F491158

General Info

Members Datasets Scaffolds Average Seq Length
1170 447 1098 579

Family's Representative Sequence

Representative Sequence 3300049664|Ga0501224_002098|Ga0501224_002098_746_2656
Length 636
Sequence MNDLPPSPKGEIWEIRSIDRVPSKIKSKKMATQLLKTTPENKDSAQKTPSGDKSKSTETTASTPDSPLGDGGTPEQISGSIAVLEALIAEGVDTIFGYPGGAIMPIYDALYDYREKLQHILVRHEQGGIHAGQGYARTSGNVGVVFATSGPGATNLVTGLADALIDSTPLVCITGQVFAHLLGTDAFQETDVINITTPITKWNYQVTDAMEIPEVMAKAFYIAKSGRPGPVLIDITKNAQIQKFDYKGYKKCNHIRSYRPKPIVRKEYVEEAAKLINSAEKPFIIFGQGVILGKAEKEFQKFIEKSGIPAACTILGLSALPSDHPLNVGMLGMHGNYGPNVLTNECDVLIAVGMRFDDRVTGRLDKYAKQAKVIHLDIDPAEIDKNVKATVPVWGDCKETLPLLTELVEQKVYPKWLEKFNDYKQKEETICIIPEMNPAVPEISMAEVIDALNDLTNGDAVIVTDVGQHQMVTCRYAKFKKSKSNVTSGGLGTMGFALPAAIGAKYGAPDRTVIAIIGDGGVQMTVQELGTIMQFDIDVKILILNNEFLGMVRQWQQLFHDKRYSFVNITSPDYIMVAKGYGIEGQKVSQRENLKTALKTMLDHNGAYLLEVMVGKENNVFPMVPQGCSVAEIRLQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
5 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
6 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
7 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
8 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
9 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
10 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
11 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
12 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
13 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
14 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
15 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
16 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
17 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
18 2738541278 Niastella sp. CF465 Isolate Unclassified
19 2738541283 Pedobacter sp. OK701 Isolate Unclassified
20 2738541284 Pedobacter sp. YR016 Isolate Unclassified
21 2738541302 Pedobacter sp. CF074 Isolate Unclassified
22 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
23 2739367651 Pedobacter sp. OK291 Isolate Unclassified
24 2739367656 Pedobacter sp. CF523 Isolate Unclassified
25 2739367663 Pedobacter sp. YR510 Isolate Unclassified
26 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
27 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
28 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
29 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
30 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
31 2818991437 Pedobacter terrae 518 Isolate Unclassified
32 2818991444 Filimonas endophytica 3197 Isolate Unclassified
33 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
34 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
35 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
36 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
37 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
38 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
39 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
40 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
41 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
42 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
43 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
44 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
45 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
46 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
47 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
48 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
49 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
50 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
51 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
52 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
53 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
54 2914759650 Rhizosphaericola mali Isolate Rhizosphere
55 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
56 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
57 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
58 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
59 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
60 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
61 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
62 2939615513 Lactococcus lactis 1925 Isolate Rhizosphere
63 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
64 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
65 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
66 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
67 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
68 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
69 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
70 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
71 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
72 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
73 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
74 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
75 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
76 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
77 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
78 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
79 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
81 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
82 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
83 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
84 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
85 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
86 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
87 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
88 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
89 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
90 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
91 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
92 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
94 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
95 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
96 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
97 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
98 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
99 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
100 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
101 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
102 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
103 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
104 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
105 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
106 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
107 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
108 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
109 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
110 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
111 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
112 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
113 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
114 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
115 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
116 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
117 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
118 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
119 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
120 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
121 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
122 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
123 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
124 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
125 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
126 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
127 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
128 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
129 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
130 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
131 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
132 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
133 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
134 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
135 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
136 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
137 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
138 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
139 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
140 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
141 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
142 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
143 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
144 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
145 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
146 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
147 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
148 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
149 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
150 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
151 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
152 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
153 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
154 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
155 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
156 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
157 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
158 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
159 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
160 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
161 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
162 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
163 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
164 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
165 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
166 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
167 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
168 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
169 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
170 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
171 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
172 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
173 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
174 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
175 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
176 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
177 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
178 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
179 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
180 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
181 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
182 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
183 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
184 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
185 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
186 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
187 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
188 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
189 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
190 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
191 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
192 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
193 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
194 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
195 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
196 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
197 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
198 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
199 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
200 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
201 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
202 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
203 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
204 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
205 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
208 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
209 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
211 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
267 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
271 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
272 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
273 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
274 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
275 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
276 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
277 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
278 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
279 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
280 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
281 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
282 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
283 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
284 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
285 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
286 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
287 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
288 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
289 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
290 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
291 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
292 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
293 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
294 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
295 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
296 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
297 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
298 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
299 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
300 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
301 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
302 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
303 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
304 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
305 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
306 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
307 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
308 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
309 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
310 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
311 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
312 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
313 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
314 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
315 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
316 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
317 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
318 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
319 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
320 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
321 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
322 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
323 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
324 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
325 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
326 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
327 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
328 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
329 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
330 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
331 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
332 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
333 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
334 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
335 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
336 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
337 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
338 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
339 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
340 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
341 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
342 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
343 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
344 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
345 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
346 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
347 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
348 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
349 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
350 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
351 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
352 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
353 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
354 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
355 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
356 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
357 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
358 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
359 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
360 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
361 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
362 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
363 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
364 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
365 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
366 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
367 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
368 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
369 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
370 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
371 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
372 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
373 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
374 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
375 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
376 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
377 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
378 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
379 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
380 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
381 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
382 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
383 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
384 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
385 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
386 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
387 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
388 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
389 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
403 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
404 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
405 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
406 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
407 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
408 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
409 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
410 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
411 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
412 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
413 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
414 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
415 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
416 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
417 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
418 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
419 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
420 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
421 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
422 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
423 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
426 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
427 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
428 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
429 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
430 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
431 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
432 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
433 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
434 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
435 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
436 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
437 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
438 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
439 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
440 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
441 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
442 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
443 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
444 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
445 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
446 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
447 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.42
Metatranscriptomes 0.43
Isolates 6.15

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 4.02
Nodule 0.09
Rhizoplane 0.94
Rhizosphere 87.69
Stem 0
Stem Tuber 0
Unclassified 7.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1018414 2162886007 Bacteria 6186
2 JGI24737J22298_10004033 3300001990 Bacteria 5133
3 JGI24735J21928_10000003 3300002067 Bacteria 385983
4 JGI24751J29686_10000950 3300002459 Bacteria 6421
5 JGI25162J39368_1000123 3300002737 Bacteria 85062
6 JGI25162J39368_1000931 3300002737 Bacteria 18808
7 JGI25164J39214_1001625 3300002772 Bacteria 4709
8 JGI25150J39212_1000001 3300002774 Bacteria 1318726
9 JGI25151J46595_10000001 3300003187 Bacteria 887211
10 JGI25406J46586_10010325 3300003203 Bacteria 4147
11 JGI25165J46597_1000399 3300003214 Bacteria 45926
12 JGI25153J46596_10000001 3300003215 Bacteria 748985
13 rootH1_10019188 3300003316 Bacteria 26527
14 rootH2_10000336 3300003320 Bacteria 69852
15 rootH2_10024557 3300003320 Bacteria 11002
16 rootH2_10112387 3300003320 Bacteria 8931
17 rootL2_10100912 3300003322 Bacteria 8358
18 rootL2_10235324 3300003322 Bacteria 3811
19 rootH1_10003494 3300003323 Bacteria 6230
20 rootH1_10007401 3300003323 Bacteria 21414
21 rootH1_10062604 3300003323 Bacteria 9248
22 JGI25160J50197_1000687 3300003354 Bacteria 18745
23 Ga0006562J51391_1004821 3300003578 Bacteria 6910
24 Ga0055536_1000004 3300003781 Bacteria 411108
25 Ga0055534_1009268 3300003784 Bacteria 2152
26 Ga0055530_10001535 3300003791 Bacteria 16585
27 Ga0055531_10000139 3300003794 Bacteria 82993
28 Ga0058863_11434785 3300004799 Bacteria 2659
29 Ga0065714_10002421 3300005288 Bacteria 18345
30 Ga0065714_10003183 3300005288 Bacteria 11043
31 Ga0065714_10006014 3300005288 Bacteria 9989
32 Ga0065714_10008525 3300005288 Bacteria 5440
33 Ga0065714_10067466 3300005288 Bacteria 5484
34 Ga0065704_10000302 3300005289 Bacteria 36124
35 Ga0065704_10002965 3300005289 Bacteria 8333
36 Ga0065704_10070912 3300005289 Bacteria 14743
37 Ga0065704_10078149 3300005289 Bacteria 4491
38 Ga0065704_10117650 3300005289 Bacteria 1830
39 Ga0065712_10000499 3300005290 Bacteria 10768
40 Ga0065712_10074461 3300005290 Bacteria 4088
41 Ga0065715_10091975 3300005293 Bacteria 5419
42 Ga0065715_10103649 3300005293 Bacteria 2994
43 Ga0065707_10117751 3300005295 Bacteria 2204
44 Ga0070658_10000160 3300005327 Bacteria 59295
45 Ga0070658_10003403 3300005327 Bacteria 13081
46 Ga0070658_10009107 3300005327 Bacteria 7982
47 Ga0070658_10103514 3300005327 Bacteria 2354
48 Ga0070676_10000980 3300005328 Bacteria 14196
49 Ga0070676_10002582 3300005328 Bacteria 9314
50 Ga0070676_10004504 3300005328 Bacteria 7335
51 Ga0070676_10032880 3300005328 Bacteria 2974
52 Ga0070683_100003447 3300005329 Bacteria 12844
53 Ga0070683_100147280 3300005329 Bacteria 2231
54 Ga0070670_100029260 3300005331 Bacteria 4741
55 Ga0070670_100035645 3300005331 Bacteria 4282
56 Ga0070670_100047585 3300005331 Bacteria 3691
57 Ga0070670_100057142 3300005331 Bacteria 3350
58 Ga0070670_100074309 3300005331 Bacteria 2920
59 Ga0070670_100098304 3300005331 Bacteria 2518
60 Ga0070670_100153832 3300005331 Bacteria 1991
61 Ga0068869_100003787 3300005334 Bacteria 9318
62 Ga0068869_100013562 3300005334 Bacteria 5423
63 Ga0068869_100042601 3300005334 Bacteria 3255
64 Ga0068869_100065305 3300005334 Bacteria 2678
65 Ga0068869_100114830 3300005334 Bacteria 2053
66 Ga0070666_10000042 3300005335 Bacteria 112296
67 Ga0070666_10003610 3300005335 Bacteria 9381
68 Ga0070666_10023903 3300005335 Bacteria 3979
69 Ga0070666_10069361 3300005335 Bacteria 2397
70 Ga0070666_10073219 3300005335 Bacteria 2333
71 Ga0070680_100000323 3300005336 Bacteria 32103
72 Ga0070682_100000158 3300005337 Bacteria 51858
73 Ga0070682_100006212 3300005337 Bacteria 6695
74 Ga0068868_100013211 3300005338 Bacteria 6048
75 Ga0068868_100029048 3300005338 Bacteria 4234
76 Ga0068868_100039782 3300005338 Bacteria 3656
77 Ga0068868_100096524 3300005338 Bacteria 2388
78 Ga0070660_100001381 3300005339 Bacteria 16497
79 Ga0070660_100006797 3300005339 Bacteria 7939
80 Ga0070660_100018003 3300005339 Bacteria 5156
81 Ga0070660_100018476 3300005339 Bacteria 5095
82 Ga0070660_100027413 3300005339 Bacteria 4250
83 Ga0070661_100002466 3300005344 Bacteria 12693
84 Ga0070661_100003469 3300005344 Bacteria 10878
85 Ga0070661_100040116 3300005344 Bacteria 3414
86 Ga0070668_100006878 3300005347 Bacteria 8429
87 Ga0070668_100024239 3300005347 Bacteria 4595
88 Ga0070669_100007952 3300005353 Bacteria 7577
89 Ga0070675_100007608 3300005354 Bacteria 8383
90 Ga0070675_100013806 3300005354 Bacteria 6359
91 Ga0070671_100000489 3300005355 Bacteria 27650
92 Ga0070671_100008573 3300005355 Bacteria 8197
93 Ga0070671_100042034 3300005355 Bacteria 3799
94 Ga0070673_100001841 3300005364 Bacteria 12677
95 Ga0070673_100049315 3300005364 Bacteria 3287
96 Ga0070673_100056413 3300005364 Bacteria 3099
97 Ga0070673_100070558 3300005364 Bacteria 2804
98 Ga0070688_100002056 3300005365 Bacteria 10157
99 Ga0070659_100000486 3300005366 Bacteria 29153
100 Ga0070659_100025920 3300005366 Bacteria 4510
101 Ga0070659_100027708 3300005366 Bacteria 4368
102 Ga0070659_100036128 3300005366 Bacteria 3850
103 Ga0070659_100056061 3300005366 Bacteria 3107
104 Ga0070667_100000497 3300005367 Bacteria 39867
105 Ga0070667_100002981 3300005367 Bacteria 14548
106 Ga0070667_100003004 3300005367 Bacteria 14486
107 Ga0070667_100023268 3300005367 Bacteria 5139
108 Ga0070667_100062831 3300005367 Bacteria 3146
109 Ga0070700_100006894 3300005441 Bacteria 6101
110 Ga0070663_100001316 3300005455 Bacteria 13590
111 Ga0070663_100067764 3300005455 Bacteria 2590
112 Ga0070678_100008016 3300005456 Bacteria 6297
113 Ga0070678_100032141 3300005456 Bacteria 3629
114 Ga0070662_100000013 3300005457 Bacteria 125019
115 Ga0070662_100016379 3300005457 Bacteria 4976
116 Ga0070662_100071153 3300005457 Bacteria 2564
117 Ga0070681_10024467 3300005458 Bacteria 6080
118 Ga0070681_10039612 3300005458 Bacteria 4723
119 Ga0070681_10068502 3300005458 Bacteria 3515
120 Ga0068867_100000968 3300005459 Bacteria 19588
121 Ga0068867_100118624 3300005459 Bacteria 2041
122 Ga0070685_10009755 3300005466 Bacteria 4976
123 Ga0070706_100027552 3300005467 Bacteria 5229
124 Ga0070698_100002401 3300005471 Bacteria 20622
125 Ga0070679_100000323 3300005530 Bacteria 40444
126 Ga0070679_100000397 3300005530 Bacteria 37025
127 Ga0070679_100000880 3300005530 Bacteria 26077
128 Ga0070679_100020451 3300005530 Bacteria 6453
129 Ga0070679_100042733 3300005530 Bacteria 4514
130 Ga0070679_100083227 3300005530 Bacteria 3188
131 Ga0070684_100000172 3300005535 Bacteria 44308
132 Ga0070684_100010008 3300005535 Bacteria 7497
133 Ga0070684_100025664 3300005535 Bacteria 4956
134 Ga0070684_100035442 3300005535 Bacteria 4270
135 Ga0070684_100042864 3300005535 Bacteria 3908
136 Ga0070684_100044547 3300005535 Bacteria 3838
137 Ga0070697_100001004 3300005536 Bacteria 21288
138 Ga0070697_100008131 3300005536 Bacteria 8185
139 Ga0068853_100004535 3300005539 Bacteria 10775
140 Ga0068853_100010943 3300005539 Bacteria 7352
141 Ga0068853_100023395 3300005539 Bacteria 5171
142 Ga0068853_100027183 3300005539 Bacteria 4807
143 Ga0068853_100040644 3300005539 Bacteria 3969
144 Ga0068853_100130160 3300005539 Bacteria 2252
145 Ga0070672_100000067 3300005543 Bacteria 47884
146 Ga0070672_100027741 3300005543 Bacteria 4227
147 Ga0070672_100045119 3300005543 Bacteria 3407
148 Ga0070686_100062888 3300005544 Bacteria 2403
149 Ga0070696_100058403 3300005546 Bacteria 2694
150 Ga0070693_100003549 3300005547 Bacteria 7274
151 Ga0070665_100000001 3300005548 Bacteria 1083363
152 Ga0070665_100000010 3300005548 Bacteria 529545
153 Ga0070665_100002117 3300005548 Bacteria 22174
154 Ga0068855_100000139 3300005563 Bacteria 92537
155 Ga0068855_100000590 3300005563 Bacteria 44483
156 Ga0068855_100004391 3300005563 Bacteria 17233
157 Ga0068855_100008545 3300005563 Bacteria 12375
158 Ga0068855_100011078 3300005563 Bacteria 10882
159 Ga0068855_100011554 3300005563 Bacteria 10665
160 Ga0068855_100012267 3300005563 Bacteria 10356
161 Ga0068855_100014431 3300005563 Bacteria 9511
162 Ga0068855_100017608 3300005563 Bacteria 8591
163 Ga0068855_100049584 3300005563 Bacteria 4952
164 Ga0068855_100091186 3300005563 Bacteria 3516
165 Ga0068855_100118608 3300005563 Bacteria 3030
166 Ga0070664_100001323 3300005564 Bacteria 19756
167 Ga0070664_100008425 3300005564 Bacteria 8336
168 Ga0070664_100039741 3300005564 Bacteria 3965
169 Ga0070664_100078386 3300005564 Bacteria 2842
170 Ga0070664_100131548 3300005564 Bacteria 2198
171 Ga0068857_100000719 3300005577 Bacteria 24689
172 Ga0068857_100003162 3300005577 Bacteria 13656
173 Ga0068857_100005435 3300005577 Bacteria 10861
174 Ga0068857_100070466 3300005577 Bacteria 3115
175 Ga0068857_100081050 3300005577 Bacteria 2898
176 Ga0068854_100018287 3300005578 Bacteria 4703
177 Ga0068854_100088051 3300005578 Bacteria 2305
178 Ga0068856_100000118 3300005614 Bacteria 78833
179 Ga0068856_100022607 3300005614 Bacteria 6113
180 Ga0068856_100032875 3300005614 Bacteria 5079
181 Ga0068856_100036702 3300005614 Bacteria 4806
182 Ga0068856_100144549 3300005614 Bacteria 2386
183 Ga0068852_100000079 3300005616 Bacteria 67303
184 Ga0068852_100002172 3300005616 Bacteria 13442
185 Ga0068852_100003597 3300005616 Bacteria 10848
186 Ga0068852_100004077 3300005616 Bacteria 10279
187 Ga0068852_100015392 3300005616 Bacteria 5931
188 Ga0068852_100037705 3300005616 Bacteria 4055
189 Ga0068852_100056063 3300005616 Bacteria 3404
190 Ga0068852_100062562 3300005616 Bacteria 3238
191 Ga0068852_100065148 3300005616 Bacteria 3178
192 Ga0068859_100000130 3300005617 Bacteria 71018
193 Ga0068859_100002955 3300005617 Bacteria 17241
194 Ga0068859_100042091 3300005617 Bacteria 4588
195 Ga0068859_100059052 3300005617 Bacteria 3864
196 Ga0068859_100107645 3300005617 Bacteria 2848
197 Ga0068859_100114194 3300005617 Bacteria 2764
198 Ga0068864_100004346 3300005618 Bacteria 11631
199 Ga0068864_100005929 3300005618 Bacteria 10018
200 Ga0068864_100012055 3300005618 Bacteria 7140
201 Ga0068864_100023531 3300005618 Bacteria 5174
202 Ga0068864_100094651 3300005618 Bacteria 2640
203 Ga0068864_100138175 3300005618 Bacteria 2196
204 Ga0068861_100022281 3300005719 Bacteria 4562
205 Ga0068851_10036070 3300005834 Bacteria 2475
206 Ga0068863_100001982 3300005841 Bacteria 20353
207 Ga0068863_100002443 3300005841 Bacteria 18455
208 Ga0068863_100012749 3300005841 Bacteria 8106
209 Ga0068858_100004507 3300005842 Bacteria 13653
210 Ga0068858_100007698 3300005842 Bacteria 10400
211 Ga0068858_100015037 3300005842 Bacteria 7281
212 Ga0068858_100055397 3300005842 Bacteria 3666
213 Ga0068860_100000200 3300005843 Bacteria 95120
214 Ga0068860_100000241 3300005843 Bacteria 83429
215 Ga0068860_100001122 3300005843 Bacteria 29492
216 Ga0068860_100001682 3300005843 Bacteria 23632
217 Ga0068860_100006618 3300005843 Bacteria 11635
218 Ga0068860_100009199 3300005843 Bacteria 9819
219 Ga0068860_100010023 3300005843 Bacteria 9393
220 Ga0068860_100019411 3300005843 Bacteria 6593
221 Ga0068860_100026735 3300005843 Bacteria 5561
222 Ga0068860_100065888 3300005843 Bacteria 3440
223 Ga0068860_100111574 3300005843 Bacteria 2615
224 Ga0068862_100010218 3300005844 Bacteria 7745
225 Ga0081539_10000345 3300005985 Bacteria 102083
226 Ga0070717_10001896 3300006028 Bacteria 14628
227 Ga0075366_10000234 3300006195 Bacteria 24583
228 Ga0075366_10010036 3300006195 Bacteria 5307
229 Ga0075366_10049783 3300006195 Bacteria 2487
230 Ga0097621_100000027 3300006237 Bacteria 71873
231 Ga0097621_100000694 3300006237 Bacteria 23625
232 Ga0097621_100003067 3300006237 Bacteria 11455
233 Ga0097621_100003792 3300006237 Bacteria 10468
234 Ga0097621_100008505 3300006237 Bacteria 7390
235 Ga0097621_100031306 3300006237 Bacteria 4221
236 Ga0097621_100039988 3300006237 Bacteria 3768
237 Ga0097621_100040619 3300006237 Bacteria 3741
238 Ga0097621_100111158 3300006237 Bacteria 2315
239 Ga0068871_100000109 3300006358 Bacteria 49767
240 Ga0068871_100000338 3300006358 Bacteria 32447
241 Ga0068871_100004528 3300006358 Bacteria 9687
242 Ga0068871_100005490 3300006358 Bacteria 8894
243 Ga0068871_100026533 3300006358 Bacteria 4521
244 Ga0068871_100029893 3300006358 Bacteria 4285
245 Ga0068871_100054112 3300006358 Bacteria 3255
246 Ga0075428_100000023 3300006844 Bacteria 127355
247 Ga0075428_100097085 3300006844 Bacteria 3212
248 Ga0075428_100107306 3300006844 Bacteria 3044
249 Ga0075430_100025613 3300006846 Bacteria 5020
250 Ga0075431_100000860 3300006847 Bacteria 26641
251 Ga0075431_100043842 3300006847 Bacteria 4613
252 Ga0075429_100001604 3300006880 Bacteria 18651
253 Ga0068865_100000376 3300006881 Bacteria 24749
254 Ga0097620_100000130 3300006931 Bacteria 71018
255 Ga0097620_100002955 3300006931 Bacteria 17241
256 Ga0097620_100009741 3300006931 Bacteria 9703
257 Ga0097620_100042090 3300006931 Bacteria 4588
258 Ga0097620_100045498 3300006931 Bacteria 4409
259 Ga0097620_100059048 3300006931 Bacteria 3864
260 Ga0097620_100107651 3300006931 Bacteria 2848
261 Ga0097620_100114196 3300006931 Bacteria 2764
262 Ga0105244_10000069 3300009036 Bacteria 119620
263 Ga0105240_10000001 3300009093 Bacteria 2887840
264 Ga0105240_10000128 3300009093 Bacteria 156107
265 Ga0105240_10000744 3300009093 Bacteria 59430
266 Ga0105240_10001477 3300009093 Bacteria 40056
267 Ga0105240_10001870 3300009093 Bacteria 35026
268 Ga0105240_10006000 3300009093 Bacteria 17962
269 Ga0105240_10007004 3300009093 Bacteria 16460
270 Ga0105240_10008403 3300009093 Bacteria 14772
271 Ga0105240_10008514 3300009093 Bacteria 14663
272 Ga0105240_10010263 3300009093 Bacteria 13184
273 Ga0105240_10015424 3300009093 Bacteria 10388
274 Ga0105240_10017211 3300009093 Bacteria 9751
275 Ga0105240_10040050 3300009093 Bacteria 5997
276 Ga0105240_10066393 3300009093 Bacteria 4475
277 Ga0105240_10071558 3300009093 Bacteria 4289
278 Ga0105240_10072040 3300009093 Bacteria 4272
279 Ga0111539_10072821 3300009094 Bacteria 4052
280 Ga0111539_10075788 3300009094 Bacteria 3962
281 Ga0111539_10268794 3300009094 Bacteria 1985
282 Ga0105245_10000926 3300009098 Bacteria 26649
283 Ga0105247_10011487 3300009101 Bacteria 5338
284 Ga0105247_10075280 3300009101 Bacteria 2118
285 Ga0114129_10006547 3300009147 Bacteria 16528
286 Ga0114129_10012944 3300009147 Bacteria 11872
287 Ga0114129_10017693 3300009147 Bacteria 10147
288 Ga0114129_10151979 3300009147 Bacteria 3168
289 Ga0105243_10000003 3300009148 Bacteria 712931
290 Ga0105243_10000130 3300009148 Bacteria 85659
291 Ga0105243_10024668 3300009148 Bacteria 4589
292 Ga0105241_10000024 3300009174 Bacteria 140808
293 Ga0105241_10000105 3300009174 Bacteria 60020
294 Ga0105241_10002088 3300009174 Bacteria 15089
295 Ga0105241_10004581 3300009174 Bacteria 10229
296 Ga0105241_10006507 3300009174 Bacteria 8614
297 Ga0105241_10008646 3300009174 Bacteria 7484
298 Ga0105241_10014095 3300009174 Bacteria 5858
299 Ga0105241_10015759 3300009174 Bacteria 5538
300 Ga0105241_10149235 3300009174 Bacteria 1911
301 Ga0105242_10008952 3300009176 Bacteria 7684
302 Ga0105242_10042190 3300009176 Bacteria 3683
303 Ga0105242_10044439 3300009176 Bacteria 3598
304 Ga0105248_10000002 3300009177 Bacteria 1054120
305 Ga0105248_10004239 3300009177 Bacteria 15863
306 Ga0105248_10018698 3300009177 Bacteria 7661
307 Ga0105248_10018861 3300009177 Bacteria 7628
308 Ga0105237_10000247 3300009545 Bacteria 76464
309 Ga0105237_10001172 3300009545 Bacteria 35046
310 Ga0105237_10004855 3300009545 Bacteria 15436
311 Ga0105237_10013031 3300009545 Bacteria 8730
312 Ga0105237_10018029 3300009545 Bacteria 7313
313 Ga0105237_10023685 3300009545 Bacteria 6287
314 Ga0105237_10029831 3300009545 Bacteria 5540
315 Ga0105237_10048644 3300009545 Bacteria 4262
316 Ga0105237_10148523 3300009545 Bacteria 2339
317 Ga0105238_10000085 3300009551 Bacteria 105043
318 Ga0105238_10009575 3300009551 Bacteria 9692
319 Ga0105238_10012364 3300009551 Bacteria 8609
320 Ga0105238_10017738 3300009551 Bacteria 7237
321 Ga0105238_10080635 3300009551 Bacteria 3244
322 Ga0105238_10098788 3300009551 Bacteria 2903
323 Ga0105249_10026641 3300009553 Bacteria 5212
324 Ga0105249_10083207 3300009553 Bacteria 2978
325 Ga0105249_10126995 3300009553 Bacteria 2430
326 Ga0105239_10000015 3300010375 Bacteria 319892
327 Ga0105239_10000045 3300010375 Bacteria 186314
328 Ga0105239_10000169 3300010375 Bacteria 93659
329 Ga0105239_10001249 3300010375 Bacteria 34548
330 Ga0105239_10004544 3300010375 Bacteria 16539
331 Ga0105239_10007713 3300010375 Bacteria 12321
332 Ga0105239_10009223 3300010375 Bacteria 11160
333 Ga0105239_10043261 3300010375 Bacteria 4936
334 Ga0105239_10089158 3300010375 Bacteria 3401
335 Ga0105239_10091422 3300010375 Bacteria 3358
336 Ga0105239_10096422 3300010375 Bacteria 3268
337 Ga0105246_10006351 3300011119 Bacteria 7213
338 Ga0105246_10015315 3300011119 Bacteria 4841
339 Ga0157373_10000990 3300013100 Bacteria 21976
340 Ga0157373_10001325 3300013100 Bacteria 18952
341 Ga0157373_10007645 3300013100 Bacteria 8029
342 Ga0157373_10008001 3300013100 Bacteria 7861
343 Ga0157373_10036310 3300013100 Bacteria 3538
344 Ga0157373_10044213 3300013100 Bacteria 3180
345 Ga0157373_10057711 3300013100 Bacteria 2753
346 Ga0157371_10000074 3300013102 Bacteria 162988
347 Ga0157371_10001756 3300013102 Bacteria 21976
348 Ga0157371_10004120 3300013102 Bacteria 12826
349 Ga0157371_10007298 3300013102 Bacteria 8978
350 Ga0157371_10012771 3300013102 Bacteria 6403
351 Ga0157371_10013704 3300013102 Bacteria 6149
352 Ga0157371_10013976 3300013102 Bacteria 6078
353 Ga0157371_10014766 3300013102 Bacteria 5879
354 Ga0157371_10015504 3300013102 Bacteria 5716
355 Ga0157371_10022297 3300013102 Bacteria 4644
356 Ga0157371_10035060 3300013102 Bacteria 3597
357 Ga0157371_10053757 3300013102 Bacteria 2860
358 Ga0157370_10000160 3300013104 Bacteria 82509
359 Ga0157370_10001419 3300013104 Bacteria 29759
360 Ga0157370_10003017 3300013104 Bacteria 19989
361 Ga0157370_10006253 3300013104 Bacteria 13183
362 Ga0157370_10013165 3300013104 Bacteria 8531
363 Ga0157370_10014776 3300013104 Bacteria 7968
364 Ga0157370_10016651 3300013104 Bacteria 7439
365 Ga0157370_10020699 3300013104 Bacteria 6563
366 Ga0157370_10027089 3300013104 Bacteria 5652
367 Ga0157370_10027777 3300013104 Bacteria 5578
368 Ga0157370_10106164 3300013104 Bacteria 2628
369 Ga0157370_10117031 3300013104 Bacteria 2490
370 Ga0157370_10143782 3300013104 Bacteria 2222
371 Ga0157369_10000016 3300013105 Bacteria 257827
372 Ga0157369_10003069 3300013105 Bacteria 19939
373 Ga0157369_10005070 3300013105 Bacteria 15412
374 Ga0157369_10012219 3300013105 Bacteria 9749
375 Ga0157369_10018947 3300013105 Bacteria 7709
376 Ga0157369_10034479 3300013105 Bacteria 5554
377 Ga0157369_10052596 3300013105 Bacteria 4406
378 Ga0157369_10110031 3300013105 Bacteria 2929
379 Ga0157374_10000001 3300013296 Bacteria 1077351
380 Ga0157374_10004634 3300013296 Bacteria 11534
381 Ga0157374_10007387 3300013296 Bacteria 9373
382 Ga0157374_10012094 3300013296 Bacteria 7495
383 Ga0157374_10016264 3300013296 Bacteria 6537
384 Ga0157374_10022346 3300013296 Bacteria 5642
385 Ga0157374_10024564 3300013296 Bacteria 5404
386 Ga0157378_10000804 3300013297 Bacteria 29224
387 Ga0157378_10004694 3300013297 Bacteria 11989
388 Ga0157378_10024523 3300013297 Bacteria 5309
389 Ga0157378_10026271 3300013297 Bacteria 5133
390 Ga0163162_10000005 3300013306 Bacteria 447195
391 Ga0163162_10000437 3300013306 Bacteria 38437
392 Ga0163162_10000445 3300013306 Bacteria 38232
393 Ga0163162_10000699 3300013306 Bacteria 30970
394 Ga0163162_10006527 3300013306 Bacteria 11300
395 Ga0163162_10016216 3300013306 Bacteria 7286
396 Ga0163162_10019461 3300013306 Bacteria 6659
397 Ga0163162_10024561 3300013306 Bacteria 5951
398 Ga0163162_10026678 3300013306 Bacteria 5710
399 Ga0163162_10032943 3300013306 Bacteria 5146
400 Ga0163162_10037865 3300013306 Bacteria 4813
401 Ga0163162_10054483 3300013306 Bacteria 4023
402 Ga0163162_10104448 3300013306 Bacteria 2928
403 Ga0157372_10000026 3300013307 Bacteria 195407
404 Ga0157372_10000071 3300013307 Bacteria 109638
405 Ga0157372_10000324 3300013307 Bacteria 52514
406 Ga0157372_10000514 3300013307 Bacteria 42626
407 Ga0157372_10001013 3300013307 Bacteria 30741
408 Ga0157372_10006860 3300013307 Bacteria 12118
409 Ga0157372_10013477 3300013307 Bacteria 8737
410 Ga0157372_10018638 3300013307 Bacteria 7466
411 Ga0157372_10035377 3300013307 Bacteria 5498
412 Ga0157372_10047723 3300013307 Bacteria 4760
413 Ga0157372_10053344 3300013307 Bacteria 4506
414 Ga0157372_10061622 3300013307 Bacteria 4201
415 Ga0157372_10072039 3300013307 Bacteria 3893
416 Ga0157372_10115472 3300013307 Bacteria 3078
417 Ga0157372_10130567 3300013307 Bacteria 2890
418 Ga0157372_10133134 3300013307 Bacteria 2862
419 Ga0157375_10003798 3300013308 Bacteria 13096
420 Ga0157375_10011081 3300013308 Bacteria 7949
421 Ga0157375_10021303 3300013308 Bacteria 5940
422 Ga0157375_10023439 3300013308 Bacteria 5695
423 Ga0157375_10063235 3300013308 Bacteria 3681
424 Ga0157375_10105930 3300013308 Bacteria 2903
425 Ga0157375_10111743 3300013308 Bacteria 2832
426 Ga0157375_10170389 3300013308 Bacteria 2324
427 Ga0157375_10171026 3300013308 Bacteria 2320
428 Ga0163163_10000193 3300014325 Bacteria 62699
429 Ga0163163_10000249 3300014325 Bacteria 54997
430 Ga0163163_10005284 3300014325 Bacteria 11145
431 Ga0163163_10015150 3300014325 Bacteria 7118
432 Ga0163163_10125853 3300014325 Bacteria 2601
433 Ga0157380_10029681 3300014326 Bacteria 4181
434 Ga0157380_10065572 3300014326 Bacteria 2919
435 Ga0182008_10000014 3300014497 Bacteria 263844
436 Ga0182008_10000358 3300014497 Bacteria 35490
437 Ga0182008_10001858 3300014497 Bacteria 13732
438 Ga0157377_10004138 3300014745 Bacteria 6626
439 Ga0157377_10008097 3300014745 Bacteria 5113
440 Ga0157379_10007199 3300014968 Bacteria 9624
441 Ga0157379_10038151 3300014968 Bacteria 4286
442 Ga0157379_10043618 3300014968 Bacteria 4004
443 Ga0157379_10100003 3300014968 Bacteria 2604
444 Ga0157376_10000808 3300014969 Bacteria 20515
445 Ga0157376_10009172 3300014969 Bacteria 7177
446 Ga0157376_10012924 3300014969 Bacteria 6213
447 Ga0157376_10017840 3300014969 Bacteria 5425
448 Ga0157376_10027846 3300014969 Bacteria 4485
449 Ga0157376_10030884 3300014969 Bacteria 4283
450 Ga0157376_10109907 3300014969 Bacteria 2424
451 Ga0157376_10119911 3300014969 Bacteria 2329
452 Ga0182006_1000015 3300015261 Bacteria 325938
453 Ga0182006_1000149 3300015261 Bacteria 74752
454 Ga0182006_1001293 3300015261 Bacteria 15436
455 Ga0182007_10000002 3300015262 Bacteria 564661
456 Ga0183373_1004 3300015682 Bacteria 537398
457 Ga0163161_10000545 3300017792 Bacteria 30599
458 Ga0163161_10004401 3300017792 Bacteria 9830
459 Ga0163161_10004913 3300017792 Bacteria 9305
460 Ga0163161_10009128 3300017792 Bacteria 6854
461 Ga0163161_10009805 3300017792 Bacteria 6635
462 Ga0163161_10018046 3300017792 Bacteria 4945
463 Ga0163161_10068281 3300017792 Bacteria 2597
464 Ga0206351_10906282 3300020077 Bacteria 4067
465 Ga0206350_10809614 3300020080 Bacteria 2663
466 Ga0213872_10014693 3300021361 Bacteria 3649
467 Ga0213876_10014400 3300021384 Bacteria 4189
468 Ga0213876_10045005 3300021384 Bacteria 2334
469 Ga0224712_10003241 3300022467 Bacteria 4190
470 Ga0207427_100072 3300025231 Bacteria 158364
471 Ga0209437_100026 3300025233 Bacteria 542698
472 Ga0209437_100251 3300025233 Bacteria 85135
473 Ga0207425_1000002 3300025245 Bacteria 1362590
474 Ga0209026_1000633 3300025250 Bacteria 22062
475 Ga0209129_1000002 3300025258 Bacteria 1359086
476 Ga0209233_1000111 3300025261 Bacteria 260262
477 Ga0209233_1000796 3300025261 Bacteria 14129
478 Ga0209675_1000179 3300025291 Bacteria 71689
479 Ga0209676_1000009 3300025292 Bacteria 981719
480 Ga0209025_1000004 3300025294 Bacteria 1361782
481 Ga0209758_1000006 3300025297 Bacteria 1359562
482 Ga0209050_1000048 3300025298 Bacteria 371553
483 Ga0207426_1000132 3300025302 Bacteria 209623
484 Ga0209257_1000025 3300025304 Bacteria 724838
485 Ga0207656_10019353 3300025321 Bacteria 2693
486 Ga0207655_1000492 3300025728 Bacteria 50910
487 Ga0207653_10013171 3300025885 Bacteria 2588
488 Ga0207710_10010678 3300025900 Bacteria 3866
489 Ga0207680_10000135 3300025903 Bacteria 34875
490 Ga0207680_10000790 3300025903 Bacteria 14916
491 Ga0207680_10016445 3300025903 Bacteria 3884
492 Ga0207647_10000044 3300025904 Bacteria 90491
493 Ga0207647_10000280 3300025904 Bacteria 41619
494 Ga0207647_10002289 3300025904 Bacteria 14588
495 Ga0207647_10007727 3300025904 Bacteria 7741
496 Ga0207647_10060113 3300025904 Bacteria 2324
497 Ga0207645_10000135 3300025907 Bacteria 56584
498 Ga0207645_10000306 3300025907 Bacteria 41222
499 Ga0207645_10014107 3300025907 Bacteria 5354
500 Ga0207645_10063460 3300025907 Bacteria 2360
501 Ga0207643_10030289 3300025908 Bacteria 3011
502 Ga0207705_10000210 3300025909 Bacteria 59411
503 Ga0207705_10006335 3300025909 Bacteria 8783
504 Ga0207705_10015636 3300025909 Bacteria 5448
505 Ga0207654_10000672 3300025911 Bacteria 19232
506 Ga0207654_10001159 3300025911 Bacteria 14168
507 Ga0207654_10006499 3300025911 Bacteria 5884
508 Ga0207654_10028058 3300025911 Bacteria 3066
509 Ga0207707_10000205 3300025912 Bacteria 62610
510 Ga0207707_10046982 3300025912 Bacteria 3760
511 Ga0207707_10058316 3300025912 Bacteria 3360
512 Ga0207695_10000001 3300025913 Bacteria 2888630
513 Ga0207695_10000047 3300025913 Bacteria 422459
514 Ga0207695_10000179 3300025913 Bacteria 185564
515 Ga0207695_10000232 3300025913 Bacteria 147559
516 Ga0207695_10000460 3300025913 Bacteria 88380
517 Ga0207695_10000962 3300025913 Bacteria 51331
518 Ga0207695_10001203 3300025913 Bacteria 44471
519 Ga0207695_10002931 3300025913 Bacteria 24635
520 Ga0207695_10003319 3300025913 Bacteria 22807
521 Ga0207695_10003840 3300025913 Bacteria 20797
522 Ga0207695_10005627 3300025913 Bacteria 16547
523 Ga0207695_10020868 3300025913 Bacteria 7486
524 Ga0207695_10023123 3300025913 Bacteria 7034
525 Ga0207695_10033370 3300025913 Bacteria 5615
526 Ga0207695_10046365 3300025913 Bacteria 4607
527 Ga0207695_10065069 3300025913 Bacteria 3750
528 Ga0207695_10079295 3300025913 Bacteria 3328
529 Ga0207695_10081724 3300025913 Bacteria 3269
530 Ga0207671_10000441 3300025914 Bacteria 57099
531 Ga0207671_10000982 3300025914 Bacteria 35278
532 Ga0207671_10002256 3300025914 Bacteria 20880
533 Ga0207671_10003343 3300025914 Bacteria 16099
534 Ga0207671_10005449 3300025914 Bacteria 11714
535 Ga0207671_10007556 3300025914 Bacteria 9412
536 Ga0207671_10008216 3300025914 Bacteria 8889
537 Ga0207671_10016469 3300025914 Bacteria 5743
538 Ga0207671_10064837 3300025914 Bacteria 2716
539 Ga0207660_10000843 3300025917 Bacteria 20195
540 Ga0207660_10009061 3300025917 Bacteria 6446
541 Ga0207657_10001302 3300025919 Bacteria 26488
542 Ga0207657_10002799 3300025919 Bacteria 18777
543 Ga0207657_10022148 3300025919 Bacteria 5960
544 Ga0207657_10041978 3300025919 Bacteria 4039
545 Ga0207657_10045574 3300025919 Bacteria 3847
546 Ga0207657_10047164 3300025919 Bacteria 3769
547 Ga0207657_10081451 3300025919 Bacteria 2719
548 Ga0207649_10011811 3300025920 Bacteria 4830
549 Ga0207649_10027658 3300025920 Bacteria 3331
550 Ga0207652_10000064 3300025921 Bacteria 111997
551 Ga0207652_10000186 3300025921 Bacteria 65493
552 Ga0207652_10000967 3300025921 Bacteria 26823
553 Ga0207652_10001125 3300025921 Bacteria 24079
554 Ga0207652_10004578 3300025921 Bacteria 11216
555 Ga0207652_10008524 3300025921 Bacteria 8251
556 Ga0207652_10053242 3300025921 Bacteria 3476
557 Ga0207652_10134235 3300025921 Bacteria 2209
558 Ga0207681_10098197 3300025923 Bacteria 2106
559 Ga0207694_10000365 3300025924 Bacteria 42492
560 Ga0207694_10001434 3300025924 Bacteria 20459
561 Ga0207694_10006285 3300025924 Bacteria 9071
562 Ga0207694_10008026 3300025924 Bacteria 7983
563 Ga0207694_10011944 3300025924 Bacteria 6547
564 Ga0207694_10045907 3300025924 Bacteria 3376
565 Ga0207694_10068129 3300025924 Bacteria 2778
566 Ga0207650_10001962 3300025925 Bacteria 14440
567 Ga0207650_10027848 3300025925 Bacteria 4048
568 Ga0207650_10063750 3300025925 Bacteria 2756
569 Ga0207659_10034177 3300025926 Bacteria 3504
570 Ga0207659_10046657 3300025926 Bacteria 3061
571 Ga0207659_10056273 3300025926 Bacteria 2816
572 Ga0207659_10075500 3300025926 Bacteria 2474
573 Ga0207687_10003289 3300025927 Bacteria 10934
574 Ga0207687_10014531 3300025927 Bacteria 5153
575 Ga0207687_10033191 3300025927 Bacteria 3500
576 Ga0207700_10023717 3300025928 Bacteria 4237
577 Ga0207644_10001671 3300025931 Bacteria 14296
578 Ga0207644_10006328 3300025931 Bacteria 7709
579 Ga0207644_10082766 3300025931 Bacteria 2375
580 Ga0207690_10000361 3300025932 Bacteria 30094
581 Ga0207690_10004696 3300025932 Bacteria 8067
582 Ga0207690_10049287 3300025932 Bacteria 2807
583 Ga0207706_10002722 3300025933 Bacteria 17218
584 Ga0207706_10007721 3300025933 Bacteria 9932
585 Ga0207706_10014390 3300025933 Bacteria 7170
586 Ga0207706_10022674 3300025933 Bacteria 5635
587 Ga0207706_10027852 3300025933 Bacteria 5051
588 Ga0207706_10046621 3300025933 Bacteria 3837
589 Ga0207706_10056023 3300025933 Bacteria 3476
590 Ga0207706_10099925 3300025933 Bacteria 2553
591 Ga0207686_10008918 3300025934 Bacteria 5428
592 Ga0207686_10033120 3300025934 Bacteria 3081
593 Ga0207709_10000008 3300025935 Bacteria 713099
594 Ga0207709_10000544 3300025935 Bacteria 32275
595 Ga0207709_10039582 3300025935 Bacteria 2816
596 Ga0207670_10019364 3300025936 Bacteria 4157
597 Ga0207704_10000019 3300025938 Bacteria 152734
598 Ga0207704_10079027 3300025938 Bacteria 2118
599 Ga0207691_10002208 3300025940 Bacteria 19051
600 Ga0207691_10007147 3300025940 Bacteria 10773
601 Ga0207691_10022714 3300025940 Bacteria 5914
602 Ga0207691_10041579 3300025940 Bacteria 4242
603 Ga0207691_10114421 3300025940 Bacteria 2397
604 Ga0207691_10174453 3300025940 Bacteria 1881
605 Ga0207711_10000023 3300025941 Bacteria 327296
606 Ga0207711_10002802 3300025941 Bacteria 15322
607 Ga0207711_10010632 3300025941 Bacteria 7655
608 Ga0207711_10016320 3300025941 Bacteria 6170
609 Ga0207689_10001157 3300025942 Bacteria 25398
610 Ga0207689_10001865 3300025942 Bacteria 19957
611 Ga0207689_10003632 3300025942 Bacteria 14091
612 Ga0207689_10004896 3300025942 Bacteria 12077
613 Ga0207689_10008304 3300025942 Bacteria 9046
614 Ga0207689_10008323 3300025942 Bacteria 9036
615 Ga0207689_10098622 3300025942 Bacteria 2400
616 Ga0207661_10004721 3300025944 Bacteria 9541
617 Ga0207661_10083211 3300025944 Bacteria 2648
618 Ga0207679_10003237 3300025945 Bacteria 10046
619 Ga0207679_10035236 3300025945 Bacteria 3539
620 Ga0207667_10000033 3300025949 Bacteria 314353
621 Ga0207667_10000087 3300025949 Bacteria 149828
622 Ga0207667_10000111 3300025949 Bacteria 131758
623 Ga0207667_10000218 3300025949 Bacteria 80364
624 Ga0207667_10000549 3300025949 Bacteria 49364
625 Ga0207667_10001284 3300025949 Bacteria 31480
626 Ga0207667_10003821 3300025949 Bacteria 18514
627 Ga0207667_10004600 3300025949 Bacteria 16926
628 Ga0207667_10013504 3300025949 Bacteria 9339
629 Ga0207667_10021551 3300025949 Bacteria 7139
630 Ga0207667_10025511 3300025949 Bacteria 6468
631 Ga0207667_10037487 3300025949 Bacteria 5181
632 Ga0207667_10060470 3300025949 Bacteria 3965
633 Ga0207667_10061519 3300025949 Bacteria 3927
634 Ga0207667_10064852 3300025949 Bacteria 3811
635 Ga0207651_10000296 3300025960 Bacteria 21316
636 Ga0207651_10002179 3300025960 Bacteria 9270
637 Ga0207651_10007315 3300025960 Bacteria 5870
638 Ga0207651_10027303 3300025960 Bacteria 3584
639 Ga0207712_10016515 3300025961 Bacteria 4783
640 Ga0207712_10079243 3300025961 Bacteria 2386
641 Ga0207668_10000272 3300025972 Bacteria 34458
642 Ga0207640_10017605 3300025981 Bacteria 4184
643 Ga0207658_10002352 3300025986 Bacteria 13898
644 Ga0207658_10003050 3300025986 Bacteria 11979
645 Ga0207658_10003314 3300025986 Bacteria 11430
646 Ga0207658_10013024 3300025986 Bacteria 5680
647 Ga0207658_10018448 3300025986 Bacteria 4818
648 Ga0207658_10054583 3300025986 Bacteria 2957
649 Ga0207677_10001377 3300026023 Bacteria 12974
650 Ga0207677_10009544 3300026023 Bacteria 5462
651 Ga0207677_10027181 3300026023 Bacteria 3599
652 Ga0207677_10055550 3300026023 Bacteria 2708
653 Ga0207677_10058828 3300026023 Bacteria 2648
654 Ga0207677_10060048 3300026023 Bacteria 2626
655 Ga0207677_10069977 3300026023 Bacteria 2470
656 Ga0207677_10074904 3300026023 Bacteria 2404
657 Ga0207703_10004858 3300026035 Bacteria 10937
658 Ga0207703_10028936 3300026035 Bacteria 4372
659 Ga0207703_10038402 3300026035 Bacteria 3821
660 Ga0207639_10002247 3300026041 Bacteria 12984
661 Ga0207639_10002486 3300026041 Bacteria 12352
662 Ga0207639_10012203 3300026041 Bacteria 5978
663 Ga0207639_10022322 3300026041 Bacteria 4558
664 Ga0207639_10027733 3300026041 Bacteria 4129
665 Ga0207639_10047523 3300026041 Bacteria 3244
666 Ga0207678_10025327 3300026067 Bacteria 5179
667 Ga0207678_10032087 3300026067 Bacteria 4579
668 Ga0207708_10078480 3300026075 Bacteria 2535
669 Ga0207702_10000194 3300026078 Bacteria 71816
670 Ga0207702_10001197 3300026078 Bacteria 26319
671 Ga0207702_10005834 3300026078 Bacteria 10710
672 Ga0207702_10010074 3300026078 Bacteria 7922
673 Ga0207702_10059674 3300026078 Bacteria 3249
674 Ga0207702_10097163 3300026078 Bacteria 2592
675 Ga0207641_10000158 3300026088 Bacteria 96378
676 Ga0207641_10000539 3300026088 Bacteria 42499
677 Ga0207641_10003749 3300026088 Bacteria 13360
678 Ga0207641_10045803 3300026088 Bacteria 3685
679 Ga0207648_10000061 3300026089 Bacteria 101034
680 Ga0207648_10000786 3300026089 Bacteria 35737
681 Ga0207648_10002643 3300026089 Bacteria 19141
682 Ga0207648_10003171 3300026089 Bacteria 17337
683 Ga0207648_10011997 3300026089 Bacteria 8132
684 Ga0207648_10015000 3300026089 Bacteria 7137
685 Ga0207648_10059941 3300026089 Bacteria 3319
686 Ga0207648_10101376 3300026089 Bacteria 2523
687 Ga0207648_10151976 3300026089 Bacteria 2043
688 Ga0207648_10165320 3300026089 Bacteria 1955
689 Ga0207676_10001574 3300026095 Bacteria 16766
690 Ga0207676_10006059 3300026095 Bacteria 8532
691 Ga0207676_10016570 3300026095 Bacteria 5337
692 Ga0207676_10020687 3300026095 Bacteria 4817
693 Ga0207674_10001723 3300026116 Bacteria 27962
694 Ga0207674_10019660 3300026116 Bacteria 7313
695 Ga0207674_10026118 3300026116 Bacteria 6213
696 Ga0207674_10078689 3300026116 Bacteria 3302
697 Ga0207674_10131916 3300026116 Bacteria 2461
698 Ga0207675_100004088 3300026118 Bacteria 14122
699 Ga0207675_100013718 3300026118 Bacteria 7561
700 Ga0207675_100040039 3300026118 Bacteria 4373
701 Ga0207675_100040221 3300026118 Bacteria 4365
702 Ga0207675_100040254 3300026118 Bacteria 4363
703 Ga0207683_10002798 3300026121 Bacteria 15232
704 Ga0207683_10004166 3300026121 Bacteria 12518
705 Ga0207683_10004426 3300026121 Bacteria 12145
706 Ga0207683_10024259 3300026121 Bacteria 5222
707 Ga0207698_10000052 3300026142 Bacteria 83049
708 Ga0207698_10000410 3300026142 Bacteria 24725
709 Ga0207698_10005000 3300026142 Bacteria 8133
710 Ga0207698_10006710 3300026142 Bacteria 7192
711 Ga0207698_10010692 3300026142 Bacteria 5918
712 Ga0207698_10076880 3300026142 Bacteria 2674
713 Ga0207698_10086515 3300026142 Bacteria 2549
714 Ga0207428_10018183 3300027907 Bacteria 6010
715 Ga0268266_10000032 3300028379 Bacteria 395079
716 Ga0268266_10000102 3300028379 Bacteria 179754
717 Ga0268266_10002971 3300028379 Bacteria 17479
718 Ga0268266_10063540 3300028379 Bacteria 3187
719 Ga0268266_10069849 3300028379 Bacteria 3044
720 Ga0268266_10122889 3300028379 Bacteria 2312
721 Ga0268265_10010187 3300028380 Bacteria 6345
722 Ga0268265_10038301 3300028380 Bacteria 3526
723 Ga0268265_10093173 3300028380 Bacteria 2413
724 Ga0268264_10000011 3300028381 Bacteria 580884
725 Ga0268264_10001129 3300028381 Bacteria 26168
726 Ga0268264_10001678 3300028381 Bacteria 20388
727 Ga0268264_10009319 3300028381 Bacteria 8129
728 Ga0268264_10011706 3300028381 Bacteria 7234
729 Ga0268264_10013291 3300028381 Bacteria 6778
730 Ga0268264_10080760 3300028381 Bacteria 2777
731 Ga0265326_10006763 3300028558 Bacteria 3542
732 Ga0265318_10015811 3300028577 Bacteria 3129
733 Ga0265323_10008461 3300028653 Bacteria 4242
734 Ga0307517_10006124 3300028786 Bacteria 17916
735 Ga0307517_10047742 3300028786 Bacteria 4428
736 Ga0307515_10000001 3300028794 Bacteria 4259510
737 Ga0307515_10000074 3300028794 Bacteria 229874
738 Ga0307515_10002716 3300028794 Bacteria 37857
739 Ga0307515_10016696 3300028794 Bacteria 13425
740 Ga0307515_10029646 3300028794 Bacteria 9236
741 Ga0265338_10012310 3300028800 Bacteria 9763
742 Ga0265338_10014452 3300028800 Bacteria 8786
743 Ga0265338_10021733 3300028800 Bacteria 6674
744 Ga0265338_10084856 3300028800 Bacteria 2642
745 Ga0307511_10000673 3300030521 Bacteria 36415
746 Ga0316177_1067390 3300030731 Bacteria 9118
747 Ga0316176_1102439 3300030732 Bacteria 5412
748 Ga0316183_1003610 3300030742 Bacteria 136078
749 Ga0316181_1144023 3300030744 Bacteria 9457
750 Ga0265330_10000123 3300031235 Bacteria 63356
751 Ga0265330_10000153 3300031235 Bacteria 55577
752 Ga0265330_10000854 3300031235 Bacteria 19006
753 Ga0265330_10001992 3300031235 Bacteria 11339
754 Ga0265330_10004423 3300031235 Bacteria 7133
755 Ga0265330_10008652 3300031235 Bacteria 4885
756 Ga0265332_10011849 3300031238 Bacteria 3873
757 Ga0265332_10030014 3300031238 Bacteria 2375
758 Ga0265328_10008335 3300031239 Bacteria 4282
759 Ga0265328_10020062 3300031239 Bacteria 2561
760 Ga0265320_10032511 3300031240 Bacteria 2669
761 Ga0265325_10000041 3300031241 Bacteria 92181
762 Ga0265325_10000785 3300031241 Bacteria 22985
763 Ga0265325_10007941 3300031241 Bacteria 6304
764 Ga0265325_10019301 3300031241 Bacteria 3771
765 Ga0265325_10023388 3300031241 Bacteria 3374
766 Ga0265325_10028974 3300031241 Bacteria 2979
767 Ga0265340_10004286 3300031247 Bacteria 7998
768 Ga0265340_10015099 3300031247 Bacteria 4019
769 Ga0265340_10020963 3300031247 Bacteria 3352
770 Ga0265340_10041181 3300031247 Bacteria 2272
771 Ga0265339_10000184 3300031249 Bacteria 53061
772 Ga0265339_10005643 3300031249 Bacteria 8303
773 Ga0265339_10007352 3300031249 Bacteria 7130
774 Ga0265339_10007645 3300031249 Bacteria 6959
775 Ga0265327_10000152 3300031251 Bacteria 149065
776 Ga0265327_10000440 3300031251 Bacteria 75453
777 Ga0265327_10001191 3300031251 Bacteria 35202
778 Ga0265316_10000068 3300031344 Bacteria 108687
779 Ga0265316_10002794 3300031344 Bacteria 17891
780 Ga0265316_10004765 3300031344 Bacteria 13400
781 Ga0265316_10006591 3300031344 Bacteria 11068
782 Ga0265316_10028078 3300031344 Bacteria 4646
783 Ga0265316_10088761 3300031344 Bacteria 2360
784 Ga0265316_10092869 3300031344 Bacteria 2300
785 Ga0265316_10115499 3300031344 Bacteria 2029
786 Ga0307513_10075092 3300031456 Bacteria 3512
787 Ga0307509_10103305 3300031507 Bacteria 2878
788 Ga0307408_100000143 3300031548 Bacteria 79423
789 Ga0307408_100002433 3300031548 Bacteria 13087
790 Ga0307408_100004072 3300031548 Bacteria 9971
791 Ga0265313_10003068 3300031595 Bacteria 13855
792 Ga0265313_10036852 3300031595 Bacteria 2452
793 Ga0307508_10001210 3300031616 Bacteria 29576
794 Ga0265314_10001814 3300031711 Bacteria 23024
795 Ga0265314_10008735 3300031711 Bacteria 8660
796 Ga0265342_10000917 3300031712 Bacteria 29252
797 Ga0265342_10003604 3300031712 Bacteria 12629
798 Ga0265342_10004003 3300031712 Bacteria 11788
799 Ga0265342_10008363 3300031712 Bacteria 7427
800 Ga0265342_10034964 3300031712 Bacteria 3079
801 Ga0316576_10070898 3300031727 Bacteria 2570
802 Ga0316578_10063865 3300031728 Bacteria 2172
803 Ga0307516_10002603 3300031730 Bacteria 23956
804 Ga0307405_10000006 3300031731 Bacteria 361477
805 Ga0316577_10000061 3300031733 Bacteria 26270
806 Ga0307407_10000031 3300031903 Bacteria 87995
807 Ga0307412_10000019 3300031911 Bacteria 266611
808 Ga0307412_10000029 3300031911 Bacteria 209074
809 Ga0307412_10019630 3300031911 Bacteria 4098
810 Ga0307412_10050829 3300031911 Bacteria 2737
811 Ga0307409_100023026 3300031995 Bacteria 4307
812 Ga0307416_100000002 3300032002 Bacteria 509907
813 Ga0307416_100000004 3300032002 Bacteria 505535
814 Ga0307414_10000776 3300032004 Bacteria 16353
815 Ga0307414_10005750 3300032004 Bacteria 6851
816 Ga0307414_10038059 3300032004 Bacteria 3226
817 Ga0307414_10043695 3300032004 Bacteria 3054
818 Ga0307507_10000034 3300033179 Bacteria 188697
819 Ga0307510_10006676 3300033180 Bacteria 13756
820 Ga0307510_10019806 3300033180 Bacteria 7879
821 Ga0373955_0023593 3300035172 Bacteria 3136
822 Ga0373924_0006668 3300035410 Bacteria 4142
823 Ga0373924_0036055 3300035410 Bacteria 2008
824 Ga0373933_0049108 3300035724 Bacteria 2515
825 Ga0373937_0019497 3300036401 Bacteria 6070
826 Ga0373937_0230019 3300036401 Bacteria 1746
827 Ga0316584_0002129 3300036712 Bacteria 12391
828 Ga0395899_0000011 3300037312 Bacteria 521331
829 Ga0395899_0000055 3300037312 Bacteria 220579
830 Ga0395899_0000726 3300037312 Bacteria 32936
831 Ga0395899_0009107 3300037312 Bacteria 7626
832 Ga0395899_0010495 3300037312 Bacteria 7093
833 Ga0395899_0011086 3300037312 Bacteria 6903
834 Ga0395899_0028035 3300037312 Bacteria 4241
835 Ga0395900_0000173 3300037418 Bacteria 103767
836 Ga0395900_0000541 3300037418 Bacteria 52877
837 Ga0395900_0007879 3300037418 Bacteria 10970
838 Ga0395900_0013989 3300037418 Bacteria 8190
839 Ga0395900_0045279 3300037418 Bacteria 4532
840 Ga0395898_0002029 3300037466 Bacteria 25368
841 Ga0395898_0002849 3300037466 Bacteria 19773
842 Ga0395898_0011571 3300037466 Bacteria 9161
843 Ga0395905_0002917 3300037471 Bacteria 18641
844 Ga0395905_0014577 3300037471 Bacteria 7497
845 Ga0395905_0019113 3300037471 Bacteria 6499
846 Ga0395905_0053430 3300037471 Bacteria 3781
847 Ga0436364_0257896 3300037853 Bacteria 53998
848 Ga0436364_0337910 3300037853 Bacteria 17987
849 Ga0395901_0003913 3300038443 Bacteria 14984
850 Ga0395901_0068624 3300038443 Bacteria 3693
851 Ga0395901_0086074 3300038443 Bacteria 3286
852 Ga0436365_0124513 3300039437 Bacteria 12264
853 Ga0436365_0744728 3300039437 Bacteria 34476
854 Ga0436365_0864707 3300039437 Bacteria 54217
855 Ga0436365_1082470 3300039437 Bacteria 2401
856 Ga0436365_1879596 3300039437 Bacteria 24111
857 Ga0439449_0001673 3300042007 Bacteria 8719
858 Ga0439457_000620 3300042014 Bacteria 10490
859 Ga0451577_0009669 3300042876 Bacteria 9253
860 Ga0451577_0024886 3300042876 Bacteria 5438
861 Ga0451577_0039199 3300042876 Bacteria 4258
862 Ga0466969_0000778 3300044656 Bacteria 17395
863 Ga0466972_0000004 3300044658 Bacteria 314413
864 Ga0466972_0000095 3300044658 Bacteria 77981
865 Ga0466972_0000579 3300044658 Bacteria 17790
866 Ga0466961_0004336 3300044693 Bacteria 8886
867 Ga0466963_0063419 3300044694 Bacteria 2473
868 Ga0453684_0007097 3300044712 Bacteria 20886
869 Ga0453684_0007618 3300044712 Bacteria 19832
870 Ga0453684_0012031 3300044712 Bacteria 14383
871 Ga0453684_0021609 3300044712 Bacteria 9601
872 Ga0453684_0092637 3300044712 Bacteria 3724
873 Ga0453684_0120888 3300044712 Bacteria 3162
874 Ga0453684_0185927 3300044712 Bacteria 2435
875 Ga0466970_0000518 3300044765 Bacteria 18999
876 Ga0466957_0000423 3300044842 Bacteria 20805
877 Ga0466959_0000125 3300045049 Bacteria 49909
878 Ga0466959_0102215 3300045049 Bacteria 2051
879 Ga0451576_0007702 3300045051 Bacteria 12806
880 Ga0451576_0051039 3300045051 Bacteria 4337
881 Ga0466967_0020795 3300045976 Bacteria 5315
882 Ga0495627_000003 3300046453 Bacteria 704557
883 Ga0495627_004693 3300046453 Bacteria 5652
884 Ga0495590_0004043 3300046457 Bacteria 5951
885 Ga0495629_0049223 3300046459 Bacteria 2954
886 Ga0495629_0076457 3300046459 Bacteria 2338
887 Ga0495650_0000107 3300046471 Bacteria 200864
888 Ga0495650_0030127 3300046471 Bacteria 2462
889 Ga0495580_0062746 3300046472 Bacteria 2607
890 Ga0495585_0000014 3300046492 Bacteria 187513
891 Ga0495596_0005212 3300046500 Bacteria 6180
892 Ga0495606_0000303 3300046507 Bacteria 84874
893 Ga0495606_0003492 3300046507 Bacteria 16646
894 Ga0495606_0019559 3300046507 Bacteria 5031
895 Ga0495606_0019848 3300046507 Bacteria 4978
896 Ga0495608_0032472 3300046511 Bacteria 3528
897 Ga0495610_0000001 3300046512 Bacteria 1620061
898 Ga0495610_0000967 3300046512 Bacteria 26569
899 Ga0495610_0003739 3300046512 Bacteria 11647
900 Ga0495616_0005202 3300046513 Bacteria 8048
901 Ga0495616_0011517 3300046513 Bacteria 5061
902 Ga0495628_0037066 3300046516 Bacteria 3910
903 Ga0495628_0051315 3300046516 Bacteria 3261
904 Ga0495630_0001261 3300046517 Bacteria 17462
905 Ga0495630_0052405 3300046517 Bacteria 3055
906 Ga0495637_0004191 3300046520 Bacteria 7486
907 Ga0495643_0001316 3300046522 Bacteria 23535
908 Ga0495648_0013720 3300046524 Bacteria 5972
909 Ga0495648_0017653 3300046524 Bacteria 5090
910 Ga0495652_0134483 3300046529 Bacteria 1953
911 Ga0495652_0134667 3300046529 Bacteria 1951
912 Ga0495654_0000001 3300046530 Bacteria 1513197
913 Ga0495587_0020543 3300046536 Bacteria 4075
914 Ga0495645_0003703 3300046543 Bacteria 10388
915 Ga0495633_0000002 3300046558 Bacteria 488754
916 Ga0495633_0000021 3300046558 Bacteria 227171
917 Ga0495633_0013940 3300046558 Bacteria 4215
918 Ga0495668_0000165 3300046616 Bacteria 98016
919 Ga0495634_0014817 3300046642 Bacteria 5607
920 Ga0495611_0000385 3300046648 Bacteria 28165
921 Ga0495625_0000021 3300046660 Bacteria 282133
922 Ga0495625_0002553 3300046660 Bacteria 19570
923 Ga0495625_0006168 3300046660 Bacteria 10738
924 Ga0495625_0067298 3300046660 Bacteria 2521
925 Ga0495625_0090890 3300046660 Bacteria 2111
926 Ga0495635_0062645 3300046663 Bacteria 2554
927 Ga0495661_0002333 3300046665 Bacteria 14641
928 Ga0495661_0004477 3300046665 Bacteria 10080
929 Ga0495661_0008530 3300046665 Bacteria 7084
930 Ga0495658_0009737 3300046683 Bacteria 4793
931 Ga0495613_0002821 3300046689 Bacteria 13042
932 Ga0495613_0027882 3300046689 Bacteria 4204
933 Ga0495670_0010198 3300046691 Bacteria 4621
934 Ga0495649_0000009 3300046694 Bacteria 451725
935 Ga0495660_0009017 3300046810 Bacteria 5828
936 Ga0495604_0026092 3300047317 Bacteria 4652
937 Ga0495674_0053305 3300047319 Bacteria 3556
938 Ga0495674_0076464 3300047319 Bacteria 2880
939 Ga0495687_000001 3300047443 Bacteria 1215582
940 Ga0495687_000586 3300047443 Bacteria 42692
941 Ga0495687_002100 3300047443 Bacteria 16729
942 Ga0495673_0011664 3300047469 Bacteria 4713
943 Ga0495684_0000682 3300047471 Bacteria 27327
944 Ga0495684_0120639 3300047471 Bacteria 1975
945 Ga0495686_0000004 3300047472 Bacteria 869019
946 Ga0495686_0000772 3300047472 Bacteria 42035
947 Ga0495686_0001407 3300047472 Bacteria 26513
948 Ga0495686_0001408 3300047472 Bacteria 26462
949 Ga0495686_0003005 3300047472 Bacteria 14986
950 Ga0495686_0007062 3300047472 Bacteria 8470
951 Ga0495686_0009495 3300047472 Bacteria 6997
952 Ga0496101_0006897 3300048904 Bacteria 7332
953 Ga0496101_0012662 3300048904 Bacteria 5637
954 Ga0496104_0033960 3300048907 Bacteria 4755
955 Ga0496104_0054853 3300048907 Bacteria 3767
956 Ga0496106_0029416 3300048909 Bacteria 4094
957 Ga0496110_0129908 3300048913 Bacteria 2274
958 Ga0496112_0054973 3300048915 Bacteria 3912
959 Ga0496114_0000416 3300048917 Bacteria 31603
960 Ga0496115_0023903 3300048918 Bacteria 4745
961 Ga0496115_0139373 3300048918 Bacteria 2001
962 Ga0496116_0000027 3300048919 Bacteria 448077
963 Ga0496116_0024733 3300048919 Bacteria 4432
964 Ga0496117_0000021 3300048920 Bacteria 444168
965 Ga0496117_0000107 3300048920 Bacteria 187748
966 Ga0496117_0004347 3300048920 Bacteria 15722
967 Ga0496118_0000531 3300048921 Bacteria 62520
968 Ga0496118_0022333 3300048921 Bacteria 5536
969 Ga0496119_0000004 3300048922 Bacteria 536344
970 Ga0496122_0000119 3300048925 Bacteria 182576
971 Ga0496122_0000344 3300048925 Bacteria 100498
972 Ga0496122_0000376 3300048925 Bacteria 95506
973 Ga0496122_0001365 3300048925 Bacteria 39692
974 Ga0496122_0004219 3300048925 Bacteria 18062
975 Ga0496122_0016702 3300048925 Bacteria 6919
976 Ga0496122_0025946 3300048925 Bacteria 5072
977 Ga0496123_0003274 3300048926 Bacteria 18349
978 Ga0496123_0010620 3300048926 Bacteria 8103
979 Ga0496123_0028964 3300048926 Bacteria 4088
980 Ga0496123_0033074 3300048926 Bacteria 3728
981 Ga0496124_0000526 3300048927 Bacteria 65165
982 Ga0496125_0000169 3300048928 Bacteria 145879
983 Ga0496126_0000744 3300048929 Bacteria 59025
984 Ga0496126_0004594 3300048929 Bacteria 16374
985 Ga0495678_002150 3300049459 Bacteria 13929
986 Ga0501032_0022083 3300049569 Bacteria 4417
987 Ga0501033_0012882 3300049570 Bacteria 6379
988 Ga0501033_0020212 3300049570 Bacteria 5033
989 Ga0501033_0086365 3300049570 Bacteria 2297
990 Ga0501034_0009300 3300049571 Bacteria 10294
991 Ga0501034_0023079 3300049571 Bacteria 6340
992 Ga0501034_0025486 3300049571 Bacteria 6022
993 Ga0501034_0031443 3300049571 Bacteria 5390
994 Ga0501034_0032204 3300049571 Bacteria 5326
995 Ga0501034_0038864 3300049571 Bacteria 4820
996 Ga0501036_0068940 3300049572 Bacteria 2993
997 Ga0501036_0080723 3300049572 Bacteria 2749
998 Ga0501036_0111026 3300049572 Bacteria 2317
999 Ga0501036_0199113 3300049572 Bacteria 1685
1000 Ga0501037_0058222 3300049573 Bacteria 2820
1001 Ga0501038_0147561 3300049574 Bacteria 1919
1002 Ga0501039_0032231 3300049575 Bacteria 4039
1003 Ga0501039_0038498 3300049575 Bacteria 3693
1004 Ga0501039_0046707 3300049575 Bacteria 3346
1005 Ga0501039_0149928 3300049575 Bacteria 1832
1006 Ga0501040_0001751 3300049576 Bacteria 13950
1007 Ga0501042_0015393 3300049578 Bacteria 5237
1008 Ga0501043_0015230 3300049579 Bacteria 6022
1009 Ga0501043_0015402 3300049579 Bacteria 5988
1010 Ga0501043_0022086 3300049579 Bacteria 4994
1011 Ga0501046_0008978 3300049580 Bacteria 8680
1012 Ga0501046_0116134 3300049580 Bacteria 2040
1013 Ga0501047_0018111 3300049581 Bacteria 6750
1014 Ga0501047_0032779 3300049581 Bacteria 5015
1015 Ga0501047_0042741 3300049581 Bacteria 4378
1016 Ga0501048_0010094 3300049582 Bacteria 7066
1017 Ga0501048_0030544 3300049582 Bacteria 3898
1018 Ga0501067_0014825 3300049583 Bacteria 4313
1019 Ga0501068_0022202 3300049584 Bacteria 3709
1020 Ga0501070_0030975 3300049586 Bacteria 4481
1021 Ga0501070_0032613 3300049586 Bacteria 4359
1022 Ga0501071_0040725 3300049587 Bacteria 3325
1023 Ga0501071_0050392 3300049587 Bacteria 2999
1024 Ga0501072_0010677 3300049588 Bacteria 6993
1025 Ga0501072_0084230 3300049588 Bacteria 2521
1026 Ga0501072_0087601 3300049588 Bacteria 2471
1027 Ga0501073_0013211 3300049589 Bacteria 6018
1028 Ga0501073_0035438 3300049589 Bacteria 3548
1029 Ga0501073_0087081 3300049589 Bacteria 2172
1030 Ga0501074_0021554 3300049590 Bacteria 4679
1031 Ga0501074_0137484 3300049590 Bacteria 1748
1032 Ga0501075_0004548 3300049591 Bacteria 9401
1033 Ga0501075_0056230 3300049591 Bacteria 2962
1034 Ga0501076_0005355 3300049592 Bacteria 9215
1035 Ga0501076_0012693 3300049592 Bacteria 6307
1036 Ga0501076_0051965 3300049592 Bacteria 3245
1037 Ga0501076_0094591 3300049592 Bacteria 2406
1038 Ga0501077_0005464 3300049593 Bacteria 7737
1039 Ga0501077_0060639 3300049593 Bacteria 2401
1040 Ga0501223_000421 3300049663 Bacteria 10268
1041 Ga0501224_002098 3300049664 Bacteria 2701
1042 Ga0501233_006883 3300049668 Bacteria 2150
1043 Ga0501242_000172 3300049674 Bacteria 4922
1044 Ga0501250_000838 3300049680 Bacteria 2290
1045 Ga0501259_000442 3300049688 Bacteria 6569
1046 Ga0501259_000985 3300049688 Bacteria 4732
1047 Ga0501225_0003642 3300049705 Bacteria 4640
1048 Ga0501079_0008095 3300049741 Bacteria 7963
1049 Ga0501079_0088434 3300049741 Bacteria 2399
1050 Ga0501079_0110172 3300049741 Bacteria 2139
1051 Ga0501080_0011276 3300049742 Bacteria 8182
1052 Ga0501080_0053548 3300049742 Bacteria 3757
1053 Ga0501080_0083240 3300049742 Bacteria 2972
1054 Ga0501081_0000624 3300049743 Bacteria 20161
1055 Ga0501241_003128 3300049758 Bacteria 3151
1056 Ga0501035_0026655 3300049822 Bacteria 5287
1057 Ga0501035_0050648 3300049822 Bacteria 3721
1058 Ga0501035_0054161 3300049822 Bacteria 3585
1059 Ga0501044_0003228 3300049823 Bacteria 18353
1060 Ga0501044_0009540 3300049823 Bacteria 10569
1061 Ga0501044_0019651 3300049823 Bacteria 7221
1062 Ga0501044_0022960 3300049823 Bacteria 6641
1063 Ga0501044_0031786 3300049823 Bacteria 5551
1064 Ga0501044_0051702 3300049823 Bacteria 4236
1065 Ga0501045_0051903 3300049824 Bacteria 2993
1066 Ga0501284_00027 3300050005 Bacteria 76239
1067 nmdc:mga0k408_32055_c1 3300050493 Bacteria 3002
1068 nmdc:mga0k408_372_c1 3300050493 Bacteria 24584
1069 nmdc:mga05p37_236500_c1 3300050507 Bacteria 2198
1070 nmdc:mga05p37_5638_c1 3300050507 Bacteria 14717
1071 nmdc:mga0qj67_27150_c1 3300050509 Bacteria 4434
1072 nmdc:mga0qj67_54657_c1 3300050509 Bacteria 3162
1073 nmdc:mga06r32_8029_c1 3300050510 Bacteria 9493
1074 nmdc:mga08y16_31623_c1 3300050511 Bacteria 5566
1075 nmdc:mga08y16_61858_c1 3300050511 Bacteria 3909
1076 nmdc:mga08y16_88771_c1 3300050511 Bacteria 3222
1077 Ga0495601_0059046 3300053077 Bacteria 2432
1078 Ga0500635_0004277 3300053080 Bacteria 3667
1079 Ga0495619_0038817 3300053085 Bacteria 3107
1080 Ga0500578_0001498 3300053086 Bacteria 23150
1081 Ga0500578_0048202 3300053086 Bacteria 2734
1082 Ga0500643_004342 3300053087 Bacteria 6461
1083 Ga0500644_0021667 3300053088 Bacteria 1929
1084 Ga0500651_0000302 3300053093 Bacteria 28484
1085 Ga0500562_000062 3300053108 Bacteria 53042
1086 Ga0500618_000245 3300053125 Bacteria 43176
1087 Ga0500618_006010 3300053125 Bacteria 3609
1088 Ga0500568_0000236 3300053139 Bacteria 47278
1089 Ga0500568_0024490 3300053139 Bacteria 2556
1090 Ga0500616_0025766 3300053153 Bacteria 3261
1091 Ga0500622_0002381 3300053156 Bacteria 13626
1092 Ga0500622_0004600 3300053156 Bacteria 8576
1093 Ga0500622_0011679 3300053156 Bacteria 4775
1094 Ga0500611_000006 3300053727 Bacteria 226069
1095 Ga0501082_0026906 3300060353 Bacteria 4955
1096 Ga0530510_0029745 3300061734 Bacteria 3921
1097 Ga0530510_0032762 3300061734 Bacteria 3740
1098 Ga0530510_0071383 3300061734 Bacteria 2521

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046529 Ga0495652_0134667 Ga0495652_0134667_17_1468 458
2 3300049741 Ga0501079_0110172 Ga0501079_0110172_638_2107 461
3 3300049593 Ga0501077_0060639 Ga0501077_0060639_819_2363 486
4 3300049590 Ga0501074_0137484 Ga0501074_0137484_208_1716 490
5 3300044694 Ga0466963_0063419 Ga0466963_0063419_905_2458 502
6 3300048918 Ga0496115_0139373 Ga0496115_0139373_294_1847 502
7 3300049574 Ga0501038_0147561 Ga0501038_0147561_25_1581 502
8 3300005544 Ga0070686_100062888 Ga0070686_1000628882 512
9 3300053086 Ga0500578_0048202 Ga0500578_0048202_12_1559 515
10 3300046660 Ga0495625_0067298 Ga0495625_0067298_17_1591 520
11 3300010375 Ga0105239_10043261 Ga0105239_100432613 521
12 3300026116 Ga0207674_10131916 Ga0207674_101319162 522
13 3300036401 Ga0373937_0230019 Ga0373937_0230019_14_1723 526
14 3300013104 Ga0157370_10143782 Ga0157370_101437821 527
15 3300049572 Ga0501036_0111026 Ga0501036_0111026_370_2079 528
16 3300049575 Ga0501039_0046707 Ga0501039_0046707_352_2061 528
17 3300049591 Ga0501075_0056230 Ga0501075_0056230_684_2393 528
18 3300014968 Ga0157379_10043618 Ga0157379_100436184 533
19 3300046516 Ga0495628_0051315 Ga0495628_0051315_301_2007 533
20 3300046543 Ga0495645_0003703 Ga0495645_0003703_962_2668 533
21 3300047317 Ga0495604_0026092 Ga0495604_0026092_2524_4230 533
22 3300047471 Ga0495684_0000682 Ga0495684_0000682_20665_22371 533
23 3300049571 Ga0501034_0032204 Ga0501034_0032204_21_1622 533
24 3300053086 Ga0500578_0001498 Ga0500578_0001498_22_1623 533
25 3300005355 Ga0070671_100000489 Ga0070671_10000048920 534
26 3300013307 Ga0157372_10047723 Ga0157372_100477232 534
27 3300025931 Ga0207644_10001671 Ga0207644_1000167113 534
28 3300047443 Ga0495687_002100 Ga0495687_002100_8568_10307 534
29 3300049588 Ga0501072_0084230 Ga0501072_0084230_849_2483 534
30 3300053085 Ga0495619_0038817 Ga0495619_0038817_1341_3044 534
31 3300046511 Ga0495608_0032472 Ga0495608_0032472_1716_3428 535
32 3300046517 Ga0495630_0001261 Ga0495630_0001261_15274_16986 535
33 3300046663 Ga0495635_0062645 Ga0495635_0062645_446_2158 535
34 3300046689 Ga0495613_0002821 Ga0495613_0002821_6057_7769 535
35 3300047319 Ga0495674_0053305 Ga0495674_0053305_774_2486 535
36 3300049580 Ga0501046_0008978 Ga0501046_0008978_3139_4794 535
37 3300031238 Ga0265332_10011849 Ga0265332_100118493 536
38 3300049572 Ga0501036_0199113 Ga0501036_0199113_10_1656 538
39 3300042876 Ga0451577_0009669 Ga0451577_0009669_7043_8740 539
40 3300044712 Ga0453684_0185927 Ga0453684_0185927_353_2050 539
41 3300049587 Ga0501071_0040725 Ga0501071_0040725_565_2268 539
42 3300049742 Ga0501080_0011276 Ga0501080_0011276_5507_7210 539
43 3300049824 Ga0501045_0051903 Ga0501045_0051903_330_2033 539
44 3300009094 Ga0111539_10072821 Ga0111539_100728212 540
45 3300031733 Ga0316577_10000061 Ga0316577_1000006120 540
46 3300036712 Ga0316584_0002129 Ga0316584_0002129_1751_3454 540
47 3300049741 Ga0501079_0088434 Ga0501079_0088434_474_2192 540
48 3300050511 nmdc:mga08y16_61858_c1 nmdc:mga08y16_61858_c1_326_2071 540
49 3300050511 nmdc:mga08y16_31623_c1 nmdc:mga08y16_31623_c1_1816_3480 542
50 3300005290 Ga0065712_10000499 Ga0065712_100004998 544
51 3300005293 Ga0065715_10091975 Ga0065715_100919751 544
52 3300005331 Ga0070670_100057142 Ga0070670_1000571422 544
53 3300005618 Ga0068864_100023531 Ga0068864_1000235312 544
54 3300006844 Ga0075428_100000023 Ga0075428_10000002365 544
55 3300025908 Ga0207643_10030289 Ga0207643_100302892 544
56 3300025921 Ga0207652_10134235 Ga0207652_101342351 544
57 3300025925 Ga0207650_10027848 Ga0207650_100278482 544
58 3300025926 Ga0207659_10056273 Ga0207659_100562732 544
59 3300026095 Ga0207676_10006059 Ga0207676_100060597 544
60 3300039437 Ga0436365_1082470 Ga0436365_1082470_101_1858 544
61 3300048909 Ga0496106_0029416 Ga0496106_0029416_1497_3206 544
62 3300048913 Ga0496110_0129908 Ga0496110_0129908_427_2136 544
63 3300048915 Ga0496112_0054973 Ga0496112_0054973_381_2090 544
64 3300005367 Ga0070667_100003004 Ga0070667_1000030043 545
65 3300005843 Ga0068860_100001682 Ga0068860_1000016824 545
66 3300006237 Ga0097621_100111158 Ga0097621_1001111582 545
67 3300025986 Ga0207658_10003314 Ga0207658_100033145 545
68 3300028381 Ga0268264_10001129 Ga0268264_1000112919 545
69 3300005536 Ga0070697_100008131 Ga0070697_1000081316 546
70 3300053077 Ga0495601_0059046 Ga0495601_0059046_213_1928 546
71 3300028380 Ga0268265_10093173 Ga0268265_100931732 547
72 3300035410 Ga0373924_0006668 Ga0373924_0006668_640_2367 547
73 3300049570 Ga0501033_0012882 Ga0501033_0012882_642_2360 547
74 3300049575 Ga0501039_0149928 Ga0501039_0149928_60_1778 547
75 3300049576 Ga0501040_0001751 Ga0501040_0001751_10592_12310 547
76 3300049578 Ga0501042_0015393 Ga0501042_0015393_1117_2835 547
77 3300049584 Ga0501068_0022202 Ga0501068_0022202_238_1956 547
78 3300049587 Ga0501071_0050392 Ga0501071_0050392_339_2057 547
79 3300049588 Ga0501072_0010677 Ga0501072_0010677_1640_3358 547
80 3300049589 Ga0501073_0035438 Ga0501073_0035438_1775_3493 547
81 3300049590 Ga0501074_0021554 Ga0501074_0021554_2719_4437 547
82 3300049591 Ga0501075_0004548 Ga0501075_0004548_570_2288 547
83 3300049592 Ga0501076_0005355 Ga0501076_0005355_321_2039 547
84 3300049592 Ga0501076_0094591 Ga0501076_0094591_114_1832 547
85 3300049593 Ga0501077_0005464 Ga0501077_0005464_1531_3249 547
86 3300049741 Ga0501079_0008095 Ga0501079_0008095_143_1861 547
87 3300049742 Ga0501080_0053548 Ga0501080_0053548_1504_3222 547
88 3300049743 Ga0501081_0000624 Ga0501081_0000624_12787_14505 547
89 3300061734 Ga0530510_0029745 Ga0530510_0029745_1481_3199 547
90 3300061734 Ga0530510_0032762 Ga0530510_0032762_75_1793 547
91 iso_pu_bacteria 2939615513 2939617042 547
92 3300005335 Ga0070666_10069361 Ga0070666_100693612 548
93 3300005563 Ga0068855_100091186 Ga0068855_1000911862 548
94 3300005842 Ga0068858_100055397 Ga0068858_1000553973 548
95 3300006237 Ga0097621_100003067 Ga0097621_1000030676 548
96 3300006358 Ga0068871_100005490 Ga0068871_1000054904 548
97 3300009098 Ga0105245_10000926 Ga0105245_100009263 548
98 3300013297 Ga0157378_10000804 Ga0157378_1000080413 548
99 3300025927 Ga0207687_10014531 Ga0207687_100145313 548
100 3300026023 Ga0207677_10069977 Ga0207677_100699772 548
101 3300025928 Ga0207700_10023717 Ga0207700_100237172 549
102 3300048920 Ga0496117_0000107 Ga0496117_0000107_171851_173578 549
103 3300049592 Ga0501076_0012693 Ga0501076_0012693_1741_3444 549
104 3300005577 Ga0068857_100070466 Ga0068857_1000704661 550
105 3300026116 Ga0207674_10019660 Ga0207674_100196603 550
106 3300009093 Ga0105240_10008514 Ga0105240_1000851412 551
107 3300025913 Ga0207695_10002931 Ga0207695_100029318 551
108 3300031235 Ga0265330_10004423 Ga0265330_100044232 551
109 3300031235 Ga0265330_10001992 Ga0265330_100019927 552
110 3300050509 nmdc:mga0qj67_27150_c1 nmdc:mga0qj67_27150_c1_1280_2968 552
111 3300013308 Ga0157375_10011081 Ga0157375_100110818 553
112 3300025936 Ga0207670_10019364 Ga0207670_100193645 553
113 3300046516 Ga0495628_0037066 Ga0495628_0037066_20_1681 553
114 3300049588 Ga0501072_0087601 Ga0501072_0087601_793_2454 553
115 3300009094 Ga0111539_10075788 Ga0111539_100757883 554
116 3300050511 nmdc:mga08y16_88771_c1 nmdc:mga08y16_88771_c1_1217_2938 554
117 3300005441 Ga0070700_100006894 Ga0070700_1000068944 555
118 3300005546 Ga0070696_100058403 Ga0070696_1000584033 555
119 3300006847 Ga0075431_100043842 Ga0075431_1000438423 555
120 3300009094 Ga0111539_10268794 Ga0111539_102687941 555
121 3300010375 Ga0105239_10004544 Ga0105239_1000454411 555
122 3300028380 Ga0268265_10010187 Ga0268265_100101875 555
123 3300031727 Ga0316576_10070898 Ga0316576_100708981 555
124 3300031728 Ga0316578_10063865 Ga0316578_100638652 555
125 3300049592 Ga0501076_0051965 Ga0501076_0051965_1117_2814 555
126 3300050507 nmdc:mga05p37_236500_c1 nmdc:mga05p37_236500_c1_193_1902 555
127 3300005293 Ga0065715_10103649 Ga0065715_101036492 556
128 3300005466 Ga0070685_10009755 Ga0070685_100097552 556
129 3300005467 Ga0070706_100027552 Ga0070706_1000275524 556
130 3300005539 Ga0068853_100023395 Ga0068853_1000233953 556
131 3300005617 Ga0068859_100002955 Ga0068859_10000295517 556
132 3300006237 Ga0097621_100040619 Ga0097621_1000406192 556
133 3300006931 Ga0097620_100002955 Ga0097620_10000295517 556
134 3300009093 Ga0105240_10015424 Ga0105240_100154245 556
135 3300009176 Ga0105242_10044439 Ga0105242_100444392 556
136 3300009551 Ga0105238_10080635 Ga0105238_100806352 556
137 3300014969 Ga0157376_10017840 Ga0157376_100178403 556
138 3300021384 Ga0213876_10045005 Ga0213876_100450052 556
139 3300022467 Ga0224712_10003241 Ga0224712_100032411 556
140 3300025885 Ga0207653_10013171 Ga0207653_100131711 556
141 3300025913 Ga0207695_10020868 Ga0207695_100208683 556
142 3300025927 Ga0207687_10033191 Ga0207687_100331911 556
143 3300025934 Ga0207686_10008918 Ga0207686_100089182 556
144 3300025938 Ga0207704_10079027 Ga0207704_100790272 556
145 3300026023 Ga0207677_10058828 Ga0207677_100588281 556
146 3300026041 Ga0207639_10012203 Ga0207639_100122033 556
147 3300026118 Ga0207675_100040039 Ga0207675_1000400393 556
148 3300028379 Ga0268266_10069849 Ga0268266_100698492 556
149 3300037853 Ga0436364_0257896 Ga0436364_0257896_2220_4118 556
150 3300037853 Ga0436364_0337910 Ga0436364_0337910_10151_11935 556
151 3300039437 Ga0436365_0744728 Ga0436365_0744728_8909_10726 556
152 3300039437 Ga0436365_0864707 Ga0436365_0864707_50702_52600 556
153 3300048904 Ga0496101_0006897 Ga0496101_0006897_2524_4230 556
154 3300048907 Ga0496104_0033960 Ga0496104_0033960_1859_3565 556
155 3300048917 Ga0496114_0000416 Ga0496114_0000416_29417_31123 556
156 3300061734 Ga0530510_0071383 Ga0530510_0071383_254_2002 556
157 3300028558 Ga0265326_10006763 Ga0265326_100067631 558
158 3300031235 Ga0265330_10000854 Ga0265330_1000085411 558
159 3300031344 Ga0265316_10000068 Ga0265316_1000006848 558
160 3300031344 Ga0265316_10088761 Ga0265316_100887611 558
161 3300046529 Ga0495652_0134483 Ga0495652_0134483_39_1766 558
162 3300006358 Ga0068871_100054112 Ga0068871_1000541122 559
163 3300013297 Ga0157378_10004694 Ga0157378_100046942 559
164 3300028653 Ga0265323_10008461 Ga0265323_100084613 559
165 3300045976 Ga0466967_0020795 Ga0466967_0020795_2713_4497 559
166 3300005616 Ga0068852_100000079 Ga0068852_1000000795 560
167 3300005617 Ga0068859_100042091 Ga0068859_1000420915 560
168 3300006931 Ga0097620_100042090 Ga0097620_1000420905 560
169 3300009093 Ga0105240_10000744 Ga0105240_100007445 560
170 3300009147 Ga0114129_10012944 Ga0114129_100129444 560
171 3300009553 Ga0105249_10026641 Ga0105249_100266414 560
172 3300013104 Ga0157370_10000160 Ga0157370_1000016046 560
173 3300013105 Ga0157369_10034479 Ga0157369_100344795 560
174 3300025913 Ga0207695_10000460 Ga0207695_1000046055 560
175 3300025949 Ga0207667_10003821 Ga0207667_100038213 560
176 3300026142 Ga0207698_10000052 Ga0207698_1000005248 560
177 3300031548 Ga0307408_100002433 Ga0307408_1000024339 560
178 3300031911 Ga0307412_10019630 Ga0307412_100196302 560
179 3300050507 nmdc:mga05p37_5638_c1 nmdc:mga05p37_5638_c1_8852_10585 560
180 3300005530 Ga0070679_100020451 Ga0070679_1000204514 561
181 3300025921 Ga0207652_10004578 Ga0207652_100045783 561
182 3300031548 Ga0307408_100004072 Ga0307408_1000040724 561
183 3300031911 Ga0307412_10050829 Ga0307412_100508292 561
184 3300044712 Ga0453684_0007097 Ga0453684_0007097_18395_20080 561
185 3300044712 Ga0453684_0021609 Ga0453684_0021609_683_2368 561
186 3300049579 Ga0501043_0022086 Ga0501043_0022086_2436_4178 561
187 3300053087 Ga0500643_004342 Ga0500643_004342_4592_6280 561
188 3300005327 Ga0070658_10003403 Ga0070658_100034035 562
189 3300005328 Ga0070676_10000980 Ga0070676_100009808 562
190 3300005335 Ga0070666_10003610 Ga0070666_100036102 562
191 3300005338 Ga0068868_100029048 Ga0068868_1000290484 562
192 3300005347 Ga0070668_100006878 Ga0070668_1000068781 562
193 3300005367 Ga0070667_100002981 Ga0070667_10000298110 562
194 3300005456 Ga0070678_100032141 Ga0070678_1000321412 562
195 3300005457 Ga0070662_100016379 Ga0070662_1000163794 562
196 3300005543 Ga0070672_100000067 Ga0070672_10000006710 562
197 3300005548 Ga0070665_100002117 Ga0070665_1000021175 562
198 3300005616 Ga0068852_100056063 Ga0068852_1000560632 562
199 3300005618 Ga0068864_100012055 Ga0068864_1000120554 562
200 3300005841 Ga0068863_100002443 Ga0068863_1000024435 562
201 3300005842 Ga0068858_100007698 Ga0068858_1000076982 562
202 3300005843 Ga0068860_100009199 Ga0068860_1000091992 562
203 3300013296 Ga0157374_10024564 Ga0157374_100245642 562
204 3300013306 Ga0163162_10016216 Ga0163162_100162165 562
205 3300013308 Ga0157375_10023439 Ga0157375_100234393 562
206 3300014325 Ga0163163_10015150 Ga0163163_100151505 562
207 3300014968 Ga0157379_10007199 Ga0157379_100071992 562
208 3300014969 Ga0157376_10012924 Ga0157376_100129245 562
209 3300025903 Ga0207680_10000790 Ga0207680_1000079010 562
210 3300025907 Ga0207645_10014107 Ga0207645_100141072 562
211 3300025909 Ga0207705_10015636 Ga0207705_100156363 562
212 3300025926 Ga0207659_10034177 Ga0207659_100341772 562
213 3300025933 Ga0207706_10022674 Ga0207706_100226742 562
214 3300025940 Ga0207691_10002208 Ga0207691_100022086 562
215 3300025960 Ga0207651_10000296 Ga0207651_100002965 562
216 3300025972 Ga0207668_10000272 Ga0207668_1000027217 562
217 3300025986 Ga0207658_10002352 Ga0207658_100023527 562
218 3300026023 Ga0207677_10027181 Ga0207677_100271813 562
219 3300026035 Ga0207703_10028936 Ga0207703_100289362 562
220 3300026041 Ga0207639_10027733 Ga0207639_100277332 562
221 3300026088 Ga0207641_10003749 Ga0207641_100037495 562
222 3300026089 Ga0207648_10000786 Ga0207648_100007865 562
223 3300026095 Ga0207676_10001574 Ga0207676_1000157412 562
224 3300026118 Ga0207675_100040254 Ga0207675_1000402542 562
225 3300028379 Ga0268266_10002971 Ga0268266_100029715 562
226 3300028800 Ga0265338_10014452 Ga0265338_100144527 562
227 3300042007 Ga0439449_0001673 Ga0439449_0001673_5687_7453 562
228 3300046536 Ga0495587_0020543 Ga0495587_0020543_1907_3700 562
229 3300047472 Ga0495686_0001408 Ga0495686_0001408_14952_16745 562
230 3300049569 Ga0501032_0022083 Ga0501032_0022083_1792_3534 562
231 3300049570 Ga0501033_0020212 Ga0501033_0020212_1577_3319 562
232 3300049571 Ga0501034_0031443 Ga0501034_0031443_1923_3665 562
233 3300049572 Ga0501036_0080723 Ga0501036_0080723_119_1861 562
234 3300049575 Ga0501039_0038498 Ga0501039_0038498_1861_3603 562
235 3300049579 Ga0501043_0015230 Ga0501043_0015230_796_2538 562
236 3300049822 Ga0501035_0026655 Ga0501035_0026655_1813_3555 562
237 3300049823 Ga0501044_0031786 Ga0501044_0031786_1950_3692 562
238 3300050005 Ga0501284_00027 Ga0501284_00027_58689_60434 562
239 3300009093 Ga0105240_10000001 Ga0105240_10000001324 563
240 3300009551 Ga0105238_10098788 Ga0105238_100987883 563
241 3300013296 Ga0157374_10022346 Ga0157374_100223464 563
242 3300025913 Ga0207695_10000001 Ga0207695_10000001326 563
243 3300047472 Ga0495686_0000004 Ga0495686_0000004_135118_136905 563
244 3300005617 Ga0068859_100107645 Ga0068859_1001076451 564
245 3300006028 Ga0070717_10001896 Ga0070717_100018966 564
246 3300006931 Ga0097620_100107651 Ga0097620_1001076513 564
247 3300009093 Ga0105240_10001870 Ga0105240_100018704 564
248 3300013102 Ga0157371_10007298 Ga0157371_100072988 564
249 3300013104 Ga0157370_10106164 Ga0157370_101061642 564
250 3300013307 Ga0157372_10013477 Ga0157372_100134772 564
251 3300013307 Ga0157372_10130567 Ga0157372_101305673 564
252 3300025933 Ga0207706_10046621 Ga0207706_100466212 564
253 3300031251 Ga0265327_10001191 Ga0265327_1000119115 564
254 3300031730 Ga0307516_10002603 Ga0307516_100026036 564
255 3300036401 Ga0373937_0019497 Ga0373937_0019497_3457_5235 564
256 3300042876 Ga0451577_0039199 Ga0451577_0039199_197_1909 564
257 3300044712 Ga0453684_0007618 Ga0453684_0007618_12966_14678 564
258 3300044842 Ga0466957_0000423 Ga0466957_0000423_263_2038 564
259 3300005536 Ga0070697_100001004 Ga0070697_10000100419 565
260 3300025914 Ga0207671_10005449 Ga0207671_100054497 565
261 3300048929 Ga0496126_0004594 Ga0496126_0004594_13794_15542 565
262 iso_pu_bacteria 2588254257 2590611153 565
263 3300009093 Ga0105240_10000128 Ga0105240_10000128119 566
264 3300009093 Ga0105240_10010263 Ga0105240_1001026310 566
265 3300009177 Ga0105248_10000002 Ga0105248_10000002275 566
266 3300009545 Ga0105237_10004855 Ga0105237_1000485514 566
267 3300010375 Ga0105239_10001249 Ga0105239_100012494 566
268 3300025911 Ga0207654_10006499 Ga0207654_100064992 566
269 3300025913 Ga0207695_10000179 Ga0207695_1000017960 566
270 3300025913 Ga0207695_10000962 Ga0207695_1000096210 566
271 3300025914 Ga0207671_10002256 Ga0207671_100022567 566
272 3300025941 Ga0207711_10000023 Ga0207711_1000002312 566
273 3300028800 Ga0265338_10012310 Ga0265338_100123106 566
274 3300031239 Ga0265328_10020062 Ga0265328_100200622 566
275 3300031249 Ga0265339_10005643 Ga0265339_100056435 566
276 3300031251 Ga0265327_10000440 Ga0265327_1000044045 566
277 3300031344 Ga0265316_10002794 Ga0265316_100027945 566
278 3300031711 Ga0265314_10008735 Ga0265314_100087355 566
279 3300047472 Ga0495686_0003005 Ga0495686_0003005_2675_4414 566
280 iso_pu_bacteria 2582581278 2585141885 566
281 iso_pu_bacteria 2585428045 2587678360 566
282 iso_pu_bacteria 2585428060 2587745670 566
283 iso_pu_bacteria 2585428182 2588209056 566
284 iso_pu_bacteria 2585428183 2588216173 566
285 iso_pu_bacteria 2585428184 2588220515 566
286 iso_pu_bacteria 2585428185 2588225231 566
287 iso_pu_bacteria 2588253712 2588445544 566
288 iso_pu_bacteria 2588254255 2590602478 566
289 iso_pu_bacteria 2728369107 2729202200 566
290 iso_pu_bacteria 2751185877 2753671803 566
291 iso_pu_bacteria 2765235839 2765576722 566
292 iso_pu_bacteria 2772190705 2772606245 566
293 iso_pu_bacteria 2816332188 2816872023 566
294 iso_pu_bacteria 2842083920 2842085778 566
295 iso_pu_bacteria 2871720351 2871720957 566
296 iso_pu_bacteria 2889290771 2889292818 566
297 iso_pu_bacteria 2905999023 2906002487 566
298 3300005328 Ga0070676_10002582 Ga0070676_100025829 567
299 3300005331 Ga0070670_100029260 Ga0070670_1000292602 567
300 3300005355 Ga0070671_100008573 Ga0070671_1000085738 567
301 3300005364 Ga0070673_100001841 Ga0070673_1000018415 567
302 3300005364 Ga0070673_100070558 Ga0070673_1000705582 567
303 3300005367 Ga0070667_100000497 Ga0070667_1000004978 567
304 3300005455 Ga0070663_100067764 Ga0070663_1000677642 567
305 3300005459 Ga0068867_100000968 Ga0068867_1000009687 567
306 3300005539 Ga0068853_100010943 Ga0068853_1000109434 567
307 3300005563 Ga0068855_100000590 Ga0068855_1000005904 567
308 3300005563 Ga0068855_100012267 Ga0068855_1000122672 567
309 3300005563 Ga0068855_100014431 Ga0068855_1000144314 567
310 3300005577 Ga0068857_100003162 Ga0068857_1000031622 567
311 3300005614 Ga0068856_100036702 Ga0068856_1000367024 567
312 3300005616 Ga0068852_100003597 Ga0068852_1000035976 567
313 3300005616 Ga0068852_100015392 Ga0068852_1000153922 567
314 3300005616 Ga0068852_100037705 Ga0068852_1000377052 567
315 3300005618 Ga0068864_100005929 Ga0068864_1000059293 567
316 3300005841 Ga0068863_100001982 Ga0068863_1000019822 567
317 3300005843 Ga0068860_100000200 Ga0068860_10000020040 567
318 3300006237 Ga0097621_100000694 Ga0097621_1000006949 567
319 3300006237 Ga0097621_100003792 Ga0097621_1000037929 567
320 3300006237 Ga0097621_100031306 Ga0097621_1000313063 567
321 3300006358 Ga0068871_100000109 Ga0068871_10000010937 567
322 3300006358 Ga0068871_100004528 Ga0068871_1000045289 567
323 3300006881 Ga0068865_100000376 Ga0068865_10000037623 567
324 3300009093 Ga0105240_10008403 Ga0105240_1000840312 567
325 3300009093 Ga0105240_10066393 Ga0105240_100663934 567
326 3300009093 Ga0105240_10071558 Ga0105240_100715583 567
327 3300009174 Ga0105241_10000024 Ga0105241_1000002492 567
328 3300009174 Ga0105241_10006507 Ga0105241_100065072 567
329 3300009174 Ga0105241_10008646 Ga0105241_100086466 567
330 3300009174 Ga0105241_10015759 Ga0105241_100157593 567
331 3300009176 Ga0105242_10008952 Ga0105242_100089526 567
332 3300009177 Ga0105248_10004239 Ga0105248_100042397 567
333 3300009177 Ga0105248_10018698 Ga0105248_100186983 567
334 3300009545 Ga0105237_10018029 Ga0105237_100180292 567
335 3300009551 Ga0105238_10000085 Ga0105238_1000008521 567
336 3300009551 Ga0105238_10009575 Ga0105238_100095759 567
337 3300009551 Ga0105238_10012364 Ga0105238_100123642 567
338 3300010375 Ga0105239_10007713 Ga0105239_1000771310 567
339 3300010375 Ga0105239_10009223 Ga0105239_100092234 567
340 3300011119 Ga0105246_10015315 Ga0105246_100153154 567
341 3300013105 Ga0157369_10005070 Ga0157369_100050703 567
342 3300013105 Ga0157369_10012219 Ga0157369_100122196 567
343 3300013105 Ga0157369_10052596 Ga0157369_100525961 567
344 3300013296 Ga0157374_10004634 Ga0157374_100046344 567
345 3300013296 Ga0157374_10012094 Ga0157374_100120944 567
346 3300013297 Ga0157378_10024523 Ga0157378_100245236 567
347 3300013306 Ga0163162_10032943 Ga0163162_100329435 567
348 3300013307 Ga0157372_10018638 Ga0157372_100186386 567
349 3300013308 Ga0157375_10021303 Ga0157375_100213034 567
350 3300014325 Ga0163163_10000249 Ga0163163_100002497 567
351 3300014969 Ga0157376_10030884 Ga0157376_100308842 567
352 3300017792 Ga0163161_10068281 Ga0163161_100682812 567
353 3300025900 Ga0207710_10010678 Ga0207710_100106782 567
354 3300025907 Ga0207645_10000135 Ga0207645_1000013525 567
355 3300025911 Ga0207654_10000672 Ga0207654_1000067212 567
356 3300025911 Ga0207654_10001159 Ga0207654_1000115912 567
357 3300025913 Ga0207695_10000047 Ga0207695_10000047155 567
358 3300025913 Ga0207695_10001203 Ga0207695_1000120329 567
359 3300025913 Ga0207695_10065069 Ga0207695_100650692 567
360 3300025913 Ga0207695_10081724 Ga0207695_100817242 567
361 3300025914 Ga0207671_10000982 Ga0207671_1000098222 567
362 3300025914 Ga0207671_10016469 Ga0207671_100164696 567
363 3300025924 Ga0207694_10000365 Ga0207694_1000036529 567
364 3300025924 Ga0207694_10001434 Ga0207694_100014347 567
365 3300025924 Ga0207694_10006285 Ga0207694_100062856 567
366 3300025924 Ga0207694_10068129 Ga0207694_100681291 567
367 3300025925 Ga0207650_10001962 Ga0207650_100019624 567
368 3300025927 Ga0207687_10003289 Ga0207687_100032899 567
369 3300025931 Ga0207644_10006328 Ga0207644_100063282 567
370 3300025938 Ga0207704_10000019 Ga0207704_1000001992 567
371 3300025940 Ga0207691_10174453 Ga0207691_101744532 567
372 3300025941 Ga0207711_10002802 Ga0207711_100028029 567
373 3300025941 Ga0207711_10010632 Ga0207711_100106324 567
374 3300025942 Ga0207689_10008323 Ga0207689_100083235 567
375 3300025949 Ga0207667_10013504 Ga0207667_100135045 567
376 3300025949 Ga0207667_10061519 Ga0207667_100615194 567
377 3300025960 Ga0207651_10002179 Ga0207651_100021797 567
378 3300025986 Ga0207658_10003050 Ga0207658_100030504 567
379 3300025986 Ga0207658_10018448 Ga0207658_100184482 567
380 3300026023 Ga0207677_10001377 Ga0207677_1000137710 567
381 3300026023 Ga0207677_10009544 Ga0207677_100095443 567
382 3300026041 Ga0207639_10002486 Ga0207639_100024864 567
383 3300026041 Ga0207639_10047523 Ga0207639_100475232 567
384 3300026067 Ga0207678_10032087 Ga0207678_100320874 567
385 3300026078 Ga0207702_10001197 Ga0207702_1000119720 567
386 3300026078 Ga0207702_10010074 Ga0207702_100100747 567
387 3300026088 Ga0207641_10045803 Ga0207641_100458032 567
388 3300026089 Ga0207648_10000061 Ga0207648_1000006165 567
389 3300026095 Ga0207676_10020687 Ga0207676_100206873 567
390 3300026121 Ga0207683_10002798 Ga0207683_100027986 567
391 3300026121 Ga0207683_10024259 Ga0207683_100242592 567
392 3300026142 Ga0207698_10000410 Ga0207698_100004104 567
393 3300026142 Ga0207698_10006710 Ga0207698_100067106 567
394 3300028379 Ga0268266_10122889 Ga0268266_101228891 567
395 3300028800 Ga0265338_10084856 Ga0265338_100848562 567
396 3300031235 Ga0265330_10008652 Ga0265330_100086523 567
397 3300031239 Ga0265328_10008335 Ga0265328_100083352 567
398 3300031241 Ga0265325_10007941 Ga0265325_100079414 567
399 3300031241 Ga0265325_10019301 Ga0265325_100193013 567
400 3300031249 Ga0265339_10000184 Ga0265339_1000018419 567
401 3300031344 Ga0265316_10028078 Ga0265316_100280784 567
402 3300031344 Ga0265316_10092869 Ga0265316_100928692 567
403 3300031344 Ga0265316_10115499 Ga0265316_101154991 567
404 3300031712 Ga0265342_10003604 Ga0265342_100036048 567
405 3300031712 Ga0265342_10004003 Ga0265342_100040039 567
406 3300031712 Ga0265342_10034964 Ga0265342_100349642 567
407 3300033180 Ga0307510_10019806 Ga0307510_100198065 567
408 3300037471 Ga0395905_0019113 Ga0395905_0019113_3270_5018 567
409 3300046459 Ga0495629_0049223 Ga0495629_0049223_980_2746 567
410 3300046459 Ga0495629_0076457 Ga0495629_0076457_491_2296 567
411 3300046507 Ga0495606_0003492 Ga0495606_0003492_4059_5828 567
412 3300046648 Ga0495611_0000385 Ga0495611_0000385_10974_12737 567
413 3300046689 Ga0495613_0027882 Ga0495613_0027882_988_2793 567
414 3300048907 Ga0496104_0054853 Ga0496104_0054853_640_2445 567
415 3300048918 Ga0496115_0023903 Ga0496115_0023903_947_2752 567
416 3300049823 Ga0501044_0003228 Ga0501044_0003228_15829_17568 567
417 3300003320 rootH2_10112387 rootH2_101123873 568
418 3300003322 rootL2_10235324 rootL2_102353242 568
419 3300003323 rootH1_10062604 rootH1_100626044 568
420 3300003578 Ga0006562J51391_1004821 Ga0006562J51391_10048212 568
421 3300003784 Ga0055534_1009268 Ga0055534_10092682 568
422 3300005337 Ga0070682_100000158 Ga0070682_10000015813 568
423 3300005530 Ga0070679_100083227 Ga0070679_1000832272 568
424 3300009036 Ga0105244_10000069 Ga0105244_1000006934 568
425 3300009148 Ga0105243_10000130 Ga0105243_1000013013 568
426 3300009148 Ga0105243_10024668 Ga0105243_100246682 568
427 3300013104 Ga0157370_10027777 Ga0157370_100277772 568
428 3300013104 Ga0157370_10117031 Ga0157370_101170312 568
429 3300015261 Ga0182006_1000015 Ga0182006_1000015165 568
430 3300015261 Ga0182006_1000149 Ga0182006_100014916 568
431 3300025291 Ga0209675_1000179 Ga0209675_100017967 568
432 3300025728 Ga0207655_1000492 Ga0207655_100049234 568
433 3300025904 Ga0207647_10060113 Ga0207647_100601131 568
434 3300025935 Ga0207709_10000544 Ga0207709_1000054417 568
435 3300025935 Ga0207709_10039582 Ga0207709_100395823 568
436 3300031911 Ga0307412_10000019 Ga0307412_10000019204 568
437 3300032002 Ga0307416_100000004 Ga0307416_100000004284 568
438 3300044658 Ga0466972_0000004 Ga0466972_0000004_301260_303002 568
439 3300044765 Ga0466970_0000518 Ga0466970_0000518_16173_17915 568
440 3300046500 Ga0495596_0005212 Ga0495596_0005212_831_2555 568
441 3300046512 Ga0495610_0000001 Ga0495610_0000001_583571_585322 568
442 3300046691 Ga0495670_0010198 Ga0495670_0010198_1376_3118 568
443 3300048919 Ga0496116_0000027 Ga0496116_0000027_289881_291605 568
444 3300048920 Ga0496117_0000021 Ga0496117_0000021_155640_157364 568
445 3300048921 Ga0496118_0000531 Ga0496118_0000531_32949_34673 568
446 3300048922 Ga0496119_0000004 Ga0496119_0000004_286816_288540 568
447 3300048925 Ga0496122_0000119 Ga0496122_0000119_119084_120805 568
448 3300048925 Ga0496122_0000344 Ga0496122_0000344_30466_32190 568
449 3300048925 Ga0496122_0000376 Ga0496122_0000376_69189_70913 568
450 3300048925 Ga0496122_0004219 Ga0496122_0004219_2865_4586 568
451 3300048925 Ga0496122_0016702 Ga0496122_0016702_4896_6623 568
452 3300048926 Ga0496123_0003274 Ga0496123_0003274_2832_4556 568
453 3300048926 Ga0496123_0010620 Ga0496123_0010620_3569_5290 568
454 3300048926 Ga0496123_0028964 Ga0496123_0028964_1979_3703 568
455 3300048927 Ga0496124_0000526 Ga0496124_0000526_63391_65115 568
456 3300048928 Ga0496125_0000169 Ga0496125_0000169_25155_26876 568
457 3300048929 Ga0496126_0000744 Ga0496126_0000744_26913_28637 568
458 3300049572 Ga0501036_0068940 Ga0501036_0068940_903_2678 568
459 3300049581 Ga0501047_0018111 Ga0501047_0018111_1935_3710 568
460 3300049823 Ga0501044_0022960 Ga0501044_0022960_522_2297 568
461 iso_pu_bacteria 2929154850 2929157835 568
462 3300021384 Ga0213876_10014400 Ga0213876_100144003 569
463 3300028800 Ga0265338_10021733 Ga0265338_100217332 569
464 3300031235 Ga0265330_10000123 Ga0265330_1000012321 569
465 3300031238 Ga0265332_10030014 Ga0265332_100300142 569
466 3300031240 Ga0265320_10032511 Ga0265320_100325112 569
467 3300031241 Ga0265325_10000041 Ga0265325_100000413 569
468 3300031247 Ga0265340_10004286 Ga0265340_100042864 569
469 3300031249 Ga0265339_10007645 Ga0265339_100076452 569
470 3300031344 Ga0265316_10006591 Ga0265316_100065917 569
471 3300031711 Ga0265314_10001814 Ga0265314_100018146 569
472 3300031712 Ga0265342_10008363 Ga0265342_100083634 569
473 3300039437 Ga0436365_1879596 Ga0436365_1879596_9012_10748 569
474 3300049663 Ga0501223_000421 Ga0501223_000421_6989_8812 569
475 iso_pu_bacteria 2818991444 2819590801 569
476 3300005339 Ga0070660_100001381 Ga0070660_1000013818 570
477 3300005530 Ga0070679_100000323 Ga0070679_10000032312 570
478 3300005535 Ga0070684_100010008 Ga0070684_1000100084 570
479 3300005563 Ga0068855_100118608 Ga0068855_1001186083 570
480 3300005616 Ga0068852_100004077 Ga0068852_1000040774 570
481 3300009093 Ga0105240_10006000 Ga0105240_100060009 570
482 3300009551 Ga0105238_10017738 Ga0105238_100177385 570
483 3300013102 Ga0157371_10014766 Ga0157371_100147663 570
484 3300013104 Ga0157370_10014776 Ga0157370_100147766 570
485 3300013307 Ga0157372_10000324 Ga0157372_1000032433 570
486 3300025261 Ga0209233_1000796 Ga0209233_10007963 570
487 3300025913 Ga0207695_10000232 Ga0207695_1000023247 570
488 3300025913 Ga0207695_10046365 Ga0207695_100463653 570
489 3300025919 Ga0207657_10002799 Ga0207657_100027998 570
490 3300025921 Ga0207652_10001125 Ga0207652_100011258 570
491 3300025924 Ga0207694_10008026 Ga0207694_100080266 570
492 3300025949 Ga0207667_10000087 Ga0207667_1000008733 570
493 3300025949 Ga0207667_10000111 Ga0207667_1000011148 570
494 3300028577 Ga0265318_10015811 Ga0265318_100158112 570
495 3300031235 Ga0265330_10000153 Ga0265330_1000015330 570
496 3300031241 Ga0265325_10000785 Ga0265325_100007856 570
497 3300031241 Ga0265325_10023388 Ga0265325_100233882 570
498 3300031241 Ga0265325_10028974 Ga0265325_100289741 570
499 3300031247 Ga0265340_10015099 Ga0265340_100150992 570
500 3300031247 Ga0265340_10020963 Ga0265340_100209631 570
501 3300031247 Ga0265340_10041181 Ga0265340_100411812 570
502 3300031249 Ga0265339_10007352 Ga0265339_100073524 570
503 3300031344 Ga0265316_10004765 Ga0265316_100047652 570
504 3300031595 Ga0265313_10003068 Ga0265313_100030689 570
505 3300031595 Ga0265313_10036852 Ga0265313_100368521 570
506 3300031712 Ga0265342_10000917 Ga0265342_100009175 570
507 3300049573 Ga0501037_0058222 Ga0501037_0058222_757_2499 570
508 3300049575 Ga0501039_0032231 Ga0501039_0032231_1776_3518 570
509 3300049579 Ga0501043_0015402 Ga0501043_0015402_1753_3495 570
510 3300049822 Ga0501035_0054161 Ga0501035_0054161_492_2234 570
511 3300049823 Ga0501044_0051702 Ga0501044_0051702_536_2278 570
512 3300053108 Ga0500562_000062 Ga0500562_000062_10648_12393 570
513 3300053153 Ga0500616_0025766 Ga0500616_0025766_812_2557 570
514 3300053156 Ga0500622_0004600 Ga0500622_0004600_6311_8056 570
515 iso_pu_bacteria 2958512119 2958515192 570
516 3300005614 Ga0068856_100144549 Ga0068856_1001445492 571
517 3300020080 Ga0206350_10809614 Ga0206350_108096142 571
518 3300026078 Ga0207702_10097163 Ga0207702_100971632 571
519 3300032004 Ga0307414_10043695 Ga0307414_100436952 571
520 3300044658 Ga0466972_0000579 Ga0466972_0000579_7818_9656 571
521 3300045051 Ga0451576_0007702 Ga0451576_0007702_2262_3995 571
522 3300049668 Ga0501233_006883 Ga0501233_006883_102_1928 571
523 3300049674 Ga0501242_000172 Ga0501242_000172_3086_4834 571
524 3300049688 Ga0501259_000985 Ga0501259_000985_1192_2940 571
525 iso_pu_bacteria 2945997725 2946001680 571
526 3300002459 JGI24751J29686_10000950 JGI24751J29686_100009504 572
527 3300005289 Ga0065704_10117650 Ga0065704_101176501 572
528 3300005290 Ga0065712_10074461 Ga0065712_100744613 572
529 3300005295 Ga0065707_10117751 Ga0065707_101177512 572
530 3300005331 Ga0070670_100035645 Ga0070670_1000356451 572
531 3300005335 Ga0070666_10073219 Ga0070666_100732192 572
532 3300005338 Ga0068868_100096524 Ga0068868_1000965242 572
533 3300005471 Ga0070698_100002401 Ga0070698_10000240115 572
534 3300005617 Ga0068859_100114194 Ga0068859_1001141942 572
535 3300005618 Ga0068864_100004346 Ga0068864_1000043468 572
536 3300005618 Ga0068864_100094651 Ga0068864_1000946511 572
537 3300005719 Ga0068861_100022281 Ga0068861_1000222813 572
538 3300006237 Ga0097621_100008505 Ga0097621_1000085055 572
539 3300006358 Ga0068871_100029893 Ga0068871_1000298935 572
540 3300006844 Ga0075428_100097085 Ga0075428_1000970852 572
541 3300006844 Ga0075428_100107306 Ga0075428_1001073062 572
542 3300006846 Ga0075430_100025613 Ga0075430_1000256135 572
543 3300006880 Ga0075429_100001604 Ga0075429_10000160415 572
544 3300006931 Ga0097620_100114196 Ga0097620_1001141962 572
545 3300009147 Ga0114129_10151979 Ga0114129_101519792 572
546 3300011119 Ga0105246_10006351 Ga0105246_100063514 572
547 3300013306 Ga0163162_10054483 Ga0163162_100544833 572
548 3300013307 Ga0157372_10035377 Ga0157372_100353772 572
549 3300013308 Ga0157375_10171026 Ga0157375_101710261 572
550 3300014325 Ga0163163_10005284 Ga0163163_100052842 572
551 3300014325 Ga0163163_10125853 Ga0163163_101258532 572
552 3300025907 Ga0207645_10000306 Ga0207645_1000030626 572
553 3300025925 Ga0207650_10063750 Ga0207650_100637503 572
554 3300025940 Ga0207691_10041579 Ga0207691_100415792 572
555 3300025940 Ga0207691_10114421 Ga0207691_101144212 572
556 3300025942 Ga0207689_10004896 Ga0207689_100048968 572
557 3300025961 Ga0207712_10016515 Ga0207712_100165153 572
558 3300025961 Ga0207712_10079243 Ga0207712_100792432 572
559 3300026023 Ga0207677_10074904 Ga0207677_100749042 572
560 3300026088 Ga0207641_10000539 Ga0207641_100005392 572
561 3300026089 Ga0207648_10003171 Ga0207648_1000317111 572
562 3300026095 Ga0207676_10016570 Ga0207676_100165702 572
563 3300026118 Ga0207675_100013718 Ga0207675_1000137183 572
564 3300026118 Ga0207675_100040221 Ga0207675_1000402212 572
565 3300026121 Ga0207683_10004426 Ga0207683_100044268 572
566 3300028379 Ga0268266_10063540 Ga0268266_100635402 572
567 3300028794 Ga0307515_10000001 Ga0307515_100000011331 572
568 3300031616 Ga0307508_10001210 Ga0307508_100012109 572
569 3300046453 Ga0495627_004693 Ga0495627_004693_3220_4980 572
570 3300049680 Ga0501250_000838 Ga0501250_000838_520_2271 572
571 3300050509 nmdc:mga0qj67_54657_c1 nmdc:mga0qj67_54657_c1_178_1935 572
572 iso_pu_bacteria 2585428115 2587943242 572
573 iso_pu_bacteria 2599185184 2599479644 572
574 iso_pu_bacteria 2881247448 2881247913 572
575 iso_pu_bacteria 2914759650 2914761968 572
576 iso_pu_bacteria 2919437846 2919438058 572
577 iso_pu_bacteria 2928078545 2928083802 572
578 iso_pu_bacteria 2928147474 2928152241 572
579 iso_pu_bacteria 2932082852 2932084806 572
580 iso_pu_bacteria 2977243572 2977245487 572
581 3300003203 JGI25406J46586_10010325 JGI25406J46586_100103252 573
582 3300003354 JGI25160J50197_1000687 JGI25160J50197_10006872 573
583 3300005328 Ga0070676_10032880 Ga0070676_100328802 573
584 3300005331 Ga0070670_100098304 Ga0070670_1000983041 573
585 3300005331 Ga0070670_100153832 Ga0070670_1001538321 573
586 3300005334 Ga0068869_100114830 Ga0068869_1001148302 573
587 3300005337 Ga0070682_100006212 Ga0070682_1000062121 573
588 3300005338 Ga0068868_100039782 Ga0068868_1000397823 573
589 3300005339 Ga0070660_100018003 Ga0070660_1000180035 573
590 3300005344 Ga0070661_100040116 Ga0070661_1000401164 573
591 3300005347 Ga0070668_100024239 Ga0070668_1000242392 573
592 3300005353 Ga0070669_100007952 Ga0070669_1000079526 573
593 3300005364 Ga0070673_100056413 Ga0070673_1000564133 573
594 3300005365 Ga0070688_100002056 Ga0070688_1000020567 573
595 3300005366 Ga0070659_100025920 Ga0070659_1000259203 573
596 3300005459 Ga0068867_100118624 Ga0068867_1001186242 573
597 3300005535 Ga0070684_100025664 Ga0070684_1000256642 573
598 3300005535 Ga0070684_100042864 Ga0070684_1000428642 573
599 3300005539 Ga0068853_100040644 Ga0068853_1000406443 573
600 3300005543 Ga0070672_100027741 Ga0070672_1000277412 573
601 3300005548 Ga0070665_100000001 Ga0070665_100000001318 573
602 3300005564 Ga0070664_100008425 Ga0070664_1000084252 573
603 3300005564 Ga0070664_100078386 Ga0070664_1000783861 573
604 3300005616 Ga0068852_100062562 Ga0068852_1000625622 573
605 3300005617 Ga0068859_100059052 Ga0068859_1000590522 573
606 3300005618 Ga0068864_100138175 Ga0068864_1001381751 573
607 3300005843 Ga0068860_100010023 Ga0068860_1000100236 573
608 3300005843 Ga0068860_100065888 Ga0068860_1000658882 573
609 3300005843 Ga0068860_100111574 Ga0068860_1001115741 573
610 3300005985 Ga0081539_10000345 Ga0081539_1000034566 573
611 3300006931 Ga0097620_100045498 Ga0097620_1000454983 573
612 3300006931 Ga0097620_100059048 Ga0097620_1000590482 573
613 3300010375 Ga0105239_10091422 Ga0105239_100914222 573
614 3300013306 Ga0163162_10104448 Ga0163162_101044483 573
615 3300013307 Ga0157372_10053344 Ga0157372_100533443 573
616 3300013307 Ga0157372_10061622 Ga0157372_100616221 573
617 3300013307 Ga0157372_10133134 Ga0157372_101331343 573
618 3300013308 Ga0157375_10170389 Ga0157375_101703892 573
619 3300014326 Ga0157380_10029681 Ga0157380_100296812 573
620 3300014745 Ga0157377_10004138 Ga0157377_100041384 573
621 3300014745 Ga0157377_10008097 Ga0157377_100080972 573
622 3300025302 Ga0207426_1000132 Ga0207426_100013250 573
623 3300025903 Ga0207680_10016445 Ga0207680_100164454 573
624 3300025904 Ga0207647_10002289 Ga0207647_100022894 573
625 3300025919 Ga0207657_10001302 Ga0207657_100013027 573
626 3300025919 Ga0207657_10022148 Ga0207657_100221481 573
627 3300025920 Ga0207649_10027658 Ga0207649_100276583 573
628 3300025923 Ga0207681_10098197 Ga0207681_100981972 573
629 3300025931 Ga0207644_10082766 Ga0207644_100827661 573
630 3300025932 Ga0207690_10004696 Ga0207690_100046966 573
631 3300025933 Ga0207706_10027852 Ga0207706_100278522 573
632 3300025933 Ga0207706_10056023 Ga0207706_100560232 573
633 3300025940 Ga0207691_10022714 Ga0207691_100227143 573
634 3300025942 Ga0207689_10008304 Ga0207689_100083044 573
635 3300025942 Ga0207689_10098622 Ga0207689_100986221 573
636 3300026023 Ga0207677_10055550 Ga0207677_100555502 573
637 3300026075 Ga0207708_10078480 Ga0207708_100784802 573
638 3300026089 Ga0207648_10002643 Ga0207648_100026432 573
639 3300026089 Ga0207648_10011997 Ga0207648_100119971 573
640 3300026089 Ga0207648_10151976 Ga0207648_101519762 573
641 3300026089 Ga0207648_10165320 Ga0207648_101653201 573
642 3300026118 Ga0207675_100004088 Ga0207675_1000040888 573
643 3300026142 Ga0207698_10010692 Ga0207698_100106924 573
644 3300027907 Ga0207428_10018183 Ga0207428_100181836 573
645 3300028379 Ga0268266_10000102 Ga0268266_1000010248 573
646 3300028380 Ga0268265_10038301 Ga0268265_100383011 573
647 3300028381 Ga0268264_10009319 Ga0268264_100093194 573
648 3300028381 Ga0268264_10080760 Ga0268264_100807602 573
649 3300031251 Ga0265327_10000152 Ga0265327_1000015254 573
650 3300031456 Ga0307513_10075092 Ga0307513_100750922 573
651 3300039437 Ga0436365_0124513 Ga0436365_0124513_1531_3267 573
652 3300042876 Ga0451577_0024886 Ga0451577_0024886_438_2180 573
653 3300044712 Ga0453684_0012031 Ga0453684_0012031_3236_4975 573
654 3300044712 Ga0453684_0120888 Ga0453684_0120888_784_2526 573
655 3300045051 Ga0451576_0051039 Ga0451576_0051039_1938_3680 573
656 3300046524 Ga0495648_0013720 Ga0495648_0013720_659_2416 573
657 3300047472 Ga0495686_0007062 Ga0495686_0007062_5022_6776 573
658 3300049705 Ga0501225_0003642 Ga0501225_0003642_49_1818 573
659 3300053139 Ga0500568_0000236 Ga0500568_0000236_37877_39631 573
660 3300053139 Ga0500568_0024490 Ga0500568_0024490_377_2170 573
661 3300053156 Ga0500622_0011679 Ga0500622_0011679_279_2036 573
662 3300053727 Ga0500611_000006 Ga0500611_000006_79966_81720 573
663 iso_pu_bacteria 2721755487 2722730760 573
664 iso_pu_bacteria 2738541273 2738701468 573
665 iso_pu_bacteria 2738541278 2738728999 573
666 iso_pu_bacteria 2738543014 2739255766 573
667 iso_pu_bacteria 2739367663 2739646716 573
668 iso_pu_bacteria 2842903701 2842905997 573
669 iso_pu_bacteria 2890737413 2890737829 573
670 iso_pu_bacteria 2896317667 2896319097 573
671 iso_pu_bacteria 2896344016 2896344530 573
672 iso_pu_bacteria 2898713307 2898713661 573
673 iso_pu_bacteria 2902048731 2902052235 573
674 iso_pu_bacteria 2904780799 2904783238 573
675 iso_pu_bacteria 2919177583 2919180846 573
676 iso_pu_bacteria 2977232053 2977233867 573
677 iso_pu_bacteria 2984572630 2984575493 573
678 iso_pu_bacteria 2984606641 2984608946 573
679 iso_pu_bacteria 3003233435 3003233852 573
680 iso_pu_bacteria 8055588893 8055591898 573
681 3300005289 Ga0065704_10002965 Ga0065704_100029653 574
682 3300005289 Ga0065704_10070912 Ga0065704_100709126 574
683 3300005334 Ga0068869_100013562 Ga0068869_1000135622 574
684 3300005334 Ga0068869_100042601 Ga0068869_1000426012 574
685 3300005335 Ga0070666_10000042 Ga0070666_1000004245 574
686 3300005339 Ga0070660_100018476 Ga0070660_1000184763 574
687 3300005366 Ga0070659_100000486 Ga0070659_1000004863 574
688 3300005366 Ga0070659_100036128 Ga0070659_1000361282 574
689 3300005458 Ga0070681_10068502 Ga0070681_100685023 574
690 3300005539 Ga0068853_100130160 Ga0068853_1001301601 574
691 3300005564 Ga0070664_100039741 Ga0070664_1000397413 574
692 3300005617 Ga0068859_100000130 Ga0068859_1000001307 574
693 3300005834 Ga0068851_10036070 Ga0068851_100360702 574
694 3300005841 Ga0068863_100012749 Ga0068863_1000127495 574
695 3300005842 Ga0068858_100004507 Ga0068858_1000045076 574
696 3300005843 Ga0068860_100006618 Ga0068860_1000066186 574
697 3300006358 Ga0068871_100026533 Ga0068871_1000265333 574
698 3300006931 Ga0097620_100000130 Ga0097620_10000013060 574
699 3300009101 Ga0105247_10011487 Ga0105247_100114873 574
700 3300009545 Ga0105237_10013031 Ga0105237_100130312 574
701 3300009553 Ga0105249_10083207 Ga0105249_100832072 574
702 3300013102 Ga0157371_10004120 Ga0157371_100041209 574
703 3300013104 Ga0157370_10016651 Ga0157370_100166513 574
704 3300013105 Ga0157369_10018947 Ga0157369_100189476 574
705 3300013105 Ga0157369_10110031 Ga0157369_101100312 574
706 3300013306 Ga0163162_10000445 Ga0163162_1000044531 574
707 3300013307 Ga0157372_10000071 Ga0157372_100000717 574
708 3300014326 Ga0157380_10065572 Ga0157380_100655721 574
709 3300014969 Ga0157376_10009172 Ga0157376_100091724 574
710 3300017792 Ga0163161_10009128 Ga0163161_100091283 574
711 3300025321 Ga0207656_10019353 Ga0207656_100193532 574
712 3300025903 Ga0207680_10000135 Ga0207680_1000013521 574
713 3300025904 Ga0207647_10000280 Ga0207647_100002806 574
714 3300025912 Ga0207707_10058316 Ga0207707_100583162 574
715 3300025919 Ga0207657_10045574 Ga0207657_100455742 574
716 3300025932 Ga0207690_10000361 Ga0207690_100003615 574
717 3300025942 Ga0207689_10001157 Ga0207689_100011572 574
718 3300025942 Ga0207689_10001865 Ga0207689_100018651 574
719 3300025945 Ga0207679_10035236 Ga0207679_100352362 574
720 3300025949 Ga0207667_10004600 Ga0207667_100046007 574
721 3300026035 Ga0207703_10004858 Ga0207703_100048586 574
722 3300026088 Ga0207641_10000158 Ga0207641_1000015861 574
723 3300028381 Ga0268264_10013291 Ga0268264_100132913 574
724 3300028786 Ga0307517_10006124 Ga0307517_100061249 574
725 3300031507 Ga0307509_10103305 Ga0307509_101033052 574
726 3300033180 Ga0307510_10006676 Ga0307510_1000667613 574
727 3300038443 Ga0395901_0086074 Ga0395901_0086074_631_2367 574
728 3300044712 Ga0453684_0092637 Ga0453684_0092637_805_2553 574
729 3300046453 Ga0495627_000003 Ga0495627_000003_56934_58673 574
730 3300046457 Ga0495590_0004043 Ga0495590_0004043_3903_5645 574
731 3300046513 Ga0495616_0005202 Ga0495616_0005202_5654_7411 574
732 3300046522 Ga0495643_0001316 Ga0495643_0001316_14040_15797 574
733 3300046530 Ga0495654_0000001 Ga0495654_0000001_1065805_1067544 574
734 3300046558 Ga0495633_0000002 Ga0495633_0000002_104123_105865 574
735 3300047472 Ga0495686_0000772 Ga0495686_0000772_25774_27528 574
736 3300047472 Ga0495686_0009495 Ga0495686_0009495_3337_5076 574
737 iso_pu_bacteria 2818991437 2819546044 574
738 3300001990 JGI24737J22298_10004033 JGI24737J22298_100040331 575
739 3300002067 JGI24735J21928_10000003 JGI24735J21928_10000003124 575
740 3300002737 JGI25162J39368_1000123 JGI25162J39368_100012332 575
741 3300002737 JGI25162J39368_1000931 JGI25162J39368_10009318 575
742 3300002772 JGI25164J39214_1001625 JGI25164J39214_10016252 575
743 3300003214 JGI25165J46597_1000399 JGI25165J46597_100039923 575
744 3300003316 rootH1_10019188 rootH1_100191882 575
745 3300003320 rootH2_10024557 rootH2_100245575 575
746 3300003322 rootL2_10100912 rootL2_101009121 575
747 3300003323 rootH1_10003494 rootH1_100034944 575
748 3300003323 rootH1_10007401 rootH1_1000740115 575
749 3300003794 Ga0055531_10000139 Ga0055531_1000013972 575
750 3300005328 Ga0070676_10004504 Ga0070676_100045047 575
751 3300005329 Ga0070683_100003447 Ga0070683_1000034472 575
752 3300005329 Ga0070683_100147280 Ga0070683_1001472801 575
753 3300005334 Ga0068869_100003787 Ga0068869_1000037873 575
754 3300005335 Ga0070666_10023903 Ga0070666_100239032 575
755 3300005336 Ga0070680_100000323 Ga0070680_1000003238 575
756 3300005338 Ga0068868_100013211 Ga0068868_1000132112 575
757 3300005344 Ga0070661_100002466 Ga0070661_1000024669 575
758 3300005344 Ga0070661_100003469 Ga0070661_1000034699 575
759 3300005354 Ga0070675_100013806 Ga0070675_1000138062 575
760 3300005355 Ga0070671_100042034 Ga0070671_1000420342 575
761 3300005367 Ga0070667_100023268 Ga0070667_1000232682 575
762 3300005367 Ga0070667_100062831 Ga0070667_1000628313 575
763 3300005455 Ga0070663_100001316 Ga0070663_10000131611 575
764 3300005456 Ga0070678_100008016 Ga0070678_1000080162 575
765 3300005457 Ga0070662_100071153 Ga0070662_1000711532 575
766 3300005458 Ga0070681_10039612 Ga0070681_100396122 575
767 3300005530 Ga0070679_100000397 Ga0070679_10000039712 575
768 3300005535 Ga0070684_100000172 Ga0070684_10000017215 575
769 3300005535 Ga0070684_100035442 Ga0070684_1000354425 575
770 3300005539 Ga0068853_100004535 Ga0068853_1000045358 575
771 3300005547 Ga0070693_100003549 Ga0070693_1000035497 575
772 3300005563 Ga0068855_100008545 Ga0068855_1000085452 575
773 3300005563 Ga0068855_100011078 Ga0068855_1000110782 575
774 3300005564 Ga0070664_100001323 Ga0070664_1000013234 575
775 3300005564 Ga0070664_100131548 Ga0070664_1001315482 575
776 3300005577 Ga0068857_100005435 Ga0068857_1000054357 575
777 3300005578 Ga0068854_100088051 Ga0068854_1000880512 575
778 3300005614 Ga0068856_100022607 Ga0068856_1000226072 575
779 3300005616 Ga0068852_100065148 Ga0068852_1000651482 575
780 3300005842 Ga0068858_100015037 Ga0068858_1000150376 575
781 3300005843 Ga0068860_100001122 Ga0068860_1000011225 575
782 3300006195 Ga0075366_10000234 Ga0075366_1000023412 575
783 3300006195 Ga0075366_10049783 Ga0075366_100497832 575
784 3300006237 Ga0097621_100000027 Ga0097621_10000002737 575
785 3300006237 Ga0097621_100039988 Ga0097621_1000399882 575
786 3300006358 Ga0068871_100000338 Ga0068871_10000033819 575
787 3300009093 Ga0105240_10072040 Ga0105240_100720402 575
788 3300009101 Ga0105247_10075280 Ga0105247_100752801 575
789 3300009147 Ga0114129_10006547 Ga0114129_100065478 575
790 3300009148 Ga0105243_10000003 Ga0105243_10000003382 575
791 3300009174 Ga0105241_10000105 Ga0105241_1000010531 575
792 3300009174 Ga0105241_10002088 Ga0105241_100020882 575
793 3300009174 Ga0105241_10149235 Ga0105241_101492352 575
794 3300009176 Ga0105242_10042190 Ga0105242_100421902 575
795 3300009177 Ga0105248_10018861 Ga0105248_100188612 575
796 3300009545 Ga0105237_10001172 Ga0105237_1000117218 575
797 3300009545 Ga0105237_10048644 Ga0105237_100486443 575
798 3300009553 Ga0105249_10126995 Ga0105249_101269952 575
799 3300010375 Ga0105239_10000015 Ga0105239_10000015252 575
800 3300010375 Ga0105239_10000045 Ga0105239_10000045136 575
801 3300010375 Ga0105239_10089158 Ga0105239_100891583 575
802 3300010375 Ga0105239_10096422 Ga0105239_100964223 575
803 3300013100 Ga0157373_10000990 Ga0157373_100009902 575
804 3300013100 Ga0157373_10007645 Ga0157373_100076455 575
805 3300013102 Ga0157371_10001756 Ga0157371_100017567 575
806 3300013102 Ga0157371_10012771 Ga0157371_100127713 575
807 3300013102 Ga0157371_10013704 Ga0157371_100137043 575
808 3300013102 Ga0157371_10015504 Ga0157371_100155046 575
809 3300013102 Ga0157371_10053757 Ga0157371_100537572 575
810 3300013105 Ga0157369_10003069 Ga0157369_1000306913 575
811 3300013296 Ga0157374_10000001 Ga0157374_10000001494 575
812 3300013296 Ga0157374_10016264 Ga0157374_100162644 575
813 3300013306 Ga0163162_10000437 Ga0163162_100004378 575
814 3300013306 Ga0163162_10000699 Ga0163162_1000069913 575
815 3300013306 Ga0163162_10006527 Ga0163162_100065272 575
816 3300013306 Ga0163162_10019461 Ga0163162_100194616 575
817 3300013306 Ga0163162_10024561 Ga0163162_100245615 575
818 3300013306 Ga0163162_10026678 Ga0163162_100266784 575
819 3300013306 Ga0163162_10037865 Ga0163162_100378652 575
820 3300013307 Ga0157372_10000026 Ga0157372_10000026136 575
821 3300013307 Ga0157372_10000514 Ga0157372_1000051433 575
822 3300013307 Ga0157372_10006860 Ga0157372_100068603 575
823 3300013307 Ga0157372_10072039 Ga0157372_100720393 575
824 3300013308 Ga0157375_10003798 Ga0157375_100037985 575
825 3300013308 Ga0157375_10105930 Ga0157375_101059302 575
826 3300014325 Ga0163163_10000193 Ga0163163_1000019312 575
827 3300014968 Ga0157379_10038151 Ga0157379_100381512 575
828 3300014968 Ga0157379_10100003 Ga0157379_101000032 575
829 3300014969 Ga0157376_10000808 Ga0157376_100008089 575
830 3300014969 Ga0157376_10027846 Ga0157376_100278462 575
831 3300014969 Ga0157376_10109907 Ga0157376_101099071 575
832 3300014969 Ga0157376_10119911 Ga0157376_101199112 575
833 3300017792 Ga0163161_10004913 Ga0163161_100049135 575
834 3300017792 Ga0163161_10018046 Ga0163161_100180463 575
835 3300020077 Ga0206351_10906282 Ga0206351_109062823 575
836 3300025231 Ga0207427_100072 Ga0207427_100072116 575
837 3300025233 Ga0209437_100026 Ga0209437_100026226 575
838 3300025233 Ga0209437_100251 Ga0209437_10025129 575
839 3300025250 Ga0209026_1000633 Ga0209026_10006332 575
840 3300025261 Ga0209233_1000111 Ga0209233_1000111120 575
841 3300025304 Ga0209257_1000025 Ga0209257_100002577 575
842 3300025907 Ga0207645_10063460 Ga0207645_100634602 575
843 3300025909 Ga0207705_10006335 Ga0207705_100063354 575
844 3300025912 Ga0207707_10000205 Ga0207707_1000020522 575
845 3300025913 Ga0207695_10003840 Ga0207695_100038408 575
846 3300025913 Ga0207695_10033370 Ga0207695_100333704 575
847 3300025914 Ga0207671_10003343 Ga0207671_100033435 575
848 3300025914 Ga0207671_10007556 Ga0207671_100075563 575
849 3300025914 Ga0207671_10064837 Ga0207671_100648371 575
850 3300025917 Ga0207660_10000843 Ga0207660_1000084313 575
851 3300025917 Ga0207660_10009061 Ga0207660_100090617 575
852 3300025920 Ga0207649_10011811 Ga0207649_100118113 575
853 3300025921 Ga0207652_10000186 Ga0207652_1000018645 575
854 3300025921 Ga0207652_10000967 Ga0207652_100009679 575
855 3300025924 Ga0207694_10011944 Ga0207694_100119443 575
856 3300025924 Ga0207694_10045907 Ga0207694_100459072 575
857 3300025926 Ga0207659_10075500 Ga0207659_100755002 575
858 3300025933 Ga0207706_10002722 Ga0207706_100027229 575
859 3300025933 Ga0207706_10014390 Ga0207706_100143902 575
860 3300025933 Ga0207706_10099925 Ga0207706_100999251 575
861 3300025934 Ga0207686_10033120 Ga0207686_100331202 575
862 3300025935 Ga0207709_10000008 Ga0207709_10000008192 575
863 3300025941 Ga0207711_10016320 Ga0207711_100163202 575
864 3300025942 Ga0207689_10003632 Ga0207689_100036326 575
865 3300025944 Ga0207661_10004721 Ga0207661_100047216 575
866 3300025944 Ga0207661_10083211 Ga0207661_100832112 575
867 3300025945 Ga0207679_10003237 Ga0207679_100032378 575
868 3300025949 Ga0207667_10000218 Ga0207667_1000021829 575
869 3300025949 Ga0207667_10000549 Ga0207667_1000054917 575
870 3300025949 Ga0207667_10037487 Ga0207667_100374874 575
871 3300025949 Ga0207667_10060470 Ga0207667_100604703 575
872 3300025960 Ga0207651_10027303 Ga0207651_100273031 575
873 3300025986 Ga0207658_10013024 Ga0207658_100130244 575
874 3300026023 Ga0207677_10060048 Ga0207677_100600482 575
875 3300026035 Ga0207703_10038402 Ga0207703_100384022 575
876 3300026041 Ga0207639_10002247 Ga0207639_100022479 575
877 3300026067 Ga0207678_10025327 Ga0207678_100253273 575
878 3300026078 Ga0207702_10005834 Ga0207702_100058347 575
879 3300026089 Ga0207648_10015000 Ga0207648_100150005 575
880 3300026089 Ga0207648_10059941 Ga0207648_100599412 575
881 3300026089 Ga0207648_10101376 Ga0207648_101013762 575
882 3300026116 Ga0207674_10026118 Ga0207674_100261182 575
883 3300026121 Ga0207683_10004166 Ga0207683_100041668 575
884 3300026142 Ga0207698_10076880 Ga0207698_100768802 575
885 3300026142 Ga0207698_10086515 Ga0207698_100865151 575
886 3300028381 Ga0268264_10001678 Ga0268264_100016785 575
887 3300028794 Ga0307515_10002716 Ga0307515_1000271621 575
888 3300028794 Ga0307515_10016696 Ga0307515_100166963 575
889 3300030521 Ga0307511_10000673 Ga0307511_100006739 575
890 3300030731 Ga0316177_1067390 Ga0316177_10673905 575
891 3300030732 Ga0316176_1102439 Ga0316176_11024395 575
892 3300030742 Ga0316183_1003610 Ga0316183_100361017 575
893 3300030744 Ga0316181_1144023 Ga0316181_11440237 575
894 3300035172 Ga0373955_0023593 Ga0373955_0023593_495_2273 575
895 3300035410 Ga0373924_0036055 Ga0373924_0036055_131_1909 575
896 3300035724 Ga0373933_0049108 Ga0373933_0049108_601_2379 575
897 3300037312 Ga0395899_0000055 Ga0395899_0000055_88284_90020 575
898 3300037312 Ga0395899_0010495 Ga0395899_0010495_1374_3113 575
899 3300042014 Ga0439457_000620 Ga0439457_000620_4126_5937 575
900 3300044658 Ga0466972_0000095 Ga0466972_0000095_70686_72431 575
901 3300046471 Ga0495650_0000107 Ga0495650_0000107_115783_117519 575
902 3300046471 Ga0495650_0030127 Ga0495650_0030127_453_2189 575
903 3300046472 Ga0495580_0062746 Ga0495580_0062746_810_2552 575
904 3300046492 Ga0495585_0000014 Ga0495585_0000014_25433_27169 575
905 3300046507 Ga0495606_0000303 Ga0495606_0000303_67886_69622 575
906 3300046507 Ga0495606_0019559 Ga0495606_0019559_996_2735 575
907 3300046512 Ga0495610_0003739 Ga0495610_0003739_1284_3020 575
908 3300046513 Ga0495616_0011517 Ga0495616_0011517_2211_3947 575
909 3300046517 Ga0495630_0052405 Ga0495630_0052405_453_2195 575
910 3300046558 Ga0495633_0000021 Ga0495633_0000021_10786_12525 575
911 3300046558 Ga0495633_0013940 Ga0495633_0013940_1070_2806 575
912 3300046642 Ga0495634_0014817 Ga0495634_0014817_3747_5525 575
913 3300046660 Ga0495625_0000021 Ga0495625_0000021_108004_109740 575
914 3300046660 Ga0495625_0006168 Ga0495625_0006168_6601_8337 575
915 3300046665 Ga0495661_0002333 Ga0495661_0002333_11400_13136 575
916 3300046665 Ga0495661_0008530 Ga0495661_0008530_944_2680 575
917 3300046683 Ga0495658_0009737 Ga0495658_0009737_198_1940 575
918 3300046694 Ga0495649_0000009 Ga0495649_0000009_349787_351523 575
919 3300046810 Ga0495660_0009017 Ga0495660_0009017_86_1822 575
920 3300047319 Ga0495674_0076464 Ga0495674_0076464_990_2732 575
921 3300047443 Ga0495687_000586 Ga0495687_000586_28579_30315 575
922 3300047469 Ga0495673_0011664 Ga0495673_0011664_85_1821 575
923 3300047471 Ga0495684_0120639 Ga0495684_0120639_203_1945 575
924 3300047472 Ga0495686_0001407 Ga0495686_0001407_18546_20282 575
925 3300048904 Ga0496101_0012662 Ga0496101_0012662_334_2109 575
926 3300048919 Ga0496116_0024733 Ga0496116_0024733_2339_4081 575
927 3300048920 Ga0496117_0004347 Ga0496117_0004347_10133_11875 575
928 3300048921 Ga0496118_0022333 Ga0496118_0022333_1639_3381 575
929 3300048925 Ga0496122_0025946 Ga0496122_0025946_2031_3773 575
930 3300048926 Ga0496123_0033074 Ga0496123_0033074_1735_3477 575
931 3300049459 Ga0495678_002150 Ga0495678_002150_1237_2973 575
932 3300049571 Ga0501034_0009300 Ga0501034_0009300_741_2504 575
933 3300049571 Ga0501034_0038864 Ga0501034_0038864_437_2179 575
934 3300049580 Ga0501046_0116134 Ga0501046_0116134_239_1981 575
935 3300049581 Ga0501047_0032779 Ga0501047_0032779_1580_3325 575
936 3300049581 Ga0501047_0042741 Ga0501047_0042741_226_1989 575
937 3300049582 Ga0501048_0010094 Ga0501048_0010094_4162_5904 575
938 3300049582 Ga0501048_0030544 Ga0501048_0030544_1008_2771 575
939 3300049583 Ga0501067_0014825 Ga0501067_0014825_264_2006 575
940 3300049586 Ga0501070_0032613 Ga0501070_0032613_982_2724 575
941 3300049589 Ga0501073_0013211 Ga0501073_0013211_1325_3088 575
942 3300049589 Ga0501073_0087081 Ga0501073_0087081_319_2061 575
943 3300049742 Ga0501080_0083240 Ga0501080_0083240_1152_2915 575
944 3300049823 Ga0501044_0009540 Ga0501044_0009540_7696_9441 575
945 3300049823 Ga0501044_0019651 Ga0501044_0019651_2876_4618 575
946 3300050493 nmdc:mga0k408_32055_c1 nmdc:mga0k408_32055_c1_320_2065 575
947 3300050493 nmdc:mga0k408_372_c1 nmdc:mga0k408_372_c1_12874_14613 575
948 3300053080 Ga0500635_0004277 Ga0500635_0004277_607_2346 575
949 3300053088 Ga0500644_0021667 Ga0500644_0021667_82_1827 575
950 3300053125 Ga0500618_006010 Ga0500618_006010_516_2252 575
951 3300060353 Ga0501082_0026906 Ga0501082_0026906_3202_4944 575
952 iso_pu_bacteria 2585427687 2586208658 575
953 iso_pu_bacteria 2738541283 2738756903 575
954 iso_pu_bacteria 2738541284 2738760158 575
955 iso_pu_bacteria 2738541302 2738856606 575
956 iso_pu_bacteria 2739367651 2739588144 575
957 iso_pu_bacteria 2739367656 2739616241 575
958 iso_pu_bacteria 2775506987 2776612140 575
959 iso_pu_bacteria 2842722452 2842724058 575
960 iso_pu_bacteria 2842909656 2842912210 575
961 iso_pu_bacteria 2849281842 2849286949 575
962 iso_pu_bacteria 2852627209 2852631197 575
963 iso_pu_bacteria 2857627736 2857631345 575
964 iso_pu_bacteria 2895498888 2895500259 575
965 iso_pu_bacteria 2904445276 2904446307 575
966 iso_pu_bacteria 2919186247 2919191466 575
967 iso_pu_bacteria 2939664404 2939669615 575
968 iso_pu_bacteria 2945997725 2945999131 575
969 iso_pu_bacteria 2954016120 2954021582 575
970 3300003781 Ga0055536_1000004 Ga0055536_1000004310 576
971 3300003791 Ga0055530_10001535 Ga0055530_100015355 576
972 3300005288 Ga0065714_10002421 Ga0065714_1000242111 576
973 3300005288 Ga0065714_10067466 Ga0065714_100674663 576
974 3300005327 Ga0070658_10009107 Ga0070658_100091073 576
975 3300005327 Ga0070658_10103514 Ga0070658_101035141 576
976 3300005331 Ga0070670_100047585 Ga0070670_1000475852 576
977 3300005331 Ga0070670_100074309 Ga0070670_1000743092 576
978 3300005334 Ga0068869_100065305 Ga0068869_1000653052 576
979 3300005339 Ga0070660_100006797 Ga0070660_1000067976 576
980 3300005339 Ga0070660_100027413 Ga0070660_1000274134 576
981 3300005354 Ga0070675_100007608 Ga0070675_1000076085 576
982 3300005366 Ga0070659_100027708 Ga0070659_1000277082 576
983 3300005530 Ga0070679_100000880 Ga0070679_1000008802 576
984 3300005530 Ga0070679_100042733 Ga0070679_1000427334 576
985 3300005535 Ga0070684_100044547 Ga0070684_1000445474 576
986 3300005563 Ga0068855_100000139 Ga0068855_10000013967 576
987 3300005563 Ga0068855_100004391 Ga0068855_1000043912 576
988 3300005563 Ga0068855_100011554 Ga0068855_1000115545 576
989 3300005577 Ga0068857_100000719 Ga0068857_1000007198 576
990 3300005577 Ga0068857_100081050 Ga0068857_1000810502 576
991 3300005578 Ga0068854_100018287 Ga0068854_1000182872 576
992 3300005614 Ga0068856_100000118 Ga0068856_10000011844 576
993 3300005614 Ga0068856_100032875 Ga0068856_1000328754 576
994 3300005616 Ga0068852_100002172 Ga0068852_1000021726 576
995 3300005843 Ga0068860_100000241 Ga0068860_10000024112 576
996 3300005843 Ga0068860_100019411 Ga0068860_1000194115 576
997 3300005843 Ga0068860_100026735 Ga0068860_1000267352 576
998 3300005844 Ga0068862_100010218 Ga0068862_1000102182 576
999 3300006847 Ga0075431_100000860 Ga0075431_1000008606 576
1000 3300006931 Ga0097620_100009741 Ga0097620_1000097417 576
1001 3300009093 Ga0105240_10017211 Ga0105240_100172117 576
1002 3300009093 Ga0105240_10040050 Ga0105240_100400502 576
1003 3300009147 Ga0114129_10017693 Ga0114129_100176935 576
1004 3300009174 Ga0105241_10014095 Ga0105241_100140955 576
1005 3300009545 Ga0105237_10000247 Ga0105237_1000024753 576
1006 3300009545 Ga0105237_10023685 Ga0105237_100236853 576
1007 3300010375 Ga0105239_10000169 Ga0105239_1000016927 576
1008 3300013100 Ga0157373_10008001 Ga0157373_100080012 576
1009 3300013100 Ga0157373_10044213 Ga0157373_100442132 576
1010 3300013104 Ga0157370_10006253 Ga0157370_100062538 576
1011 3300013104 Ga0157370_10013165 Ga0157370_100131658 576
1012 3300013104 Ga0157370_10020699 Ga0157370_100206995 576
1013 3300013104 Ga0157370_10027089 Ga0157370_100270895 576
1014 3300013307 Ga0157372_10001013 Ga0157372_100010138 576
1015 3300015682 Ga0183373_1004 Ga0183373_1004252 576
1016 3300025292 Ga0209676_1000009 Ga0209676_1000009245 576
1017 3300025298 Ga0209050_1000048 Ga0209050_100004840 576
1018 3300025904 Ga0207647_10007727 Ga0207647_100077276 576
1019 3300025913 Ga0207695_10005627 Ga0207695_1000562712 576
1020 3300025913 Ga0207695_10023123 Ga0207695_100231234 576
1021 3300025914 Ga0207671_10000441 Ga0207671_100004415 576
1022 3300025914 Ga0207671_10008216 Ga0207671_100082164 576
1023 3300025919 Ga0207657_10041978 Ga0207657_100419781 576
1024 3300025919 Ga0207657_10081451 Ga0207657_100814512 576
1025 3300025921 Ga0207652_10000064 Ga0207652_1000006430 576
1026 3300025921 Ga0207652_10053242 Ga0207652_100532423 576
1027 3300025949 Ga0207667_10000033 Ga0207667_1000003365 576
1028 3300025949 Ga0207667_10001284 Ga0207667_100012848 576
1029 3300025949 Ga0207667_10021551 Ga0207667_100215513 576
1030 3300025981 Ga0207640_10017605 Ga0207640_100176053 576
1031 3300025986 Ga0207658_10054583 Ga0207658_100545831 576
1032 3300026078 Ga0207702_10000194 Ga0207702_1000019410 576
1033 3300026078 Ga0207702_10059674 Ga0207702_100596742 576
1034 3300026116 Ga0207674_10001723 Ga0207674_1000172315 576
1035 3300026116 Ga0207674_10078689 Ga0207674_100786892 576
1036 3300026142 Ga0207698_10005000 Ga0207698_100050004 576
1037 3300028381 Ga0268264_10000011 Ga0268264_10000011420 576
1038 3300028381 Ga0268264_10011706 Ga0268264_100117062 576
1039 3300028786 Ga0307517_10047742 Ga0307517_100477422 576
1040 3300028794 Ga0307515_10000074 Ga0307515_10000074151 576
1041 3300028794 Ga0307515_10029646 Ga0307515_100296464 576
1042 3300031548 Ga0307408_100000143 Ga0307408_10000014341 576
1043 3300037312 Ga0395899_0009107 Ga0395899_0009107_5094_6836 576
1044 3300037312 Ga0395899_0011086 Ga0395899_0011086_4625_6367 576
1045 3300037312 Ga0395899_0028035 Ga0395899_0028035_2109_3848 576
1046 3300037418 Ga0395900_0000541 Ga0395900_0000541_11663_13411 576
1047 3300037418 Ga0395900_0007879 Ga0395900_0007879_7187_8929 576
1048 3300037418 Ga0395900_0013989 Ga0395900_0013989_1671_3413 576
1049 3300037418 Ga0395900_0045279 Ga0395900_0045279_403_2142 576
1050 3300037466 Ga0395898_0002029 Ga0395898_0002029_9771_11513 576
1051 3300037466 Ga0395898_0011571 Ga0395898_0011571_525_2267 576
1052 3300037471 Ga0395905_0002917 Ga0395905_0002917_11122_12861 576
1053 3300037471 Ga0395905_0053430 Ga0395905_0053430_1251_2996 576
1054 3300038443 Ga0395901_0003913 Ga0395901_0003913_11193_12932 576
1055 3300038443 Ga0395901_0068624 Ga0395901_0068624_860_2602 576
1056 3300044656 Ga0466969_0000778 Ga0466969_0000778_4548_6320 576
1057 3300044693 Ga0466961_0004336 Ga0466961_0004336_4379_6151 576
1058 3300045049 Ga0466959_0000125 Ga0466959_0000125_36756_38528 576
1059 3300045049 Ga0466959_0102215 Ga0466959_0102215_21_1793 576
1060 3300046512 Ga0495610_0000967 Ga0495610_0000967_7108_8856 576
1061 3300047443 Ga0495687_000001 Ga0495687_000001_855029_856825 576
1062 3300049570 Ga0501033_0086365 Ga0501033_0086365_144_1889 576
1063 3300049571 Ga0501034_0023079 Ga0501034_0023079_1221_2966 576
1064 3300049571 Ga0501034_0025486 Ga0501034_0025486_3841_5586 576
1065 3300049586 Ga0501070_0030975 Ga0501070_0030975_2212_3957 576
1066 3300049664 Ga0501224_002098 Ga0501224_002098_746_2656 576
1067 3300049688 Ga0501259_000442 Ga0501259_000442_4515_6425 576
1068 3300049822 Ga0501035_0050648 Ga0501035_0050648_1086_2831 576
1069 3300050510 nmdc:mga06r32_8029_c1 nmdc:mga06r32_8029_c1_803_2551 576
1070 iso_pu_bacteria 2852623160 2852625216 576
1071 iso_pu_bacteria 2884933994 2884934229 576
1072 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001101 577
1073 3300003187 JGI25151J46595_10000001 JGI25151J46595_10000001692 577
1074 3300003215 JGI25153J46596_10000001 JGI25153J46596_10000001581 577
1075 3300005288 Ga0065714_10006014 Ga0065714_100060148 577
1076 3300005327 Ga0070658_10000160 Ga0070658_1000016040 577
1077 3300005563 Ga0068855_100049584 Ga0068855_1000495844 577
1078 3300013100 Ga0157373_10057711 Ga0157373_100577113 577
1079 3300013102 Ga0157371_10000074 Ga0157371_1000007427 577
1080 3300013102 Ga0157371_10013976 Ga0157371_100139762 577
1081 3300013104 Ga0157370_10001419 Ga0157370_100014196 577
1082 3300013105 Ga0157369_10000016 Ga0157369_100000169 577
1083 3300013297 Ga0157378_10026271 Ga0157378_100262713 577
1084 3300013308 Ga0157375_10111743 Ga0157375_101117432 577
1085 3300014497 Ga0182008_10001858 Ga0182008_100018589 577
1086 3300015261 Ga0182006_1001293 Ga0182006_10012939 577
1087 3300015262 Ga0182007_10000002 Ga0182007_10000002212 577
1088 3300017792 Ga0163161_10000545 Ga0163161_1000054526 577
1089 3300017792 Ga0163161_10004401 Ga0163161_100044015 577
1090 3300025245 Ga0207425_1000002 Ga0207425_10000021057 577
1091 3300025258 Ga0209129_1000002 Ga0209129_10000021057 577
1092 3300025294 Ga0209025_1000004 Ga0209025_1000004135 577
1093 3300025297 Ga0209758_1000006 Ga0209758_1000006135 577
1094 3300025909 Ga0207705_10000210 Ga0207705_1000021040 577
1095 3300025949 Ga0207667_10064852 Ga0207667_100648522 577
1096 3300031731 Ga0307405_10000006 Ga0307405_10000006287 577
1097 3300031903 Ga0307407_10000031 Ga0307407_1000003174 577
1098 3300031995 Ga0307409_100023026 Ga0307409_1000230264 577
1099 3300032002 Ga0307416_100000002 Ga0307416_100000002195 577
1100 3300046507 Ga0495606_0019848 Ga0495606_0019848_1753_3501 577
1101 3300046520 Ga0495637_0004191 Ga0495637_0004191_3279_5069 577
1102 3300005364 Ga0070673_100049315 Ga0070673_1000493152 578
1103 3300005366 Ga0070659_100056061 Ga0070659_1000560612 578
1104 3300005457 Ga0070662_100000013 Ga0070662_10000001366 578
1105 3300005543 Ga0070672_100045119 Ga0070672_1000451192 578
1106 3300009093 Ga0105240_10001477 Ga0105240_100014779 578
1107 3300009174 Ga0105241_10004581 Ga0105241_100045814 578
1108 3300009545 Ga0105237_10148523 Ga0105237_101485232 578
1109 3300013296 Ga0157374_10007387 Ga0157374_100073877 578
1110 3300013307 Ga0157372_10115472 Ga0157372_101154723 578
1111 3300025904 Ga0207647_10000044 Ga0207647_1000004467 578
1112 3300025913 Ga0207695_10003319 Ga0207695_1000331914 578
1113 3300025919 Ga0207657_10047164 Ga0207657_100471642 578
1114 3300025926 Ga0207659_10046657 Ga0207659_100466572 578
1115 3300025932 Ga0207690_10049287 Ga0207690_100492872 578
1116 3300025933 Ga0207706_10007721 Ga0207706_100077219 578
1117 3300025940 Ga0207691_10007147 Ga0207691_100071473 578
1118 3300025960 Ga0207651_10007315 Ga0207651_100073152 578
1119 3300033179 Ga0307507_10000034 Ga0307507_1000003464 578
1120 3300046524 Ga0495648_0017653 Ga0495648_0017653_2949_4703 578
1121 3300046616 Ga0495668_0000165 Ga0495668_0000165_64804_66558 578
1122 3300046660 Ga0495625_0002553 Ga0495625_0002553_14094_15848 578
1123 3300046660 Ga0495625_0090890 Ga0495625_0090890_188_1954 578
1124 3300046665 Ga0495661_0004477 Ga0495661_0004477_1755_3503 578
1125 3300053125 Ga0500618_000245 Ga0500618_000245_18349_20103 578
1126 3300053156 Ga0500622_0002381 Ga0500622_0002381_3073_4839 578
1127 2162886007 SwRhRL2b_contig_1018414 SwRhRL2b_0723.00008410 579
1128 3300003320 rootH2_10000336 rootH2_1000033660 579
1129 3300004799 Ga0058863_11434785 Ga0058863_114347852 579
1130 3300005288 Ga0065714_10003183 Ga0065714_100031837 579
1131 3300005288 Ga0065714_10008525 Ga0065714_100085251 579
1132 3300005289 Ga0065704_10000302 Ga0065704_1000030214 579
1133 3300005289 Ga0065704_10078149 Ga0065704_100781492 579
1134 3300005458 Ga0070681_10024467 Ga0070681_100244673 579
1135 3300005539 Ga0068853_100027183 Ga0068853_1000271832 579
1136 3300005548 Ga0070665_100000010 Ga0070665_100000010415 579
1137 3300005563 Ga0068855_100017608 Ga0068855_1000176087 579
1138 3300006195 Ga0075366_10010036 Ga0075366_100100362 579
1139 3300009093 Ga0105240_10007004 Ga0105240_100070042 579
1140 3300009545 Ga0105237_10029831 Ga0105237_100298313 579
1141 3300013100 Ga0157373_10001325 Ga0157373_1000132512 579
1142 3300013100 Ga0157373_10036310 Ga0157373_100363102 579
1143 3300013102 Ga0157371_10022297 Ga0157371_100222972 579
1144 3300013102 Ga0157371_10035060 Ga0157371_100350604 579
1145 3300013104 Ga0157370_10003017 Ga0157370_100030173 579
1146 3300013306 Ga0163162_10000005 Ga0163162_10000005366 579
1147 3300013308 Ga0157375_10063235 Ga0157375_100632353 579
1148 3300014497 Ga0182008_10000014 Ga0182008_1000001417 579
1149 3300014497 Ga0182008_10000358 Ga0182008_100003586 579
1150 3300017792 Ga0163161_10009805 Ga0163161_100098053 579
1151 3300021361 Ga0213872_10014693 Ga0213872_100146934 579
1152 3300025911 Ga0207654_10028058 Ga0207654_100280582 579
1153 3300025912 Ga0207707_10046982 Ga0207707_100469822 579
1154 3300025913 Ga0207695_10079295 Ga0207695_100792952 579
1155 3300025921 Ga0207652_10008524 Ga0207652_100085246 579
1156 3300025949 Ga0207667_10025511 Ga0207667_100255112 579
1157 3300026041 Ga0207639_10022322 Ga0207639_100223224 579
1158 3300028379 Ga0268266_10000032 Ga0268266_10000032162 579
1159 3300031911 Ga0307412_10000029 Ga0307412_10000029138 579
1160 3300032004 Ga0307414_10000776 Ga0307414_100007762 579
1161 3300032004 Ga0307414_10005750 Ga0307414_100057505 579
1162 3300032004 Ga0307414_10038059 Ga0307414_100380593 579
1163 3300037312 Ga0395899_0000011 Ga0395899_0000011_472764_474515 579
1164 3300037312 Ga0395899_0000726 Ga0395899_0000726_10468_12225 579
1165 3300037418 Ga0395900_0000173 Ga0395900_0000173_2753_4510 579
1166 3300037466 Ga0395898_0002849 Ga0395898_0002849_10764_12521 579
1167 3300037471 Ga0395905_0014577 Ga0395905_0014577_2625_4382 579
1168 3300048925 Ga0496122_0001365 Ga0496122_0001365_26254_27993 579
1169 3300049758 Ga0501241_003128 Ga0501241_003128_812_2551 579
1170 3300053093 Ga0500651_0000302 Ga0500651_0000302_8585_10324 579

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00205

TPP_enzyme_M

Thiamine pyrophosphate enzyme, central domain

269

404

0.98

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

465

612

0.98

PF02776

TPP_enzyme_N

Thiamine pyrophosphate enzyme, N-terminal TPP binding domain

77

195

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lpi-assembly4.cif.gz_D crystal structure of ahas holo-enzyme 0.9647 18 577
6lpi-assembly4.cif.gz_D crystal structure of ahas holo-enzyme 0.9629 18 577
6lpi-assembly3.cif.gz_C crystal structure of ahas holo-enzyme 0.9607 18 577
6lpi-assembly2.cif.gz_B crystal structure of ahas holo-enzyme 0.9591 19 577
6lpi-assembly3.cif.gz_C crystal structure of ahas holo-enzyme 0.9589 18 577
ID Description Score Start End Superfamily
af_P0DP89_182_327_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9808 208 348 3.40.50.1220
af_P08142_199_364_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9691 211 369 3.40.50.1220
1yhzA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9687 383 563 3.40.50.970
af_P0DP89_1_170_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9622 20 185 3.40.50.970
af_A0A1D8PJF9_456_683_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9582 379 579 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A1F3FB36-F1-model_v4 Acetolactate synthase (EC 2.2.1.6) 0.9888 67 579 GO:0000287
GO:0003984
GO:0005948
GO:0009097
GO:0009099
GO:0030976
GO:0050660
AF-A0A357JGG1-F1-model_v4 Acetolactate synthase large subunit (EC 2.2.1.6) 0.9874 18 346 GO:0000287
GO:0003984
GO:0005948
GO:0009097
GO:0009099
GO:0030976
GO:0050660
AF-A0A2E9DU44-F1-model_v4 Thiamine pyrophosphate enzyme TPP-binding domain-containing protein 0.9864 317 579 GO:0000287
GO:0003984
GO:0005948
GO:0009097
GO:0009099
GO:0030976
GO:0050660
AF-A0A3D2IC13-F1-model_v4 Acetolactate synthase large subunit (EC 2.2.1.6) 0.985 73 420 GO:0000287
GO:0003984
GO:0005948
GO:0009097
GO:0009099
GO:0030976
GO:0050660
AF-A0A1F3FB36-F1-model_v4 Acetolactate synthase (EC 2.2.1.6) 0.9849 67 579 GO:0000287
GO:0003984
GO:0005948
GO:0009097
GO:0009099
GO:0030976
GO:0050660

Feature Viewer

pLDDT pTM Quality
92.1 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map