1412_2056 211
132 3300041999 Ga0439433_0013199 Ga0439433_0013199_400_1044 211
133 3300044694 Ga0466963_0071146 Ga0466963_0071146_1249_1899 211
134 3300044706 Ga0466964_0195485 Ga0466964_0195485_15_665 211
135 3300044901 Ga0466960_0154642 Ga0466960_0154642_414_1064 211
136 3300045049 Ga0466959_0540198 Ga0466959_0540198_109_759 211
137 3300048904 Ga0496101_0727733 Ga0496101_0727733_29_673 211
138 3300049578 Ga0501042_0460073 Ga0501042_0460073_234_884 211
139 3300050492 nmdc:mga0yw44_405127_c1 nmdc:mga0yw44_405127_c1_203_847 211
140 iso_pu_bacteria 2643221679 2644444657 211
141 iso_pu_bacteria 2643221711 2644611451 211
142 iso_pu_bacteria 2808606365 2808874871 211
143 iso_pu_bacteria 2811994882 2812375420 211
144 iso_pu_bacteria 2818991318 2819428152 211
145 iso_pu_bacteria 2818991458 2819668295 211
146 iso_pu_bacteria 2818991462 2819692145 211
147 iso_pu_bacteria 2818991469 2819729886 211
148 3300002738 JGI25154J39366_1001355 JGI25154J39366_100135511 212
149 3300002773 JGI25152J39213_1000287 JGI25152J39213_100028721 212
150 3300003162 Ga0006778J45830_1078606 Ga0006778J45830_10786062 212
151 3300005288 Ga0065714_10006667 Ga0065714_100066672 212
152 3300005288 Ga0065714_10018258 Ga0065714_100182581 212
153 3300005288 Ga0065714_10079388 Ga0065714_100793883 212
154 3300005290 Ga0065712_10142570 Ga0065712_101425702 212
155 3300005328 Ga0070676_10050823 Ga0070676_100508232 212
156 3300005331 Ga0070670_100207901 Ga0070670_1002079012 212
157 3300005333 Ga0070677_10016041 Ga0070677_100160413 212
158 3300005335 Ga0070666_10080484 Ga0070666_100804842 212
159 3300005347 Ga0070668_100500479 Ga0070668_1005004791 212
160 3300005355 Ga0070671_100043398 Ga0070671_1000433983 212
161 3300005356 Ga0070674_100044006 Ga0070674_1000440062 212
162 3300005364 Ga0070673_100129609 Ga0070673_1001296092 212
163 3300005456 Ga0070678_100259617 Ga0070678_1002596172 212
164 3300005543 Ga0070672_100094056 Ga0070672_1000940562 212
165 3300005548 Ga0070665_100468732 Ga0070665_1004687322 212
166 3300005615 Ga0070702_100872388 Ga0070702_1008723881 212
167 3300006051 Ga0075364_10062263 Ga0075364_100622634 212
168 3300006051 Ga0075364_10392738 Ga0075364_103927382 212
169 3300006058 Ga0075432_10003166 Ga0075432_100031662 212
170 3300006058 Ga0075432_10009240 Ga0075432_100092402 212
171 3300006353 Ga0075370_10244350 Ga0075370_102443501 212
172 3300009011 Ga0105251_10021156 Ga0105251_100211562 212
173 3300009036 Ga0105244_10034792 Ga0105244_100347922 212
174 3300009036 Ga0105244_10041596 Ga0105244_100415962 212
175 3300009036 Ga0105244_10207337 Ga0105244_102073371 212
176 3300009148 Ga0105243_10085815 Ga0105243_100858153 212
177 3300009176 Ga0105242_10310092 Ga0105242_103100922 212
178 3300009177 Ga0105248_10239847 Ga0105248_102398472 212
179 3300011119 Ga0105246_10001188 Ga0105246_100011884 212
180 3300011119 Ga0105246_10009988 Ga0105246_100099882 212
181 3300011119 Ga0105246_10035287 Ga0105246_100352873 212
182 3300011119 Ga0105246_10108960 Ga0105246_101089602 212
183 3300013100 Ga0157373_10156733 Ga0157373_101567332 212
184 3300013102 Ga0157371_10135771 Ga0157371_101357712 212
185 3300013105 Ga0157369_10076515 Ga0157369_100765153 212
186 3300013105 Ga0157369_10166300 Ga0157369_101663002 212
187 3300013105 Ga0157369_10170360 Ga0157369_101703603 212
188 3300014497 Ga0182008_10270258 Ga0182008_102702581 212
189 3300020075 Ga0206349_1059080 Ga0206349_10590801 212
190 3300020075 Ga0206349_1725218 Ga0206349_17252181 212
191 3300020076 Ga0206355_1119720 Ga0206355_11197201 212
192 3300020080 Ga0206350_11108628 Ga0206350_111086282 212
193 3300020081 Ga0206354_10229204 Ga0206354_102292042 212
194 3300020082 Ga0206353_10901940 Ga0206353_109019402 212
195 3300022467 Ga0224712_10080403 Ga0224712_100804031 212
196 3300025245 Ga0207425_1003632 Ga0207425_10036327 212
197 3300025246 Ga0209646_1000071 Ga0209646_1000071167 212
198 3300025254 Ga0209148_1002255 Ga0209148_10022554 212
199 3300025258 Ga0209129_1000129 Ga0209129_1000129101 212
200 3300025294 Ga0209025_1000889 Ga0209025_100088910 212
201 3300025303 Ga0209051_1002347 Ga0209051_100234714 212
202 3300025303 Ga0209051_1005468 Ga0209051_10054683 212
203 3300025315 Ga0207697_10004708 Ga0207697_100047088 212
204 3300025315 Ga0207697_10007572 Ga0207697_100075722 212
205 3300025728 Ga0207655_1006309 Ga0207655_10063092 212
206 3300025728 Ga0207655_1013054 Ga0207655_10130546 212
207 3300025728 Ga0207655_1021347 Ga0207655_10213472 212
208 3300025893 Ga0207682_10005480 Ga0207682_100054802 212
209 3300025907 Ga0207645_10052524 Ga0207645_100525242 212
210 3300025923 Ga0207681_10009275 Ga0207681_100092757 212
211 3300025925 Ga0207650_10118003 Ga0207650_101180032 212
212 3300025931 Ga0207644_10255908 Ga0207644_102559082 212
213 3300025934 Ga0207686_10296358 Ga0207686_102963581 212
214 3300025940 Ga0207691_10000576 Ga0207691_100005763 212
215 3300025960 Ga0207651_10035401 Ga0207651_100354012 212
216 3300025972 Ga0207668_10473086 Ga0207668_104730862 212
217 3300025986 Ga0207658_10154852 Ga0207658_101548522 212
218 3300026121 Ga0207683_10002636 Ga0207683_100026367 212
219 3300027907 Ga0207428_10005185 Ga0207428_1000518510 212
220 3300027907 Ga0207428_10083190 Ga0207428_100831902 212
221 3300028379 Ga0268266_10254901 Ga0268266_102549012 212
222 3300030744 Ga0316181_1187045 Ga0316181_11870451 212
223 3300031548 Ga0307408_100020444 Ga0307408_1000204443 212
224 3300031548 Ga0307408_100046082 Ga0307408_1000460823 212
225 3300031548 Ga0307408_100140379 Ga0307408_1001403792 212
226 3300031548 Ga0307408_100151705 Ga0307408_1001517053 212
227 3300031548 Ga0307408_100171610 Ga0307408_1001716102 212
228 3300031548 Ga0307408_100518360 Ga0307408_1005183602 212
229 3300031548 Ga0307408_100545524 Ga0307408_1005455242 212
230 3300031548 Ga0307408_100603563 Ga0307408_1006035632 212
231 3300031548 Ga0307408_100822727 Ga0307408_1008227271 212
232 3300031731 Ga0307405_10005557 Ga0307405_100055575 212
233 3300031731 Ga0307405_10035230 Ga0307405_100352301 212
234 3300031731 Ga0307405_10045514 Ga0307405_100455142 212
235 3300031731 Ga0307405_10066854 Ga0307405_100668542 212
236 3300031731 Ga0307405_10075688 Ga0307405_100756883 212
237 3300031731 Ga0307405_10105030 Ga0307405_101050302 212
238 3300031731 Ga0307405_10302632 Ga0307405_103026322 212
239 3300031731 Ga0307405_10375100 Ga0307405_103751002 212
240 3300031824 Ga0307413_10083565 Ga0307413_100835652 212
241 3300031824 Ga0307413_10095859 Ga0307413_100958592 212
242 3300031824 Ga0307413_10148651 Ga0307413_101486512 212
243 3300031824 Ga0307413_10159717 Ga0307413_101597173 212
244 3300031824 Ga0307413_10578737 Ga0307413_105787371 212
245 3300031852 Ga0307410_10010427 Ga0307410_100104275 212
246 3300031852 Ga0307410_10013185 Ga0307410_100131853 212
247 3300031852 Ga0307410_10014223 Ga0307410_100142231 212
248 3300031852 Ga0307410_10064020 Ga0307410_100640202 212
249 3300031852 Ga0307410_10086142 Ga0307410_100861422 212
250 3300031852 Ga0307410_10150581 Ga0307410_101505812 212
251 3300031852 Ga0307410_10485127 Ga0307410_104851271 212
252 3300031852 Ga0307410_10499862 Ga0307410_104998621 212
253 3300031901 Ga0307406_10000821 Ga0307406_100008213 212
254 3300031901 Ga0307406_10009301 Ga0307406_100093014 212
255 3300031901 Ga0307406_10146709 Ga0307406_101467092 212
256 3300031901 Ga0307406_10182422 Ga0307406_101824222 212
257 3300031901 Ga0307406_10632145 Ga0307406_106321452 212
258 3300031901 Ga0307406_10769419 Ga0307406_107694192 212
259 3300031903 Ga0307407_10028770 Ga0307407_100287701 212
260 3300031903 Ga0307407_10035896 Ga0307407_100358962 212
261 3300031903 Ga0307407_10095843 Ga0307407_100958432 212
262 3300031903 Ga0307407_10535668 Ga0307407_105356681 212
263 3300031911 Ga0307412_10005371 Ga0307412_100053714 212
264 3300031911 Ga0307412_10021117 Ga0307412_100211172 212
265 3300031911 Ga0307412_10035356 Ga0307412_100353563 212
266 3300031911 Ga0307412_10048485 Ga0307412_100484852 212
267 3300031911 Ga0307412_10066186 Ga0307412_100661862 212
268 3300031911 Ga0307412_10103027 Ga0307412_101030272 212
269 3300031911 Ga0307412_10205884 Ga0307412_102058841 212
270 3300031911 Ga0307412_10239470 Ga0307412_102394702 212
271 3300031911 Ga0307412_10350902 Ga0307412_103509022 212
272 3300031995 Ga0307409_100015608 Ga0307409_1000156082 212
273 3300031995 Ga0307409_100037678 Ga0307409_1000376782 212
274 3300031995 Ga0307409_100085802 Ga0307409_1000858023 212
275 3300031995 Ga0307409_100173532 Ga0307409_1001735322 212
276 3300031995 Ga0307409_100434738 Ga0307409_1004347382 212
277 3300031995 Ga0307409_100544677 Ga0307409_1005446772 212
278 3300032002 Ga0307416_100004503 Ga0307416_1000045033 212
279 3300032002 Ga0307416_100058971 Ga0307416_1000589712 212
280 3300032002 Ga0307416_100093901 Ga0307416_1000939012 212
281 3300032002 Ga0307416_100140118 Ga0307416_1001401182 212
282 3300032002 Ga0307416_100217089 Ga0307416_1002170892 212
283 3300032002 Ga0307416_100250784 Ga0307416_1002507842 212
284 3300032002 Ga0307416_100297673 Ga0307416_1002976731 212
285 3300032002 Ga0307416_100468870 Ga0307416_1004688702 212
286 3300032002 Ga0307416_100787115 Ga0307416_1007871152 212
287 3300032002 Ga0307416_101018545 Ga0307416_1010185452 212
288 3300032002 Ga0307416_101222280 Ga0307416_1012222801 212
289 3300032004 Ga0307414_10001424 Ga0307414_100014242 212
290 3300032004 Ga0307414_10064546 Ga0307414_100645463 212
291 3300032004 Ga0307414_10115873 Ga0307414_101158732 212
292 3300032004 Ga0307414_10479465 Ga0307414_104794652 212
293 3300032004 Ga0307414_10633990 Ga0307414_106339902 212
294 3300032004 Ga0307414_10693359 Ga0307414_106933592 212
295 3300032004 Ga0307414_10834767 Ga0307414_108347672 212
296 3300032004 Ga0307414_10930182 Ga0307414_109301821 212
297 3300032005 Ga0307411_10001803 Ga0307411_100018037 212
298 3300032005 Ga0307411_10116941 Ga0307411_101169412 212
299 3300032005 Ga0307411_10145659 Ga0307411_101456592 212
300 3300032126 Ga0307415_100027191 Ga0307415_1000271911 212
301 3300032126 Ga0307415_100105357 Ga0307415_1001053572 212
302 3300032126 Ga0307415_100248127 Ga0307415_1002481271 212
303 3300032126 Ga0307415_100673486 Ga0307415_1006734861 212
304 3300037312 Ga0395899_0013669 Ga0395899_0013669_5015_5674 212
305 3300037312 Ga0395899_0031373 Ga0395899_0031373_338_997 212
306 3300037312 Ga0395899_0095266 Ga0395899_0095266_496_1155 212
307 3300037418 Ga0395900_0074975 Ga0395900_0074975_96_755 212
308 3300037418 Ga0395900_0098425 Ga0395900_0098425_1074_1739 212
309 3300037418 Ga0395900_0109031 Ga0395900_0109031_846_1505 212
310 3300037418 Ga0395900_0248139 Ga0395900_0248139_211_870 212
311 3300037418 Ga0395900_0359633 Ga0395900_0359633_659_1318 212
312 3300037466 Ga0395898_0004661 Ga0395898_0004661_321_980 212
313 3300037466 Ga0395898_0017563 Ga0395898_0017563_2228_2887 212
314 3300037466 Ga0395898_0030371 Ga0395898_0030371_693_1352 212
315 3300037466 Ga0395898_0085077 Ga0395898_0085077_2251_2910 212
316 3300037466 Ga0395898_0267485 Ga0395898_0267485_532_1191 212
317 3300037466 Ga0395898_0284473 Ga0395898_0284473_59_718 212
318 3300037471 Ga0395905_0029015 Ga0395905_0029015_1327_1986 212
319 3300038443 Ga0395901_0031737 Ga0395901_0031737_3576_4235 212
320 3300038443 Ga0395901_0037105 Ga0395901_0037105_2233_2892 212
321 3300038443 Ga0395901_0106777 Ga0395901_0106777_2070_2729 212
322 3300038443 Ga0395901_0109771 Ga0395901_0109771_30_689 212
323 3300038443 Ga0395901_0380215 Ga0395901_0380215_637_1296 212
324 3300041404 Ga0439436_0013087 Ga0439436_0013087_1525_2190 212
325 3300041404 Ga0439436_0022849 Ga0439436_0022849_207_866 212
326 3300041405 Ga0439438_006435 Ga0439438_006435_627_1286 212
327 3300041406 Ga0439439_0000385 Ga0439439_0000385_2677_3336 212
328 3300041411 Ga0439466_0002897 Ga0439466_0002897_2860_3519 212
329 3300041999 Ga0439433_0000411 Ga0439433_0000411_2805_3464 212
330 3300041999 Ga0439433_0021715 Ga0439433_0021715_482_1141 212
331 3300041999 Ga0439433_0061707 Ga0439433_0061707_132_791 212
332 3300042002 Ga0439442_000009 Ga0439442_000009_8585_9244 212
333 3300042002 Ga0439442_000111 Ga0439442_000111_2301_2960 212
334 3300042002 Ga0439442_000906 Ga0439442_000906_330_995 212
335 3300042002 Ga0439442_044108 Ga0439442_044108_34_693 212
336 3300042007 Ga0439449_0000879 Ga0439449_0000879_2544_3209 212
337 3300042007 Ga0439449_0052709 Ga0439449_0052709_47_706 212
338 3300042007 Ga0439449_0074337 Ga0439449_0074337_550_1209 212
339 3300042007 Ga0439449_0108529 Ga0439449_0108529_315_974 212
340 3300042007 Ga0439449_0136439 Ga0439449_0136439_51_716 212
341 3300042010 Ga0439452_002345 Ga0439452_002345_4703_5362 212
342 3300042010 Ga0439452_062261 Ga0439452_062261_139_798 212
343 3300042014 Ga0439457_003049 Ga0439457_003049_1362_2021 212
344 3300042014 Ga0439457_027800 Ga0439457_027800_224_883 212
345 3300042122 Ga0450920_000142 Ga0450920_000142_6931_7590 212
346 3300042122 Ga0450920_001596 Ga0450920_001596_717_1376 212
347 3300042122 Ga0450920_001738 Ga0450920_001738_1788_2447 212
348 3300042125 Ga0450923_040174 Ga0450923_040174_90_749 212
349 3300042146 Ga0450907_000098 Ga0450907_000098_7975_8634 212
350 3300042156 Ga0439446_0000569 Ga0439446_0000569_3546_4205 212
351 3300042156 Ga0439446_0024758 Ga0439446_0024758_486_1145 212
352 3300042184 Ga0450908_015479 Ga0450908_015479_252_911 212
353 3300042184 Ga0450908_025207 Ga0450908_025207_170_829 212
354 3300042185 Ga0450909_002920 Ga0450909_002920_118_777 212
355 3300042435 Ga0439434_0000038 Ga0439434_0000038_48_707 212
356 3300042435 Ga0439434_0002125 Ga0439434_0002125_1656_2315 212
357 3300042435 Ga0439434_0018392 Ga0439434_0018392_816_1481 212
358 3300042531 Ga0450918_003836 Ga0450918_003836_1510_2169 212
359 3300044683 Ga0466965_0013299 Ga0466965_0013299_456_1127 212
360 3300046463 Ga0495653_0077904 Ga0495653_0077904_199_864 212
361 3300046472 Ga0495580_0013953 Ga0495580_0013953_2319_2978 212
362 3300046472 Ga0495580_0107901 Ga0495580_0107901_1101_1766 212
363 3300046473 Ga0495582_0211236 Ga0495582_0211236_246_911 212
364 3300046476 Ga0495662_0003321 Ga0495662_0003321_6027_6692 212
365 3300046477 Ga0495664_0010276 Ga0495664_0010276_3436_4101 212
366 3300046499 Ga0495594_0045205 Ga0495594_0045205_889_1554 212
367 3300046517 Ga0495630_0314574 Ga0495630_0314574_11_676 212
368 3300046518 Ga0495631_0021142 Ga0495631_0021142_537_1202 212
369 3300046531 Ga0495665_0012151 Ga0495665_0012151_1646_2311 212
370 3300046531 Ga0495665_0023162 Ga0495665_0023162_2469_3134 212
371 3300046535 Ga0495586_0016686 Ga0495586_0016686_856_1521 212
372 3300046535 Ga0495586_0112706 Ga0495586_0112706_693_1358 212
373 3300046535 Ga0495586_0336386 Ga0495586_0336386_40_705 212
374 3300046536 Ga0495587_0014418 Ga0495587_0014418_3712_4377 212
375 3300046543 Ga0495645_0032105 Ga0495645_0032105_2724_3389 212
376 3300046543 Ga0495645_0341467 Ga0495645_0341467_109_768 212
377 3300046558 Ga0495633_0029463 Ga0495633_0029463_1934_2599 212
378 3300046559 Ga0495667_0007359 Ga0495667_0007359_5881_6546 212
379 3300046615 Ga0495656_0064014 Ga0495656_0064014_830_1495 212
380 3300046615 Ga0495656_0246951 Ga0495656_0246951_28_693 212
381 3300046616 Ga0495668_0095685 Ga0495668_0095685_16_681 212
382 3300046642 Ga0495634_0137921 Ga0495634_0137921_374_1039 212
383 3300046663 Ga0495635_0247938 Ga0495635_0247938_281_946 212
384 3300046664 Ga0495659_0214278 Ga0495659_0214278_83_748 212
385 3300046674 Ga0495588_0009811 Ga0495588_0009811_1585_2250 212
386 3300046674 Ga0495588_0025286 Ga0495588_0025286_1579_2244 212
387 3300046674 Ga0495588_0297748 Ga0495588_0297748_24_689 212
388 3300046691 Ga0495670_0203279 Ga0495670_0203279_312_977 212
389 3300046809 Ga0495600_0011932 Ga0495600_0011932_1029_1694 212
390 3300046809 Ga0495600_0030987 Ga0495600_0030987_1253_1918 212
391 3300047315 Ga0495581_0027133 Ga0495581_0027133_377_1042 212
392 3300047315 Ga0495581_0054617 Ga0495581_0054617_704_1369 212
393 3300047315 Ga0495581_0060619 Ga0495581_0060619_72_737 212
394 3300047317 Ga0495604_0073108 Ga0495604_0073108_1429_2094 212
395 3300047318 Ga0495636_0009817 Ga0495636_0009817_736_1401 212
396 3300047318 Ga0495636_0115086 Ga0495636_0115086_169_834 212
397 3300047322 Ga0495680_0139327 Ga0495680_0139327_197_862 212
398 3300047322 Ga0495680_0359429 Ga0495680_0359429_300_965 212
399 3300047444 Ga0495675_0086235 Ga0495675_0086235_856_1521 212
400 3300048903 Ga0496100_0544353 Ga0496100_0544353_158_823 212
401 3300048904 Ga0496101_0043466 Ga0496101_0043466_2298_2963 212
402 3300048905 Ga0496102_0043251 Ga0496102_0043251_2993_3658 212
403 3300048905 Ga0496102_0073793 Ga0496102_0073793_1283_1948 212
404 3300048905 Ga0496102_0260036 Ga0496102_0260036_553_1218 212
405 3300048905 Ga0496102_0469559 Ga0496102_0469559_333_992 212
406 3300048906 Ga0496103_0018600 Ga0496103_0018600_3085_3750 212
407 3300048906 Ga0496103_0190776 Ga0496103_0190776_542_1207 212
408 3300048907 Ga0496104_0157072 Ga0496104_0157072_45_710 212
409 3300048909 Ga0496106_0255152 Ga0496106_0255152_575_1240 212
410 3300048910 Ga0496107_0085173 Ga0496107_0085173_1397_2062 212
411 3300048910 Ga0496107_0212125 Ga0496107_0212125_634_1299 212
412 3300048911 Ga0496108_0160659 Ga0496108_0160659_49_714 212
413 3300048912 Ga0496109_0471377 Ga0496109_0471377_73_738 212
414 3300048913 Ga0496110_0546730 Ga0496110_0546730_230_895 212
415 3300048915 Ga0496112_0063416 Ga0496112_0063416_1426_2091 212
416 3300048915 Ga0496112_0098580 Ga0496112_0098580_1918_2577 212
417 3300048915 Ga0496112_0199696 Ga0496112_0199696_660_1325 212
418 3300048916 Ga0496113_0800030 Ga0496113_0800030_23_682 212
419 3300048917 Ga0496114_1001305 Ga0496114_1001305_37_678 212
420 3300048924 Ga0496121_0456356 Ga0496121_0456356_44_709 212
421 3300048925 Ga0496122_0090992 Ga0496122_0090992_109_750 212
422 3300048928 Ga0496125_0012431 Ga0496125_0012431_737_1378 212
423 3300048928 Ga0496125_0024172 Ga0496125_0024172_3826_4467 212
424 3300048928 Ga0496125_0110814 Ga0496125_0110814_1258_1899 212
425 3300048928 Ga0496125_0113495 Ga0496125_0113495_951_1592 212
426 3300048929 Ga0496126_0200863 Ga0496126_0200863_505_1146 212
427 3300048929 Ga0496126_0206864 Ga0496126_0206864_312_953 212
428 3300048929 Ga0496126_0226283 Ga0496126_0226283_36_701 212
429 3300049127 Ga0501306_000430 Ga0501306_000430_36_710 212
430 3300049127 Ga0501306_009070 Ga0501306_009070_162_845 212
431 3300049127 Ga0501306_010470 Ga0501306_010470_69_728 212
432 3300049127 Ga0501306_025177 Ga0501306_025177_152_811 212
433 3300049129 Ga0501309_001111 Ga0501309_001111_1000_1674 212
434 3300049130 Ga0501310_001286 Ga0501310_001286_787_1446 212
435 3300049130 Ga0501310_004884 Ga0501310_004884_252_926 212
436 3300049130 Ga0501310_007673 Ga0501310_007673_275_934 212
437 3300049160 Ga0501304_004820 Ga0501304_004820_187_846 212
438 3300049161 Ga0501305_000363 Ga0501305_000363_311_985 212
439 3300049161 Ga0501305_009514 Ga0501305_009514_586_1245 212
440 3300049162 Ga0501307_002508 Ga0501307_002508_247_906 212
441 3300049527 Ga0501311_006888 Ga0501311_006888_280_939 212
442 3300049528 Ga0501312_014262 Ga0501312_014262_274_933 212
443 3300049529 Ga0501313_004944 Ga0501313_004944_563_1222 212
444 3300049530 Ga0501314_002523 Ga0501314_002523_124_783 212
445 3300049531 Ga0501315_007900 Ga0501315_007900_325_984 212
446 3300049532 Ga0501316_009972 Ga0501316_009972_234_893 212
447 3300049533 Ga0501317_000791 Ga0501317_000791_944_1618 212
448 3300049533 Ga0501317_001278 Ga0501317_001278_694_1353 212
449 3300049533 Ga0501317_008698 Ga0501317_008698_247_906 212
450 3300049533 Ga0501317_009202 Ga0501317_009202_246_905 212
451 3300049534 Ga0501318_000267 Ga0501318_000267_1336_2010 212
452 3300049534 Ga0501318_001622 Ga0501318_001622_325_984 212
453 3300049534 Ga0501318_002590 Ga0501318_002590_247_906 212
454 3300049535 Ga0501319_000468 Ga0501319_000468_569_1228 212
455 3300049535 Ga0501319_003869 Ga0501319_003869_163_822 212
456 3300049537 Ga0501321_000167 Ga0501321_000167_123_782 212
457 3300049537 Ga0501321_000886 Ga0501321_000886_976_1650 212
458 3300049537 Ga0501321_002580 Ga0501321_002580_738_1397 212
459 3300049537 Ga0501321_002598 Ga0501321_002598_164_829 212
460 3300049537 Ga0501321_006279 Ga0501321_006279_247_906 212
461 3300049539 Ga0501323_001848 Ga0501323_001848_827_1492 212
462 3300049539 Ga0501323_005348 Ga0501323_005348_709_1383 212
463 3300049540 Ga0501324_001452 Ga0501324_001452_559_1218 212
464 3300049540 Ga0501324_009112 Ga0501324_009112_215_874 212
465 3300049541 Ga0501325_003612 Ga0501325_003612_234_893 212
466 3300049541 Ga0501325_005115 Ga0501325_005115_247_906 212
467 3300049569 Ga0501032_0001701 Ga0501032_0001701_6251_6910 212
468 3300049569 Ga0501032_0013055 Ga0501032_0013055_454_1113 212
469 3300049571 Ga0501034_0000231 Ga0501034_0000231_34003_34662 212
470 3300049571 Ga0501034_0007983 Ga0501034_0007983_1852_2493 212
471 3300049571 Ga0501034_0019587 Ga0501034_0019587_1925_2602 212
472 3300049572 Ga0501036_0092580 Ga0501036_0092580_607_1266 212
473 3300049573 Ga0501037_0002217 Ga0501037_0002217_3107_3766 212
474 3300049573 Ga0501037_0008820 Ga0501037_0008820_5496_6155 212
475 3300049574 Ga0501038_0014926 Ga0501038_0014926_69_710 212
476 3300049574 Ga0501038_0046047 Ga0501038_0046047_2686_3345 212
477 3300049574 Ga0501038_0053268 Ga0501038_0053268_800_1465 212
478 3300049574 Ga0501038_0054563 Ga0501038_0054563_448_1089 212
479 3300049575 Ga0501039_0016716 Ga0501039_0016716_3747_4406 212
480 3300049576 Ga0501040_0560676 Ga0501040_0560676_16_675 212
481 3300049581 Ga0501047_0100219 Ga0501047_0100219_1431_2099 212
482 3300049653 Ga0501206_021971 Ga0501206_021971_34_708 212
483 3300049823 Ga0501044_0289062 Ga0501044_0289062_885_1544 212
484 3300049851 Ga0501212_033242 Ga0501212_033242_123_782 212
485 3300050491 nmdc:mga00v17_102753_c1 nmdc:mga00v17_102753_c1_96_737 212
486 3300050491 nmdc:mga00v17_328340_c1 nmdc:mga00v17_328340_c1_96_737 212
487 3300050496 nmdc:mga07m45_420899_c1 nmdc:mga07m45_420899_c1_49_708 212
488 3300050516 nmdc:mga0sz30_37922_c1 nmdc:mga0sz30_37922_c1_1136_1777 212
489 3300059503 Ga0587080_024822 Ga0587080_024822_225_890 212
490 3300059510 Ga0587090_000258 Ga0587090_000258_705_1370 212
491 3300059643 Ga0587072_000361 Ga0587072_000361_3521_4186 212
492 3300059660 Ga0587124_009055 Ga0587124_009055_186_851 212
493 iso_pu_bacteria 2643221567 2643853458 212
494 iso_pu_bacteria 2643221624 2644137418 212
495 iso_pu_bacteria 2852643534 2852645806 212
496 iso_pu_bacteria 2857733635 2857733733 212
497 iso_pu_bacteria 2887443736 2887443841 212
498 iso_pu_bacteria 2906799679 2906800621 212
499 iso_pu_bacteria 2919446982 2919447228 212
500 3300005336 Ga0070680_100144028 Ga0070680_1001440283 213
501 3300005339 Ga0070660_100114343 Ga0070660_1001143432 213
502 3300005456 Ga0070678_100167797 Ga0070678_1001677972 213
503 3300005535 Ga0070684_100819153 Ga0070684_1008191531 213
504 3300005577 Ga0068857_100392985 Ga0068857_1003929852 213
505 3300006237 Ga0097621_101043841 Ga0097621_1010438411 213
506 3300009011 Ga0105251_10216341 Ga0105251_102163411 213
507 3300009551 Ga0105238_10841990 Ga0105238_108419901 213
508 3300011119 Ga0105246_10328984 Ga0105246_103289841 213
509 3300013104 Ga0157370_10446681 Ga0157370_104466812 213
510 3300013105 Ga0157369_10030211 Ga0157369_100302117 213
511 3300013307 Ga0157372_10181282 Ga0157372_101812822 213
512 3300014326 Ga0157380_10332630 Ga0157380_103326301 213
513 3300014326 Ga0157380_10981385 Ga0157380_109813852 213
514 3300025912 Ga0207707_10429912 Ga0207707_104299122 213
515 3300025917 Ga0207660_10343982 Ga0207660_103439821 213
516 3300025944 Ga0207661_10215847 Ga0207661_102158471 213
517 3300031852 Ga0307410_10016877 Ga0307410_100168773 213
518 3300032002 Ga0307416_100139581 Ga0307416_1001395811 213
519 3300044765 Ga0466970_0170906 Ga0466970_0170906_475_1122 213
520 3300046457 Ga0495590_0000097 Ga0495590_0000097_25962_26621 213
521 3300047317 Ga0495604_0383114 Ga0495604_0383114_108_758 213
522 3300048088 Ga0495602_0119797 Ga0495602_0119797_650_1300 213
523 3300048904 Ga0496101_0159712 Ga0496101_0159712_781_1428 213
524 3300048909 Ga0496106_0377225 Ga0496106_0377225_153_833 213
525 3300048911 Ga0496108_0074897 Ga0496108_0074897_819_1469 213
526 3300048912 Ga0496109_0055975 Ga0496109_0055975_719_1369 213
527 3300048913 Ga0496110_0257181 Ga0496110_0257181_670_1320 213
528 3300048914 Ga0496111_0088231 Ga0496111_0088231_795_1451 213
529 3300048920 Ga0496117_0014912 Ga0496117_0014912_5187_5834 213
530 3300048921 Ga0496118_0016847 Ga0496118_0016847_835_1482 213
531 3300048922 Ga0496119_0069993 Ga0496119_0069993_615_1262 213
532 3300048923 Ga0496120_0051724 Ga0496120_0051724_159_806 213
533 3300048925 Ga0496122_0162505 Ga0496122_0162505_40_687 213
534 3300048926 Ga0496123_0030194 Ga0496123_0030194_2608_3255 213
535 3300048927 Ga0496124_0000256 Ga0496124_0000256_100887_101534 213
536 3300049531 Ga0501315_034431 Ga0501315_034431_26_688 213
537 3300049537 Ga0501321_010988 Ga0501321_010988_188_871 213
538 3300049822 Ga0501035_0188181 Ga0501035_0188181_842_1525 213
539 3300049823 Ga0501044_0196966 Ga0501044_0196966_560_1210 213
540 iso_pu_bacteria 2751185788 2753301307 213
541 iso_pu_bacteria 2757320536 2758226039 213
542 iso_pu_bacteria 2773857758 2774380274 213
543 iso_pu_bacteria 2784132109 2784471798 213
544 iso_pu_bacteria 2848551377 2848551785 213
545 iso_pu_bacteria 2904430863 2904433469 213
546 iso_pu_bacteria 2904501621 2904503665 213
547 iso_pu_bacteria 2904509784 2904511894 213
548 iso_pu_bacteria 2908674828 2908675305 213
549 iso_pu_bacteria 2908678064 2908680816 213
550 iso_pu_bacteria 2909074476 2909075372 213
551 iso_pu_bacteria 2919039151 2919039989 213
552 iso_pu_bacteria 2919042368 2919044935 213
553 iso_pu_bacteria 2919069694 2919071635 213
554 iso_pu_bacteria 2928104781 2928106779 213
555 iso_pu_bacteria 2928500415 2928501330 213
556 iso_pu_bacteria 2974294766 2974297269 213
557 iso_pu_bacteria 2974324384 2974326496 213
558 iso_pu_bacteria 2977236895 2977240296 213
559 iso_pu_bacteria 2977264416 2977266733 213
560 iso_pu_bacteria 2984542743 2984545425 213
561 iso_pu_bacteria 2984551494 2984553494 213
562 iso_pu_bacteria 8016254467 8016257449 213
563 3300001989 JGI24739J22299_10114563 JGI24739J22299_101145631 214
564 3300003578 Ga0006562J51391_1016339 Ga0006562J51391_10163392 214
565 3300005364 Ga0070673_100631903 Ga0070673_1006319032 214
566 3300005441 Ga0070700_100459107 Ga0070700_1004591071 214
567 3300005455 Ga0070663_100715651 Ga0070663_1007156511 214
568 3300005548 Ga0070665_101071564 Ga0070665_1010715641 214
569 3300005614 Ga0068856_100831618 Ga0068856_1008316182 214
570 3300005616 Ga0068852_100615067 Ga0068852_1006150672 214
571 3300005840 Ga0068870_10238337 Ga0068870_102383372 214
572 3300009098 Ga0105245_10055442 Ga0105245_100554422 214
573 3300009148 Ga0105243_10376242 Ga0105243_103762422 214
574 3300009174 Ga0105241_10530083 Ga0105241_105300831 214
575 3300009551 Ga0105238_10345780 Ga0105238_103457802 214
576 3300010375 Ga0105239_10671037 Ga0105239_106710372 214
577 3300011119 Ga0105246_10123820 Ga0105246_101238203 214
578 3300013102 Ga0157371_10041953 Ga0157371_100419532 214
579 3300013105 Ga0157369_10777861 Ga0157369_107778611 214
580 3300013296 Ga0157374_10505194 Ga0157374_105051942 214
581 3300013306 Ga0163162_10149421 Ga0163162_101494212 214
582 3300013307 Ga0157372_10265624 Ga0157372_102656242 214
583 3300013307 Ga0157372_10857396 Ga0157372_108573962 214
584 3300014326 Ga0157380_10127393 Ga0157380_101273932 214
585 3300014745 Ga0157377_10104966 Ga0157377_101049662 214
586 3300020080 Ga0206350_11386828 Ga0206350_113868281 214
587 3300025924 Ga0207694_10129609 Ga0207694_101296092 214
588 3300025932 Ga0207690_10401060 Ga0207690_104010602 214
589 3300025940 Ga0207691_10113899 Ga0207691_101138992 214
590 3300026075 Ga0207708_10187315 Ga0207708_101873152 214
591 3300026089 Ga0207648_10063684 Ga0207648_100636842 214
592 3300026121 Ga0207683_10066226 Ga0207683_100662263 214
593 3300026142 Ga0207698_10424256 Ga0207698_104242561 214
594 3300028379 Ga0268266_10410655 Ga0268266_104106551 214
595 3300031824 Ga0307413_10229057 Ga0307413_102290572 214
596 3300031852 Ga0307410_10000904 Ga0307410_100009046 214
597 3300031852 Ga0307410_10478335 Ga0307410_104783352 214
598 3300031903 Ga0307407_10035928 Ga0307407_100359282 214
599 3300031911 Ga0307412_10171715 Ga0307412_101717152 214
600 3300031995 Ga0307409_100011105 Ga0307409_1000111054 214
601 3300035398 Ga0316574_0472121 Ga0316574_0472121_45_707 214
602 3300037418 Ga0395900_0078247 Ga0395900_0078247_45_716 214
603 3300037418 Ga0395900_0299983 Ga0395900_0299983_122_781 214
604 3300037466 Ga0395898_0032213 Ga0395898_0032213_1582_2241 214
605 3300037466 Ga0395898_0330504 Ga0395898_0330504_254_925 214
606 3300038443 Ga0395901_0010676 Ga0395901_0010676_3173_3832 214
607 3300038443 Ga0395901_0038572 Ga0395901_0038572_4218_4907 214
608 3300038443 Ga0395901_0048393 Ga0395901_0048393_3144_3806 214
609 3300038443 Ga0395901_0111900 Ga0395901_0111900_324_995 214
610 3300041459 Ga0451800_1578277 Ga0451800_1578277_128_784 214
611 3300044765 Ga0466970_0000064 Ga0466970_0000064_32647_33297 214
612 3300046459 Ga0495629_0150900 Ga0495629_0150900_44_715 214
613 3300046459 Ga0495629_0312903 Ga0495629_0312903_268_921 214
614 3300046463 Ga0495653_0081953 Ga0495653_0081953_342_1013 214
615 3300046473 Ga0495582_0089775 Ga0495582_0089775_863_1537 214
616 3300046473 Ga0495582_0154450 Ga0495582_0154450_13_684 214
617 3300046533 Ga0495640_0171032 Ga0495640_0171032_77_730 214
618 3300046683 Ga0495658_0246767 Ga0495658_0246767_358_1032 214
619 3300046690 Ga0495624_0468858 Ga0495624_0468858_34_705 214
620 3300047315 Ga0495581_0057699 Ga0495581_0057699_30_683 214
621 3300047319 Ga0495674_0302654 Ga0495674_0302654_50_721 214
622 3300047322 Ga0495680_0404874 Ga0495680_0404874_68_721 214
623 3300047471 Ga0495684_0160396 Ga0495684_0160396_177_830 214
624 3300048903 Ga0496100_0009167 Ga0496100_0009167_2021_2674 214
625 3300048904 Ga0496101_0033137 Ga0496101_0033137_1679_2353 214
626 3300048905 Ga0496102_0002600 Ga0496102_0002600_4393_5067 214
627 3300048905 Ga0496102_0059503 Ga0496102_0059503_2177_2830 214
628 3300048905 Ga0496102_0062548 Ga0496102_0062548_1261_1935 214
629 3300048906 Ga0496103_0050247 Ga0496103_0050247_1604_2257 214
630 3300048907 Ga0496104_0225201 Ga0496104_0225201_935_1606 214
631 3300048909 Ga0496106_0044487 Ga0496106_0044487_2226_2879 214
632 3300048910 Ga0496107_0089273 Ga0496107_0089273_106_759 214
633 3300048911 Ga0496108_0246403 Ga0496108_0246403_707_1378 214
634 3300048913 Ga0496110_0070348 Ga0496110_0070348_1743_2396 214
635 3300048913 Ga0496110_0305164 Ga0496110_0305164_325_978 214
636 3300048915 Ga0496112_0513445 Ga0496112_0513445_463_1116 214
637 3300048917 Ga0496114_0387163 Ga0496114_0387163_494_1147 214
638 3300048918 Ga0496115_0575736 Ga0496115_0575736_150_803 214
639 3300048920 Ga0496117_0014231 Ga0496117_0014231_3399_4049 214
640 3300048921 Ga0496118_0022850 Ga0496118_0022850_3431_4081 214
641 3300048922 Ga0496119_0000772 Ga0496119_0000772_33169_33819 214
642 3300048923 Ga0496120_0000875 Ga0496120_0000875_178_828 214
643 3300048929 Ga0496126_0011797 Ga0496126_0011797_7579_8295 214
644 3300049162 Ga0501307_007168 Ga0501307_007168_44_697 214
645 3300049531 Ga0501315_005366 Ga0501315_005366_12_665 214
646 3300049537 Ga0501321_022175 Ga0501321_022175_125_778 214
647 3300049568 Ga0501031_0001578 Ga0501031_0001578_8061_8741 214
648 3300049570 Ga0501033_0141404 Ga0501033_0141404_1017_1697 214
649 3300049571 Ga0501034_0265125 Ga0501034_0265125_305_1021 214
650 3300049572 Ga0501036_0036436 Ga0501036_0036436_123_803 214
651 3300049572 Ga0501036_0312068 Ga0501036_0312068_293_949 214
652 3300049574 Ga0501038_0276632 Ga0501038_0276632_552_1232 214
653 3300049575 Ga0501039_0097656 Ga0501039_0097656_890_1546 214
654 3300049576 Ga0501040_0000683 Ga0501040_0000683_3417_4097 214
655 3300049577 Ga0501041_0037023 Ga0501041_0037023_1006_1686 214
656 3300049578 Ga0501042_0232618 Ga0501042_0232618_597_1277 214
657 3300049580 Ga0501046_0256754 Ga0501046_0256754_53_733 214
658 3300049582 Ga0501048_0003317 Ga0501048_0003317_2482_3162 214
659 3300049587 Ga0501071_0002381 Ga0501071_0002381_9093_9773 214
660 3300049588 Ga0501072_0003741 Ga0501072_0003741_7385_8065 214
661 3300049591 Ga0501075_0002860 Ga0501075_0002860_7426_8106 214
662 3300049592 Ga0501076_0012191 Ga0501076_0012191_4655_5335 214
663 3300049741 Ga0501079_0002499 Ga0501079_0002499_11857_12537 214
664 3300049742 Ga0501080_0056001 Ga0501080_0056001_2522_3202 214
665 3300049824 Ga0501045_0001668 Ga0501045_0001668_2667_3347 214
666 3300053085 Ga0495619_0631178 Ga0495619_0631178_20_673 214
667 3300060353 Ga0501082_0020703 Ga0501082_0020703_1413_2093 214
668 3300061734 Ga0530510_0004600 Ga0530510_0004600_8804_9484 214
669 iso_pu_bacteria 2643221546 2643753444 214
670 iso_pu_bacteria 2844852863 2844854833 214
671 iso_pu_bacteria 2870622029 2870623952 214
672 iso_pu_bacteria 2939657138 2939658413 214
673 iso_pu_bacteria 2966924647 2966927163 214
674 iso_pu_bacteria 3001889506 3001891866 214
675 iso_pu_bacteria 8056037122 8056038897 214
676 iso_pu_bacteria 8057345674 8057347925 214
677 3300005456 Ga0070678_100051769 Ga0070678_1000517692 215
678 3300005985 Ga0081539_10013397 Ga0081539_100133972 215
679 3300005985 Ga0081539_10026528 Ga0081539_100265285 215
680 3300026121 Ga0207683_10021001 Ga0207683_100210015 215
681 3300028794 Ga0307515_10163458 Ga0307515_101634582 215
682 3300031901 Ga0307406_10137933 Ga0307406_101379332 215
683 3300031903 Ga0307407_10262570 Ga0307407_102625702 215
684 3300031995 Ga0307409_100113904 Ga0307409_1001139042 215
685 3300031995 Ga0307409_100812253 Ga0307409_1008122532 215
686 3300032002 Ga0307416_100116719 Ga0307416_1001167193 215
687 3300032126 Ga0307415_100428403 Ga0307415_1004284032 215
688 3300032126 Ga0307415_100497132 Ga0307415_1004971322 215
689 3300037312 Ga0395899_0128254 Ga0395899_0128254_203_886 215
690 3300037418 Ga0395900_0000887 Ga0395900_0000887_22552_23235 215
691 3300037466 Ga0395898_0000622 Ga0395898_0000622_32087_32770 215
692 3300044658 Ga0466972_0015798 Ga0466972_0015798_204_887 215
693 3300044683 Ga0466965_0014135 Ga0466965_0014135_2026_2709 215
694 3300044683 Ga0466965_0107781 Ga0466965_0107781_27_704 215
695 3300044706 Ga0466964_0060228 Ga0466964_0060228_77_760 215
696 3300044719 Ga0466971_0025113 Ga0466971_0025113_1519_2202 215
697 3300044765 Ga0466970_0039308 Ga0466970_0039308_1039_1716 215
698 3300044842 Ga0466957_0160124 Ga0466957_0160124_406_1089 215
699 3300044901 Ga0466960_0022025 Ga0466960_0022025_494_1177 215
700 3300044901 Ga0466960_0046747 Ga0466960_0046747_201_872 215
701 3300045049 Ga0466959_0026316 Ga0466959_0026316_541_1224 215
702 3300045836 Ga0466958_0020668 Ga0466958_0020668_1225_1908 215
703 3300048925 Ga0496122_0007772 Ga0496122_0007772_2199_2858 215
704 3300048926 Ga0496123_0005067 Ga0496123_0005067_10978_11637 215
705 3300053085 Ga0495619_0130822 Ga0495619_0130822_1025_1693 215
706 3300059508 Ga0587088_008720 Ga0587088_008720_526_1200 215
707 3300061719 Ga0466962_0066760 Ga0466962_0066760_446_1129 215
708 iso_pu_bacteria 2585428157 2588109033 215
709 iso_pu_bacteria 2643221566 2643848139 215
710 iso_pu_bacteria 2643221575 2643885318 215
711 iso_pu_bacteria 2773857759 2774384607 215
712 iso_pu_bacteria 2808606368 2808885722 215
713 iso_pu_bacteria 2821268502 2821270098 215
714 iso_pu_bacteria 2857720070 2857720214 215
715 iso_pu_bacteria 2857729791 2857730064 215
716 iso_pu_bacteria 2857737099 2857738485 215
717 iso_pu_bacteria 2862993130 2862995731 215
718 iso_pu_bacteria 2928090899 2928091948 215
719 iso_pu_bacteria 2928121344 2928123289 215
720 iso_pu_bacteria 2977251589 2977253798 215
721 iso_pu_bacteria 2984580707 2984581285 215
722 iso_pu_bacteria 8004212874 8004214026 215
723 3300005327 Ga0070658_10000249 Ga0070658_1000024935 216
724 3300005366 Ga0070659_100062233 Ga0070659_1000622332 216
725 3300005563 Ga0068855_100006335 Ga0068855_1000063352 216
726 3300005577 Ga0068857_100027117 Ga0068857_1000271175 216
727 3300005614 Ga0068856_100269789 Ga0068856_1002697892 216
728 3300005616 Ga0068852_100012619 Ga0068852_1000126194 216
729 3300005616 Ga0068852_100317723 Ga0068852_1003177232 216
730 3300005834 Ga0068851_10000014 Ga0068851_100000145 216
731 3300013102 Ga0157371_10141371 Ga0157371_101413712 216
732 3300013104 Ga0157370_10087879 Ga0157370_100878794 216
733 3300013306 Ga0163162_10686217 Ga0163162_106862171 216
734 3300013307 Ga0157372_10038848 Ga0157372_100388488 216
735 3300025321 Ga0207656_10000002 Ga0207656_10000002271 216
736 3300025909 Ga0207705_10000006 Ga0207705_1000000680 216
737 3300025909 Ga0207705_10078113 Ga0207705_100781134 216
738 3300025914 Ga0207671_10000002 Ga0207671_10000002565 216
739 3300025932 Ga0207690_10044222 Ga0207690_100442223 216
740 3300025949 Ga0207667_10002778 Ga0207667_1000277815 216
741 3300025949 Ga0207667_10025868 Ga0207667_100258685 216
742 3300026041 Ga0207639_10120853 Ga0207639_101208532 216
743 3300026142 Ga0207698_10009092 Ga0207698_100090925 216
744 3300026142 Ga0207698_10059135 Ga0207698_100591355 216
745 3300038735 Ga0400485_11442 Ga0400485_11442_15600_16280 216
746 3300038741 Ga0400488_41679 Ga0400488_41679_414_1094 216
747 3300038742 Ga0400486_30354 Ga0400486_30354_4356_5036 216
748 3300042533 Ga0450901_014369 Ga0450901_014369_66_782 216
749 3300044683 Ga0466965_0016847 Ga0466965_0016847_2709_3419 216
750 3300049823 Ga0501044_0008707 Ga0501044_0008707_3593_4291 216
751 3300053087 Ga0500643_000174 Ga0500643_000174_26602_27261 216
752 3300053104 Ga0500556_0000001 Ga0500556_0000001_574518_575177 216
753 3300053139 Ga0500568_0000006 Ga0500568_0000006_119446_120105 216
754 iso_pu_bacteria 2643221613 2644081886 216
755 iso_pu_bacteria 2643221632 2644183171 216
756 iso_pu_bacteria 2643221690 2644506678 216
757 iso_pu_bacteria 2643221694 2644526416 216
758 iso_pu_bacteria 2643221721 2644665070 216
759 iso_pu_bacteria 2643221722 2644671082 216
760 iso_pu_bacteria 2738541272 2738692606 216
761 iso_pu_bacteria 2738543027 2739323683 216
762 iso_pu_bacteria 2739367654 2739608848 216
763 iso_pu_bacteria 2758568522 2760303690 216
764 iso_pu_bacteria 2758568621 2760622456 216
765 iso_pu_bacteria 2808606394 2809027190 216
766 iso_pu_bacteria 2811994872 2812323293 216
767 iso_pu_bacteria 2835188231 2835191116 216
768 iso_pu_bacteria 2839986021 2839986619 216
769 iso_pu_bacteria 2870628048 2870630446 216
770 iso_pu_bacteria 2884994152 2884994953 216
771 iso_pu_bacteria 2932431166 2932434247 216
772 iso_pu_bacteria 2935890801 2935891239 216
773 iso_pu_bacteria 2995726249 2995728052 216
774 iso_pu_bacteria 8055037949 8055038522 216
775 iso_pu_bacteria 8056579771 8056583940 216
776 3300003203 JGI25406J46586_10024934 JGI25406J46586_100249342 217
777 3300005344 Ga0070661_100345153 Ga0070661_1003451532 217
778 3300005535 Ga0070684_100305649 Ga0070684_1003056492 217
779 3300005985 Ga0081539_10001179 Ga0081539_1000117940 217
780 3300006038 Ga0075365_10058685 Ga0075365_100586853 217
781 3300006186 Ga0075369_10090625 Ga0075369_100906252 217
782 3300020081 Ga0206354_11106463 Ga0206354_111064631 217
783 3300022467 Ga0224712_10187713 Ga0224712_101877132 217
784 3300025728 Ga0207655_1118481 Ga0207655_11184811 217
785 3300026121 Ga0207683_10120427 Ga0207683_101204272 217
786 3300037418 Ga0395900_0289747 Ga0395900_0289747_69_803 217
787 3300038443 Ga0395901_0201636 Ga0395901_0201636_617_1351 217
788 3300044684 Ga0466966_0095564 Ga0466966_0095564_27_695 217
789 3300044765 Ga0466970_0081599 Ga0466970_0081599_211_879 217
790 3300047472 Ga0495686_0120550 Ga0495686_0120550_216_887 217
791 3300048904 Ga0496101_0326683 Ga0496101_0326683_463_1128 217
792 3300048908 Ga0496105_0171630 Ga0496105_0171630_740_1402 217
793 3300048912 Ga0496109_0014519 Ga0496109_0014519_6161_6826 217
794 3300048920 Ga0496117_0000053 Ga0496117_0000053_184213_184875 217
795 3300048922 Ga0496119_0002404 Ga0496119_0002404_18672_19334 217
796 3300048922 Ga0496119_0010769 Ga0496119_0010769_2916_3578 217
797 3300048923 Ga0496120_0003532 Ga0496120_0003532_4441_5103 217
798 3300048923 Ga0496120_0026228 Ga0496120_0026228_1693_2355 217
799 3300048925 Ga0496122_0003193 Ga0496122_0003193_18778_19440 217
800 3300048926 Ga0496123_0012608 Ga0496123_0012608_4089_4751 217
801 3300048927 Ga0496124_0024369 Ga0496124_0024369_1800_2462 217
802 3300048928 Ga0496125_0004557 Ga0496125_0004557_4415_5077 217
803 3300048929 Ga0496126_0035572 Ga0496126_0035572_974_1636 217
804 3300049583 Ga0501067_0081677 Ga0501067_0081677_592_1281 217
805 3300049589 Ga0501073_0000089 Ga0501073_0000089_7869_8531 217
806 3300050492 nmdc:mga0yw44_46291_c1 nmdc:mga0yw44_46291_c1_1143_1805 217
807 3300053104 Ga0500556_0000095 Ga0500556_0000095_15621_16283 217
808 3300053117 Ga0500593_001763 Ga0500593_001763_5051_5713 217
809 3300053136 Ga0500559_0000942 Ga0500559_0000942_6334_6996 217
810 iso_pu_bacteria 2643221597 2643995645 217
811 iso_pu_bacteria 2808606306 2808631104 217
812 3300003285 Ga0007423J48922_100143 Ga0007423J48922_1001432 218
813 3300005437 Ga0070710_10149582 Ga0070710_101495822 218
814 3300005985 Ga0081539_10149056 Ga0081539_101490562 218
815 3300009036 Ga0105244_10074082 Ga0105244_100740822 218
816 3300013104 Ga0157370_10150804 Ga0157370_101508043 218
817 3300013105 Ga0157369_10000618 Ga0157369_100006186 218
818 3300013105 Ga0157369_10163339 Ga0157369_101633392 218
819 3300013308 Ga0157375_10231427 Ga0157375_102314273 218
820 3300014326 Ga0157380_10266014 Ga0157380_102660142 218
821 3300020069 Ga0197907_10128035 Ga0197907_101280352 218
822 3300025909 Ga0207705_10045604 Ga0207705_100456043 218
823 3300025918 Ga0207662_10171044 Ga0207662_101710442 218
824 3300030736 Ga0316180_1163515 Ga0316180_11635151 218
825 3300031649 Ga0307514_10003548 Ga0307514_100035486 218
826 3300032002 Ga0307416_100917674 Ga0307416_1009176741 218
827 3300037312 Ga0395899_0005440 Ga0395899_0005440_2496_3152 218
828 3300041486 Ga0451807_0001797 Ga0451807_0001797_1062_1763 218
829 3300044765 Ga0466970_0018676 Ga0466970_0018676_2309_2965 218
830 3300044842 Ga0466957_0034986 Ga0466957_0034986_1726_2382 218
831 3300045049 Ga0466959_0013330 Ga0466959_0013330_3812_4468 218
832 3300048904 Ga0496101_0034464 Ga0496101_0034464_1361_2032 218
833 3300048905 Ga0496102_0341002 Ga0496102_0341002_252_923 218
834 3300048906 Ga0496103_0058555 Ga0496103_0058555_338_1009 218
835 3300048912 Ga0496109_0844811 Ga0496109_0844811_21_719 218
836 3300048913 Ga0496110_0550298 Ga0496110_0550298_246_917 218
837 3300048913 Ga0496110_0871358 Ga0496110_0871358_60_758 218
838 3300048914 Ga0496111_0068418 Ga0496111_0068418_1865_2560 218
839 3300048917 Ga0496114_0066128 Ga0496114_0066128_1009_1680 218
840 3300048917 Ga0496114_0220628 Ga0496114_0220628_771_1436 218
841 3300048918 Ga0496115_0033812 Ga0496115_0033812_1220_1891 218
842 3300048920 Ga0496117_0000346 Ga0496117_0000346_33929_34594 218
843 3300048921 Ga0496118_0089381 Ga0496118_0089381_657_1346 218
844 3300048921 Ga0496118_0190081 Ga0496118_0190081_262_933 218
845 3300048922 Ga0496119_0002845 Ga0496119_0002845_14622_15293 218
846 3300048922 Ga0496119_0026366 Ga0496119_0026366_3318_4007 218
847 3300048923 Ga0496120_0017718 Ga0496120_0017718_2621_3292 218
848 3300048924 Ga0496121_0000528 Ga0496121_0000528_34815_35486 218
849 3300048924 Ga0496121_0134184 Ga0496121_0134184_912_1583 218
850 3300048925 Ga0496122_0001714 Ga0496122_0001714_23480_24169 218
851 3300048925 Ga0496122_0004828 Ga0496122_0004828_74_775 218
852 3300048925 Ga0496122_0004987 Ga0496122_0004987_8858_9523 218
853 3300048926 Ga0496123_0000800 Ga0496123_0000800_34545_35246 218
854 3300048926 Ga0496123_0172177 Ga0496123_0172177_29_694 218
855 3300048927 Ga0496124_0001400 Ga0496124_0001400_819_1520 218
856 3300048927 Ga0496124_0034703 Ga0496124_0034703_2884_3579 218
857 3300048928 Ga0496125_0000079 Ga0496125_0000079_117253_117945 218
858 3300048928 Ga0496125_0000350 Ga0496125_0000350_31266_31976 218
859 3300048929 Ga0496126_0064516 Ga0496126_0064516_972_1643 218
860 3300049527 Ga0501311_017982 Ga0501311_017982_109_768 218
861 3300049574 Ga0501038_0002939 Ga0501038_0002939_6504_7193 218
862 3300049579 Ga0501043_0148585 Ga0501043_0148585_473_1144 218
863 3300049580 Ga0501046_0002882 Ga0501046_0002882_4342_5031 218
864 3300049581 Ga0501047_0005206 Ga0501047_0005206_9285_9974 218
865 3300049583 Ga0501067_0040560 Ga0501067_0040560_1031_1720 218
866 3300049586 Ga0501070_0064274 Ga0501070_0064274_2121_2792 218
867 3300049587 Ga0501071_0015332 Ga0501071_0015332_308_979 218
868 3300049589 Ga0501073_0423795 Ga0501073_0423795_92_781 218
869 3300049590 Ga0501074_0441908 Ga0501074_0441908_171_842 218
870 3300049744 Ga0501083_0016955 Ga0501083_0016955_4041_4730 218
871 3300049822 Ga0501035_0020790 Ga0501035_0020790_17_706 218
872 3300049823 Ga0501044_0009255 Ga0501044_0009255_5291_5980 218
873 3300053098 Ga0500650_0010883 Ga0500650_0010883_16_675 218
874 3300053136 Ga0500559_0001957 Ga0500559_0001957_7788_8453 218
875 3300053136 Ga0500559_0028882 Ga0500559_0028882_1324_2010 218
876 3300053139 Ga0500568_0032923 Ga0500568_0032923_563_1282 218
877 3300053140 Ga0500573_0000023 Ga0500573_0000023_40108_40773 218
878 3300053140 Ga0500573_0003592 Ga0500573_0003592_6744_7412 218
879 3300053140 Ga0500573_0008240 Ga0500573_0008240_3510_4169 218
880 3300053140 Ga0500573_0084164 Ga0500573_0084164_227_886 218
881 3300053140 Ga0500573_0336752 Ga0500573_0336752_56_721 218
882 3300053142 Ga0500577_0082532 Ga0500577_0082532_44_703 218
883 3300053153 Ga0500616_0000078 Ga0500616_0000078_89385_90050 218
884 3300060353 Ga0501082_0504886 Ga0501082_0504886_337_1008 218
885 iso_pu_bacteria 2585428094 2587863400 218
886 iso_pu_bacteria 2643221549 2643767885 218
887 iso_pu_bacteria 2643221572 2643875024 218
888 iso_pu_bacteria 2643221616 2644095861 218
889 iso_pu_bacteria 2643221619 2644111275 218
890 iso_pu_bacteria 2643221669 2644382080 218
891 iso_pu_bacteria 2721755702 2723641921 218
892 iso_pu_bacteria 2773857763 2774399397 218
893 iso_pu_bacteria 2808606372 2808901877 218
894 iso_pu_bacteria 2808606447 2809227518 218
895 iso_pu_bacteria 2833709550 2833711054 218
896 iso_pu_bacteria 2844841374 2844842229 218
897 iso_pu_bacteria 2852632344 2852634279 218
898 iso_pu_bacteria 2884763398 2884765223 218
899 iso_pu_bacteria 2895660088 2895661150 218
900 iso_pu_bacteria 2919055335 2919057876 218
901 iso_pu_bacteria 2919443155 2919446327 218
902 iso_pu_bacteria 2919523602 2919524272 218
903 iso_pu_bacteria 2928153084 2928156115 218
904 iso_pu_bacteria 2935409751 2935411262 218
905 iso_pu_bacteria 2939660829 2939664031 218
906 iso_pu_bacteria 8045830549 8045831680 218
907 iso_pu_bacteria 8046352972 8046353046 218
908 3300003578 Ga0006562J51391_1037714 Ga0006562J51391_10377146 219
909 3300005288 Ga0065714_10006408 Ga0065714_100064083 219
910 3300005356 Ga0070674_100115343 Ga0070674_1001153431 219
911 3300005366 Ga0070659_100093597 Ga0070659_1000935972 219
912 3300005455 Ga0070663_100586512 Ga0070663_1005865122 219
913 3300005456 Ga0070678_100820619 Ga0070678_1008206191 219
914 3300005530 Ga0070679_100279323 Ga0070679_1002793232 219
915 3300006038 Ga0075365_10004127 Ga0075365_100041276 219
916 3300006038 Ga0075365_10015407 Ga0075365_100154073 219
917 3300006042 Ga0075368_10031679 Ga0075368_100316792 219
918 3300006051 Ga0075364_10007016 Ga0075364_100070169 219
919 3300006051 Ga0075364_10092681 Ga0075364_100926813 219
920 3300006178 Ga0075367_10027967 Ga0075367_100279673 219
921 3300006186 Ga0075369_10032165 Ga0075369_100321652 219
922 3300009553 Ga0105249_10341249 Ga0105249_103412492 219
923 3300013306 Ga0163162_10053915 Ga0163162_100539152 219
924 3300014325 Ga0163163_10386062 Ga0163163_103860622 219
925 3300014326 Ga0157380_10320617 Ga0157380_103206172 219
926 3300020078 Ga0206352_10956613 Ga0206352_109566132 219
927 3300025728 Ga0207655_1009263 Ga0207655_10092634 219
928 3300025904 Ga0207647_10100842 Ga0207647_101008423 219
929 3300025931 Ga0207644_10047230 Ga0207644_100472303 219
930 3300025932 Ga0207690_10065410 Ga0207690_100654102 219
931 3300026041 Ga0207639_10393337 Ga0207639_103933372 219
932 3300026067 Ga0207678_10980855 Ga0207678_109808551 219
933 3300027866 Ga0209813_10091241 Ga0209813_100912412 219
934 3300031901 Ga0307406_10000344 Ga0307406_1000034426 219
935 3300037418 Ga0395900_0656864 Ga0395900_0656864_20_700 219
936 3300038443 Ga0395901_0044761 Ga0395901_0044761_1781_2461 219
937 3300041460 Ga0451802_0163578 Ga0451802_0163578_60_731 219
938 3300041507 Ga0451851_0285165 Ga0451851_0285165_84_755 219
939 3300046460 Ga0495638_0132749 Ga0495638_0132749_657_1349 219
940 3300046518 Ga0495631_0144609 Ga0495631_0144609_336_1007 219
941 3300046530 Ga0495654_0070481 Ga0495654_0070481_649_1341 219
942 3300046543 Ga0495645_0040567 Ga0495645_0040567_2328_3008 219
943 3300047320 Ga0495672_0035054 Ga0495672_0035054_2050_2727 219
944 3300047472 Ga0495686_0048817 Ga0495686_0048817_1339_2031 219
945 3300048903 Ga0496100_0037873 Ga0496100_0037873_1627_2301 219
946 3300048904 Ga0496101_0037430 Ga0496101_0037430_2702_3376 219
947 3300048905 Ga0496102_0329742 Ga0496102_0329742_135_809 219
948 3300048906 Ga0496103_0014201 Ga0496103_0014201_701_1375 219
949 3300048907 Ga0496104_0026584 Ga0496104_0026584_2242_2916 219
950 3300048910 Ga0496107_0089296 Ga0496107_0089296_823_1497 219
951 3300048914 Ga0496111_0063329 Ga0496111_0063329_917_1591 219
952 3300048917 Ga0496114_0027523 Ga0496114_0027523_1972_2652 219
953 3300048920 Ga0496117_0083171 Ga0496117_0083171_132_806 219
954 3300048924 Ga0496121_0029210 Ga0496121_0029210_1995_2669 219
955 3300048925 Ga0496122_0248147 Ga0496122_0248147_94_762 219
956 3300048925 Ga0496122_0388344 Ga0496122_0388344_17_682 219
957 3300048928 Ga0496125_0000061 Ga0496125_0000061_261357_262025 219
958 3300049533 Ga0501317_027486 Ga0501317_027486_119_790 219
959 3300049570 Ga0501033_0024476 Ga0501033_0024476_1692_2360 219
960 3300049571 Ga0501034_0046802 Ga0501034_0046802_173_847 219
961 3300049578 Ga0501042_0002564 Ga0501042_0002564_4801_5469 219
962 3300049579 Ga0501043_0068271 Ga0501043_0068271_1654_2322 219
963 3300049579 Ga0501043_0091245 Ga0501043_0091245_691_1368 219
964 3300049580 Ga0501046_0076706 Ga0501046_0076706_791_1462 219
965 3300049581 Ga0501047_0001693 Ga0501047_0001693_10339_11016 219
966 3300049581 Ga0501047_0056740 Ga0501047_0056740_551_1219 219
967 3300049586 Ga0501070_0006252 Ga0501070_0006252_3586_4257 219
968 3300049588 Ga0501072_0076228 Ga0501072_0076228_909_1583 219
969 3300049742 Ga0501080_0030229 Ga0501080_0030229_4038_4709 219
970 3300049744 Ga0501083_0000031 Ga0501083_0000031_77077_77745 219
971 3300049744 Ga0501083_0072440 Ga0501083_0072440_911_1579 219
972 3300049822 Ga0501035_0009916 Ga0501035_0009916_472_1149 219
973 3300049823 Ga0501044_0004120 Ga0501044_0004120_14201_14878 219
974 3300050491 nmdc:mga00v17_225763_c1 nmdc:mga00v17_225763_c1_94_759 219
975 3300050491 nmdc:mga00v17_30368_c1 nmdc:mga00v17_30368_c1_847_1512 219
976 3300050492 nmdc:mga0yw44_42497_c1 nmdc:mga0yw44_42497_c1_180_851 219
977 3300050492 nmdc:mga0yw44_465171_c1 nmdc:mga0yw44_465171_c1_74_748 219
978 3300050492 nmdc:mga0yw44_4879_c1 nmdc:mga0yw44_4879_c1_3884_4549 219
979 3300050495 nmdc:mga04h51_10058_c1 nmdc:mga04h51_10058_c1_1282_1953 219
980 3300050516 nmdc:mga0sz30_187692_c1 nmdc:mga0sz30_187692_c1_204_875 219
981 3300050516 nmdc:mga0sz30_20756_c1 nmdc:mga0sz30_20756_c1_107_772 219
982 3300053139 Ga0500568_0000300 Ga0500568_0000300_1345_2016 219
983 3300053139 Ga0500568_0013408 Ga0500568_0013408_638_1312 219
984 3300053146 Ga0500588_0089350 Ga0500588_0089350_336_1010 219
985 3300053153 Ga0500616_0000359 Ga0500616_0000359_33073_33747 219
986 3300013307 Ga0157372_10405206 Ga0157372_104052062 220
987 3300020069 Ga0197907_11478864 Ga0197907_114788641 220
988 3300020081 Ga0206354_10538482 Ga0206354_105384821 220
989 3300031824 Ga0307413_10287311 Ga0307413_102873112 220
990 3300031901 Ga0307406_10345597 Ga0307406_103455972 220
991 3300044683 Ga0466965_0000002 Ga0466965_0000002_276460_277134 220
992 3300044683 Ga0466965_0148321 Ga0466965_0148321_364_1032 220
993 3300046615 Ga0495656_0015399 Ga0495656_0015399_999_1688 220
994 3300049532 Ga0501316_028444 Ga0501316_028444_49_720 220
995 3300049570 Ga0501033_0046677 Ga0501033_0046677_269_943 220
996 3300049571 Ga0501034_0243101 Ga0501034_0243101_706_1380 220
997 3300049571 Ga0501034_0251522 Ga0501034_0251522_443_1117 220
998 3300049572 Ga0501036_0241592 Ga0501036_0241592_785_1459 220
999 3300049573 Ga0501037_0338476 Ga0501037_0338476_172_846 220
1000 3300049574 Ga0501038_0111969 Ga0501038_0111969_1567_2241 220
1001 3300049574 Ga0501038_0215013 Ga0501038_0215013_665_1339 220
1002 3300049574 Ga0501038_0329329 Ga0501038_0329329_502_1173 220
1003 3300049581 Ga0501047_0417418 Ga0501047_0417418_288_962 220
1004 3300049587 Ga0501071_0305139 Ga0501071_0305139_241_915 220
1005 3300017792 Ga0163161_10113591 Ga0163161_101135911 221
1006 3300026067 Ga0207678_10783237 Ga0207678_107832371 221
1007 3300031903 Ga0307407_10088413 Ga0307407_100884133 221
1008 3300042007 Ga0439449_0043751 Ga0439449_0043751_462_1136 221
1009 3300048920 Ga0496117_0018670 Ga0496117_0018670_3795_4466 221
1010 3300048921 Ga0496118_0043392 Ga0496118_0043392_1755_2426 221
1011 3300048925 Ga0496122_0035334 Ga0496122_0035334_2526_3197 221
1012 3300048926 Ga0496123_0029610 Ga0496123_0029610_2591_3262 221
1013 3300048929 Ga0496126_0176464 Ga0496126_0176464_287_958 221
1014 3300049574 Ga0501038_0138128 Ga0501038_0138128_449_1120 221
1015 3300001979 JGI24740J21852_10022415 JGI24740J21852_100224151 222
1016 3300001989 JGI24739J22299_10021486 JGI24739J22299_100214863 222
1017 3300001990 JGI24737J22298_10010405 JGI24737J22298_100104053 222
1018 3300002067 JGI24735J21928_10001156 JGI24735J21928_100011563 222
1019 3300002737 JGI25162J39368_1010229 JGI25162J39368_10102292 222
1020 3300002772 JGI25164J39214_1001493 JGI25164J39214_10014935 222
1021 3300003214 JGI25165J46597_1000002 JGI25165J46597_1000002508 222
1022 3300003752 Ga0055539_1000008 Ga0055539_1000008510 222
1023 3300003752 Ga0055539_1000058 Ga0055539_100005822 222
1024 3300003756 Ga0055533_1000001 Ga0055533_1000001559 222
1025 3300003759 Ga0055525_1000638 Ga0055525_10006384 222
1026 3300003760 Ga0055527_1000001 Ga0055527_100000127 222
1027 3300003763 Ga0055529_1000065 Ga0055529_100006527 222
1028 3300003763 Ga0055529_1023094 Ga0055529_10230941 222
1029 3300003841 Ga0055541_1015138 Ga0055541_10151382 222
1030 3300005435 Ga0070714_100178044 Ga0070714_1001780442 222
1031 3300005564 Ga0070664_100578916 Ga0070664_1005789161 222
1032 3300005618 Ga0068864_100409715 Ga0068864_1004097152 222
1033 3300006051 Ga0075364_10042559 Ga0075364_100425594 222
1034 3300006186 Ga0075369_10038122 Ga0075369_100381222 222
1035 3300009094 Ga0111539_10541380 Ga0111539_105413802 222
1036 3300009148 Ga0105243_10344320 Ga0105243_103443202 222
1037 3300009553 Ga0105249_10131519 Ga0105249_101315192 222
1038 3300013308 Ga0157375_10282007 Ga0157375_102820072 222
1039 3300014326 Ga0157380_10104980 Ga0157380_101049802 222
1040 3300014745 Ga0157377_10258076 Ga0157377_102580761 222
1041 3300020069 Ga0197907_10158780 Ga0197907_101587803 222
1042 3300020070 Ga0206356_11319510 Ga0206356_113195103 222
1043 3300020080 Ga0206350_10550532 Ga0206350_105505321 222
1044 3300020081 Ga0206354_11039122 Ga0206354_110391222 222
1045 3300020082 Ga0206353_10948841 Ga0206353_109488412 222
1046 3300022467 Ga0224712_10053012 Ga0224712_100530122 222
1047 3300025225 Ga0209566_100026 Ga0209566_100026164 222
1048 3300025226 Ga0209674_100001 Ga0209674_100001560 222
1049 3300025228 Ga0209672_100006 Ga0209672_100006948 222
1050 3300025229 Ga0209147_102541 Ga0209147_1025414 222
1051 3300025230 Ga0209563_100001 Ga0209563_100001560 222
1052 3300025230 Ga0209563_101613 Ga0209563_1016137 222
1053 3300025231 Ga0207427_100089 Ga0207427_1000893 222
1054 3300025233 Ga0209437_100447 Ga0209437_10044723 222
1055 3300025242 Ga0209258_105429 Ga0209258_1054293 222
1056 3300025253 Ga0209677_100001 Ga0209677_100001560 222
1057 3300025254 Ga0209148_1000015 Ga0209148_1000015792 222
1058 3300025261 Ga0209233_1000001 Ga0209233_10000012298 222
1059 3300025272 Ga0209455_1000013 Ga0209455_1000013792 222
1060 3300025272 Ga0209455_1003920 Ga0209455_10039203 222
1061 3300025904 Ga0207647_10043060 Ga0207647_100430602 222
1062 3300025929 Ga0207664_10207061 Ga0207664_102070612 222
1063 3300025935 Ga0207709_10069523 Ga0207709_100695233 222
1064 3300025945 Ga0207679_10384111 Ga0207679_103841112 222
1065 3300025961 Ga0207712_10084607 Ga0207712_100846072 222
1066 3300025986 Ga0207658_10038526 Ga0207658_100385262 222
1067 3300026095 Ga0207676_10619672 Ga0207676_106196722 222
1068 3300031852 Ga0307410_10105491 Ga0307410_101054912 222
1069 3300031901 Ga0307406_10107242 Ga0307406_101072421 222
1070 3300031911 Ga0307412_10864439 Ga0307412_108644391 222
1071 3300044684 Ga0466966_0313684 Ga0466966_0313684_19_702 222
1072 3300044735 Ga0466968_0145849 Ga0466968_0145849_197_874 222
1073 3300044765 Ga0466970_0196954 Ga0466970_0196954_89_766 222
1074 3300045976 Ga0466967_0168047 Ga0466967_0168047_295_972 222
1075 3300046460 Ga0495638_0182255 Ga0495638_0182255_277_945 222
1076 3300047472 Ga0495686_0137513 Ga0495686_0137513_139_807 222
1077 3300048903 Ga0496100_0035112 Ga0496100_0035112_1600_2268 222
1078 3300048904 Ga0496101_0065191 Ga0496101_0065191_1836_2504 222
1079 3300048905 Ga0496102_0090831 Ga0496102_0090831_1105_1773 222
1080 3300048906 Ga0496103_0128676 Ga0496103_0128676_314_982 222
1081 3300048907 Ga0496104_0032699 Ga0496104_0032699_161_844 222
1082 3300048907 Ga0496104_0161718 Ga0496104_0161718_1222_1890 222
1083 3300048908 Ga0496105_0016186 Ga0496105_0016186_1860_2579 222
1084 3300048908 Ga0496105_0106962 Ga0496105_0106962_898_1566 222
1085 3300048908 Ga0496105_0294395 Ga0496105_0294395_592_1260 222
1086 3300048908 Ga0496105_0605746 Ga0496105_0605746_147_830 222
1087 3300048910 Ga0496107_0357328 Ga0496107_0357328_132_815 222
1088 3300048914 Ga0496111_0056250 Ga0496111_0056250_916_1602 222
1089 3300048916 Ga0496113_0065896 Ga0496113_0065896_1107_1775 222
1090 3300048917 Ga0496114_0008179 Ga0496114_0008179_7249_7917 222
1091 3300048918 Ga0496115_0221435 Ga0496115_0221435_628_1296 222
1092 3300048919 Ga0496116_0005584 Ga0496116_0005584_2401_3078 222
1093 3300048920 Ga0496117_0021516 Ga0496117_0021516_939_1625 222
1094 3300048920 Ga0496117_0037736 Ga0496117_0037736_1391_2059 222
1095 3300048920 Ga0496117_0040741 Ga0496117_0040741_1137_1814 222
1096 3300048920 Ga0496117_0057081 Ga0496117_0057081_1387_2070 222
1097 3300048921 Ga0496118_0012176 Ga0496118_0012176_252_938 222
1098 3300048921 Ga0496118_0014303 Ga0496118_0014303_2816_3499 222
1099 3300048921 Ga0496118_0021989 Ga0496118_0021989_1861_2538 222
1100 3300048922 Ga0496119_0006633 Ga0496119_0006633_8747_9424 222
1101 3300048922 Ga0496119_0039809 Ga0496119_0039809_1472_2158 222
1102 3300048923 Ga0496120_0001871 Ga0496120_0001871_6082_6759 222
1103 3300048923 Ga0496120_0053235 Ga0496120_0053235_1468_2154 222
1104 3300048925 Ga0496122_0000030 Ga0496122_0000030_115192_115869 222
1105 3300048925 Ga0496122_0000120 Ga0496122_0000120_123135_123827 222
1106 3300048925 Ga0496122_0020154 Ga0496122_0020154_4488_5165 222
1107 3300048926 Ga0496123_0000024 Ga0496123_0000024_115193_115870 222
1108 3300048926 Ga0496123_0000051 Ga0496123_0000051_153028_153720 222
1109 3300048927 Ga0496124_0006961 Ga0496124_0006961_860_1552 222
1110 3300048927 Ga0496124_0033930 Ga0496124_0033930_1154_1831 222
1111 3300048928 Ga0496125_0011710 Ga0496125_0011710_6056_6733 222
1112 3300048928 Ga0496125_0026332 Ga0496125_0026332_4165_4851 222
1113 3300048929 Ga0496126_0001272 Ga0496126_0001272_18153_18821 222
1114 3300048929 Ga0496126_0030455 Ga0496126_0030455_2136_2813 222
1115 3300048929 Ga0496126_0039327 Ga0496126_0039327_1827_2495 222
1116 3300048929 Ga0496126_0084913 Ga0496126_0084913_1813_2481 222
1117 3300049528 Ga0501312_020076 Ga0501312_020076_307_975 222
1118 3300049534 Ga0501318_024287 Ga0501318_024287_11_679 222
1119 3300049568 Ga0501031_0007690 Ga0501031_0007690_2319_2996 222
1120 3300049568 Ga0501031_0040115 Ga0501031_0040115_548_1216 222
1121 3300049569 Ga0501032_0002037 Ga0501032_0002037_3053_3721 222
1122 3300049569 Ga0501032_0015000 Ga0501032_0015000_3226_3903 222
1123 3300049569 Ga0501032_0200059 Ga0501032_0200059_576_1253 222
1124 3300049570 Ga0501033_0014733 Ga0501033_0014733_560_1237 222
1125 3300049570 Ga0501033_0045734 Ga0501033_0045734_1014_1682 222
1126 3300049570 Ga0501033_0051589 Ga0501033_0051589_2166_2843 222
1127 3300049570 Ga0501033_0055808 Ga0501033_0055808_1942_2619 222
1128 3300049571 Ga0501034_0023555 Ga0501034_0023555_3760_4428 222
1129 3300049571 Ga0501034_0069767 Ga0501034_0069767_2797_3474 222
1130 3300049571 Ga0501034_0075333 Ga0501034_0075333_48_725 222
1131 3300049571 Ga0501034_0741592 Ga0501034_0741592_44_721 222
1132 3300049572 Ga0501036_0024010 Ga0501036_0024010_1575_2243 222
1133 3300049572 Ga0501036_0340037 Ga0501036_0340037_517_1194 222
1134 3300049573 Ga0501037_0014222 Ga0501037_0014222_2152_2820 222
1135 3300049573 Ga0501037_0047012 Ga0501037_0047012_1780_2457 222
1136 3300049573 Ga0501037_0053136 Ga0501037_0053136_1366_2043 222
1137 3300049574 Ga0501038_0498350 Ga0501038_0498350_183_860 222
1138 3300049575 Ga0501039_0015610 Ga0501039_0015610_1758_2426 222
1139 3300049575 Ga0501039_0065179 Ga0501039_0065179_61_738 222
1140 3300049575 Ga0501039_0230943 Ga0501039_0230943_44_721 222
1141 3300049579 Ga0501043_0082166 Ga0501043_0082166_69_746 222
1142 3300049579 Ga0501043_0225195 Ga0501043_0225195_747_1424 222
1143 3300049580 Ga0501046_0015068 Ga0501046_0015068_3857_4525 222
1144 3300049580 Ga0501046_0020765 Ga0501046_0020765_859_1536 222
1145 3300049581 Ga0501047_0007489 Ga0501047_0007489_6624_7301 222
1146 3300049581 Ga0501047_0194687 Ga0501047_0194687_707_1384 222
1147 3300049581 Ga0501047_0296047 Ga0501047_0296047_580_1257 222
1148 3300049582 Ga0501048_0002200 Ga0501048_0002200_9247_9924 222
1149 3300049582 Ga0501048_0117290 Ga0501048_0117290_513_1181 222
1150 3300049583 Ga0501067_0080920 Ga0501067_0080920_678_1355 222
1151 3300049584 Ga0501068_0013268 Ga0501068_0013268_2971_3639 222
1152 3300049586 Ga0501070_0001115 Ga0501070_0001115_9995_10678 222
1153 3300049586 Ga0501070_0009418 Ga0501070_0009418_7275_7952 222
1154 3300049586 Ga0501070_0089176 Ga0501070_0089176_182_859 222
1155 3300049586 Ga0501070_0177426 Ga0501070_0177426_868_1557 222
1156 3300049586 Ga0501070_0309761 Ga0501070_0309761_154_831 222
1157 3300049588 Ga0501072_0394247 Ga0501072_0394247_195_872 222
1158 3300049589 Ga0501073_0014799 Ga0501073_0014799_4280_4957 222
1159 3300049590 Ga0501074_0026637 Ga0501074_0026637_907_1584 222
1160 3300049741 Ga0501079_0473588 Ga0501079_0473588_196_873 222
1161 3300049822 Ga0501035_0048714 Ga0501035_0048714_190_867 222
1162 3300049822 Ga0501035_0088234 Ga0501035_0088234_1077_1754 222
1163 3300049822 Ga0501035_0169028 Ga0501035_0169028_707_1384 222
1164 3300049823 Ga0501044_0037014 Ga0501044_0037014_1381_2058 222
1165 3300049823 Ga0501044_0053882 Ga0501044_0053882_2691_3359 222
1166 3300049823 Ga0501044_0422676 Ga0501044_0422676_506_1183 222
1167 3300049824 Ga0501045_0042376 Ga0501045_0042376_2069_2746 222
1168 3300050492 nmdc:mga0yw44_60122_c1 nmdc:mga0yw44_60122_c1_246_923 222
1169 3300050516 nmdc:mga0sz30_134414_c1 nmdc:mga0sz30_134414_c1_383_1051 222
1170 3300053080 Ga0500635_0000010 Ga0500635_0000010_136772_137455 222
1171 3300060353 Ga0501082_0350804 Ga0501082_0350804_456_1124 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00574

CLP_protease

Clp protease

27

210

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i7x-assembly1.cif.gz_H crystal structure of human clpp in complex with zg36 0.9772 38 211
8i7x-assembly1.cif.gz_L crystal structure of human clpp in complex with zg36 0.9766 40 211
6h23-assembly1.cif.gz_D crystal structure of the hclpp y118a mutant with an activating small molecule 0.9732 37 213
8i7x-assembly1.cif.gz_K crystal structure of human clpp in complex with zg36 0.9731 40 211
8i7x-assembly1.cif.gz_F crystal structure of human clpp in complex with zg36 0.9727 38 211
ID Description Score Start End Superfamily
1y7oA00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9605 36 213 3.90.226.10
1yg8S00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9521 38 214 3.90.226.10
af_Q2PMR0_6_196_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9364 24 213 3.90.226.10
af_Q2PMR0_6_196_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.927 24 213 3.90.226.10
1yg8S00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9265 38 214 3.90.226.10
ID Description Score Start End GO Terms
AF-G6EPE8-F1-model_v4 deleted 0.9914 40 139
AF-F8TGT4-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 0.9891 42 113 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0009532
GO:0051117
AF-G1C6I0-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 0.9857 42 119 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0009507
GO:0051117
AF-A0A059B6T9-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 0.9829 37 212 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0009532
GO:0051117
AF-A0A5D2R4P3-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 0.9753 38 133 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0009532
GO:0051117

Feature Viewer

pLDDT pTM Quality
81.42 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map