F491158
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1170 | 447 | 1098 | 579 |
Family's Representative Sequence
| Representative Sequence | 3300049664|Ga0501224_002098|Ga0501224_002098_746_2656 |
| Length | 636 |
| Sequence | MNDLPPSPKGEIWEIRSIDRVPSKIKSKKMATQLLKTTPENKDSAQKTPSGDKSKSTETTASTPDSPLGDGGTPEQISGSIAVLEALIAEGVDTIFGYPGGAIMPIYDALYDYREKLQHILVRHEQGGIHAGQGYARTSGNVGVVFATSGPGATNLVTGLADALIDSTPLVCITGQVFAHLLGTDAFQETDVINITTPITKWNYQVTDAMEIPEVMAKAFYIAKSGRPGPVLIDITKNAQIQKFDYKGYKKCNHIRSYRPKPIVRKEYVEEAAKLINSAEKPFIIFGQGVILGKAEKEFQKFIEKSGIPAACTILGLSALPSDHPLNVGMLGMHGNYGPNVLTNECDVLIAVGMRFDDRVTGRLDKYAKQAKVIHLDIDPAEIDKNVKATVPVWGDCKETLPLLTELVEQKVYPKWLEKFNDYKQKEETICIIPEMNPAVPEISMAEVIDALNDLTNGDAVIVTDVGQHQMVTCRYAKFKKSKSNVTSGGLGTMGFALPAAIGAKYGAPDRTVIAIIGDGGVQMTVQELGTIMQFDIDVKILILNNEFLGMVRQWQQLFHDKRYSFVNITSPDYIMVAKGYGIEGQKVSQRENLKTALKTMLDHNGAYLLEVMVGKENNVFPMVPQGCSVAEIRLQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 3 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 4 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 5 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 6 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 7 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 8 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 9 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 10 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 11 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 12 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 13 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 14 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 15 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 16 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 17 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 18 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 19 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 20 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 21 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 22 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 23 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 24 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 25 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 26 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 27 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 28 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 29 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 30 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 31 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 32 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 33 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 34 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 35 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 36 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 37 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 38 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 39 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 40 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 41 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 42 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 43 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 44 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 45 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 46 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 47 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 48 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 49 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 50 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 51 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 52 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 53 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 54 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 55 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 56 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 57 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 58 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 59 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 60 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 61 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 62 | 2939615513 | Lactococcus lactis 1925 | Isolate | Rhizosphere |
| 63 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 64 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 65 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 66 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 67 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 68 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 69 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 70 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 71 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 72 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 73 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 74 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 75 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 76 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 77 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 78 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 79 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 81 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 82 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 83 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 84 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 85 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 86 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 87 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 88 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 89 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 90 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 91 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 92 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 93 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 94 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 95 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 96 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 97 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 98 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 103 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 105 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 107 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 115 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 122 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 123 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 124 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 125 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 126 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 127 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 128 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 129 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 130 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 132 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 136 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 138 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 139 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 140 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 141 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 142 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 143 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 144 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 145 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 146 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 147 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 148 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 149 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 150 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 152 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 154 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 155 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 156 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 157 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 158 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 159 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 187 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 191 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 192 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 193 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 195 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 196 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 197 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 198 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 199 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 202 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 203 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 204 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 206 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 267 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 271 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 272 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 273 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 274 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 275 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 276 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 277 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 278 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 279 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 280 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 281 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 282 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 283 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 284 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 285 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 286 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 287 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 288 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 289 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 290 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 291 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 292 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 293 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 294 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 295 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 296 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 297 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 298 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 299 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 300 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 301 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 302 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 303 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 304 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 305 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 306 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 307 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 308 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 309 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 310 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 311 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 312 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 313 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 314 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 315 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 316 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 317 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 318 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 319 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 320 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 321 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 322 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 323 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 324 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 325 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 326 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 327 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 328 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 329 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 330 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 331 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 332 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 333 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 334 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 374 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 375 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 376 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 377 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 378 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 379 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 380 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 381 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 382 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 383 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 384 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 385 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 386 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 387 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 388 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 413 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 414 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 415 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 416 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 417 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 418 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 419 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 423 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 427 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 428 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 434 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 436 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 437 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 438 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 439 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 440 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 441 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 442 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 443 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 444 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 445 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 447 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.42 |
| Metatranscriptomes | 0.43 |
| Isolates | 6.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.17 |
| Bulb | 0 |
| Endosphere | 4.02 |
| Nodule | 0.09 |
| Rhizoplane | 0.94 |
| Rhizosphere | 87.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1018414 | 2162886007 | Bacteria | 6186 |
| 2 | JGI24737J22298_10004033 | 3300001990 | Bacteria | 5133 |
| 3 | JGI24735J21928_10000003 | 3300002067 | Bacteria | 385983 |
| 4 | JGI24751J29686_10000950 | 3300002459 | Bacteria | 6421 |
| 5 | JGI25162J39368_1000123 | 3300002737 | Bacteria | 85062 |
| 6 | JGI25162J39368_1000931 | 3300002737 | Bacteria | 18808 |
| 7 | JGI25164J39214_1001625 | 3300002772 | Bacteria | 4709 |
| 8 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 9 | JGI25151J46595_10000001 | 3300003187 | Bacteria | 887211 |
| 10 | JGI25406J46586_10010325 | 3300003203 | Bacteria | 4147 |
| 11 | JGI25165J46597_1000399 | 3300003214 | Bacteria | 45926 |
| 12 | JGI25153J46596_10000001 | 3300003215 | Bacteria | 748985 |
| 13 | rootH1_10019188 | 3300003316 | Bacteria | 26527 |
| 14 | rootH2_10000336 | 3300003320 | Bacteria | 69852 |
| 15 | rootH2_10024557 | 3300003320 | Bacteria | 11002 |
| 16 | rootH2_10112387 | 3300003320 | Bacteria | 8931 |
| 17 | rootL2_10100912 | 3300003322 | Bacteria | 8358 |
| 18 | rootL2_10235324 | 3300003322 | Bacteria | 3811 |
| 19 | rootH1_10003494 | 3300003323 | Bacteria | 6230 |
| 20 | rootH1_10007401 | 3300003323 | Bacteria | 21414 |
| 21 | rootH1_10062604 | 3300003323 | Bacteria | 9248 |
| 22 | JGI25160J50197_1000687 | 3300003354 | Bacteria | 18745 |
| 23 | Ga0006562J51391_1004821 | 3300003578 | Bacteria | 6910 |
| 24 | Ga0055536_1000004 | 3300003781 | Bacteria | 411108 |
| 25 | Ga0055534_1009268 | 3300003784 | Bacteria | 2152 |
| 26 | Ga0055530_10001535 | 3300003791 | Bacteria | 16585 |
| 27 | Ga0055531_10000139 | 3300003794 | Bacteria | 82993 |
| 28 | Ga0058863_11434785 | 3300004799 | Bacteria | 2659 |
| 29 | Ga0065714_10002421 | 3300005288 | Bacteria | 18345 |
| 30 | Ga0065714_10003183 | 3300005288 | Bacteria | 11043 |
| 31 | Ga0065714_10006014 | 3300005288 | Bacteria | 9989 |
| 32 | Ga0065714_10008525 | 3300005288 | Bacteria | 5440 |
| 33 | Ga0065714_10067466 | 3300005288 | Bacteria | 5484 |
| 34 | Ga0065704_10000302 | 3300005289 | Bacteria | 36124 |
| 35 | Ga0065704_10002965 | 3300005289 | Bacteria | 8333 |
| 36 | Ga0065704_10070912 | 3300005289 | Bacteria | 14743 |
| 37 | Ga0065704_10078149 | 3300005289 | Bacteria | 4491 |
| 38 | Ga0065704_10117650 | 3300005289 | Bacteria | 1830 |
| 39 | Ga0065712_10000499 | 3300005290 | Bacteria | 10768 |
| 40 | Ga0065712_10074461 | 3300005290 | Bacteria | 4088 |
| 41 | Ga0065715_10091975 | 3300005293 | Bacteria | 5419 |
| 42 | Ga0065715_10103649 | 3300005293 | Bacteria | 2994 |
| 43 | Ga0065707_10117751 | 3300005295 | Bacteria | 2204 |
| 44 | Ga0070658_10000160 | 3300005327 | Bacteria | 59295 |
| 45 | Ga0070658_10003403 | 3300005327 | Bacteria | 13081 |
| 46 | Ga0070658_10009107 | 3300005327 | Bacteria | 7982 |
| 47 | Ga0070658_10103514 | 3300005327 | Bacteria | 2354 |
| 48 | Ga0070676_10000980 | 3300005328 | Bacteria | 14196 |
| 49 | Ga0070676_10002582 | 3300005328 | Bacteria | 9314 |
| 50 | Ga0070676_10004504 | 3300005328 | Bacteria | 7335 |
| 51 | Ga0070676_10032880 | 3300005328 | Bacteria | 2974 |
| 52 | Ga0070683_100003447 | 3300005329 | Bacteria | 12844 |
| 53 | Ga0070683_100147280 | 3300005329 | Bacteria | 2231 |
| 54 | Ga0070670_100029260 | 3300005331 | Bacteria | 4741 |
| 55 | Ga0070670_100035645 | 3300005331 | Bacteria | 4282 |
| 56 | Ga0070670_100047585 | 3300005331 | Bacteria | 3691 |
| 57 | Ga0070670_100057142 | 3300005331 | Bacteria | 3350 |
| 58 | Ga0070670_100074309 | 3300005331 | Bacteria | 2920 |
| 59 | Ga0070670_100098304 | 3300005331 | Bacteria | 2518 |
| 60 | Ga0070670_100153832 | 3300005331 | Bacteria | 1991 |
| 61 | Ga0068869_100003787 | 3300005334 | Bacteria | 9318 |
| 62 | Ga0068869_100013562 | 3300005334 | Bacteria | 5423 |
| 63 | Ga0068869_100042601 | 3300005334 | Bacteria | 3255 |
| 64 | Ga0068869_100065305 | 3300005334 | Bacteria | 2678 |
| 65 | Ga0068869_100114830 | 3300005334 | Bacteria | 2053 |
| 66 | Ga0070666_10000042 | 3300005335 | Bacteria | 112296 |
| 67 | Ga0070666_10003610 | 3300005335 | Bacteria | 9381 |
| 68 | Ga0070666_10023903 | 3300005335 | Bacteria | 3979 |
| 69 | Ga0070666_10069361 | 3300005335 | Bacteria | 2397 |
| 70 | Ga0070666_10073219 | 3300005335 | Bacteria | 2333 |
| 71 | Ga0070680_100000323 | 3300005336 | Bacteria | 32103 |
| 72 | Ga0070682_100000158 | 3300005337 | Bacteria | 51858 |
| 73 | Ga0070682_100006212 | 3300005337 | Bacteria | 6695 |
| 74 | Ga0068868_100013211 | 3300005338 | Bacteria | 6048 |
| 75 | Ga0068868_100029048 | 3300005338 | Bacteria | 4234 |
| 76 | Ga0068868_100039782 | 3300005338 | Bacteria | 3656 |
| 77 | Ga0068868_100096524 | 3300005338 | Bacteria | 2388 |
| 78 | Ga0070660_100001381 | 3300005339 | Bacteria | 16497 |
| 79 | Ga0070660_100006797 | 3300005339 | Bacteria | 7939 |
| 80 | Ga0070660_100018003 | 3300005339 | Bacteria | 5156 |
| 81 | Ga0070660_100018476 | 3300005339 | Bacteria | 5095 |
| 82 | Ga0070660_100027413 | 3300005339 | Bacteria | 4250 |
| 83 | Ga0070661_100002466 | 3300005344 | Bacteria | 12693 |
| 84 | Ga0070661_100003469 | 3300005344 | Bacteria | 10878 |
| 85 | Ga0070661_100040116 | 3300005344 | Bacteria | 3414 |
| 86 | Ga0070668_100006878 | 3300005347 | Bacteria | 8429 |
| 87 | Ga0070668_100024239 | 3300005347 | Bacteria | 4595 |
| 88 | Ga0070669_100007952 | 3300005353 | Bacteria | 7577 |
| 89 | Ga0070675_100007608 | 3300005354 | Bacteria | 8383 |
| 90 | Ga0070675_100013806 | 3300005354 | Bacteria | 6359 |
| 91 | Ga0070671_100000489 | 3300005355 | Bacteria | 27650 |
| 92 | Ga0070671_100008573 | 3300005355 | Bacteria | 8197 |
| 93 | Ga0070671_100042034 | 3300005355 | Bacteria | 3799 |
| 94 | Ga0070673_100001841 | 3300005364 | Bacteria | 12677 |
| 95 | Ga0070673_100049315 | 3300005364 | Bacteria | 3287 |
| 96 | Ga0070673_100056413 | 3300005364 | Bacteria | 3099 |
| 97 | Ga0070673_100070558 | 3300005364 | Bacteria | 2804 |
| 98 | Ga0070688_100002056 | 3300005365 | Bacteria | 10157 |
| 99 | Ga0070659_100000486 | 3300005366 | Bacteria | 29153 |
| 100 | Ga0070659_100025920 | 3300005366 | Bacteria | 4510 |
| 101 | Ga0070659_100027708 | 3300005366 | Bacteria | 4368 |
| 102 | Ga0070659_100036128 | 3300005366 | Bacteria | 3850 |
| 103 | Ga0070659_100056061 | 3300005366 | Bacteria | 3107 |
| 104 | Ga0070667_100000497 | 3300005367 | Bacteria | 39867 |
| 105 | Ga0070667_100002981 | 3300005367 | Bacteria | 14548 |
| 106 | Ga0070667_100003004 | 3300005367 | Bacteria | 14486 |
| 107 | Ga0070667_100023268 | 3300005367 | Bacteria | 5139 |
| 108 | Ga0070667_100062831 | 3300005367 | Bacteria | 3146 |
| 109 | Ga0070700_100006894 | 3300005441 | Bacteria | 6101 |
| 110 | Ga0070663_100001316 | 3300005455 | Bacteria | 13590 |
| 111 | Ga0070663_100067764 | 3300005455 | Bacteria | 2590 |
| 112 | Ga0070678_100008016 | 3300005456 | Bacteria | 6297 |
| 113 | Ga0070678_100032141 | 3300005456 | Bacteria | 3629 |
| 114 | Ga0070662_100000013 | 3300005457 | Bacteria | 125019 |
| 115 | Ga0070662_100016379 | 3300005457 | Bacteria | 4976 |
| 116 | Ga0070662_100071153 | 3300005457 | Bacteria | 2564 |
| 117 | Ga0070681_10024467 | 3300005458 | Bacteria | 6080 |
| 118 | Ga0070681_10039612 | 3300005458 | Bacteria | 4723 |
| 119 | Ga0070681_10068502 | 3300005458 | Bacteria | 3515 |
| 120 | Ga0068867_100000968 | 3300005459 | Bacteria | 19588 |
| 121 | Ga0068867_100118624 | 3300005459 | Bacteria | 2041 |
| 122 | Ga0070685_10009755 | 3300005466 | Bacteria | 4976 |
| 123 | Ga0070706_100027552 | 3300005467 | Bacteria | 5229 |
| 124 | Ga0070698_100002401 | 3300005471 | Bacteria | 20622 |
| 125 | Ga0070679_100000323 | 3300005530 | Bacteria | 40444 |
| 126 | Ga0070679_100000397 | 3300005530 | Bacteria | 37025 |
| 127 | Ga0070679_100000880 | 3300005530 | Bacteria | 26077 |
| 128 | Ga0070679_100020451 | 3300005530 | Bacteria | 6453 |
| 129 | Ga0070679_100042733 | 3300005530 | Bacteria | 4514 |
| 130 | Ga0070679_100083227 | 3300005530 | Bacteria | 3188 |
| 131 | Ga0070684_100000172 | 3300005535 | Bacteria | 44308 |
| 132 | Ga0070684_100010008 | 3300005535 | Bacteria | 7497 |
| 133 | Ga0070684_100025664 | 3300005535 | Bacteria | 4956 |
| 134 | Ga0070684_100035442 | 3300005535 | Bacteria | 4270 |
| 135 | Ga0070684_100042864 | 3300005535 | Bacteria | 3908 |
| 136 | Ga0070684_100044547 | 3300005535 | Bacteria | 3838 |
| 137 | Ga0070697_100001004 | 3300005536 | Bacteria | 21288 |
| 138 | Ga0070697_100008131 | 3300005536 | Bacteria | 8185 |
| 139 | Ga0068853_100004535 | 3300005539 | Bacteria | 10775 |
| 140 | Ga0068853_100010943 | 3300005539 | Bacteria | 7352 |
| 141 | Ga0068853_100023395 | 3300005539 | Bacteria | 5171 |
| 142 | Ga0068853_100027183 | 3300005539 | Bacteria | 4807 |
| 143 | Ga0068853_100040644 | 3300005539 | Bacteria | 3969 |
| 144 | Ga0068853_100130160 | 3300005539 | Bacteria | 2252 |
| 145 | Ga0070672_100000067 | 3300005543 | Bacteria | 47884 |
| 146 | Ga0070672_100027741 | 3300005543 | Bacteria | 4227 |
| 147 | Ga0070672_100045119 | 3300005543 | Bacteria | 3407 |
| 148 | Ga0070686_100062888 | 3300005544 | Bacteria | 2403 |
| 149 | Ga0070696_100058403 | 3300005546 | Bacteria | 2694 |
| 150 | Ga0070693_100003549 | 3300005547 | Bacteria | 7274 |
| 151 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 152 | Ga0070665_100000010 | 3300005548 | Bacteria | 529545 |
| 153 | Ga0070665_100002117 | 3300005548 | Bacteria | 22174 |
| 154 | Ga0068855_100000139 | 3300005563 | Bacteria | 92537 |
| 155 | Ga0068855_100000590 | 3300005563 | Bacteria | 44483 |
| 156 | Ga0068855_100004391 | 3300005563 | Bacteria | 17233 |
| 157 | Ga0068855_100008545 | 3300005563 | Bacteria | 12375 |
| 158 | Ga0068855_100011078 | 3300005563 | Bacteria | 10882 |
| 159 | Ga0068855_100011554 | 3300005563 | Bacteria | 10665 |
| 160 | Ga0068855_100012267 | 3300005563 | Bacteria | 10356 |
| 161 | Ga0068855_100014431 | 3300005563 | Bacteria | 9511 |
| 162 | Ga0068855_100017608 | 3300005563 | Bacteria | 8591 |
| 163 | Ga0068855_100049584 | 3300005563 | Bacteria | 4952 |
| 164 | Ga0068855_100091186 | 3300005563 | Bacteria | 3516 |
| 165 | Ga0068855_100118608 | 3300005563 | Bacteria | 3030 |
| 166 | Ga0070664_100001323 | 3300005564 | Bacteria | 19756 |
| 167 | Ga0070664_100008425 | 3300005564 | Bacteria | 8336 |
| 168 | Ga0070664_100039741 | 3300005564 | Bacteria | 3965 |
| 169 | Ga0070664_100078386 | 3300005564 | Bacteria | 2842 |
| 170 | Ga0070664_100131548 | 3300005564 | Bacteria | 2198 |
| 171 | Ga0068857_100000719 | 3300005577 | Bacteria | 24689 |
| 172 | Ga0068857_100003162 | 3300005577 | Bacteria | 13656 |
| 173 | Ga0068857_100005435 | 3300005577 | Bacteria | 10861 |
| 174 | Ga0068857_100070466 | 3300005577 | Bacteria | 3115 |
| 175 | Ga0068857_100081050 | 3300005577 | Bacteria | 2898 |
| 176 | Ga0068854_100018287 | 3300005578 | Bacteria | 4703 |
| 177 | Ga0068854_100088051 | 3300005578 | Bacteria | 2305 |
| 178 | Ga0068856_100000118 | 3300005614 | Bacteria | 78833 |
| 179 | Ga0068856_100022607 | 3300005614 | Bacteria | 6113 |
| 180 | Ga0068856_100032875 | 3300005614 | Bacteria | 5079 |
| 181 | Ga0068856_100036702 | 3300005614 | Bacteria | 4806 |
| 182 | Ga0068856_100144549 | 3300005614 | Bacteria | 2386 |
| 183 | Ga0068852_100000079 | 3300005616 | Bacteria | 67303 |
| 184 | Ga0068852_100002172 | 3300005616 | Bacteria | 13442 |
| 185 | Ga0068852_100003597 | 3300005616 | Bacteria | 10848 |
| 186 | Ga0068852_100004077 | 3300005616 | Bacteria | 10279 |
| 187 | Ga0068852_100015392 | 3300005616 | Bacteria | 5931 |
| 188 | Ga0068852_100037705 | 3300005616 | Bacteria | 4055 |
| 189 | Ga0068852_100056063 | 3300005616 | Bacteria | 3404 |
| 190 | Ga0068852_100062562 | 3300005616 | Bacteria | 3238 |
| 191 | Ga0068852_100065148 | 3300005616 | Bacteria | 3178 |
| 192 | Ga0068859_100000130 | 3300005617 | Bacteria | 71018 |
| 193 | Ga0068859_100002955 | 3300005617 | Bacteria | 17241 |
| 194 | Ga0068859_100042091 | 3300005617 | Bacteria | 4588 |
| 195 | Ga0068859_100059052 | 3300005617 | Bacteria | 3864 |
| 196 | Ga0068859_100107645 | 3300005617 | Bacteria | 2848 |
| 197 | Ga0068859_100114194 | 3300005617 | Bacteria | 2764 |
| 198 | Ga0068864_100004346 | 3300005618 | Bacteria | 11631 |
| 199 | Ga0068864_100005929 | 3300005618 | Bacteria | 10018 |
| 200 | Ga0068864_100012055 | 3300005618 | Bacteria | 7140 |
| 201 | Ga0068864_100023531 | 3300005618 | Bacteria | 5174 |
| 202 | Ga0068864_100094651 | 3300005618 | Bacteria | 2640 |
| 203 | Ga0068864_100138175 | 3300005618 | Bacteria | 2196 |
| 204 | Ga0068861_100022281 | 3300005719 | Bacteria | 4562 |
| 205 | Ga0068851_10036070 | 3300005834 | Bacteria | 2475 |
| 206 | Ga0068863_100001982 | 3300005841 | Bacteria | 20353 |
| 207 | Ga0068863_100002443 | 3300005841 | Bacteria | 18455 |
| 208 | Ga0068863_100012749 | 3300005841 | Bacteria | 8106 |
| 209 | Ga0068858_100004507 | 3300005842 | Bacteria | 13653 |
| 210 | Ga0068858_100007698 | 3300005842 | Bacteria | 10400 |
| 211 | Ga0068858_100015037 | 3300005842 | Bacteria | 7281 |
| 212 | Ga0068858_100055397 | 3300005842 | Bacteria | 3666 |
| 213 | Ga0068860_100000200 | 3300005843 | Bacteria | 95120 |
| 214 | Ga0068860_100000241 | 3300005843 | Bacteria | 83429 |
| 215 | Ga0068860_100001122 | 3300005843 | Bacteria | 29492 |
| 216 | Ga0068860_100001682 | 3300005843 | Bacteria | 23632 |
| 217 | Ga0068860_100006618 | 3300005843 | Bacteria | 11635 |
| 218 | Ga0068860_100009199 | 3300005843 | Bacteria | 9819 |
| 219 | Ga0068860_100010023 | 3300005843 | Bacteria | 9393 |
| 220 | Ga0068860_100019411 | 3300005843 | Bacteria | 6593 |
| 221 | Ga0068860_100026735 | 3300005843 | Bacteria | 5561 |
| 222 | Ga0068860_100065888 | 3300005843 | Bacteria | 3440 |
| 223 | Ga0068860_100111574 | 3300005843 | Bacteria | 2615 |
| 224 | Ga0068862_100010218 | 3300005844 | Bacteria | 7745 |
| 225 | Ga0081539_10000345 | 3300005985 | Bacteria | 102083 |
| 226 | Ga0070717_10001896 | 3300006028 | Bacteria | 14628 |
| 227 | Ga0075366_10000234 | 3300006195 | Bacteria | 24583 |
| 228 | Ga0075366_10010036 | 3300006195 | Bacteria | 5307 |
| 229 | Ga0075366_10049783 | 3300006195 | Bacteria | 2487 |
| 230 | Ga0097621_100000027 | 3300006237 | Bacteria | 71873 |
| 231 | Ga0097621_100000694 | 3300006237 | Bacteria | 23625 |
| 232 | Ga0097621_100003067 | 3300006237 | Bacteria | 11455 |
| 233 | Ga0097621_100003792 | 3300006237 | Bacteria | 10468 |
| 234 | Ga0097621_100008505 | 3300006237 | Bacteria | 7390 |
| 235 | Ga0097621_100031306 | 3300006237 | Bacteria | 4221 |
| 236 | Ga0097621_100039988 | 3300006237 | Bacteria | 3768 |
| 237 | Ga0097621_100040619 | 3300006237 | Bacteria | 3741 |
| 238 | Ga0097621_100111158 | 3300006237 | Bacteria | 2315 |
| 239 | Ga0068871_100000109 | 3300006358 | Bacteria | 49767 |
| 240 | Ga0068871_100000338 | 3300006358 | Bacteria | 32447 |
| 241 | Ga0068871_100004528 | 3300006358 | Bacteria | 9687 |
| 242 | Ga0068871_100005490 | 3300006358 | Bacteria | 8894 |
| 243 | Ga0068871_100026533 | 3300006358 | Bacteria | 4521 |
| 244 | Ga0068871_100029893 | 3300006358 | Bacteria | 4285 |
| 245 | Ga0068871_100054112 | 3300006358 | Bacteria | 3255 |
| 246 | Ga0075428_100000023 | 3300006844 | Bacteria | 127355 |
| 247 | Ga0075428_100097085 | 3300006844 | Bacteria | 3212 |
| 248 | Ga0075428_100107306 | 3300006844 | Bacteria | 3044 |
| 249 | Ga0075430_100025613 | 3300006846 | Bacteria | 5020 |
| 250 | Ga0075431_100000860 | 3300006847 | Bacteria | 26641 |
| 251 | Ga0075431_100043842 | 3300006847 | Bacteria | 4613 |
| 252 | Ga0075429_100001604 | 3300006880 | Bacteria | 18651 |
| 253 | Ga0068865_100000376 | 3300006881 | Bacteria | 24749 |
| 254 | Ga0097620_100000130 | 3300006931 | Bacteria | 71018 |
| 255 | Ga0097620_100002955 | 3300006931 | Bacteria | 17241 |
| 256 | Ga0097620_100009741 | 3300006931 | Bacteria | 9703 |
| 257 | Ga0097620_100042090 | 3300006931 | Bacteria | 4588 |
| 258 | Ga0097620_100045498 | 3300006931 | Bacteria | 4409 |
| 259 | Ga0097620_100059048 | 3300006931 | Bacteria | 3864 |
| 260 | Ga0097620_100107651 | 3300006931 | Bacteria | 2848 |
| 261 | Ga0097620_100114196 | 3300006931 | Bacteria | 2764 |
| 262 | Ga0105244_10000069 | 3300009036 | Bacteria | 119620 |
| 263 | Ga0105240_10000001 | 3300009093 | Bacteria | 2887840 |
| 264 | Ga0105240_10000128 | 3300009093 | Bacteria | 156107 |
| 265 | Ga0105240_10000744 | 3300009093 | Bacteria | 59430 |
| 266 | Ga0105240_10001477 | 3300009093 | Bacteria | 40056 |
| 267 | Ga0105240_10001870 | 3300009093 | Bacteria | 35026 |
| 268 | Ga0105240_10006000 | 3300009093 | Bacteria | 17962 |
| 269 | Ga0105240_10007004 | 3300009093 | Bacteria | 16460 |
| 270 | Ga0105240_10008403 | 3300009093 | Bacteria | 14772 |
| 271 | Ga0105240_10008514 | 3300009093 | Bacteria | 14663 |
| 272 | Ga0105240_10010263 | 3300009093 | Bacteria | 13184 |
| 273 | Ga0105240_10015424 | 3300009093 | Bacteria | 10388 |
| 274 | Ga0105240_10017211 | 3300009093 | Bacteria | 9751 |
| 275 | Ga0105240_10040050 | 3300009093 | Bacteria | 5997 |
| 276 | Ga0105240_10066393 | 3300009093 | Bacteria | 4475 |
| 277 | Ga0105240_10071558 | 3300009093 | Bacteria | 4289 |
| 278 | Ga0105240_10072040 | 3300009093 | Bacteria | 4272 |
| 279 | Ga0111539_10072821 | 3300009094 | Bacteria | 4052 |
| 280 | Ga0111539_10075788 | 3300009094 | Bacteria | 3962 |
| 281 | Ga0111539_10268794 | 3300009094 | Bacteria | 1985 |
| 282 | Ga0105245_10000926 | 3300009098 | Bacteria | 26649 |
| 283 | Ga0105247_10011487 | 3300009101 | Bacteria | 5338 |
| 284 | Ga0105247_10075280 | 3300009101 | Bacteria | 2118 |
| 285 | Ga0114129_10006547 | 3300009147 | Bacteria | 16528 |
| 286 | Ga0114129_10012944 | 3300009147 | Bacteria | 11872 |
| 287 | Ga0114129_10017693 | 3300009147 | Bacteria | 10147 |
| 288 | Ga0114129_10151979 | 3300009147 | Bacteria | 3168 |
| 289 | Ga0105243_10000003 | 3300009148 | Bacteria | 712931 |
| 290 | Ga0105243_10000130 | 3300009148 | Bacteria | 85659 |
| 291 | Ga0105243_10024668 | 3300009148 | Bacteria | 4589 |
| 292 | Ga0105241_10000024 | 3300009174 | Bacteria | 140808 |
| 293 | Ga0105241_10000105 | 3300009174 | Bacteria | 60020 |
| 294 | Ga0105241_10002088 | 3300009174 | Bacteria | 15089 |
| 295 | Ga0105241_10004581 | 3300009174 | Bacteria | 10229 |
| 296 | Ga0105241_10006507 | 3300009174 | Bacteria | 8614 |
| 297 | Ga0105241_10008646 | 3300009174 | Bacteria | 7484 |
| 298 | Ga0105241_10014095 | 3300009174 | Bacteria | 5858 |
| 299 | Ga0105241_10015759 | 3300009174 | Bacteria | 5538 |
| 300 | Ga0105241_10149235 | 3300009174 | Bacteria | 1911 |
| 301 | Ga0105242_10008952 | 3300009176 | Bacteria | 7684 |
| 302 | Ga0105242_10042190 | 3300009176 | Bacteria | 3683 |
| 303 | Ga0105242_10044439 | 3300009176 | Bacteria | 3598 |
| 304 | Ga0105248_10000002 | 3300009177 | Bacteria | 1054120 |
| 305 | Ga0105248_10004239 | 3300009177 | Bacteria | 15863 |
| 306 | Ga0105248_10018698 | 3300009177 | Bacteria | 7661 |
| 307 | Ga0105248_10018861 | 3300009177 | Bacteria | 7628 |
| 308 | Ga0105237_10000247 | 3300009545 | Bacteria | 76464 |
| 309 | Ga0105237_10001172 | 3300009545 | Bacteria | 35046 |
| 310 | Ga0105237_10004855 | 3300009545 | Bacteria | 15436 |
| 311 | Ga0105237_10013031 | 3300009545 | Bacteria | 8730 |
| 312 | Ga0105237_10018029 | 3300009545 | Bacteria | 7313 |
| 313 | Ga0105237_10023685 | 3300009545 | Bacteria | 6287 |
| 314 | Ga0105237_10029831 | 3300009545 | Bacteria | 5540 |
| 315 | Ga0105237_10048644 | 3300009545 | Bacteria | 4262 |
| 316 | Ga0105237_10148523 | 3300009545 | Bacteria | 2339 |
| 317 | Ga0105238_10000085 | 3300009551 | Bacteria | 105043 |
| 318 | Ga0105238_10009575 | 3300009551 | Bacteria | 9692 |
| 319 | Ga0105238_10012364 | 3300009551 | Bacteria | 8609 |
| 320 | Ga0105238_10017738 | 3300009551 | Bacteria | 7237 |
| 321 | Ga0105238_10080635 | 3300009551 | Bacteria | 3244 |
| 322 | Ga0105238_10098788 | 3300009551 | Bacteria | 2903 |
| 323 | Ga0105249_10026641 | 3300009553 | Bacteria | 5212 |
| 324 | Ga0105249_10083207 | 3300009553 | Bacteria | 2978 |
| 325 | Ga0105249_10126995 | 3300009553 | Bacteria | 2430 |
| 326 | Ga0105239_10000015 | 3300010375 | Bacteria | 319892 |
| 327 | Ga0105239_10000045 | 3300010375 | Bacteria | 186314 |
| 328 | Ga0105239_10000169 | 3300010375 | Bacteria | 93659 |
| 329 | Ga0105239_10001249 | 3300010375 | Bacteria | 34548 |
| 330 | Ga0105239_10004544 | 3300010375 | Bacteria | 16539 |
| 331 | Ga0105239_10007713 | 3300010375 | Bacteria | 12321 |
| 332 | Ga0105239_10009223 | 3300010375 | Bacteria | 11160 |
| 333 | Ga0105239_10043261 | 3300010375 | Bacteria | 4936 |
| 334 | Ga0105239_10089158 | 3300010375 | Bacteria | 3401 |
| 335 | Ga0105239_10091422 | 3300010375 | Bacteria | 3358 |
| 336 | Ga0105239_10096422 | 3300010375 | Bacteria | 3268 |
| 337 | Ga0105246_10006351 | 3300011119 | Bacteria | 7213 |
| 338 | Ga0105246_10015315 | 3300011119 | Bacteria | 4841 |
| 339 | Ga0157373_10000990 | 3300013100 | Bacteria | 21976 |
| 340 | Ga0157373_10001325 | 3300013100 | Bacteria | 18952 |
| 341 | Ga0157373_10007645 | 3300013100 | Bacteria | 8029 |
| 342 | Ga0157373_10008001 | 3300013100 | Bacteria | 7861 |
| 343 | Ga0157373_10036310 | 3300013100 | Bacteria | 3538 |
| 344 | Ga0157373_10044213 | 3300013100 | Bacteria | 3180 |
| 345 | Ga0157373_10057711 | 3300013100 | Bacteria | 2753 |
| 346 | Ga0157371_10000074 | 3300013102 | Bacteria | 162988 |
| 347 | Ga0157371_10001756 | 3300013102 | Bacteria | 21976 |
| 348 | Ga0157371_10004120 | 3300013102 | Bacteria | 12826 |
| 349 | Ga0157371_10007298 | 3300013102 | Bacteria | 8978 |
| 350 | Ga0157371_10012771 | 3300013102 | Bacteria | 6403 |
| 351 | Ga0157371_10013704 | 3300013102 | Bacteria | 6149 |
| 352 | Ga0157371_10013976 | 3300013102 | Bacteria | 6078 |
| 353 | Ga0157371_10014766 | 3300013102 | Bacteria | 5879 |
| 354 | Ga0157371_10015504 | 3300013102 | Bacteria | 5716 |
| 355 | Ga0157371_10022297 | 3300013102 | Bacteria | 4644 |
| 356 | Ga0157371_10035060 | 3300013102 | Bacteria | 3597 |
| 357 | Ga0157371_10053757 | 3300013102 | Bacteria | 2860 |
| 358 | Ga0157370_10000160 | 3300013104 | Bacteria | 82509 |
| 359 | Ga0157370_10001419 | 3300013104 | Bacteria | 29759 |
| 360 | Ga0157370_10003017 | 3300013104 | Bacteria | 19989 |
| 361 | Ga0157370_10006253 | 3300013104 | Bacteria | 13183 |
| 362 | Ga0157370_10013165 | 3300013104 | Bacteria | 8531 |
| 363 | Ga0157370_10014776 | 3300013104 | Bacteria | 7968 |
| 364 | Ga0157370_10016651 | 3300013104 | Bacteria | 7439 |
| 365 | Ga0157370_10020699 | 3300013104 | Bacteria | 6563 |
| 366 | Ga0157370_10027089 | 3300013104 | Bacteria | 5652 |
| 367 | Ga0157370_10027777 | 3300013104 | Bacteria | 5578 |
| 368 | Ga0157370_10106164 | 3300013104 | Bacteria | 2628 |
| 369 | Ga0157370_10117031 | 3300013104 | Bacteria | 2490 |
| 370 | Ga0157370_10143782 | 3300013104 | Bacteria | 2222 |
| 371 | Ga0157369_10000016 | 3300013105 | Bacteria | 257827 |
| 372 | Ga0157369_10003069 | 3300013105 | Bacteria | 19939 |
| 373 | Ga0157369_10005070 | 3300013105 | Bacteria | 15412 |
| 374 | Ga0157369_10012219 | 3300013105 | Bacteria | 9749 |
| 375 | Ga0157369_10018947 | 3300013105 | Bacteria | 7709 |
| 376 | Ga0157369_10034479 | 3300013105 | Bacteria | 5554 |
| 377 | Ga0157369_10052596 | 3300013105 | Bacteria | 4406 |
| 378 | Ga0157369_10110031 | 3300013105 | Bacteria | 2929 |
| 379 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 380 | Ga0157374_10004634 | 3300013296 | Bacteria | 11534 |
| 381 | Ga0157374_10007387 | 3300013296 | Bacteria | 9373 |
| 382 | Ga0157374_10012094 | 3300013296 | Bacteria | 7495 |
| 383 | Ga0157374_10016264 | 3300013296 | Bacteria | 6537 |
| 384 | Ga0157374_10022346 | 3300013296 | Bacteria | 5642 |
| 385 | Ga0157374_10024564 | 3300013296 | Bacteria | 5404 |
| 386 | Ga0157378_10000804 | 3300013297 | Bacteria | 29224 |
| 387 | Ga0157378_10004694 | 3300013297 | Bacteria | 11989 |
| 388 | Ga0157378_10024523 | 3300013297 | Bacteria | 5309 |
| 389 | Ga0157378_10026271 | 3300013297 | Bacteria | 5133 |
| 390 | Ga0163162_10000005 | 3300013306 | Bacteria | 447195 |
| 391 | Ga0163162_10000437 | 3300013306 | Bacteria | 38437 |
| 392 | Ga0163162_10000445 | 3300013306 | Bacteria | 38232 |
| 393 | Ga0163162_10000699 | 3300013306 | Bacteria | 30970 |
| 394 | Ga0163162_10006527 | 3300013306 | Bacteria | 11300 |
| 395 | Ga0163162_10016216 | 3300013306 | Bacteria | 7286 |
| 396 | Ga0163162_10019461 | 3300013306 | Bacteria | 6659 |
| 397 | Ga0163162_10024561 | 3300013306 | Bacteria | 5951 |
| 398 | Ga0163162_10026678 | 3300013306 | Bacteria | 5710 |
| 399 | Ga0163162_10032943 | 3300013306 | Bacteria | 5146 |
| 400 | Ga0163162_10037865 | 3300013306 | Bacteria | 4813 |
| 401 | Ga0163162_10054483 | 3300013306 | Bacteria | 4023 |
| 402 | Ga0163162_10104448 | 3300013306 | Bacteria | 2928 |
| 403 | Ga0157372_10000026 | 3300013307 | Bacteria | 195407 |
| 404 | Ga0157372_10000071 | 3300013307 | Bacteria | 109638 |
| 405 | Ga0157372_10000324 | 3300013307 | Bacteria | 52514 |
| 406 | Ga0157372_10000514 | 3300013307 | Bacteria | 42626 |
| 407 | Ga0157372_10001013 | 3300013307 | Bacteria | 30741 |
| 408 | Ga0157372_10006860 | 3300013307 | Bacteria | 12118 |
| 409 | Ga0157372_10013477 | 3300013307 | Bacteria | 8737 |
| 410 | Ga0157372_10018638 | 3300013307 | Bacteria | 7466 |
| 411 | Ga0157372_10035377 | 3300013307 | Bacteria | 5498 |
| 412 | Ga0157372_10047723 | 3300013307 | Bacteria | 4760 |
| 413 | Ga0157372_10053344 | 3300013307 | Bacteria | 4506 |
| 414 | Ga0157372_10061622 | 3300013307 | Bacteria | 4201 |
| 415 | Ga0157372_10072039 | 3300013307 | Bacteria | 3893 |
| 416 | Ga0157372_10115472 | 3300013307 | Bacteria | 3078 |
| 417 | Ga0157372_10130567 | 3300013307 | Bacteria | 2890 |
| 418 | Ga0157372_10133134 | 3300013307 | Bacteria | 2862 |
| 419 | Ga0157375_10003798 | 3300013308 | Bacteria | 13096 |
| 420 | Ga0157375_10011081 | 3300013308 | Bacteria | 7949 |
| 421 | Ga0157375_10021303 | 3300013308 | Bacteria | 5940 |
| 422 | Ga0157375_10023439 | 3300013308 | Bacteria | 5695 |
| 423 | Ga0157375_10063235 | 3300013308 | Bacteria | 3681 |
| 424 | Ga0157375_10105930 | 3300013308 | Bacteria | 2903 |
| 425 | Ga0157375_10111743 | 3300013308 | Bacteria | 2832 |
| 426 | Ga0157375_10170389 | 3300013308 | Bacteria | 2324 |
| 427 | Ga0157375_10171026 | 3300013308 | Bacteria | 2320 |
| 428 | Ga0163163_10000193 | 3300014325 | Bacteria | 62699 |
| 429 | Ga0163163_10000249 | 3300014325 | Bacteria | 54997 |
| 430 | Ga0163163_10005284 | 3300014325 | Bacteria | 11145 |
| 431 | Ga0163163_10015150 | 3300014325 | Bacteria | 7118 |
| 432 | Ga0163163_10125853 | 3300014325 | Bacteria | 2601 |
| 433 | Ga0157380_10029681 | 3300014326 | Bacteria | 4181 |
| 434 | Ga0157380_10065572 | 3300014326 | Bacteria | 2919 |
| 435 | Ga0182008_10000014 | 3300014497 | Bacteria | 263844 |
| 436 | Ga0182008_10000358 | 3300014497 | Bacteria | 35490 |
| 437 | Ga0182008_10001858 | 3300014497 | Bacteria | 13732 |
| 438 | Ga0157377_10004138 | 3300014745 | Bacteria | 6626 |
| 439 | Ga0157377_10008097 | 3300014745 | Bacteria | 5113 |
| 440 | Ga0157379_10007199 | 3300014968 | Bacteria | 9624 |
| 441 | Ga0157379_10038151 | 3300014968 | Bacteria | 4286 |
| 442 | Ga0157379_10043618 | 3300014968 | Bacteria | 4004 |
| 443 | Ga0157379_10100003 | 3300014968 | Bacteria | 2604 |
| 444 | Ga0157376_10000808 | 3300014969 | Bacteria | 20515 |
| 445 | Ga0157376_10009172 | 3300014969 | Bacteria | 7177 |
| 446 | Ga0157376_10012924 | 3300014969 | Bacteria | 6213 |
| 447 | Ga0157376_10017840 | 3300014969 | Bacteria | 5425 |
| 448 | Ga0157376_10027846 | 3300014969 | Bacteria | 4485 |
| 449 | Ga0157376_10030884 | 3300014969 | Bacteria | 4283 |
| 450 | Ga0157376_10109907 | 3300014969 | Bacteria | 2424 |
| 451 | Ga0157376_10119911 | 3300014969 | Bacteria | 2329 |
| 452 | Ga0182006_1000015 | 3300015261 | Bacteria | 325938 |
| 453 | Ga0182006_1000149 | 3300015261 | Bacteria | 74752 |
| 454 | Ga0182006_1001293 | 3300015261 | Bacteria | 15436 |
| 455 | Ga0182007_10000002 | 3300015262 | Bacteria | 564661 |
| 456 | Ga0183373_1004 | 3300015682 | Bacteria | 537398 |
| 457 | Ga0163161_10000545 | 3300017792 | Bacteria | 30599 |
| 458 | Ga0163161_10004401 | 3300017792 | Bacteria | 9830 |
| 459 | Ga0163161_10004913 | 3300017792 | Bacteria | 9305 |
| 460 | Ga0163161_10009128 | 3300017792 | Bacteria | 6854 |
| 461 | Ga0163161_10009805 | 3300017792 | Bacteria | 6635 |
| 462 | Ga0163161_10018046 | 3300017792 | Bacteria | 4945 |
| 463 | Ga0163161_10068281 | 3300017792 | Bacteria | 2597 |
| 464 | Ga0206351_10906282 | 3300020077 | Bacteria | 4067 |
| 465 | Ga0206350_10809614 | 3300020080 | Bacteria | 2663 |
| 466 | Ga0213872_10014693 | 3300021361 | Bacteria | 3649 |
| 467 | Ga0213876_10014400 | 3300021384 | Bacteria | 4189 |
| 468 | Ga0213876_10045005 | 3300021384 | Bacteria | 2334 |
| 469 | Ga0224712_10003241 | 3300022467 | Bacteria | 4190 |
| 470 | Ga0207427_100072 | 3300025231 | Bacteria | 158364 |
| 471 | Ga0209437_100026 | 3300025233 | Bacteria | 542698 |
| 472 | Ga0209437_100251 | 3300025233 | Bacteria | 85135 |
| 473 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 474 | Ga0209026_1000633 | 3300025250 | Bacteria | 22062 |
| 475 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 476 | Ga0209233_1000111 | 3300025261 | Bacteria | 260262 |
| 477 | Ga0209233_1000796 | 3300025261 | Bacteria | 14129 |
| 478 | Ga0209675_1000179 | 3300025291 | Bacteria | 71689 |
| 479 | Ga0209676_1000009 | 3300025292 | Bacteria | 981719 |
| 480 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 481 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 482 | Ga0209050_1000048 | 3300025298 | Bacteria | 371553 |
| 483 | Ga0207426_1000132 | 3300025302 | Bacteria | 209623 |
| 484 | Ga0209257_1000025 | 3300025304 | Bacteria | 724838 |
| 485 | Ga0207656_10019353 | 3300025321 | Bacteria | 2693 |
| 486 | Ga0207655_1000492 | 3300025728 | Bacteria | 50910 |
| 487 | Ga0207653_10013171 | 3300025885 | Bacteria | 2588 |
| 488 | Ga0207710_10010678 | 3300025900 | Bacteria | 3866 |
| 489 | Ga0207680_10000135 | 3300025903 | Bacteria | 34875 |
| 490 | Ga0207680_10000790 | 3300025903 | Bacteria | 14916 |
| 491 | Ga0207680_10016445 | 3300025903 | Bacteria | 3884 |
| 492 | Ga0207647_10000044 | 3300025904 | Bacteria | 90491 |
| 493 | Ga0207647_10000280 | 3300025904 | Bacteria | 41619 |
| 494 | Ga0207647_10002289 | 3300025904 | Bacteria | 14588 |
| 495 | Ga0207647_10007727 | 3300025904 | Bacteria | 7741 |
| 496 | Ga0207647_10060113 | 3300025904 | Bacteria | 2324 |
| 497 | Ga0207645_10000135 | 3300025907 | Bacteria | 56584 |
| 498 | Ga0207645_10000306 | 3300025907 | Bacteria | 41222 |
| 499 | Ga0207645_10014107 | 3300025907 | Bacteria | 5354 |
| 500 | Ga0207645_10063460 | 3300025907 | Bacteria | 2360 |
| 501 | Ga0207643_10030289 | 3300025908 | Bacteria | 3011 |
| 502 | Ga0207705_10000210 | 3300025909 | Bacteria | 59411 |
| 503 | Ga0207705_10006335 | 3300025909 | Bacteria | 8783 |
| 504 | Ga0207705_10015636 | 3300025909 | Bacteria | 5448 |
| 505 | Ga0207654_10000672 | 3300025911 | Bacteria | 19232 |
| 506 | Ga0207654_10001159 | 3300025911 | Bacteria | 14168 |
| 507 | Ga0207654_10006499 | 3300025911 | Bacteria | 5884 |
| 508 | Ga0207654_10028058 | 3300025911 | Bacteria | 3066 |
| 509 | Ga0207707_10000205 | 3300025912 | Bacteria | 62610 |
| 510 | Ga0207707_10046982 | 3300025912 | Bacteria | 3760 |
| 511 | Ga0207707_10058316 | 3300025912 | Bacteria | 3360 |
| 512 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 513 | Ga0207695_10000047 | 3300025913 | Bacteria | 422459 |
| 514 | Ga0207695_10000179 | 3300025913 | Bacteria | 185564 |
| 515 | Ga0207695_10000232 | 3300025913 | Bacteria | 147559 |
| 516 | Ga0207695_10000460 | 3300025913 | Bacteria | 88380 |
| 517 | Ga0207695_10000962 | 3300025913 | Bacteria | 51331 |
| 518 | Ga0207695_10001203 | 3300025913 | Bacteria | 44471 |
| 519 | Ga0207695_10002931 | 3300025913 | Bacteria | 24635 |
| 520 | Ga0207695_10003319 | 3300025913 | Bacteria | 22807 |
| 521 | Ga0207695_10003840 | 3300025913 | Bacteria | 20797 |
| 522 | Ga0207695_10005627 | 3300025913 | Bacteria | 16547 |
| 523 | Ga0207695_10020868 | 3300025913 | Bacteria | 7486 |
| 524 | Ga0207695_10023123 | 3300025913 | Bacteria | 7034 |
| 525 | Ga0207695_10033370 | 3300025913 | Bacteria | 5615 |
| 526 | Ga0207695_10046365 | 3300025913 | Bacteria | 4607 |
| 527 | Ga0207695_10065069 | 3300025913 | Bacteria | 3750 |
| 528 | Ga0207695_10079295 | 3300025913 | Bacteria | 3328 |
| 529 | Ga0207695_10081724 | 3300025913 | Bacteria | 3269 |
| 530 | Ga0207671_10000441 | 3300025914 | Bacteria | 57099 |
| 531 | Ga0207671_10000982 | 3300025914 | Bacteria | 35278 |
| 532 | Ga0207671_10002256 | 3300025914 | Bacteria | 20880 |
| 533 | Ga0207671_10003343 | 3300025914 | Bacteria | 16099 |
| 534 | Ga0207671_10005449 | 3300025914 | Bacteria | 11714 |
| 535 | Ga0207671_10007556 | 3300025914 | Bacteria | 9412 |
| 536 | Ga0207671_10008216 | 3300025914 | Bacteria | 8889 |
| 537 | Ga0207671_10016469 | 3300025914 | Bacteria | 5743 |
| 538 | Ga0207671_10064837 | 3300025914 | Bacteria | 2716 |
| 539 | Ga0207660_10000843 | 3300025917 | Bacteria | 20195 |
| 540 | Ga0207660_10009061 | 3300025917 | Bacteria | 6446 |
| 541 | Ga0207657_10001302 | 3300025919 | Bacteria | 26488 |
| 542 | Ga0207657_10002799 | 3300025919 | Bacteria | 18777 |
| 543 | Ga0207657_10022148 | 3300025919 | Bacteria | 5960 |
| 544 | Ga0207657_10041978 | 3300025919 | Bacteria | 4039 |
| 545 | Ga0207657_10045574 | 3300025919 | Bacteria | 3847 |
| 546 | Ga0207657_10047164 | 3300025919 | Bacteria | 3769 |
| 547 | Ga0207657_10081451 | 3300025919 | Bacteria | 2719 |
| 548 | Ga0207649_10011811 | 3300025920 | Bacteria | 4830 |
| 549 | Ga0207649_10027658 | 3300025920 | Bacteria | 3331 |
| 550 | Ga0207652_10000064 | 3300025921 | Bacteria | 111997 |
| 551 | Ga0207652_10000186 | 3300025921 | Bacteria | 65493 |
| 552 | Ga0207652_10000967 | 3300025921 | Bacteria | 26823 |
| 553 | Ga0207652_10001125 | 3300025921 | Bacteria | 24079 |
| 554 | Ga0207652_10004578 | 3300025921 | Bacteria | 11216 |
| 555 | Ga0207652_10008524 | 3300025921 | Bacteria | 8251 |
| 556 | Ga0207652_10053242 | 3300025921 | Bacteria | 3476 |
| 557 | Ga0207652_10134235 | 3300025921 | Bacteria | 2209 |
| 558 | Ga0207681_10098197 | 3300025923 | Bacteria | 2106 |
| 559 | Ga0207694_10000365 | 3300025924 | Bacteria | 42492 |
| 560 | Ga0207694_10001434 | 3300025924 | Bacteria | 20459 |
| 561 | Ga0207694_10006285 | 3300025924 | Bacteria | 9071 |
| 562 | Ga0207694_10008026 | 3300025924 | Bacteria | 7983 |
| 563 | Ga0207694_10011944 | 3300025924 | Bacteria | 6547 |
| 564 | Ga0207694_10045907 | 3300025924 | Bacteria | 3376 |
| 565 | Ga0207694_10068129 | 3300025924 | Bacteria | 2778 |
| 566 | Ga0207650_10001962 | 3300025925 | Bacteria | 14440 |
| 567 | Ga0207650_10027848 | 3300025925 | Bacteria | 4048 |
| 568 | Ga0207650_10063750 | 3300025925 | Bacteria | 2756 |
| 569 | Ga0207659_10034177 | 3300025926 | Bacteria | 3504 |
| 570 | Ga0207659_10046657 | 3300025926 | Bacteria | 3061 |
| 571 | Ga0207659_10056273 | 3300025926 | Bacteria | 2816 |
| 572 | Ga0207659_10075500 | 3300025926 | Bacteria | 2474 |
| 573 | Ga0207687_10003289 | 3300025927 | Bacteria | 10934 |
| 574 | Ga0207687_10014531 | 3300025927 | Bacteria | 5153 |
| 575 | Ga0207687_10033191 | 3300025927 | Bacteria | 3500 |
| 576 | Ga0207700_10023717 | 3300025928 | Bacteria | 4237 |
| 577 | Ga0207644_10001671 | 3300025931 | Bacteria | 14296 |
| 578 | Ga0207644_10006328 | 3300025931 | Bacteria | 7709 |
| 579 | Ga0207644_10082766 | 3300025931 | Bacteria | 2375 |
| 580 | Ga0207690_10000361 | 3300025932 | Bacteria | 30094 |
| 581 | Ga0207690_10004696 | 3300025932 | Bacteria | 8067 |
| 582 | Ga0207690_10049287 | 3300025932 | Bacteria | 2807 |
| 583 | Ga0207706_10002722 | 3300025933 | Bacteria | 17218 |
| 584 | Ga0207706_10007721 | 3300025933 | Bacteria | 9932 |
| 585 | Ga0207706_10014390 | 3300025933 | Bacteria | 7170 |
| 586 | Ga0207706_10022674 | 3300025933 | Bacteria | 5635 |
| 587 | Ga0207706_10027852 | 3300025933 | Bacteria | 5051 |
| 588 | Ga0207706_10046621 | 3300025933 | Bacteria | 3837 |
| 589 | Ga0207706_10056023 | 3300025933 | Bacteria | 3476 |
| 590 | Ga0207706_10099925 | 3300025933 | Bacteria | 2553 |
| 591 | Ga0207686_10008918 | 3300025934 | Bacteria | 5428 |
| 592 | Ga0207686_10033120 | 3300025934 | Bacteria | 3081 |
| 593 | Ga0207709_10000008 | 3300025935 | Bacteria | 713099 |
| 594 | Ga0207709_10000544 | 3300025935 | Bacteria | 32275 |
| 595 | Ga0207709_10039582 | 3300025935 | Bacteria | 2816 |
| 596 | Ga0207670_10019364 | 3300025936 | Bacteria | 4157 |
| 597 | Ga0207704_10000019 | 3300025938 | Bacteria | 152734 |
| 598 | Ga0207704_10079027 | 3300025938 | Bacteria | 2118 |
| 599 | Ga0207691_10002208 | 3300025940 | Bacteria | 19051 |
| 600 | Ga0207691_10007147 | 3300025940 | Bacteria | 10773 |
| 601 | Ga0207691_10022714 | 3300025940 | Bacteria | 5914 |
| 602 | Ga0207691_10041579 | 3300025940 | Bacteria | 4242 |
| 603 | Ga0207691_10114421 | 3300025940 | Bacteria | 2397 |
| 604 | Ga0207691_10174453 | 3300025940 | Bacteria | 1881 |
| 605 | Ga0207711_10000023 | 3300025941 | Bacteria | 327296 |
| 606 | Ga0207711_10002802 | 3300025941 | Bacteria | 15322 |
| 607 | Ga0207711_10010632 | 3300025941 | Bacteria | 7655 |
| 608 | Ga0207711_10016320 | 3300025941 | Bacteria | 6170 |
| 609 | Ga0207689_10001157 | 3300025942 | Bacteria | 25398 |
| 610 | Ga0207689_10001865 | 3300025942 | Bacteria | 19957 |
| 611 | Ga0207689_10003632 | 3300025942 | Bacteria | 14091 |
| 612 | Ga0207689_10004896 | 3300025942 | Bacteria | 12077 |
| 613 | Ga0207689_10008304 | 3300025942 | Bacteria | 9046 |
| 614 | Ga0207689_10008323 | 3300025942 | Bacteria | 9036 |
| 615 | Ga0207689_10098622 | 3300025942 | Bacteria | 2400 |
| 616 | Ga0207661_10004721 | 3300025944 | Bacteria | 9541 |
| 617 | Ga0207661_10083211 | 3300025944 | Bacteria | 2648 |
| 618 | Ga0207679_10003237 | 3300025945 | Bacteria | 10046 |
| 619 | Ga0207679_10035236 | 3300025945 | Bacteria | 3539 |
| 620 | Ga0207667_10000033 | 3300025949 | Bacteria | 314353 |
| 621 | Ga0207667_10000087 | 3300025949 | Bacteria | 149828 |
| 622 | Ga0207667_10000111 | 3300025949 | Bacteria | 131758 |
| 623 | Ga0207667_10000218 | 3300025949 | Bacteria | 80364 |
| 624 | Ga0207667_10000549 | 3300025949 | Bacteria | 49364 |
| 625 | Ga0207667_10001284 | 3300025949 | Bacteria | 31480 |
| 626 | Ga0207667_10003821 | 3300025949 | Bacteria | 18514 |
| 627 | Ga0207667_10004600 | 3300025949 | Bacteria | 16926 |
| 628 | Ga0207667_10013504 | 3300025949 | Bacteria | 9339 |
| 629 | Ga0207667_10021551 | 3300025949 | Bacteria | 7139 |
| 630 | Ga0207667_10025511 | 3300025949 | Bacteria | 6468 |
| 631 | Ga0207667_10037487 | 3300025949 | Bacteria | 5181 |
| 632 | Ga0207667_10060470 | 3300025949 | Bacteria | 3965 |
| 633 | Ga0207667_10061519 | 3300025949 | Bacteria | 3927 |
| 634 | Ga0207667_10064852 | 3300025949 | Bacteria | 3811 |
| 635 | Ga0207651_10000296 | 3300025960 | Bacteria | 21316 |
| 636 | Ga0207651_10002179 | 3300025960 | Bacteria | 9270 |
| 637 | Ga0207651_10007315 | 3300025960 | Bacteria | 5870 |
| 638 | Ga0207651_10027303 | 3300025960 | Bacteria | 3584 |
| 639 | Ga0207712_10016515 | 3300025961 | Bacteria | 4783 |
| 640 | Ga0207712_10079243 | 3300025961 | Bacteria | 2386 |
| 641 | Ga0207668_10000272 | 3300025972 | Bacteria | 34458 |
| 642 | Ga0207640_10017605 | 3300025981 | Bacteria | 4184 |
| 643 | Ga0207658_10002352 | 3300025986 | Bacteria | 13898 |
| 644 | Ga0207658_10003050 | 3300025986 | Bacteria | 11979 |
| 645 | Ga0207658_10003314 | 3300025986 | Bacteria | 11430 |
| 646 | Ga0207658_10013024 | 3300025986 | Bacteria | 5680 |
| 647 | Ga0207658_10018448 | 3300025986 | Bacteria | 4818 |
| 648 | Ga0207658_10054583 | 3300025986 | Bacteria | 2957 |
| 649 | Ga0207677_10001377 | 3300026023 | Bacteria | 12974 |
| 650 | Ga0207677_10009544 | 3300026023 | Bacteria | 5462 |
| 651 | Ga0207677_10027181 | 3300026023 | Bacteria | 3599 |
| 652 | Ga0207677_10055550 | 3300026023 | Bacteria | 2708 |
| 653 | Ga0207677_10058828 | 3300026023 | Bacteria | 2648 |
| 654 | Ga0207677_10060048 | 3300026023 | Bacteria | 2626 |
| 655 | Ga0207677_10069977 | 3300026023 | Bacteria | 2470 |
| 656 | Ga0207677_10074904 | 3300026023 | Bacteria | 2404 |
| 657 | Ga0207703_10004858 | 3300026035 | Bacteria | 10937 |
| 658 | Ga0207703_10028936 | 3300026035 | Bacteria | 4372 |
| 659 | Ga0207703_10038402 | 3300026035 | Bacteria | 3821 |
| 660 | Ga0207639_10002247 | 3300026041 | Bacteria | 12984 |
| 661 | Ga0207639_10002486 | 3300026041 | Bacteria | 12352 |
| 662 | Ga0207639_10012203 | 3300026041 | Bacteria | 5978 |
| 663 | Ga0207639_10022322 | 3300026041 | Bacteria | 4558 |
| 664 | Ga0207639_10027733 | 3300026041 | Bacteria | 4129 |
| 665 | Ga0207639_10047523 | 3300026041 | Bacteria | 3244 |
| 666 | Ga0207678_10025327 | 3300026067 | Bacteria | 5179 |
| 667 | Ga0207678_10032087 | 3300026067 | Bacteria | 4579 |
| 668 | Ga0207708_10078480 | 3300026075 | Bacteria | 2535 |
| 669 | Ga0207702_10000194 | 3300026078 | Bacteria | 71816 |
| 670 | Ga0207702_10001197 | 3300026078 | Bacteria | 26319 |
| 671 | Ga0207702_10005834 | 3300026078 | Bacteria | 10710 |
| 672 | Ga0207702_10010074 | 3300026078 | Bacteria | 7922 |
| 673 | Ga0207702_10059674 | 3300026078 | Bacteria | 3249 |
| 674 | Ga0207702_10097163 | 3300026078 | Bacteria | 2592 |
| 675 | Ga0207641_10000158 | 3300026088 | Bacteria | 96378 |
| 676 | Ga0207641_10000539 | 3300026088 | Bacteria | 42499 |
| 677 | Ga0207641_10003749 | 3300026088 | Bacteria | 13360 |
| 678 | Ga0207641_10045803 | 3300026088 | Bacteria | 3685 |
| 679 | Ga0207648_10000061 | 3300026089 | Bacteria | 101034 |
| 680 | Ga0207648_10000786 | 3300026089 | Bacteria | 35737 |
| 681 | Ga0207648_10002643 | 3300026089 | Bacteria | 19141 |
| 682 | Ga0207648_10003171 | 3300026089 | Bacteria | 17337 |
| 683 | Ga0207648_10011997 | 3300026089 | Bacteria | 8132 |
| 684 | Ga0207648_10015000 | 3300026089 | Bacteria | 7137 |
| 685 | Ga0207648_10059941 | 3300026089 | Bacteria | 3319 |
| 686 | Ga0207648_10101376 | 3300026089 | Bacteria | 2523 |
| 687 | Ga0207648_10151976 | 3300026089 | Bacteria | 2043 |
| 688 | Ga0207648_10165320 | 3300026089 | Bacteria | 1955 |
| 689 | Ga0207676_10001574 | 3300026095 | Bacteria | 16766 |
| 690 | Ga0207676_10006059 | 3300026095 | Bacteria | 8532 |
| 691 | Ga0207676_10016570 | 3300026095 | Bacteria | 5337 |
| 692 | Ga0207676_10020687 | 3300026095 | Bacteria | 4817 |
| 693 | Ga0207674_10001723 | 3300026116 | Bacteria | 27962 |
| 694 | Ga0207674_10019660 | 3300026116 | Bacteria | 7313 |
| 695 | Ga0207674_10026118 | 3300026116 | Bacteria | 6213 |
| 696 | Ga0207674_10078689 | 3300026116 | Bacteria | 3302 |
| 697 | Ga0207674_10131916 | 3300026116 | Bacteria | 2461 |
| 698 | Ga0207675_100004088 | 3300026118 | Bacteria | 14122 |
| 699 | Ga0207675_100013718 | 3300026118 | Bacteria | 7561 |
| 700 | Ga0207675_100040039 | 3300026118 | Bacteria | 4373 |
| 701 | Ga0207675_100040221 | 3300026118 | Bacteria | 4365 |
| 702 | Ga0207675_100040254 | 3300026118 | Bacteria | 4363 |
| 703 | Ga0207683_10002798 | 3300026121 | Bacteria | 15232 |
| 704 | Ga0207683_10004166 | 3300026121 | Bacteria | 12518 |
| 705 | Ga0207683_10004426 | 3300026121 | Bacteria | 12145 |
| 706 | Ga0207683_10024259 | 3300026121 | Bacteria | 5222 |
| 707 | Ga0207698_10000052 | 3300026142 | Bacteria | 83049 |
| 708 | Ga0207698_10000410 | 3300026142 | Bacteria | 24725 |
| 709 | Ga0207698_10005000 | 3300026142 | Bacteria | 8133 |
| 710 | Ga0207698_10006710 | 3300026142 | Bacteria | 7192 |
| 711 | Ga0207698_10010692 | 3300026142 | Bacteria | 5918 |
| 712 | Ga0207698_10076880 | 3300026142 | Bacteria | 2674 |
| 713 | Ga0207698_10086515 | 3300026142 | Bacteria | 2549 |
| 714 | Ga0207428_10018183 | 3300027907 | Bacteria | 6010 |
| 715 | Ga0268266_10000032 | 3300028379 | Bacteria | 395079 |
| 716 | Ga0268266_10000102 | 3300028379 | Bacteria | 179754 |
| 717 | Ga0268266_10002971 | 3300028379 | Bacteria | 17479 |
| 718 | Ga0268266_10063540 | 3300028379 | Bacteria | 3187 |
| 719 | Ga0268266_10069849 | 3300028379 | Bacteria | 3044 |
| 720 | Ga0268266_10122889 | 3300028379 | Bacteria | 2312 |
| 721 | Ga0268265_10010187 | 3300028380 | Bacteria | 6345 |
| 722 | Ga0268265_10038301 | 3300028380 | Bacteria | 3526 |
| 723 | Ga0268265_10093173 | 3300028380 | Bacteria | 2413 |
| 724 | Ga0268264_10000011 | 3300028381 | Bacteria | 580884 |
| 725 | Ga0268264_10001129 | 3300028381 | Bacteria | 26168 |
| 726 | Ga0268264_10001678 | 3300028381 | Bacteria | 20388 |
| 727 | Ga0268264_10009319 | 3300028381 | Bacteria | 8129 |
| 728 | Ga0268264_10011706 | 3300028381 | Bacteria | 7234 |
| 729 | Ga0268264_10013291 | 3300028381 | Bacteria | 6778 |
| 730 | Ga0268264_10080760 | 3300028381 | Bacteria | 2777 |
| 731 | Ga0265326_10006763 | 3300028558 | Bacteria | 3542 |
| 732 | Ga0265318_10015811 | 3300028577 | Bacteria | 3129 |
| 733 | Ga0265323_10008461 | 3300028653 | Bacteria | 4242 |
| 734 | Ga0307517_10006124 | 3300028786 | Bacteria | 17916 |
| 735 | Ga0307517_10047742 | 3300028786 | Bacteria | 4428 |
| 736 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 737 | Ga0307515_10000074 | 3300028794 | Bacteria | 229874 |
| 738 | Ga0307515_10002716 | 3300028794 | Bacteria | 37857 |
| 739 | Ga0307515_10016696 | 3300028794 | Bacteria | 13425 |
| 740 | Ga0307515_10029646 | 3300028794 | Bacteria | 9236 |
| 741 | Ga0265338_10012310 | 3300028800 | Bacteria | 9763 |
| 742 | Ga0265338_10014452 | 3300028800 | Bacteria | 8786 |
| 743 | Ga0265338_10021733 | 3300028800 | Bacteria | 6674 |
| 744 | Ga0265338_10084856 | 3300028800 | Bacteria | 2642 |
| 745 | Ga0307511_10000673 | 3300030521 | Bacteria | 36415 |
| 746 | Ga0316177_1067390 | 3300030731 | Bacteria | 9118 |
| 747 | Ga0316176_1102439 | 3300030732 | Bacteria | 5412 |
| 748 | Ga0316183_1003610 | 3300030742 | Bacteria | 136078 |
| 749 | Ga0316181_1144023 | 3300030744 | Bacteria | 9457 |
| 750 | Ga0265330_10000123 | 3300031235 | Bacteria | 63356 |
| 751 | Ga0265330_10000153 | 3300031235 | Bacteria | 55577 |
| 752 | Ga0265330_10000854 | 3300031235 | Bacteria | 19006 |
| 753 | Ga0265330_10001992 | 3300031235 | Bacteria | 11339 |
| 754 | Ga0265330_10004423 | 3300031235 | Bacteria | 7133 |
| 755 | Ga0265330_10008652 | 3300031235 | Bacteria | 4885 |
| 756 | Ga0265332_10011849 | 3300031238 | Bacteria | 3873 |
| 757 | Ga0265332_10030014 | 3300031238 | Bacteria | 2375 |
| 758 | Ga0265328_10008335 | 3300031239 | Bacteria | 4282 |
| 759 | Ga0265328_10020062 | 3300031239 | Bacteria | 2561 |
| 760 | Ga0265320_10032511 | 3300031240 | Bacteria | 2669 |
| 761 | Ga0265325_10000041 | 3300031241 | Bacteria | 92181 |
| 762 | Ga0265325_10000785 | 3300031241 | Bacteria | 22985 |
| 763 | Ga0265325_10007941 | 3300031241 | Bacteria | 6304 |
| 764 | Ga0265325_10019301 | 3300031241 | Bacteria | 3771 |
| 765 | Ga0265325_10023388 | 3300031241 | Bacteria | 3374 |
| 766 | Ga0265325_10028974 | 3300031241 | Bacteria | 2979 |
| 767 | Ga0265340_10004286 | 3300031247 | Bacteria | 7998 |
| 768 | Ga0265340_10015099 | 3300031247 | Bacteria | 4019 |
| 769 | Ga0265340_10020963 | 3300031247 | Bacteria | 3352 |
| 770 | Ga0265340_10041181 | 3300031247 | Bacteria | 2272 |
| 771 | Ga0265339_10000184 | 3300031249 | Bacteria | 53061 |
| 772 | Ga0265339_10005643 | 3300031249 | Bacteria | 8303 |
| 773 | Ga0265339_10007352 | 3300031249 | Bacteria | 7130 |
| 774 | Ga0265339_10007645 | 3300031249 | Bacteria | 6959 |
| 775 | Ga0265327_10000152 | 3300031251 | Bacteria | 149065 |
| 776 | Ga0265327_10000440 | 3300031251 | Bacteria | 75453 |
| 777 | Ga0265327_10001191 | 3300031251 | Bacteria | 35202 |
| 778 | Ga0265316_10000068 | 3300031344 | Bacteria | 108687 |
| 779 | Ga0265316_10002794 | 3300031344 | Bacteria | 17891 |
| 780 | Ga0265316_10004765 | 3300031344 | Bacteria | 13400 |
| 781 | Ga0265316_10006591 | 3300031344 | Bacteria | 11068 |
| 782 | Ga0265316_10028078 | 3300031344 | Bacteria | 4646 |
| 783 | Ga0265316_10088761 | 3300031344 | Bacteria | 2360 |
| 784 | Ga0265316_10092869 | 3300031344 | Bacteria | 2300 |
| 785 | Ga0265316_10115499 | 3300031344 | Bacteria | 2029 |
| 786 | Ga0307513_10075092 | 3300031456 | Bacteria | 3512 |
| 787 | Ga0307509_10103305 | 3300031507 | Bacteria | 2878 |
| 788 | Ga0307408_100000143 | 3300031548 | Bacteria | 79423 |
| 789 | Ga0307408_100002433 | 3300031548 | Bacteria | 13087 |
| 790 | Ga0307408_100004072 | 3300031548 | Bacteria | 9971 |
| 791 | Ga0265313_10003068 | 3300031595 | Bacteria | 13855 |
| 792 | Ga0265313_10036852 | 3300031595 | Bacteria | 2452 |
| 793 | Ga0307508_10001210 | 3300031616 | Bacteria | 29576 |
| 794 | Ga0265314_10001814 | 3300031711 | Bacteria | 23024 |
| 795 | Ga0265314_10008735 | 3300031711 | Bacteria | 8660 |
| 796 | Ga0265342_10000917 | 3300031712 | Bacteria | 29252 |
| 797 | Ga0265342_10003604 | 3300031712 | Bacteria | 12629 |
| 798 | Ga0265342_10004003 | 3300031712 | Bacteria | 11788 |
| 799 | Ga0265342_10008363 | 3300031712 | Bacteria | 7427 |
| 800 | Ga0265342_10034964 | 3300031712 | Bacteria | 3079 |
| 801 | Ga0316576_10070898 | 3300031727 | Bacteria | 2570 |
| 802 | Ga0316578_10063865 | 3300031728 | Bacteria | 2172 |
| 803 | Ga0307516_10002603 | 3300031730 | Bacteria | 23956 |
| 804 | Ga0307405_10000006 | 3300031731 | Bacteria | 361477 |
| 805 | Ga0316577_10000061 | 3300031733 | Bacteria | 26270 |
| 806 | Ga0307407_10000031 | 3300031903 | Bacteria | 87995 |
| 807 | Ga0307412_10000019 | 3300031911 | Bacteria | 266611 |
| 808 | Ga0307412_10000029 | 3300031911 | Bacteria | 209074 |
| 809 | Ga0307412_10019630 | 3300031911 | Bacteria | 4098 |
| 810 | Ga0307412_10050829 | 3300031911 | Bacteria | 2737 |
| 811 | Ga0307409_100023026 | 3300031995 | Bacteria | 4307 |
| 812 | Ga0307416_100000002 | 3300032002 | Bacteria | 509907 |
| 813 | Ga0307416_100000004 | 3300032002 | Bacteria | 505535 |
| 814 | Ga0307414_10000776 | 3300032004 | Bacteria | 16353 |
| 815 | Ga0307414_10005750 | 3300032004 | Bacteria | 6851 |
| 816 | Ga0307414_10038059 | 3300032004 | Bacteria | 3226 |
| 817 | Ga0307414_10043695 | 3300032004 | Bacteria | 3054 |
| 818 | Ga0307507_10000034 | 3300033179 | Bacteria | 188697 |
| 819 | Ga0307510_10006676 | 3300033180 | Bacteria | 13756 |
| 820 | Ga0307510_10019806 | 3300033180 | Bacteria | 7879 |
| 821 | Ga0373955_0023593 | 3300035172 | Bacteria | 3136 |
| 822 | Ga0373924_0006668 | 3300035410 | Bacteria | 4142 |
| 823 | Ga0373924_0036055 | 3300035410 | Bacteria | 2008 |
| 824 | Ga0373933_0049108 | 3300035724 | Bacteria | 2515 |
| 825 | Ga0373937_0019497 | 3300036401 | Bacteria | 6070 |
| 826 | Ga0373937_0230019 | 3300036401 | Bacteria | 1746 |
| 827 | Ga0316584_0002129 | 3300036712 | Bacteria | 12391 |
| 828 | Ga0395899_0000011 | 3300037312 | Bacteria | 521331 |
| 829 | Ga0395899_0000055 | 3300037312 | Bacteria | 220579 |
| 830 | Ga0395899_0000726 | 3300037312 | Bacteria | 32936 |
| 831 | Ga0395899_0009107 | 3300037312 | Bacteria | 7626 |
| 832 | Ga0395899_0010495 | 3300037312 | Bacteria | 7093 |
| 833 | Ga0395899_0011086 | 3300037312 | Bacteria | 6903 |
| 834 | Ga0395899_0028035 | 3300037312 | Bacteria | 4241 |
| 835 | Ga0395900_0000173 | 3300037418 | Bacteria | 103767 |
| 836 | Ga0395900_0000541 | 3300037418 | Bacteria | 52877 |
| 837 | Ga0395900_0007879 | 3300037418 | Bacteria | 10970 |
| 838 | Ga0395900_0013989 | 3300037418 | Bacteria | 8190 |
| 839 | Ga0395900_0045279 | 3300037418 | Bacteria | 4532 |
| 840 | Ga0395898_0002029 | 3300037466 | Bacteria | 25368 |
| 841 | Ga0395898_0002849 | 3300037466 | Bacteria | 19773 |
| 842 | Ga0395898_0011571 | 3300037466 | Bacteria | 9161 |
| 843 | Ga0395905_0002917 | 3300037471 | Bacteria | 18641 |
| 844 | Ga0395905_0014577 | 3300037471 | Bacteria | 7497 |
| 845 | Ga0395905_0019113 | 3300037471 | Bacteria | 6499 |
| 846 | Ga0395905_0053430 | 3300037471 | Bacteria | 3781 |
| 847 | Ga0436364_0257896 | 3300037853 | Bacteria | 53998 |
| 848 | Ga0436364_0337910 | 3300037853 | Bacteria | 17987 |
| 849 | Ga0395901_0003913 | 3300038443 | Bacteria | 14984 |
| 850 | Ga0395901_0068624 | 3300038443 | Bacteria | 3693 |
| 851 | Ga0395901_0086074 | 3300038443 | Bacteria | 3286 |
| 852 | Ga0436365_0124513 | 3300039437 | Bacteria | 12264 |
| 853 | Ga0436365_0744728 | 3300039437 | Bacteria | 34476 |
| 854 | Ga0436365_0864707 | 3300039437 | Bacteria | 54217 |
| 855 | Ga0436365_1082470 | 3300039437 | Bacteria | 2401 |
| 856 | Ga0436365_1879596 | 3300039437 | Bacteria | 24111 |
| 857 | Ga0439449_0001673 | 3300042007 | Bacteria | 8719 |
| 858 | Ga0439457_000620 | 3300042014 | Bacteria | 10490 |
| 859 | Ga0451577_0009669 | 3300042876 | Bacteria | 9253 |
| 860 | Ga0451577_0024886 | 3300042876 | Bacteria | 5438 |
| 861 | Ga0451577_0039199 | 3300042876 | Bacteria | 4258 |
| 862 | Ga0466969_0000778 | 3300044656 | Bacteria | 17395 |
| 863 | Ga0466972_0000004 | 3300044658 | Bacteria | 314413 |
| 864 | Ga0466972_0000095 | 3300044658 | Bacteria | 77981 |
| 865 | Ga0466972_0000579 | 3300044658 | Bacteria | 17790 |
| 866 | Ga0466961_0004336 | 3300044693 | Bacteria | 8886 |
| 867 | Ga0466963_0063419 | 3300044694 | Bacteria | 2473 |
| 868 | Ga0453684_0007097 | 3300044712 | Bacteria | 20886 |
| 869 | Ga0453684_0007618 | 3300044712 | Bacteria | 19832 |
| 870 | Ga0453684_0012031 | 3300044712 | Bacteria | 14383 |
| 871 | Ga0453684_0021609 | 3300044712 | Bacteria | 9601 |
| 872 | Ga0453684_0092637 | 3300044712 | Bacteria | 3724 |
| 873 | Ga0453684_0120888 | 3300044712 | Bacteria | 3162 |
| 874 | Ga0453684_0185927 | 3300044712 | Bacteria | 2435 |
| 875 | Ga0466970_0000518 | 3300044765 | Bacteria | 18999 |
| 876 | Ga0466957_0000423 | 3300044842 | Bacteria | 20805 |
| 877 | Ga0466959_0000125 | 3300045049 | Bacteria | 49909 |
| 878 | Ga0466959_0102215 | 3300045049 | Bacteria | 2051 |
| 879 | Ga0451576_0007702 | 3300045051 | Bacteria | 12806 |
| 880 | Ga0451576_0051039 | 3300045051 | Bacteria | 4337 |
| 881 | Ga0466967_0020795 | 3300045976 | Bacteria | 5315 |
| 882 | Ga0495627_000003 | 3300046453 | Bacteria | 704557 |
| 883 | Ga0495627_004693 | 3300046453 | Bacteria | 5652 |
| 884 | Ga0495590_0004043 | 3300046457 | Bacteria | 5951 |
| 885 | Ga0495629_0049223 | 3300046459 | Bacteria | 2954 |
| 886 | Ga0495629_0076457 | 3300046459 | Bacteria | 2338 |
| 887 | Ga0495650_0000107 | 3300046471 | Bacteria | 200864 |
| 888 | Ga0495650_0030127 | 3300046471 | Bacteria | 2462 |
| 889 | Ga0495580_0062746 | 3300046472 | Bacteria | 2607 |
| 890 | Ga0495585_0000014 | 3300046492 | Bacteria | 187513 |
| 891 | Ga0495596_0005212 | 3300046500 | Bacteria | 6180 |
| 892 | Ga0495606_0000303 | 3300046507 | Bacteria | 84874 |
| 893 | Ga0495606_0003492 | 3300046507 | Bacteria | 16646 |
| 894 | Ga0495606_0019559 | 3300046507 | Bacteria | 5031 |
| 895 | Ga0495606_0019848 | 3300046507 | Bacteria | 4978 |
| 896 | Ga0495608_0032472 | 3300046511 | Bacteria | 3528 |
| 897 | Ga0495610_0000001 | 3300046512 | Bacteria | 1620061 |
| 898 | Ga0495610_0000967 | 3300046512 | Bacteria | 26569 |
| 899 | Ga0495610_0003739 | 3300046512 | Bacteria | 11647 |
| 900 | Ga0495616_0005202 | 3300046513 | Bacteria | 8048 |
| 901 | Ga0495616_0011517 | 3300046513 | Bacteria | 5061 |
| 902 | Ga0495628_0037066 | 3300046516 | Bacteria | 3910 |
| 903 | Ga0495628_0051315 | 3300046516 | Bacteria | 3261 |
| 904 | Ga0495630_0001261 | 3300046517 | Bacteria | 17462 |
| 905 | Ga0495630_0052405 | 3300046517 | Bacteria | 3055 |
| 906 | Ga0495637_0004191 | 3300046520 | Bacteria | 7486 |
| 907 | Ga0495643_0001316 | 3300046522 | Bacteria | 23535 |
| 908 | Ga0495648_0013720 | 3300046524 | Bacteria | 5972 |
| 909 | Ga0495648_0017653 | 3300046524 | Bacteria | 5090 |
| 910 | Ga0495652_0134483 | 3300046529 | Bacteria | 1953 |
| 911 | Ga0495652_0134667 | 3300046529 | Bacteria | 1951 |
| 912 | Ga0495654_0000001 | 3300046530 | Bacteria | 1513197 |
| 913 | Ga0495587_0020543 | 3300046536 | Bacteria | 4075 |
| 914 | Ga0495645_0003703 | 3300046543 | Bacteria | 10388 |
| 915 | Ga0495633_0000002 | 3300046558 | Bacteria | 488754 |
| 916 | Ga0495633_0000021 | 3300046558 | Bacteria | 227171 |
| 917 | Ga0495633_0013940 | 3300046558 | Bacteria | 4215 |
| 918 | Ga0495668_0000165 | 3300046616 | Bacteria | 98016 |
| 919 | Ga0495634_0014817 | 3300046642 | Bacteria | 5607 |
| 920 | Ga0495611_0000385 | 3300046648 | Bacteria | 28165 |
| 921 | Ga0495625_0000021 | 3300046660 | Bacteria | 282133 |
| 922 | Ga0495625_0002553 | 3300046660 | Bacteria | 19570 |
| 923 | Ga0495625_0006168 | 3300046660 | Bacteria | 10738 |
| 924 | Ga0495625_0067298 | 3300046660 | Bacteria | 2521 |
| 925 | Ga0495625_0090890 | 3300046660 | Bacteria | 2111 |
| 926 | Ga0495635_0062645 | 3300046663 | Bacteria | 2554 |
| 927 | Ga0495661_0002333 | 3300046665 | Bacteria | 14641 |
| 928 | Ga0495661_0004477 | 3300046665 | Bacteria | 10080 |
| 929 | Ga0495661_0008530 | 3300046665 | Bacteria | 7084 |
| 930 | Ga0495658_0009737 | 3300046683 | Bacteria | 4793 |
| 931 | Ga0495613_0002821 | 3300046689 | Bacteria | 13042 |
| 932 | Ga0495613_0027882 | 3300046689 | Bacteria | 4204 |
| 933 | Ga0495670_0010198 | 3300046691 | Bacteria | 4621 |
| 934 | Ga0495649_0000009 | 3300046694 | Bacteria | 451725 |
| 935 | Ga0495660_0009017 | 3300046810 | Bacteria | 5828 |
| 936 | Ga0495604_0026092 | 3300047317 | Bacteria | 4652 |
| 937 | Ga0495674_0053305 | 3300047319 | Bacteria | 3556 |
| 938 | Ga0495674_0076464 | 3300047319 | Bacteria | 2880 |
| 939 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 940 | Ga0495687_000586 | 3300047443 | Bacteria | 42692 |
| 941 | Ga0495687_002100 | 3300047443 | Bacteria | 16729 |
| 942 | Ga0495673_0011664 | 3300047469 | Bacteria | 4713 |
| 943 | Ga0495684_0000682 | 3300047471 | Bacteria | 27327 |
| 944 | Ga0495684_0120639 | 3300047471 | Bacteria | 1975 |
| 945 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 946 | Ga0495686_0000772 | 3300047472 | Bacteria | 42035 |
| 947 | Ga0495686_0001407 | 3300047472 | Bacteria | 26513 |
| 948 | Ga0495686_0001408 | 3300047472 | Bacteria | 26462 |
| 949 | Ga0495686_0003005 | 3300047472 | Bacteria | 14986 |
| 950 | Ga0495686_0007062 | 3300047472 | Bacteria | 8470 |
| 951 | Ga0495686_0009495 | 3300047472 | Bacteria | 6997 |
| 952 | Ga0496101_0006897 | 3300048904 | Bacteria | 7332 |
| 953 | Ga0496101_0012662 | 3300048904 | Bacteria | 5637 |
| 954 | Ga0496104_0033960 | 3300048907 | Bacteria | 4755 |
| 955 | Ga0496104_0054853 | 3300048907 | Bacteria | 3767 |
| 956 | Ga0496106_0029416 | 3300048909 | Bacteria | 4094 |
| 957 | Ga0496110_0129908 | 3300048913 | Bacteria | 2274 |
| 958 | Ga0496112_0054973 | 3300048915 | Bacteria | 3912 |
| 959 | Ga0496114_0000416 | 3300048917 | Bacteria | 31603 |
| 960 | Ga0496115_0023903 | 3300048918 | Bacteria | 4745 |
| 961 | Ga0496115_0139373 | 3300048918 | Bacteria | 2001 |
| 962 | Ga0496116_0000027 | 3300048919 | Bacteria | 448077 |
| 963 | Ga0496116_0024733 | 3300048919 | Bacteria | 4432 |
| 964 | Ga0496117_0000021 | 3300048920 | Bacteria | 444168 |
| 965 | Ga0496117_0000107 | 3300048920 | Bacteria | 187748 |
| 966 | Ga0496117_0004347 | 3300048920 | Bacteria | 15722 |
| 967 | Ga0496118_0000531 | 3300048921 | Bacteria | 62520 |
| 968 | Ga0496118_0022333 | 3300048921 | Bacteria | 5536 |
| 969 | Ga0496119_0000004 | 3300048922 | Bacteria | 536344 |
| 970 | Ga0496122_0000119 | 3300048925 | Bacteria | 182576 |
| 971 | Ga0496122_0000344 | 3300048925 | Bacteria | 100498 |
| 972 | Ga0496122_0000376 | 3300048925 | Bacteria | 95506 |
| 973 | Ga0496122_0001365 | 3300048925 | Bacteria | 39692 |
| 974 | Ga0496122_0004219 | 3300048925 | Bacteria | 18062 |
| 975 | Ga0496122_0016702 | 3300048925 | Bacteria | 6919 |
| 976 | Ga0496122_0025946 | 3300048925 | Bacteria | 5072 |
| 977 | Ga0496123_0003274 | 3300048926 | Bacteria | 18349 |
| 978 | Ga0496123_0010620 | 3300048926 | Bacteria | 8103 |
| 979 | Ga0496123_0028964 | 3300048926 | Bacteria | 4088 |
| 980 | Ga0496123_0033074 | 3300048926 | Bacteria | 3728 |
| 981 | Ga0496124_0000526 | 3300048927 | Bacteria | 65165 |
| 982 | Ga0496125_0000169 | 3300048928 | Bacteria | 145879 |
| 983 | Ga0496126_0000744 | 3300048929 | Bacteria | 59025 |
| 984 | Ga0496126_0004594 | 3300048929 | Bacteria | 16374 |
| 985 | Ga0495678_002150 | 3300049459 | Bacteria | 13929 |
| 986 | Ga0501032_0022083 | 3300049569 | Bacteria | 4417 |
| 987 | Ga0501033_0012882 | 3300049570 | Bacteria | 6379 |
| 988 | Ga0501033_0020212 | 3300049570 | Bacteria | 5033 |
| 989 | Ga0501033_0086365 | 3300049570 | Bacteria | 2297 |
| 990 | Ga0501034_0009300 | 3300049571 | Bacteria | 10294 |
| 991 | Ga0501034_0023079 | 3300049571 | Bacteria | 6340 |
| 992 | Ga0501034_0025486 | 3300049571 | Bacteria | 6022 |
| 993 | Ga0501034_0031443 | 3300049571 | Bacteria | 5390 |
| 994 | Ga0501034_0032204 | 3300049571 | Bacteria | 5326 |
| 995 | Ga0501034_0038864 | 3300049571 | Bacteria | 4820 |
| 996 | Ga0501036_0068940 | 3300049572 | Bacteria | 2993 |
| 997 | Ga0501036_0080723 | 3300049572 | Bacteria | 2749 |
| 998 | Ga0501036_0111026 | 3300049572 | Bacteria | 2317 |
| 999 | Ga0501036_0199113 | 3300049572 | Bacteria | 1685 |
| 1000 | Ga0501037_0058222 | 3300049573 | Bacteria | 2820 |
| 1001 | Ga0501038_0147561 | 3300049574 | Bacteria | 1919 |
| 1002 | Ga0501039_0032231 | 3300049575 | Bacteria | 4039 |
| 1003 | Ga0501039_0038498 | 3300049575 | Bacteria | 3693 |
| 1004 | Ga0501039_0046707 | 3300049575 | Bacteria | 3346 |
| 1005 | Ga0501039_0149928 | 3300049575 | Bacteria | 1832 |
| 1006 | Ga0501040_0001751 | 3300049576 | Bacteria | 13950 |
| 1007 | Ga0501042_0015393 | 3300049578 | Bacteria | 5237 |
| 1008 | Ga0501043_0015230 | 3300049579 | Bacteria | 6022 |
| 1009 | Ga0501043_0015402 | 3300049579 | Bacteria | 5988 |
| 1010 | Ga0501043_0022086 | 3300049579 | Bacteria | 4994 |
| 1011 | Ga0501046_0008978 | 3300049580 | Bacteria | 8680 |
| 1012 | Ga0501046_0116134 | 3300049580 | Bacteria | 2040 |
| 1013 | Ga0501047_0018111 | 3300049581 | Bacteria | 6750 |
| 1014 | Ga0501047_0032779 | 3300049581 | Bacteria | 5015 |
| 1015 | Ga0501047_0042741 | 3300049581 | Bacteria | 4378 |
| 1016 | Ga0501048_0010094 | 3300049582 | Bacteria | 7066 |
| 1017 | Ga0501048_0030544 | 3300049582 | Bacteria | 3898 |
| 1018 | Ga0501067_0014825 | 3300049583 | Bacteria | 4313 |
| 1019 | Ga0501068_0022202 | 3300049584 | Bacteria | 3709 |
| 1020 | Ga0501070_0030975 | 3300049586 | Bacteria | 4481 |
| 1021 | Ga0501070_0032613 | 3300049586 | Bacteria | 4359 |
| 1022 | Ga0501071_0040725 | 3300049587 | Bacteria | 3325 |
| 1023 | Ga0501071_0050392 | 3300049587 | Bacteria | 2999 |
| 1024 | Ga0501072_0010677 | 3300049588 | Bacteria | 6993 |
| 1025 | Ga0501072_0084230 | 3300049588 | Bacteria | 2521 |
| 1026 | Ga0501072_0087601 | 3300049588 | Bacteria | 2471 |
| 1027 | Ga0501073_0013211 | 3300049589 | Bacteria | 6018 |
| 1028 | Ga0501073_0035438 | 3300049589 | Bacteria | 3548 |
| 1029 | Ga0501073_0087081 | 3300049589 | Bacteria | 2172 |
| 1030 | Ga0501074_0021554 | 3300049590 | Bacteria | 4679 |
| 1031 | Ga0501074_0137484 | 3300049590 | Bacteria | 1748 |
| 1032 | Ga0501075_0004548 | 3300049591 | Bacteria | 9401 |
| 1033 | Ga0501075_0056230 | 3300049591 | Bacteria | 2962 |
| 1034 | Ga0501076_0005355 | 3300049592 | Bacteria | 9215 |
| 1035 | Ga0501076_0012693 | 3300049592 | Bacteria | 6307 |
| 1036 | Ga0501076_0051965 | 3300049592 | Bacteria | 3245 |
| 1037 | Ga0501076_0094591 | 3300049592 | Bacteria | 2406 |
| 1038 | Ga0501077_0005464 | 3300049593 | Bacteria | 7737 |
| 1039 | Ga0501077_0060639 | 3300049593 | Bacteria | 2401 |
| 1040 | Ga0501223_000421 | 3300049663 | Bacteria | 10268 |
| 1041 | Ga0501224_002098 | 3300049664 | Bacteria | 2701 |
| 1042 | Ga0501233_006883 | 3300049668 | Bacteria | 2150 |
| 1043 | Ga0501242_000172 | 3300049674 | Bacteria | 4922 |
| 1044 | Ga0501250_000838 | 3300049680 | Bacteria | 2290 |
| 1045 | Ga0501259_000442 | 3300049688 | Bacteria | 6569 |
| 1046 | Ga0501259_000985 | 3300049688 | Bacteria | 4732 |
| 1047 | Ga0501225_0003642 | 3300049705 | Bacteria | 4640 |
| 1048 | Ga0501079_0008095 | 3300049741 | Bacteria | 7963 |
| 1049 | Ga0501079_0088434 | 3300049741 | Bacteria | 2399 |
| 1050 | Ga0501079_0110172 | 3300049741 | Bacteria | 2139 |
| 1051 | Ga0501080_0011276 | 3300049742 | Bacteria | 8182 |
| 1052 | Ga0501080_0053548 | 3300049742 | Bacteria | 3757 |
| 1053 | Ga0501080_0083240 | 3300049742 | Bacteria | 2972 |
| 1054 | Ga0501081_0000624 | 3300049743 | Bacteria | 20161 |
| 1055 | Ga0501241_003128 | 3300049758 | Bacteria | 3151 |
| 1056 | Ga0501035_0026655 | 3300049822 | Bacteria | 5287 |
| 1057 | Ga0501035_0050648 | 3300049822 | Bacteria | 3721 |
| 1058 | Ga0501035_0054161 | 3300049822 | Bacteria | 3585 |
| 1059 | Ga0501044_0003228 | 3300049823 | Bacteria | 18353 |
| 1060 | Ga0501044_0009540 | 3300049823 | Bacteria | 10569 |
| 1061 | Ga0501044_0019651 | 3300049823 | Bacteria | 7221 |
| 1062 | Ga0501044_0022960 | 3300049823 | Bacteria | 6641 |
| 1063 | Ga0501044_0031786 | 3300049823 | Bacteria | 5551 |
| 1064 | Ga0501044_0051702 | 3300049823 | Bacteria | 4236 |
| 1065 | Ga0501045_0051903 | 3300049824 | Bacteria | 2993 |
| 1066 | Ga0501284_00027 | 3300050005 | Bacteria | 76239 |
| 1067 | nmdc:mga0k408_32055_c1 | 3300050493 | Bacteria | 3002 |
| 1068 | nmdc:mga0k408_372_c1 | 3300050493 | Bacteria | 24584 |
| 1069 | nmdc:mga05p37_236500_c1 | 3300050507 | Bacteria | 2198 |
| 1070 | nmdc:mga05p37_5638_c1 | 3300050507 | Bacteria | 14717 |
| 1071 | nmdc:mga0qj67_27150_c1 | 3300050509 | Bacteria | 4434 |
| 1072 | nmdc:mga0qj67_54657_c1 | 3300050509 | Bacteria | 3162 |
| 1073 | nmdc:mga06r32_8029_c1 | 3300050510 | Bacteria | 9493 |
| 1074 | nmdc:mga08y16_31623_c1 | 3300050511 | Bacteria | 5566 |
| 1075 | nmdc:mga08y16_61858_c1 | 3300050511 | Bacteria | 3909 |
| 1076 | nmdc:mga08y16_88771_c1 | 3300050511 | Bacteria | 3222 |
| 1077 | Ga0495601_0059046 | 3300053077 | Bacteria | 2432 |
| 1078 | Ga0500635_0004277 | 3300053080 | Bacteria | 3667 |
| 1079 | Ga0495619_0038817 | 3300053085 | Bacteria | 3107 |
| 1080 | Ga0500578_0001498 | 3300053086 | Bacteria | 23150 |
| 1081 | Ga0500578_0048202 | 3300053086 | Bacteria | 2734 |
| 1082 | Ga0500643_004342 | 3300053087 | Bacteria | 6461 |
| 1083 | Ga0500644_0021667 | 3300053088 | Bacteria | 1929 |
| 1084 | Ga0500651_0000302 | 3300053093 | Bacteria | 28484 |
| 1085 | Ga0500562_000062 | 3300053108 | Bacteria | 53042 |
| 1086 | Ga0500618_000245 | 3300053125 | Bacteria | 43176 |
| 1087 | Ga0500618_006010 | 3300053125 | Bacteria | 3609 |
| 1088 | Ga0500568_0000236 | 3300053139 | Bacteria | 47278 |
| 1089 | Ga0500568_0024490 | 3300053139 | Bacteria | 2556 |
| 1090 | Ga0500616_0025766 | 3300053153 | Bacteria | 3261 |
| 1091 | Ga0500622_0002381 | 3300053156 | Bacteria | 13626 |
| 1092 | Ga0500622_0004600 | 3300053156 | Bacteria | 8576 |
| 1093 | Ga0500622_0011679 | 3300053156 | Bacteria | 4775 |
| 1094 | Ga0500611_000006 | 3300053727 | Bacteria | 226069 |
| 1095 | Ga0501082_0026906 | 3300060353 | Bacteria | 4955 |
| 1096 | Ga0530510_0029745 | 3300061734 | Bacteria | 3921 |
| 1097 | Ga0530510_0032762 | 3300061734 | Bacteria | 3740 |
| 1098 | Ga0530510_0071383 | 3300061734 | Bacteria | 2521 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046529 | Ga0495652_0134667 | Ga0495652_0134667_17_1468 | 458 |
| 2 | 3300049741 | Ga0501079_0110172 | Ga0501079_0110172_638_2107 | 461 |
| 3 | 3300049593 | Ga0501077_0060639 | Ga0501077_0060639_819_2363 | 486 |
| 4 | 3300049590 | Ga0501074_0137484 | Ga0501074_0137484_208_1716 | 490 |
| 5 | 3300044694 | Ga0466963_0063419 | Ga0466963_0063419_905_2458 | 502 |
| 6 | 3300048918 | Ga0496115_0139373 | Ga0496115_0139373_294_1847 | 502 |
| 7 | 3300049574 | Ga0501038_0147561 | Ga0501038_0147561_25_1581 | 502 |
| 8 | 3300005544 | Ga0070686_100062888 | Ga0070686_1000628882 | 512 |
| 9 | 3300053086 | Ga0500578_0048202 | Ga0500578_0048202_12_1559 | 515 |
| 10 | 3300046660 | Ga0495625_0067298 | Ga0495625_0067298_17_1591 | 520 |
| 11 | 3300010375 | Ga0105239_10043261 | Ga0105239_100432613 | 521 |
| 12 | 3300026116 | Ga0207674_10131916 | Ga0207674_101319162 | 522 |
| 13 | 3300036401 | Ga0373937_0230019 | Ga0373937_0230019_14_1723 | 526 |
| 14 | 3300013104 | Ga0157370_10143782 | Ga0157370_101437821 | 527 |
| 15 | 3300049572 | Ga0501036_0111026 | Ga0501036_0111026_370_2079 | 528 |
| 16 | 3300049575 | Ga0501039_0046707 | Ga0501039_0046707_352_2061 | 528 |
| 17 | 3300049591 | Ga0501075_0056230 | Ga0501075_0056230_684_2393 | 528 |
| 18 | 3300014968 | Ga0157379_10043618 | Ga0157379_100436184 | 533 |
| 19 | 3300046516 | Ga0495628_0051315 | Ga0495628_0051315_301_2007 | 533 |
| 20 | 3300046543 | Ga0495645_0003703 | Ga0495645_0003703_962_2668 | 533 |
| 21 | 3300047317 | Ga0495604_0026092 | Ga0495604_0026092_2524_4230 | 533 |
| 22 | 3300047471 | Ga0495684_0000682 | Ga0495684_0000682_20665_22371 | 533 |
| 23 | 3300049571 | Ga0501034_0032204 | Ga0501034_0032204_21_1622 | 533 |
| 24 | 3300053086 | Ga0500578_0001498 | Ga0500578_0001498_22_1623 | 533 |
| 25 | 3300005355 | Ga0070671_100000489 | Ga0070671_10000048920 | 534 |
| 26 | 3300013307 | Ga0157372_10047723 | Ga0157372_100477232 | 534 |
| 27 | 3300025931 | Ga0207644_10001671 | Ga0207644_1000167113 | 534 |
| 28 | 3300047443 | Ga0495687_002100 | Ga0495687_002100_8568_10307 | 534 |
| 29 | 3300049588 | Ga0501072_0084230 | Ga0501072_0084230_849_2483 | 534 |
| 30 | 3300053085 | Ga0495619_0038817 | Ga0495619_0038817_1341_3044 | 534 |
| 31 | 3300046511 | Ga0495608_0032472 | Ga0495608_0032472_1716_3428 | 535 |
| 32 | 3300046517 | Ga0495630_0001261 | Ga0495630_0001261_15274_16986 | 535 |
| 33 | 3300046663 | Ga0495635_0062645 | Ga0495635_0062645_446_2158 | 535 |
| 34 | 3300046689 | Ga0495613_0002821 | Ga0495613_0002821_6057_7769 | 535 |
| 35 | 3300047319 | Ga0495674_0053305 | Ga0495674_0053305_774_2486 | 535 |
| 36 | 3300049580 | Ga0501046_0008978 | Ga0501046_0008978_3139_4794 | 535 |
| 37 | 3300031238 | Ga0265332_10011849 | Ga0265332_100118493 | 536 |
| 38 | 3300049572 | Ga0501036_0199113 | Ga0501036_0199113_10_1656 | 538 |
| 39 | 3300042876 | Ga0451577_0009669 | Ga0451577_0009669_7043_8740 | 539 |
| 40 | 3300044712 | Ga0453684_0185927 | Ga0453684_0185927_353_2050 | 539 |
| 41 | 3300049587 | Ga0501071_0040725 | Ga0501071_0040725_565_2268 | 539 |
| 42 | 3300049742 | Ga0501080_0011276 | Ga0501080_0011276_5507_7210 | 539 |
| 43 | 3300049824 | Ga0501045_0051903 | Ga0501045_0051903_330_2033 | 539 |
| 44 | 3300009094 | Ga0111539_10072821 | Ga0111539_100728212 | 540 |
| 45 | 3300031733 | Ga0316577_10000061 | Ga0316577_1000006120 | 540 |
| 46 | 3300036712 | Ga0316584_0002129 | Ga0316584_0002129_1751_3454 | 540 |
| 47 | 3300049741 | Ga0501079_0088434 | Ga0501079_0088434_474_2192 | 540 |
| 48 | 3300050511 | nmdc:mga08y16_61858_c1 | nmdc:mga08y16_61858_c1_326_2071 | 540 |
| 49 | 3300050511 | nmdc:mga08y16_31623_c1 | nmdc:mga08y16_31623_c1_1816_3480 | 542 |
| 50 | 3300005290 | Ga0065712_10000499 | Ga0065712_100004998 | 544 |
| 51 | 3300005293 | Ga0065715_10091975 | Ga0065715_100919751 | 544 |
| 52 | 3300005331 | Ga0070670_100057142 | Ga0070670_1000571422 | 544 |
| 53 | 3300005618 | Ga0068864_100023531 | Ga0068864_1000235312 | 544 |
| 54 | 3300006844 | Ga0075428_100000023 | Ga0075428_10000002365 | 544 |
| 55 | 3300025908 | Ga0207643_10030289 | Ga0207643_100302892 | 544 |
| 56 | 3300025921 | Ga0207652_10134235 | Ga0207652_101342351 | 544 |
| 57 | 3300025925 | Ga0207650_10027848 | Ga0207650_100278482 | 544 |
| 58 | 3300025926 | Ga0207659_10056273 | Ga0207659_100562732 | 544 |
| 59 | 3300026095 | Ga0207676_10006059 | Ga0207676_100060597 | 544 |
| 60 | 3300039437 | Ga0436365_1082470 | Ga0436365_1082470_101_1858 | 544 |
| 61 | 3300048909 | Ga0496106_0029416 | Ga0496106_0029416_1497_3206 | 544 |
| 62 | 3300048913 | Ga0496110_0129908 | Ga0496110_0129908_427_2136 | 544 |
| 63 | 3300048915 | Ga0496112_0054973 | Ga0496112_0054973_381_2090 | 544 |
| 64 | 3300005367 | Ga0070667_100003004 | Ga0070667_1000030043 | 545 |
| 65 | 3300005843 | Ga0068860_100001682 | Ga0068860_1000016824 | 545 |
| 66 | 3300006237 | Ga0097621_100111158 | Ga0097621_1001111582 | 545 |
| 67 | 3300025986 | Ga0207658_10003314 | Ga0207658_100033145 | 545 |
| 68 | 3300028381 | Ga0268264_10001129 | Ga0268264_1000112919 | 545 |
| 69 | 3300005536 | Ga0070697_100008131 | Ga0070697_1000081316 | 546 |
| 70 | 3300053077 | Ga0495601_0059046 | Ga0495601_0059046_213_1928 | 546 |
| 71 | 3300028380 | Ga0268265_10093173 | Ga0268265_100931732 | 547 |
| 72 | 3300035410 | Ga0373924_0006668 | Ga0373924_0006668_640_2367 | 547 |
| 73 | 3300049570 | Ga0501033_0012882 | Ga0501033_0012882_642_2360 | 547 |
| 74 | 3300049575 | Ga0501039_0149928 | Ga0501039_0149928_60_1778 | 547 |
| 75 | 3300049576 | Ga0501040_0001751 | Ga0501040_0001751_10592_12310 | 547 |
| 76 | 3300049578 | Ga0501042_0015393 | Ga0501042_0015393_1117_2835 | 547 |
| 77 | 3300049584 | Ga0501068_0022202 | Ga0501068_0022202_238_1956 | 547 |
| 78 | 3300049587 | Ga0501071_0050392 | Ga0501071_0050392_339_2057 | 547 |
| 79 | 3300049588 | Ga0501072_0010677 | Ga0501072_0010677_1640_3358 | 547 |
| 80 | 3300049589 | Ga0501073_0035438 | Ga0501073_0035438_1775_3493 | 547 |
| 81 | 3300049590 | Ga0501074_0021554 | Ga0501074_0021554_2719_4437 | 547 |
| 82 | 3300049591 | Ga0501075_0004548 | Ga0501075_0004548_570_2288 | 547 |
| 83 | 3300049592 | Ga0501076_0005355 | Ga0501076_0005355_321_2039 | 547 |
| 84 | 3300049592 | Ga0501076_0094591 | Ga0501076_0094591_114_1832 | 547 |
| 85 | 3300049593 | Ga0501077_0005464 | Ga0501077_0005464_1531_3249 | 547 |
| 86 | 3300049741 | Ga0501079_0008095 | Ga0501079_0008095_143_1861 | 547 |
| 87 | 3300049742 | Ga0501080_0053548 | Ga0501080_0053548_1504_3222 | 547 |
| 88 | 3300049743 | Ga0501081_0000624 | Ga0501081_0000624_12787_14505 | 547 |
| 89 | 3300061734 | Ga0530510_0029745 | Ga0530510_0029745_1481_3199 | 547 |
| 90 | 3300061734 | Ga0530510_0032762 | Ga0530510_0032762_75_1793 | 547 |
| 91 | iso_pu_bacteria | 2939615513 | 2939617042 | 547 |
| 92 | 3300005335 | Ga0070666_10069361 | Ga0070666_100693612 | 548 |
| 93 | 3300005563 | Ga0068855_100091186 | Ga0068855_1000911862 | 548 |
| 94 | 3300005842 | Ga0068858_100055397 | Ga0068858_1000553973 | 548 |
| 95 | 3300006237 | Ga0097621_100003067 | Ga0097621_1000030676 | 548 |
| 96 | 3300006358 | Ga0068871_100005490 | Ga0068871_1000054904 | 548 |
| 97 | 3300009098 | Ga0105245_10000926 | Ga0105245_100009263 | 548 |
| 98 | 3300013297 | Ga0157378_10000804 | Ga0157378_1000080413 | 548 |
| 99 | 3300025927 | Ga0207687_10014531 | Ga0207687_100145313 | 548 |
| 100 | 3300026023 | Ga0207677_10069977 | Ga0207677_100699772 | 548 |
| 101 | 3300025928 | Ga0207700_10023717 | Ga0207700_100237172 | 549 |
| 102 | 3300048920 | Ga0496117_0000107 | Ga0496117_0000107_171851_173578 | 549 |
| 103 | 3300049592 | Ga0501076_0012693 | Ga0501076_0012693_1741_3444 | 549 |
| 104 | 3300005577 | Ga0068857_100070466 | Ga0068857_1000704661 | 550 |
| 105 | 3300026116 | Ga0207674_10019660 | Ga0207674_100196603 | 550 |
| 106 | 3300009093 | Ga0105240_10008514 | Ga0105240_1000851412 | 551 |
| 107 | 3300025913 | Ga0207695_10002931 | Ga0207695_100029318 | 551 |
| 108 | 3300031235 | Ga0265330_10004423 | Ga0265330_100044232 | 551 |
| 109 | 3300031235 | Ga0265330_10001992 | Ga0265330_100019927 | 552 |
| 110 | 3300050509 | nmdc:mga0qj67_27150_c1 | nmdc:mga0qj67_27150_c1_1280_2968 | 552 |
| 111 | 3300013308 | Ga0157375_10011081 | Ga0157375_100110818 | 553 |
| 112 | 3300025936 | Ga0207670_10019364 | Ga0207670_100193645 | 553 |
| 113 | 3300046516 | Ga0495628_0037066 | Ga0495628_0037066_20_1681 | 553 |
| 114 | 3300049588 | Ga0501072_0087601 | Ga0501072_0087601_793_2454 | 553 |
| 115 | 3300009094 | Ga0111539_10075788 | Ga0111539_100757883 | 554 |
| 116 | 3300050511 | nmdc:mga08y16_88771_c1 | nmdc:mga08y16_88771_c1_1217_2938 | 554 |
| 117 | 3300005441 | Ga0070700_100006894 | Ga0070700_1000068944 | 555 |
| 118 | 3300005546 | Ga0070696_100058403 | Ga0070696_1000584033 | 555 |
| 119 | 3300006847 | Ga0075431_100043842 | Ga0075431_1000438423 | 555 |
| 120 | 3300009094 | Ga0111539_10268794 | Ga0111539_102687941 | 555 |
| 121 | 3300010375 | Ga0105239_10004544 | Ga0105239_1000454411 | 555 |
| 122 | 3300028380 | Ga0268265_10010187 | Ga0268265_100101875 | 555 |
| 123 | 3300031727 | Ga0316576_10070898 | Ga0316576_100708981 | 555 |
| 124 | 3300031728 | Ga0316578_10063865 | Ga0316578_100638652 | 555 |
| 125 | 3300049592 | Ga0501076_0051965 | Ga0501076_0051965_1117_2814 | 555 |
| 126 | 3300050507 | nmdc:mga05p37_236500_c1 | nmdc:mga05p37_236500_c1_193_1902 | 555 |
| 127 | 3300005293 | Ga0065715_10103649 | Ga0065715_101036492 | 556 |
| 128 | 3300005466 | Ga0070685_10009755 | Ga0070685_100097552 | 556 |
| 129 | 3300005467 | Ga0070706_100027552 | Ga0070706_1000275524 | 556 |
| 130 | 3300005539 | Ga0068853_100023395 | Ga0068853_1000233953 | 556 |
| 131 | 3300005617 | Ga0068859_100002955 | Ga0068859_10000295517 | 556 |
| 132 | 3300006237 | Ga0097621_100040619 | Ga0097621_1000406192 | 556 |
| 133 | 3300006931 | Ga0097620_100002955 | Ga0097620_10000295517 | 556 |
| 134 | 3300009093 | Ga0105240_10015424 | Ga0105240_100154245 | 556 |
| 135 | 3300009176 | Ga0105242_10044439 | Ga0105242_100444392 | 556 |
| 136 | 3300009551 | Ga0105238_10080635 | Ga0105238_100806352 | 556 |
| 137 | 3300014969 | Ga0157376_10017840 | Ga0157376_100178403 | 556 |
| 138 | 3300021384 | Ga0213876_10045005 | Ga0213876_100450052 | 556 |
| 139 | 3300022467 | Ga0224712_10003241 | Ga0224712_100032411 | 556 |
| 140 | 3300025885 | Ga0207653_10013171 | Ga0207653_100131711 | 556 |
| 141 | 3300025913 | Ga0207695_10020868 | Ga0207695_100208683 | 556 |
| 142 | 3300025927 | Ga0207687_10033191 | Ga0207687_100331911 | 556 |
| 143 | 3300025934 | Ga0207686_10008918 | Ga0207686_100089182 | 556 |
| 144 | 3300025938 | Ga0207704_10079027 | Ga0207704_100790272 | 556 |
| 145 | 3300026023 | Ga0207677_10058828 | Ga0207677_100588281 | 556 |
| 146 | 3300026041 | Ga0207639_10012203 | Ga0207639_100122033 | 556 |
| 147 | 3300026118 | Ga0207675_100040039 | Ga0207675_1000400393 | 556 |
| 148 | 3300028379 | Ga0268266_10069849 | Ga0268266_100698492 | 556 |
| 149 | 3300037853 | Ga0436364_0257896 | Ga0436364_0257896_2220_4118 | 556 |
| 150 | 3300037853 | Ga0436364_0337910 | Ga0436364_0337910_10151_11935 | 556 |
| 151 | 3300039437 | Ga0436365_0744728 | Ga0436365_0744728_8909_10726 | 556 |
| 152 | 3300039437 | Ga0436365_0864707 | Ga0436365_0864707_50702_52600 | 556 |
| 153 | 3300048904 | Ga0496101_0006897 | Ga0496101_0006897_2524_4230 | 556 |
| 154 | 3300048907 | Ga0496104_0033960 | Ga0496104_0033960_1859_3565 | 556 |
| 155 | 3300048917 | Ga0496114_0000416 | Ga0496114_0000416_29417_31123 | 556 |
| 156 | 3300061734 | Ga0530510_0071383 | Ga0530510_0071383_254_2002 | 556 |
| 157 | 3300028558 | Ga0265326_10006763 | Ga0265326_100067631 | 558 |
| 158 | 3300031235 | Ga0265330_10000854 | Ga0265330_1000085411 | 558 |
| 159 | 3300031344 | Ga0265316_10000068 | Ga0265316_1000006848 | 558 |
| 160 | 3300031344 | Ga0265316_10088761 | Ga0265316_100887611 | 558 |
| 161 | 3300046529 | Ga0495652_0134483 | Ga0495652_0134483_39_1766 | 558 |
| 162 | 3300006358 | Ga0068871_100054112 | Ga0068871_1000541122 | 559 |
| 163 | 3300013297 | Ga0157378_10004694 | Ga0157378_100046942 | 559 |
| 164 | 3300028653 | Ga0265323_10008461 | Ga0265323_100084613 | 559 |
| 165 | 3300045976 | Ga0466967_0020795 | Ga0466967_0020795_2713_4497 | 559 |
| 166 | 3300005616 | Ga0068852_100000079 | Ga0068852_1000000795 | 560 |
| 167 | 3300005617 | Ga0068859_100042091 | Ga0068859_1000420915 | 560 |
| 168 | 3300006931 | Ga0097620_100042090 | Ga0097620_1000420905 | 560 |
| 169 | 3300009093 | Ga0105240_10000744 | Ga0105240_100007445 | 560 |
| 170 | 3300009147 | Ga0114129_10012944 | Ga0114129_100129444 | 560 |
| 171 | 3300009553 | Ga0105249_10026641 | Ga0105249_100266414 | 560 |
| 172 | 3300013104 | Ga0157370_10000160 | Ga0157370_1000016046 | 560 |
| 173 | 3300013105 | Ga0157369_10034479 | Ga0157369_100344795 | 560 |
| 174 | 3300025913 | Ga0207695_10000460 | Ga0207695_1000046055 | 560 |
| 175 | 3300025949 | Ga0207667_10003821 | Ga0207667_100038213 | 560 |
| 176 | 3300026142 | Ga0207698_10000052 | Ga0207698_1000005248 | 560 |
| 177 | 3300031548 | Ga0307408_100002433 | Ga0307408_1000024339 | 560 |
| 178 | 3300031911 | Ga0307412_10019630 | Ga0307412_100196302 | 560 |
| 179 | 3300050507 | nmdc:mga05p37_5638_c1 | nmdc:mga05p37_5638_c1_8852_10585 | 560 |
| 180 | 3300005530 | Ga0070679_100020451 | Ga0070679_1000204514 | 561 |
| 181 | 3300025921 | Ga0207652_10004578 | Ga0207652_100045783 | 561 |
| 182 | 3300031548 | Ga0307408_100004072 | Ga0307408_1000040724 | 561 |
| 183 | 3300031911 | Ga0307412_10050829 | Ga0307412_100508292 | 561 |
| 184 | 3300044712 | Ga0453684_0007097 | Ga0453684_0007097_18395_20080 | 561 |
| 185 | 3300044712 | Ga0453684_0021609 | Ga0453684_0021609_683_2368 | 561 |
| 186 | 3300049579 | Ga0501043_0022086 | Ga0501043_0022086_2436_4178 | 561 |
| 187 | 3300053087 | Ga0500643_004342 | Ga0500643_004342_4592_6280 | 561 |
| 188 | 3300005327 | Ga0070658_10003403 | Ga0070658_100034035 | 562 |
| 189 | 3300005328 | Ga0070676_10000980 | Ga0070676_100009808 | 562 |
| 190 | 3300005335 | Ga0070666_10003610 | Ga0070666_100036102 | 562 |
| 191 | 3300005338 | Ga0068868_100029048 | Ga0068868_1000290484 | 562 |
| 192 | 3300005347 | Ga0070668_100006878 | Ga0070668_1000068781 | 562 |
| 193 | 3300005367 | Ga0070667_100002981 | Ga0070667_10000298110 | 562 |
| 194 | 3300005456 | Ga0070678_100032141 | Ga0070678_1000321412 | 562 |
| 195 | 3300005457 | Ga0070662_100016379 | Ga0070662_1000163794 | 562 |
| 196 | 3300005543 | Ga0070672_100000067 | Ga0070672_10000006710 | 562 |
| 197 | 3300005548 | Ga0070665_100002117 | Ga0070665_1000021175 | 562 |
| 198 | 3300005616 | Ga0068852_100056063 | Ga0068852_1000560632 | 562 |
| 199 | 3300005618 | Ga0068864_100012055 | Ga0068864_1000120554 | 562 |
| 200 | 3300005841 | Ga0068863_100002443 | Ga0068863_1000024435 | 562 |
| 201 | 3300005842 | Ga0068858_100007698 | Ga0068858_1000076982 | 562 |
| 202 | 3300005843 | Ga0068860_100009199 | Ga0068860_1000091992 | 562 |
| 203 | 3300013296 | Ga0157374_10024564 | Ga0157374_100245642 | 562 |
| 204 | 3300013306 | Ga0163162_10016216 | Ga0163162_100162165 | 562 |
| 205 | 3300013308 | Ga0157375_10023439 | Ga0157375_100234393 | 562 |
| 206 | 3300014325 | Ga0163163_10015150 | Ga0163163_100151505 | 562 |
| 207 | 3300014968 | Ga0157379_10007199 | Ga0157379_100071992 | 562 |
| 208 | 3300014969 | Ga0157376_10012924 | Ga0157376_100129245 | 562 |
| 209 | 3300025903 | Ga0207680_10000790 | Ga0207680_1000079010 | 562 |
| 210 | 3300025907 | Ga0207645_10014107 | Ga0207645_100141072 | 562 |
| 211 | 3300025909 | Ga0207705_10015636 | Ga0207705_100156363 | 562 |
| 212 | 3300025926 | Ga0207659_10034177 | Ga0207659_100341772 | 562 |
| 213 | 3300025933 | Ga0207706_10022674 | Ga0207706_100226742 | 562 |
| 214 | 3300025940 | Ga0207691_10002208 | Ga0207691_100022086 | 562 |
| 215 | 3300025960 | Ga0207651_10000296 | Ga0207651_100002965 | 562 |
| 216 | 3300025972 | Ga0207668_10000272 | Ga0207668_1000027217 | 562 |
| 217 | 3300025986 | Ga0207658_10002352 | Ga0207658_100023527 | 562 |
| 218 | 3300026023 | Ga0207677_10027181 | Ga0207677_100271813 | 562 |
| 219 | 3300026035 | Ga0207703_10028936 | Ga0207703_100289362 | 562 |
| 220 | 3300026041 | Ga0207639_10027733 | Ga0207639_100277332 | 562 |
| 221 | 3300026088 | Ga0207641_10003749 | Ga0207641_100037495 | 562 |
| 222 | 3300026089 | Ga0207648_10000786 | Ga0207648_100007865 | 562 |
| 223 | 3300026095 | Ga0207676_10001574 | Ga0207676_1000157412 | 562 |
| 224 | 3300026118 | Ga0207675_100040254 | Ga0207675_1000402542 | 562 |
| 225 | 3300028379 | Ga0268266_10002971 | Ga0268266_100029715 | 562 |
| 226 | 3300028800 | Ga0265338_10014452 | Ga0265338_100144527 | 562 |
| 227 | 3300042007 | Ga0439449_0001673 | Ga0439449_0001673_5687_7453 | 562 |
| 228 | 3300046536 | Ga0495587_0020543 | Ga0495587_0020543_1907_3700 | 562 |
| 229 | 3300047472 | Ga0495686_0001408 | Ga0495686_0001408_14952_16745 | 562 |
| 230 | 3300049569 | Ga0501032_0022083 | Ga0501032_0022083_1792_3534 | 562 |
| 231 | 3300049570 | Ga0501033_0020212 | Ga0501033_0020212_1577_3319 | 562 |
| 232 | 3300049571 | Ga0501034_0031443 | Ga0501034_0031443_1923_3665 | 562 |
| 233 | 3300049572 | Ga0501036_0080723 | Ga0501036_0080723_119_1861 | 562 |
| 234 | 3300049575 | Ga0501039_0038498 | Ga0501039_0038498_1861_3603 | 562 |
| 235 | 3300049579 | Ga0501043_0015230 | Ga0501043_0015230_796_2538 | 562 |
| 236 | 3300049822 | Ga0501035_0026655 | Ga0501035_0026655_1813_3555 | 562 |
| 237 | 3300049823 | Ga0501044_0031786 | Ga0501044_0031786_1950_3692 | 562 |
| 238 | 3300050005 | Ga0501284_00027 | Ga0501284_00027_58689_60434 | 562 |
| 239 | 3300009093 | Ga0105240_10000001 | Ga0105240_10000001324 | 563 |
| 240 | 3300009551 | Ga0105238_10098788 | Ga0105238_100987883 | 563 |
| 241 | 3300013296 | Ga0157374_10022346 | Ga0157374_100223464 | 563 |
| 242 | 3300025913 | Ga0207695_10000001 | Ga0207695_10000001326 | 563 |
| 243 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_135118_136905 | 563 |
| 244 | 3300005617 | Ga0068859_100107645 | Ga0068859_1001076451 | 564 |
| 245 | 3300006028 | Ga0070717_10001896 | Ga0070717_100018966 | 564 |
| 246 | 3300006931 | Ga0097620_100107651 | Ga0097620_1001076513 | 564 |
| 247 | 3300009093 | Ga0105240_10001870 | Ga0105240_100018704 | 564 |
| 248 | 3300013102 | Ga0157371_10007298 | Ga0157371_100072988 | 564 |
| 249 | 3300013104 | Ga0157370_10106164 | Ga0157370_101061642 | 564 |
| 250 | 3300013307 | Ga0157372_10013477 | Ga0157372_100134772 | 564 |
| 251 | 3300013307 | Ga0157372_10130567 | Ga0157372_101305673 | 564 |
| 252 | 3300025933 | Ga0207706_10046621 | Ga0207706_100466212 | 564 |
| 253 | 3300031251 | Ga0265327_10001191 | Ga0265327_1000119115 | 564 |
| 254 | 3300031730 | Ga0307516_10002603 | Ga0307516_100026036 | 564 |
| 255 | 3300036401 | Ga0373937_0019497 | Ga0373937_0019497_3457_5235 | 564 |
| 256 | 3300042876 | Ga0451577_0039199 | Ga0451577_0039199_197_1909 | 564 |
| 257 | 3300044712 | Ga0453684_0007618 | Ga0453684_0007618_12966_14678 | 564 |
| 258 | 3300044842 | Ga0466957_0000423 | Ga0466957_0000423_263_2038 | 564 |
| 259 | 3300005536 | Ga0070697_100001004 | Ga0070697_10000100419 | 565 |
| 260 | 3300025914 | Ga0207671_10005449 | Ga0207671_100054497 | 565 |
| 261 | 3300048929 | Ga0496126_0004594 | Ga0496126_0004594_13794_15542 | 565 |
| 262 | iso_pu_bacteria | 2588254257 | 2590611153 | 565 |
| 263 | 3300009093 | Ga0105240_10000128 | Ga0105240_10000128119 | 566 |
| 264 | 3300009093 | Ga0105240_10010263 | Ga0105240_1001026310 | 566 |
| 265 | 3300009177 | Ga0105248_10000002 | Ga0105248_10000002275 | 566 |
| 266 | 3300009545 | Ga0105237_10004855 | Ga0105237_1000485514 | 566 |
| 267 | 3300010375 | Ga0105239_10001249 | Ga0105239_100012494 | 566 |
| 268 | 3300025911 | Ga0207654_10006499 | Ga0207654_100064992 | 566 |
| 269 | 3300025913 | Ga0207695_10000179 | Ga0207695_1000017960 | 566 |
| 270 | 3300025913 | Ga0207695_10000962 | Ga0207695_1000096210 | 566 |
| 271 | 3300025914 | Ga0207671_10002256 | Ga0207671_100022567 | 566 |
| 272 | 3300025941 | Ga0207711_10000023 | Ga0207711_1000002312 | 566 |
| 273 | 3300028800 | Ga0265338_10012310 | Ga0265338_100123106 | 566 |
| 274 | 3300031239 | Ga0265328_10020062 | Ga0265328_100200622 | 566 |
| 275 | 3300031249 | Ga0265339_10005643 | Ga0265339_100056435 | 566 |
| 276 | 3300031251 | Ga0265327_10000440 | Ga0265327_1000044045 | 566 |
| 277 | 3300031344 | Ga0265316_10002794 | Ga0265316_100027945 | 566 |
| 278 | 3300031711 | Ga0265314_10008735 | Ga0265314_100087355 | 566 |
| 279 | 3300047472 | Ga0495686_0003005 | Ga0495686_0003005_2675_4414 | 566 |
| 280 | iso_pu_bacteria | 2582581278 | 2585141885 | 566 |
| 281 | iso_pu_bacteria | 2585428045 | 2587678360 | 566 |
| 282 | iso_pu_bacteria | 2585428060 | 2587745670 | 566 |
| 283 | iso_pu_bacteria | 2585428182 | 2588209056 | 566 |
| 284 | iso_pu_bacteria | 2585428183 | 2588216173 | 566 |
| 285 | iso_pu_bacteria | 2585428184 | 2588220515 | 566 |
| 286 | iso_pu_bacteria | 2585428185 | 2588225231 | 566 |
| 287 | iso_pu_bacteria | 2588253712 | 2588445544 | 566 |
| 288 | iso_pu_bacteria | 2588254255 | 2590602478 | 566 |
| 289 | iso_pu_bacteria | 2728369107 | 2729202200 | 566 |
| 290 | iso_pu_bacteria | 2751185877 | 2753671803 | 566 |
| 291 | iso_pu_bacteria | 2765235839 | 2765576722 | 566 |
| 292 | iso_pu_bacteria | 2772190705 | 2772606245 | 566 |
| 293 | iso_pu_bacteria | 2816332188 | 2816872023 | 566 |
| 294 | iso_pu_bacteria | 2842083920 | 2842085778 | 566 |
| 295 | iso_pu_bacteria | 2871720351 | 2871720957 | 566 |
| 296 | iso_pu_bacteria | 2889290771 | 2889292818 | 566 |
| 297 | iso_pu_bacteria | 2905999023 | 2906002487 | 566 |
| 298 | 3300005328 | Ga0070676_10002582 | Ga0070676_100025829 | 567 |
| 299 | 3300005331 | Ga0070670_100029260 | Ga0070670_1000292602 | 567 |
| 300 | 3300005355 | Ga0070671_100008573 | Ga0070671_1000085738 | 567 |
| 301 | 3300005364 | Ga0070673_100001841 | Ga0070673_1000018415 | 567 |
| 302 | 3300005364 | Ga0070673_100070558 | Ga0070673_1000705582 | 567 |
| 303 | 3300005367 | Ga0070667_100000497 | Ga0070667_1000004978 | 567 |
| 304 | 3300005455 | Ga0070663_100067764 | Ga0070663_1000677642 | 567 |
| 305 | 3300005459 | Ga0068867_100000968 | Ga0068867_1000009687 | 567 |
| 306 | 3300005539 | Ga0068853_100010943 | Ga0068853_1000109434 | 567 |
| 307 | 3300005563 | Ga0068855_100000590 | Ga0068855_1000005904 | 567 |
| 308 | 3300005563 | Ga0068855_100012267 | Ga0068855_1000122672 | 567 |
| 309 | 3300005563 | Ga0068855_100014431 | Ga0068855_1000144314 | 567 |
| 310 | 3300005577 | Ga0068857_100003162 | Ga0068857_1000031622 | 567 |
| 311 | 3300005614 | Ga0068856_100036702 | Ga0068856_1000367024 | 567 |
| 312 | 3300005616 | Ga0068852_100003597 | Ga0068852_1000035976 | 567 |
| 313 | 3300005616 | Ga0068852_100015392 | Ga0068852_1000153922 | 567 |
| 314 | 3300005616 | Ga0068852_100037705 | Ga0068852_1000377052 | 567 |
| 315 | 3300005618 | Ga0068864_100005929 | Ga0068864_1000059293 | 567 |
| 316 | 3300005841 | Ga0068863_100001982 | Ga0068863_1000019822 | 567 |
| 317 | 3300005843 | Ga0068860_100000200 | Ga0068860_10000020040 | 567 |
| 318 | 3300006237 | Ga0097621_100000694 | Ga0097621_1000006949 | 567 |
| 319 | 3300006237 | Ga0097621_100003792 | Ga0097621_1000037929 | 567 |
| 320 | 3300006237 | Ga0097621_100031306 | Ga0097621_1000313063 | 567 |
| 321 | 3300006358 | Ga0068871_100000109 | Ga0068871_10000010937 | 567 |
| 322 | 3300006358 | Ga0068871_100004528 | Ga0068871_1000045289 | 567 |
| 323 | 3300006881 | Ga0068865_100000376 | Ga0068865_10000037623 | 567 |
| 324 | 3300009093 | Ga0105240_10008403 | Ga0105240_1000840312 | 567 |
| 325 | 3300009093 | Ga0105240_10066393 | Ga0105240_100663934 | 567 |
| 326 | 3300009093 | Ga0105240_10071558 | Ga0105240_100715583 | 567 |
| 327 | 3300009174 | Ga0105241_10000024 | Ga0105241_1000002492 | 567 |
| 328 | 3300009174 | Ga0105241_10006507 | Ga0105241_100065072 | 567 |
| 329 | 3300009174 | Ga0105241_10008646 | Ga0105241_100086466 | 567 |
| 330 | 3300009174 | Ga0105241_10015759 | Ga0105241_100157593 | 567 |
| 331 | 3300009176 | Ga0105242_10008952 | Ga0105242_100089526 | 567 |
| 332 | 3300009177 | Ga0105248_10004239 | Ga0105248_100042397 | 567 |
| 333 | 3300009177 | Ga0105248_10018698 | Ga0105248_100186983 | 567 |
| 334 | 3300009545 | Ga0105237_10018029 | Ga0105237_100180292 | 567 |
| 335 | 3300009551 | Ga0105238_10000085 | Ga0105238_1000008521 | 567 |
| 336 | 3300009551 | Ga0105238_10009575 | Ga0105238_100095759 | 567 |
| 337 | 3300009551 | Ga0105238_10012364 | Ga0105238_100123642 | 567 |
| 338 | 3300010375 | Ga0105239_10007713 | Ga0105239_1000771310 | 567 |
| 339 | 3300010375 | Ga0105239_10009223 | Ga0105239_100092234 | 567 |
| 340 | 3300011119 | Ga0105246_10015315 | Ga0105246_100153154 | 567 |
| 341 | 3300013105 | Ga0157369_10005070 | Ga0157369_100050703 | 567 |
| 342 | 3300013105 | Ga0157369_10012219 | Ga0157369_100122196 | 567 |
| 343 | 3300013105 | Ga0157369_10052596 | Ga0157369_100525961 | 567 |
| 344 | 3300013296 | Ga0157374_10004634 | Ga0157374_100046344 | 567 |
| 345 | 3300013296 | Ga0157374_10012094 | Ga0157374_100120944 | 567 |
| 346 | 3300013297 | Ga0157378_10024523 | Ga0157378_100245236 | 567 |
| 347 | 3300013306 | Ga0163162_10032943 | Ga0163162_100329435 | 567 |
| 348 | 3300013307 | Ga0157372_10018638 | Ga0157372_100186386 | 567 |
| 349 | 3300013308 | Ga0157375_10021303 | Ga0157375_100213034 | 567 |
| 350 | 3300014325 | Ga0163163_10000249 | Ga0163163_100002497 | 567 |
| 351 | 3300014969 | Ga0157376_10030884 | Ga0157376_100308842 | 567 |
| 352 | 3300017792 | Ga0163161_10068281 | Ga0163161_100682812 | 567 |
| 353 | 3300025900 | Ga0207710_10010678 | Ga0207710_100106782 | 567 |
| 354 | 3300025907 | Ga0207645_10000135 | Ga0207645_1000013525 | 567 |
| 355 | 3300025911 | Ga0207654_10000672 | Ga0207654_1000067212 | 567 |
| 356 | 3300025911 | Ga0207654_10001159 | Ga0207654_1000115912 | 567 |
| 357 | 3300025913 | Ga0207695_10000047 | Ga0207695_10000047155 | 567 |
| 358 | 3300025913 | Ga0207695_10001203 | Ga0207695_1000120329 | 567 |
| 359 | 3300025913 | Ga0207695_10065069 | Ga0207695_100650692 | 567 |
| 360 | 3300025913 | Ga0207695_10081724 | Ga0207695_100817242 | 567 |
| 361 | 3300025914 | Ga0207671_10000982 | Ga0207671_1000098222 | 567 |
| 362 | 3300025914 | Ga0207671_10016469 | Ga0207671_100164696 | 567 |
| 363 | 3300025924 | Ga0207694_10000365 | Ga0207694_1000036529 | 567 |
| 364 | 3300025924 | Ga0207694_10001434 | Ga0207694_100014347 | 567 |
| 365 | 3300025924 | Ga0207694_10006285 | Ga0207694_100062856 | 567 |
| 366 | 3300025924 | Ga0207694_10068129 | Ga0207694_100681291 | 567 |
| 367 | 3300025925 | Ga0207650_10001962 | Ga0207650_100019624 | 567 |
| 368 | 3300025927 | Ga0207687_10003289 | Ga0207687_100032899 | 567 |
| 369 | 3300025931 | Ga0207644_10006328 | Ga0207644_100063282 | 567 |
| 370 | 3300025938 | Ga0207704_10000019 | Ga0207704_1000001992 | 567 |
| 371 | 3300025940 | Ga0207691_10174453 | Ga0207691_101744532 | 567 |
| 372 | 3300025941 | Ga0207711_10002802 | Ga0207711_100028029 | 567 |
| 373 | 3300025941 | Ga0207711_10010632 | Ga0207711_100106324 | 567 |
| 374 | 3300025942 | Ga0207689_10008323 | Ga0207689_100083235 | 567 |
| 375 | 3300025949 | Ga0207667_10013504 | Ga0207667_100135045 | 567 |
| 376 | 3300025949 | Ga0207667_10061519 | Ga0207667_100615194 | 567 |
| 377 | 3300025960 | Ga0207651_10002179 | Ga0207651_100021797 | 567 |
| 378 | 3300025986 | Ga0207658_10003050 | Ga0207658_100030504 | 567 |
| 379 | 3300025986 | Ga0207658_10018448 | Ga0207658_100184482 | 567 |
| 380 | 3300026023 | Ga0207677_10001377 | Ga0207677_1000137710 | 567 |
| 381 | 3300026023 | Ga0207677_10009544 | Ga0207677_100095443 | 567 |
| 382 | 3300026041 | Ga0207639_10002486 | Ga0207639_100024864 | 567 |
| 383 | 3300026041 | Ga0207639_10047523 | Ga0207639_100475232 | 567 |
| 384 | 3300026067 | Ga0207678_10032087 | Ga0207678_100320874 | 567 |
| 385 | 3300026078 | Ga0207702_10001197 | Ga0207702_1000119720 | 567 |
| 386 | 3300026078 | Ga0207702_10010074 | Ga0207702_100100747 | 567 |
| 387 | 3300026088 | Ga0207641_10045803 | Ga0207641_100458032 | 567 |
| 388 | 3300026089 | Ga0207648_10000061 | Ga0207648_1000006165 | 567 |
| 389 | 3300026095 | Ga0207676_10020687 | Ga0207676_100206873 | 567 |
| 390 | 3300026121 | Ga0207683_10002798 | Ga0207683_100027986 | 567 |
| 391 | 3300026121 | Ga0207683_10024259 | Ga0207683_100242592 | 567 |
| 392 | 3300026142 | Ga0207698_10000410 | Ga0207698_100004104 | 567 |
| 393 | 3300026142 | Ga0207698_10006710 | Ga0207698_100067106 | 567 |
| 394 | 3300028379 | Ga0268266_10122889 | Ga0268266_101228891 | 567 |
| 395 | 3300028800 | Ga0265338_10084856 | Ga0265338_100848562 | 567 |
| 396 | 3300031235 | Ga0265330_10008652 | Ga0265330_100086523 | 567 |
| 397 | 3300031239 | Ga0265328_10008335 | Ga0265328_100083352 | 567 |
| 398 | 3300031241 | Ga0265325_10007941 | Ga0265325_100079414 | 567 |
| 399 | 3300031241 | Ga0265325_10019301 | Ga0265325_100193013 | 567 |
| 400 | 3300031249 | Ga0265339_10000184 | Ga0265339_1000018419 | 567 |
| 401 | 3300031344 | Ga0265316_10028078 | Ga0265316_100280784 | 567 |
| 402 | 3300031344 | Ga0265316_10092869 | Ga0265316_100928692 | 567 |
| 403 | 3300031344 | Ga0265316_10115499 | Ga0265316_101154991 | 567 |
| 404 | 3300031712 | Ga0265342_10003604 | Ga0265342_100036048 | 567 |
| 405 | 3300031712 | Ga0265342_10004003 | Ga0265342_100040039 | 567 |
| 406 | 3300031712 | Ga0265342_10034964 | Ga0265342_100349642 | 567 |
| 407 | 3300033180 | Ga0307510_10019806 | Ga0307510_100198065 | 567 |
| 408 | 3300037471 | Ga0395905_0019113 | Ga0395905_0019113_3270_5018 | 567 |
| 409 | 3300046459 | Ga0495629_0049223 | Ga0495629_0049223_980_2746 | 567 |
| 410 | 3300046459 | Ga0495629_0076457 | Ga0495629_0076457_491_2296 | 567 |
| 411 | 3300046507 | Ga0495606_0003492 | Ga0495606_0003492_4059_5828 | 567 |
| 412 | 3300046648 | Ga0495611_0000385 | Ga0495611_0000385_10974_12737 | 567 |
| 413 | 3300046689 | Ga0495613_0027882 | Ga0495613_0027882_988_2793 | 567 |
| 414 | 3300048907 | Ga0496104_0054853 | Ga0496104_0054853_640_2445 | 567 |
| 415 | 3300048918 | Ga0496115_0023903 | Ga0496115_0023903_947_2752 | 567 |
| 416 | 3300049823 | Ga0501044_0003228 | Ga0501044_0003228_15829_17568 | 567 |
| 417 | 3300003320 | rootH2_10112387 | rootH2_101123873 | 568 |
| 418 | 3300003322 | rootL2_10235324 | rootL2_102353242 | 568 |
| 419 | 3300003323 | rootH1_10062604 | rootH1_100626044 | 568 |
| 420 | 3300003578 | Ga0006562J51391_1004821 | Ga0006562J51391_10048212 | 568 |
| 421 | 3300003784 | Ga0055534_1009268 | Ga0055534_10092682 | 568 |
| 422 | 3300005337 | Ga0070682_100000158 | Ga0070682_10000015813 | 568 |
| 423 | 3300005530 | Ga0070679_100083227 | Ga0070679_1000832272 | 568 |
| 424 | 3300009036 | Ga0105244_10000069 | Ga0105244_1000006934 | 568 |
| 425 | 3300009148 | Ga0105243_10000130 | Ga0105243_1000013013 | 568 |
| 426 | 3300009148 | Ga0105243_10024668 | Ga0105243_100246682 | 568 |
| 427 | 3300013104 | Ga0157370_10027777 | Ga0157370_100277772 | 568 |
| 428 | 3300013104 | Ga0157370_10117031 | Ga0157370_101170312 | 568 |
| 429 | 3300015261 | Ga0182006_1000015 | Ga0182006_1000015165 | 568 |
| 430 | 3300015261 | Ga0182006_1000149 | Ga0182006_100014916 | 568 |
| 431 | 3300025291 | Ga0209675_1000179 | Ga0209675_100017967 | 568 |
| 432 | 3300025728 | Ga0207655_1000492 | Ga0207655_100049234 | 568 |
| 433 | 3300025904 | Ga0207647_10060113 | Ga0207647_100601131 | 568 |
| 434 | 3300025935 | Ga0207709_10000544 | Ga0207709_1000054417 | 568 |
| 435 | 3300025935 | Ga0207709_10039582 | Ga0207709_100395823 | 568 |
| 436 | 3300031911 | Ga0307412_10000019 | Ga0307412_10000019204 | 568 |
| 437 | 3300032002 | Ga0307416_100000004 | Ga0307416_100000004284 | 568 |
| 438 | 3300044658 | Ga0466972_0000004 | Ga0466972_0000004_301260_303002 | 568 |
| 439 | 3300044765 | Ga0466970_0000518 | Ga0466970_0000518_16173_17915 | 568 |
| 440 | 3300046500 | Ga0495596_0005212 | Ga0495596_0005212_831_2555 | 568 |
| 441 | 3300046512 | Ga0495610_0000001 | Ga0495610_0000001_583571_585322 | 568 |
| 442 | 3300046691 | Ga0495670_0010198 | Ga0495670_0010198_1376_3118 | 568 |
| 443 | 3300048919 | Ga0496116_0000027 | Ga0496116_0000027_289881_291605 | 568 |
| 444 | 3300048920 | Ga0496117_0000021 | Ga0496117_0000021_155640_157364 | 568 |
| 445 | 3300048921 | Ga0496118_0000531 | Ga0496118_0000531_32949_34673 | 568 |
| 446 | 3300048922 | Ga0496119_0000004 | Ga0496119_0000004_286816_288540 | 568 |
| 447 | 3300048925 | Ga0496122_0000119 | Ga0496122_0000119_119084_120805 | 568 |
| 448 | 3300048925 | Ga0496122_0000344 | Ga0496122_0000344_30466_32190 | 568 |
| 449 | 3300048925 | Ga0496122_0000376 | Ga0496122_0000376_69189_70913 | 568 |
| 450 | 3300048925 | Ga0496122_0004219 | Ga0496122_0004219_2865_4586 | 568 |
| 451 | 3300048925 | Ga0496122_0016702 | Ga0496122_0016702_4896_6623 | 568 |
| 452 | 3300048926 | Ga0496123_0003274 | Ga0496123_0003274_2832_4556 | 568 |
| 453 | 3300048926 | Ga0496123_0010620 | Ga0496123_0010620_3569_5290 | 568 |
| 454 | 3300048926 | Ga0496123_0028964 | Ga0496123_0028964_1979_3703 | 568 |
| 455 | 3300048927 | Ga0496124_0000526 | Ga0496124_0000526_63391_65115 | 568 |
| 456 | 3300048928 | Ga0496125_0000169 | Ga0496125_0000169_25155_26876 | 568 |
| 457 | 3300048929 | Ga0496126_0000744 | Ga0496126_0000744_26913_28637 | 568 |
| 458 | 3300049572 | Ga0501036_0068940 | Ga0501036_0068940_903_2678 | 568 |
| 459 | 3300049581 | Ga0501047_0018111 | Ga0501047_0018111_1935_3710 | 568 |
| 460 | 3300049823 | Ga0501044_0022960 | Ga0501044_0022960_522_2297 | 568 |
| 461 | iso_pu_bacteria | 2929154850 | 2929157835 | 568 |
| 462 | 3300021384 | Ga0213876_10014400 | Ga0213876_100144003 | 569 |
| 463 | 3300028800 | Ga0265338_10021733 | Ga0265338_100217332 | 569 |
| 464 | 3300031235 | Ga0265330_10000123 | Ga0265330_1000012321 | 569 |
| 465 | 3300031238 | Ga0265332_10030014 | Ga0265332_100300142 | 569 |
| 466 | 3300031240 | Ga0265320_10032511 | Ga0265320_100325112 | 569 |
| 467 | 3300031241 | Ga0265325_10000041 | Ga0265325_100000413 | 569 |
| 468 | 3300031247 | Ga0265340_10004286 | Ga0265340_100042864 | 569 |
| 469 | 3300031249 | Ga0265339_10007645 | Ga0265339_100076452 | 569 |
| 470 | 3300031344 | Ga0265316_10006591 | Ga0265316_100065917 | 569 |
| 471 | 3300031711 | Ga0265314_10001814 | Ga0265314_100018146 | 569 |
| 472 | 3300031712 | Ga0265342_10008363 | Ga0265342_100083634 | 569 |
| 473 | 3300039437 | Ga0436365_1879596 | Ga0436365_1879596_9012_10748 | 569 |
| 474 | 3300049663 | Ga0501223_000421 | Ga0501223_000421_6989_8812 | 569 |
| 475 | iso_pu_bacteria | 2818991444 | 2819590801 | 569 |
| 476 | 3300005339 | Ga0070660_100001381 | Ga0070660_1000013818 | 570 |
| 477 | 3300005530 | Ga0070679_100000323 | Ga0070679_10000032312 | 570 |
| 478 | 3300005535 | Ga0070684_100010008 | Ga0070684_1000100084 | 570 |
| 479 | 3300005563 | Ga0068855_100118608 | Ga0068855_1001186083 | 570 |
| 480 | 3300005616 | Ga0068852_100004077 | Ga0068852_1000040774 | 570 |
| 481 | 3300009093 | Ga0105240_10006000 | Ga0105240_100060009 | 570 |
| 482 | 3300009551 | Ga0105238_10017738 | Ga0105238_100177385 | 570 |
| 483 | 3300013102 | Ga0157371_10014766 | Ga0157371_100147663 | 570 |
| 484 | 3300013104 | Ga0157370_10014776 | Ga0157370_100147766 | 570 |
| 485 | 3300013307 | Ga0157372_10000324 | Ga0157372_1000032433 | 570 |
| 486 | 3300025261 | Ga0209233_1000796 | Ga0209233_10007963 | 570 |
| 487 | 3300025913 | Ga0207695_10000232 | Ga0207695_1000023247 | 570 |
| 488 | 3300025913 | Ga0207695_10046365 | Ga0207695_100463653 | 570 |
| 489 | 3300025919 | Ga0207657_10002799 | Ga0207657_100027998 | 570 |
| 490 | 3300025921 | Ga0207652_10001125 | Ga0207652_100011258 | 570 |
| 491 | 3300025924 | Ga0207694_10008026 | Ga0207694_100080266 | 570 |
| 492 | 3300025949 | Ga0207667_10000087 | Ga0207667_1000008733 | 570 |
| 493 | 3300025949 | Ga0207667_10000111 | Ga0207667_1000011148 | 570 |
| 494 | 3300028577 | Ga0265318_10015811 | Ga0265318_100158112 | 570 |
| 495 | 3300031235 | Ga0265330_10000153 | Ga0265330_1000015330 | 570 |
| 496 | 3300031241 | Ga0265325_10000785 | Ga0265325_100007856 | 570 |
| 497 | 3300031241 | Ga0265325_10023388 | Ga0265325_100233882 | 570 |
| 498 | 3300031241 | Ga0265325_10028974 | Ga0265325_100289741 | 570 |
| 499 | 3300031247 | Ga0265340_10015099 | Ga0265340_100150992 | 570 |
| 500 | 3300031247 | Ga0265340_10020963 | Ga0265340_100209631 | 570 |
| 501 | 3300031247 | Ga0265340_10041181 | Ga0265340_100411812 | 570 |
| 502 | 3300031249 | Ga0265339_10007352 | Ga0265339_100073524 | 570 |
| 503 | 3300031344 | Ga0265316_10004765 | Ga0265316_100047652 | 570 |
| 504 | 3300031595 | Ga0265313_10003068 | Ga0265313_100030689 | 570 |
| 505 | 3300031595 | Ga0265313_10036852 | Ga0265313_100368521 | 570 |
| 506 | 3300031712 | Ga0265342_10000917 | Ga0265342_100009175 | 570 |
| 507 | 3300049573 | Ga0501037_0058222 | Ga0501037_0058222_757_2499 | 570 |
| 508 | 3300049575 | Ga0501039_0032231 | Ga0501039_0032231_1776_3518 | 570 |
| 509 | 3300049579 | Ga0501043_0015402 | Ga0501043_0015402_1753_3495 | 570 |
| 510 | 3300049822 | Ga0501035_0054161 | Ga0501035_0054161_492_2234 | 570 |
| 511 | 3300049823 | Ga0501044_0051702 | Ga0501044_0051702_536_2278 | 570 |
| 512 | 3300053108 | Ga0500562_000062 | Ga0500562_000062_10648_12393 | 570 |
| 513 | 3300053153 | Ga0500616_0025766 | Ga0500616_0025766_812_2557 | 570 |
| 514 | 3300053156 | Ga0500622_0004600 | Ga0500622_0004600_6311_8056 | 570 |
| 515 | iso_pu_bacteria | 2958512119 | 2958515192 | 570 |
| 516 | 3300005614 | Ga0068856_100144549 | Ga0068856_1001445492 | 571 |
| 517 | 3300020080 | Ga0206350_10809614 | Ga0206350_108096142 | 571 |
| 518 | 3300026078 | Ga0207702_10097163 | Ga0207702_100971632 | 571 |
| 519 | 3300032004 | Ga0307414_10043695 | Ga0307414_100436952 | 571 |
| 520 | 3300044658 | Ga0466972_0000579 | Ga0466972_0000579_7818_9656 | 571 |
| 521 | 3300045051 | Ga0451576_0007702 | Ga0451576_0007702_2262_3995 | 571 |
| 522 | 3300049668 | Ga0501233_006883 | Ga0501233_006883_102_1928 | 571 |
| 523 | 3300049674 | Ga0501242_000172 | Ga0501242_000172_3086_4834 | 571 |
| 524 | 3300049688 | Ga0501259_000985 | Ga0501259_000985_1192_2940 | 571 |
| 525 | iso_pu_bacteria | 2945997725 | 2946001680 | 571 |
| 526 | 3300002459 | JGI24751J29686_10000950 | JGI24751J29686_100009504 | 572 |
| 527 | 3300005289 | Ga0065704_10117650 | Ga0065704_101176501 | 572 |
| 528 | 3300005290 | Ga0065712_10074461 | Ga0065712_100744613 | 572 |
| 529 | 3300005295 | Ga0065707_10117751 | Ga0065707_101177512 | 572 |
| 530 | 3300005331 | Ga0070670_100035645 | Ga0070670_1000356451 | 572 |
| 531 | 3300005335 | Ga0070666_10073219 | Ga0070666_100732192 | 572 |
| 532 | 3300005338 | Ga0068868_100096524 | Ga0068868_1000965242 | 572 |
| 533 | 3300005471 | Ga0070698_100002401 | Ga0070698_10000240115 | 572 |
| 534 | 3300005617 | Ga0068859_100114194 | Ga0068859_1001141942 | 572 |
| 535 | 3300005618 | Ga0068864_100004346 | Ga0068864_1000043468 | 572 |
| 536 | 3300005618 | Ga0068864_100094651 | Ga0068864_1000946511 | 572 |
| 537 | 3300005719 | Ga0068861_100022281 | Ga0068861_1000222813 | 572 |
| 538 | 3300006237 | Ga0097621_100008505 | Ga0097621_1000085055 | 572 |
| 539 | 3300006358 | Ga0068871_100029893 | Ga0068871_1000298935 | 572 |
| 540 | 3300006844 | Ga0075428_100097085 | Ga0075428_1000970852 | 572 |
| 541 | 3300006844 | Ga0075428_100107306 | Ga0075428_1001073062 | 572 |
| 542 | 3300006846 | Ga0075430_100025613 | Ga0075430_1000256135 | 572 |
| 543 | 3300006880 | Ga0075429_100001604 | Ga0075429_10000160415 | 572 |
| 544 | 3300006931 | Ga0097620_100114196 | Ga0097620_1001141962 | 572 |
| 545 | 3300009147 | Ga0114129_10151979 | Ga0114129_101519792 | 572 |
| 546 | 3300011119 | Ga0105246_10006351 | Ga0105246_100063514 | 572 |
| 547 | 3300013306 | Ga0163162_10054483 | Ga0163162_100544833 | 572 |
| 548 | 3300013307 | Ga0157372_10035377 | Ga0157372_100353772 | 572 |
| 549 | 3300013308 | Ga0157375_10171026 | Ga0157375_101710261 | 572 |
| 550 | 3300014325 | Ga0163163_10005284 | Ga0163163_100052842 | 572 |
| 551 | 3300014325 | Ga0163163_10125853 | Ga0163163_101258532 | 572 |
| 552 | 3300025907 | Ga0207645_10000306 | Ga0207645_1000030626 | 572 |
| 553 | 3300025925 | Ga0207650_10063750 | Ga0207650_100637503 | 572 |
| 554 | 3300025940 | Ga0207691_10041579 | Ga0207691_100415792 | 572 |
| 555 | 3300025940 | Ga0207691_10114421 | Ga0207691_101144212 | 572 |
| 556 | 3300025942 | Ga0207689_10004896 | Ga0207689_100048968 | 572 |
| 557 | 3300025961 | Ga0207712_10016515 | Ga0207712_100165153 | 572 |
| 558 | 3300025961 | Ga0207712_10079243 | Ga0207712_100792432 | 572 |
| 559 | 3300026023 | Ga0207677_10074904 | Ga0207677_100749042 | 572 |
| 560 | 3300026088 | Ga0207641_10000539 | Ga0207641_100005392 | 572 |
| 561 | 3300026089 | Ga0207648_10003171 | Ga0207648_1000317111 | 572 |
| 562 | 3300026095 | Ga0207676_10016570 | Ga0207676_100165702 | 572 |
| 563 | 3300026118 | Ga0207675_100013718 | Ga0207675_1000137183 | 572 |
| 564 | 3300026118 | Ga0207675_100040221 | Ga0207675_1000402212 | 572 |
| 565 | 3300026121 | Ga0207683_10004426 | Ga0207683_100044268 | 572 |
| 566 | 3300028379 | Ga0268266_10063540 | Ga0268266_100635402 | 572 |
| 567 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000011331 | 572 |
| 568 | 3300031616 | Ga0307508_10001210 | Ga0307508_100012109 | 572 |
| 569 | 3300046453 | Ga0495627_004693 | Ga0495627_004693_3220_4980 | 572 |
| 570 | 3300049680 | Ga0501250_000838 | Ga0501250_000838_520_2271 | 572 |
| 571 | 3300050509 | nmdc:mga0qj67_54657_c1 | nmdc:mga0qj67_54657_c1_178_1935 | 572 |
| 572 | iso_pu_bacteria | 2585428115 | 2587943242 | 572 |
| 573 | iso_pu_bacteria | 2599185184 | 2599479644 | 572 |
| 574 | iso_pu_bacteria | 2881247448 | 2881247913 | 572 |
| 575 | iso_pu_bacteria | 2914759650 | 2914761968 | 572 |
| 576 | iso_pu_bacteria | 2919437846 | 2919438058 | 572 |
| 577 | iso_pu_bacteria | 2928078545 | 2928083802 | 572 |
| 578 | iso_pu_bacteria | 2928147474 | 2928152241 | 572 |
| 579 | iso_pu_bacteria | 2932082852 | 2932084806 | 572 |
| 580 | iso_pu_bacteria | 2977243572 | 2977245487 | 572 |
| 581 | 3300003203 | JGI25406J46586_10010325 | JGI25406J46586_100103252 | 573 |
| 582 | 3300003354 | JGI25160J50197_1000687 | JGI25160J50197_10006872 | 573 |
| 583 | 3300005328 | Ga0070676_10032880 | Ga0070676_100328802 | 573 |
| 584 | 3300005331 | Ga0070670_100098304 | Ga0070670_1000983041 | 573 |
| 585 | 3300005331 | Ga0070670_100153832 | Ga0070670_1001538321 | 573 |
| 586 | 3300005334 | Ga0068869_100114830 | Ga0068869_1001148302 | 573 |
| 587 | 3300005337 | Ga0070682_100006212 | Ga0070682_1000062121 | 573 |
| 588 | 3300005338 | Ga0068868_100039782 | Ga0068868_1000397823 | 573 |
| 589 | 3300005339 | Ga0070660_100018003 | Ga0070660_1000180035 | 573 |
| 590 | 3300005344 | Ga0070661_100040116 | Ga0070661_1000401164 | 573 |
| 591 | 3300005347 | Ga0070668_100024239 | Ga0070668_1000242392 | 573 |
| 592 | 3300005353 | Ga0070669_100007952 | Ga0070669_1000079526 | 573 |
| 593 | 3300005364 | Ga0070673_100056413 | Ga0070673_1000564133 | 573 |
| 594 | 3300005365 | Ga0070688_100002056 | Ga0070688_1000020567 | 573 |
| 595 | 3300005366 | Ga0070659_100025920 | Ga0070659_1000259203 | 573 |
| 596 | 3300005459 | Ga0068867_100118624 | Ga0068867_1001186242 | 573 |
| 597 | 3300005535 | Ga0070684_100025664 | Ga0070684_1000256642 | 573 |
| 598 | 3300005535 | Ga0070684_100042864 | Ga0070684_1000428642 | 573 |
| 599 | 3300005539 | Ga0068853_100040644 | Ga0068853_1000406443 | 573 |
| 600 | 3300005543 | Ga0070672_100027741 | Ga0070672_1000277412 | 573 |
| 601 | 3300005548 | Ga0070665_100000001 | Ga0070665_100000001318 | 573 |
| 602 | 3300005564 | Ga0070664_100008425 | Ga0070664_1000084252 | 573 |
| 603 | 3300005564 | Ga0070664_100078386 | Ga0070664_1000783861 | 573 |
| 604 | 3300005616 | Ga0068852_100062562 | Ga0068852_1000625622 | 573 |
| 605 | 3300005617 | Ga0068859_100059052 | Ga0068859_1000590522 | 573 |
| 606 | 3300005618 | Ga0068864_100138175 | Ga0068864_1001381751 | 573 |
| 607 | 3300005843 | Ga0068860_100010023 | Ga0068860_1000100236 | 573 |
| 608 | 3300005843 | Ga0068860_100065888 | Ga0068860_1000658882 | 573 |
| 609 | 3300005843 | Ga0068860_100111574 | Ga0068860_1001115741 | 573 |
| 610 | 3300005985 | Ga0081539_10000345 | Ga0081539_1000034566 | 573 |
| 611 | 3300006931 | Ga0097620_100045498 | Ga0097620_1000454983 | 573 |
| 612 | 3300006931 | Ga0097620_100059048 | Ga0097620_1000590482 | 573 |
| 613 | 3300010375 | Ga0105239_10091422 | Ga0105239_100914222 | 573 |
| 614 | 3300013306 | Ga0163162_10104448 | Ga0163162_101044483 | 573 |
| 615 | 3300013307 | Ga0157372_10053344 | Ga0157372_100533443 | 573 |
| 616 | 3300013307 | Ga0157372_10061622 | Ga0157372_100616221 | 573 |
| 617 | 3300013307 | Ga0157372_10133134 | Ga0157372_101331343 | 573 |
| 618 | 3300013308 | Ga0157375_10170389 | Ga0157375_101703892 | 573 |
| 619 | 3300014326 | Ga0157380_10029681 | Ga0157380_100296812 | 573 |
| 620 | 3300014745 | Ga0157377_10004138 | Ga0157377_100041384 | 573 |
| 621 | 3300014745 | Ga0157377_10008097 | Ga0157377_100080972 | 573 |
| 622 | 3300025302 | Ga0207426_1000132 | Ga0207426_100013250 | 573 |
| 623 | 3300025903 | Ga0207680_10016445 | Ga0207680_100164454 | 573 |
| 624 | 3300025904 | Ga0207647_10002289 | Ga0207647_100022894 | 573 |
| 625 | 3300025919 | Ga0207657_10001302 | Ga0207657_100013027 | 573 |
| 626 | 3300025919 | Ga0207657_10022148 | Ga0207657_100221481 | 573 |
| 627 | 3300025920 | Ga0207649_10027658 | Ga0207649_100276583 | 573 |
| 628 | 3300025923 | Ga0207681_10098197 | Ga0207681_100981972 | 573 |
| 629 | 3300025931 | Ga0207644_10082766 | Ga0207644_100827661 | 573 |
| 630 | 3300025932 | Ga0207690_10004696 | Ga0207690_100046966 | 573 |
| 631 | 3300025933 | Ga0207706_10027852 | Ga0207706_100278522 | 573 |
| 632 | 3300025933 | Ga0207706_10056023 | Ga0207706_100560232 | 573 |
| 633 | 3300025940 | Ga0207691_10022714 | Ga0207691_100227143 | 573 |
| 634 | 3300025942 | Ga0207689_10008304 | Ga0207689_100083044 | 573 |
| 635 | 3300025942 | Ga0207689_10098622 | Ga0207689_100986221 | 573 |
| 636 | 3300026023 | Ga0207677_10055550 | Ga0207677_100555502 | 573 |
| 637 | 3300026075 | Ga0207708_10078480 | Ga0207708_100784802 | 573 |
| 638 | 3300026089 | Ga0207648_10002643 | Ga0207648_100026432 | 573 |
| 639 | 3300026089 | Ga0207648_10011997 | Ga0207648_100119971 | 573 |
| 640 | 3300026089 | Ga0207648_10151976 | Ga0207648_101519762 | 573 |
| 641 | 3300026089 | Ga0207648_10165320 | Ga0207648_101653201 | 573 |
| 642 | 3300026118 | Ga0207675_100004088 | Ga0207675_1000040888 | 573 |
| 643 | 3300026142 | Ga0207698_10010692 | Ga0207698_100106924 | 573 |
| 644 | 3300027907 | Ga0207428_10018183 | Ga0207428_100181836 | 573 |
| 645 | 3300028379 | Ga0268266_10000102 | Ga0268266_1000010248 | 573 |
| 646 | 3300028380 | Ga0268265_10038301 | Ga0268265_100383011 | 573 |
| 647 | 3300028381 | Ga0268264_10009319 | Ga0268264_100093194 | 573 |
| 648 | 3300028381 | Ga0268264_10080760 | Ga0268264_100807602 | 573 |
| 649 | 3300031251 | Ga0265327_10000152 | Ga0265327_1000015254 | 573 |
| 650 | 3300031456 | Ga0307513_10075092 | Ga0307513_100750922 | 573 |
| 651 | 3300039437 | Ga0436365_0124513 | Ga0436365_0124513_1531_3267 | 573 |
| 652 | 3300042876 | Ga0451577_0024886 | Ga0451577_0024886_438_2180 | 573 |
| 653 | 3300044712 | Ga0453684_0012031 | Ga0453684_0012031_3236_4975 | 573 |
| 654 | 3300044712 | Ga0453684_0120888 | Ga0453684_0120888_784_2526 | 573 |
| 655 | 3300045051 | Ga0451576_0051039 | Ga0451576_0051039_1938_3680 | 573 |
| 656 | 3300046524 | Ga0495648_0013720 | Ga0495648_0013720_659_2416 | 573 |
| 657 | 3300047472 | Ga0495686_0007062 | Ga0495686_0007062_5022_6776 | 573 |
| 658 | 3300049705 | Ga0501225_0003642 | Ga0501225_0003642_49_1818 | 573 |
| 659 | 3300053139 | Ga0500568_0000236 | Ga0500568_0000236_37877_39631 | 573 |
| 660 | 3300053139 | Ga0500568_0024490 | Ga0500568_0024490_377_2170 | 573 |
| 661 | 3300053156 | Ga0500622_0011679 | Ga0500622_0011679_279_2036 | 573 |
| 662 | 3300053727 | Ga0500611_000006 | Ga0500611_000006_79966_81720 | 573 |
| 663 | iso_pu_bacteria | 2721755487 | 2722730760 | 573 |
| 664 | iso_pu_bacteria | 2738541273 | 2738701468 | 573 |
| 665 | iso_pu_bacteria | 2738541278 | 2738728999 | 573 |
| 666 | iso_pu_bacteria | 2738543014 | 2739255766 | 573 |
| 667 | iso_pu_bacteria | 2739367663 | 2739646716 | 573 |
| 668 | iso_pu_bacteria | 2842903701 | 2842905997 | 573 |
| 669 | iso_pu_bacteria | 2890737413 | 2890737829 | 573 |
| 670 | iso_pu_bacteria | 2896317667 | 2896319097 | 573 |
| 671 | iso_pu_bacteria | 2896344016 | 2896344530 | 573 |
| 672 | iso_pu_bacteria | 2898713307 | 2898713661 | 573 |
| 673 | iso_pu_bacteria | 2902048731 | 2902052235 | 573 |
| 674 | iso_pu_bacteria | 2904780799 | 2904783238 | 573 |
| 675 | iso_pu_bacteria | 2919177583 | 2919180846 | 573 |
| 676 | iso_pu_bacteria | 2977232053 | 2977233867 | 573 |
| 677 | iso_pu_bacteria | 2984572630 | 2984575493 | 573 |
| 678 | iso_pu_bacteria | 2984606641 | 2984608946 | 573 |
| 679 | iso_pu_bacteria | 3003233435 | 3003233852 | 573 |
| 680 | iso_pu_bacteria | 8055588893 | 8055591898 | 573 |
| 681 | 3300005289 | Ga0065704_10002965 | Ga0065704_100029653 | 574 |
| 682 | 3300005289 | Ga0065704_10070912 | Ga0065704_100709126 | 574 |
| 683 | 3300005334 | Ga0068869_100013562 | Ga0068869_1000135622 | 574 |
| 684 | 3300005334 | Ga0068869_100042601 | Ga0068869_1000426012 | 574 |
| 685 | 3300005335 | Ga0070666_10000042 | Ga0070666_1000004245 | 574 |
| 686 | 3300005339 | Ga0070660_100018476 | Ga0070660_1000184763 | 574 |
| 687 | 3300005366 | Ga0070659_100000486 | Ga0070659_1000004863 | 574 |
| 688 | 3300005366 | Ga0070659_100036128 | Ga0070659_1000361282 | 574 |
| 689 | 3300005458 | Ga0070681_10068502 | Ga0070681_100685023 | 574 |
| 690 | 3300005539 | Ga0068853_100130160 | Ga0068853_1001301601 | 574 |
| 691 | 3300005564 | Ga0070664_100039741 | Ga0070664_1000397413 | 574 |
| 692 | 3300005617 | Ga0068859_100000130 | Ga0068859_1000001307 | 574 |
| 693 | 3300005834 | Ga0068851_10036070 | Ga0068851_100360702 | 574 |
| 694 | 3300005841 | Ga0068863_100012749 | Ga0068863_1000127495 | 574 |
| 695 | 3300005842 | Ga0068858_100004507 | Ga0068858_1000045076 | 574 |
| 696 | 3300005843 | Ga0068860_100006618 | Ga0068860_1000066186 | 574 |
| 697 | 3300006358 | Ga0068871_100026533 | Ga0068871_1000265333 | 574 |
| 698 | 3300006931 | Ga0097620_100000130 | Ga0097620_10000013060 | 574 |
| 699 | 3300009101 | Ga0105247_10011487 | Ga0105247_100114873 | 574 |
| 700 | 3300009545 | Ga0105237_10013031 | Ga0105237_100130312 | 574 |
| 701 | 3300009553 | Ga0105249_10083207 | Ga0105249_100832072 | 574 |
| 702 | 3300013102 | Ga0157371_10004120 | Ga0157371_100041209 | 574 |
| 703 | 3300013104 | Ga0157370_10016651 | Ga0157370_100166513 | 574 |
| 704 | 3300013105 | Ga0157369_10018947 | Ga0157369_100189476 | 574 |
| 705 | 3300013105 | Ga0157369_10110031 | Ga0157369_101100312 | 574 |
| 706 | 3300013306 | Ga0163162_10000445 | Ga0163162_1000044531 | 574 |
| 707 | 3300013307 | Ga0157372_10000071 | Ga0157372_100000717 | 574 |
| 708 | 3300014326 | Ga0157380_10065572 | Ga0157380_100655721 | 574 |
| 709 | 3300014969 | Ga0157376_10009172 | Ga0157376_100091724 | 574 |
| 710 | 3300017792 | Ga0163161_10009128 | Ga0163161_100091283 | 574 |
| 711 | 3300025321 | Ga0207656_10019353 | Ga0207656_100193532 | 574 |
| 712 | 3300025903 | Ga0207680_10000135 | Ga0207680_1000013521 | 574 |
| 713 | 3300025904 | Ga0207647_10000280 | Ga0207647_100002806 | 574 |
| 714 | 3300025912 | Ga0207707_10058316 | Ga0207707_100583162 | 574 |
| 715 | 3300025919 | Ga0207657_10045574 | Ga0207657_100455742 | 574 |
| 716 | 3300025932 | Ga0207690_10000361 | Ga0207690_100003615 | 574 |
| 717 | 3300025942 | Ga0207689_10001157 | Ga0207689_100011572 | 574 |
| 718 | 3300025942 | Ga0207689_10001865 | Ga0207689_100018651 | 574 |
| 719 | 3300025945 | Ga0207679_10035236 | Ga0207679_100352362 | 574 |
| 720 | 3300025949 | Ga0207667_10004600 | Ga0207667_100046007 | 574 |
| 721 | 3300026035 | Ga0207703_10004858 | Ga0207703_100048586 | 574 |
| 722 | 3300026088 | Ga0207641_10000158 | Ga0207641_1000015861 | 574 |
| 723 | 3300028381 | Ga0268264_10013291 | Ga0268264_100132913 | 574 |
| 724 | 3300028786 | Ga0307517_10006124 | Ga0307517_100061249 | 574 |
| 725 | 3300031507 | Ga0307509_10103305 | Ga0307509_101033052 | 574 |
| 726 | 3300033180 | Ga0307510_10006676 | Ga0307510_1000667613 | 574 |
| 727 | 3300038443 | Ga0395901_0086074 | Ga0395901_0086074_631_2367 | 574 |
| 728 | 3300044712 | Ga0453684_0092637 | Ga0453684_0092637_805_2553 | 574 |
| 729 | 3300046453 | Ga0495627_000003 | Ga0495627_000003_56934_58673 | 574 |
| 730 | 3300046457 | Ga0495590_0004043 | Ga0495590_0004043_3903_5645 | 574 |
| 731 | 3300046513 | Ga0495616_0005202 | Ga0495616_0005202_5654_7411 | 574 |
| 732 | 3300046522 | Ga0495643_0001316 | Ga0495643_0001316_14040_15797 | 574 |
| 733 | 3300046530 | Ga0495654_0000001 | Ga0495654_0000001_1065805_1067544 | 574 |
| 734 | 3300046558 | Ga0495633_0000002 | Ga0495633_0000002_104123_105865 | 574 |
| 735 | 3300047472 | Ga0495686_0000772 | Ga0495686_0000772_25774_27528 | 574 |
| 736 | 3300047472 | Ga0495686_0009495 | Ga0495686_0009495_3337_5076 | 574 |
| 737 | iso_pu_bacteria | 2818991437 | 2819546044 | 574 |
| 738 | 3300001990 | JGI24737J22298_10004033 | JGI24737J22298_100040331 | 575 |
| 739 | 3300002067 | JGI24735J21928_10000003 | JGI24735J21928_10000003124 | 575 |
| 740 | 3300002737 | JGI25162J39368_1000123 | JGI25162J39368_100012332 | 575 |
| 741 | 3300002737 | JGI25162J39368_1000931 | JGI25162J39368_10009318 | 575 |
| 742 | 3300002772 | JGI25164J39214_1001625 | JGI25164J39214_10016252 | 575 |
| 743 | 3300003214 | JGI25165J46597_1000399 | JGI25165J46597_100039923 | 575 |
| 744 | 3300003316 | rootH1_10019188 | rootH1_100191882 | 575 |
| 745 | 3300003320 | rootH2_10024557 | rootH2_100245575 | 575 |
| 746 | 3300003322 | rootL2_10100912 | rootL2_101009121 | 575 |
| 747 | 3300003323 | rootH1_10003494 | rootH1_100034944 | 575 |
| 748 | 3300003323 | rootH1_10007401 | rootH1_1000740115 | 575 |
| 749 | 3300003794 | Ga0055531_10000139 | Ga0055531_1000013972 | 575 |
| 750 | 3300005328 | Ga0070676_10004504 | Ga0070676_100045047 | 575 |
| 751 | 3300005329 | Ga0070683_100003447 | Ga0070683_1000034472 | 575 |
| 752 | 3300005329 | Ga0070683_100147280 | Ga0070683_1001472801 | 575 |
| 753 | 3300005334 | Ga0068869_100003787 | Ga0068869_1000037873 | 575 |
| 754 | 3300005335 | Ga0070666_10023903 | Ga0070666_100239032 | 575 |
| 755 | 3300005336 | Ga0070680_100000323 | Ga0070680_1000003238 | 575 |
| 756 | 3300005338 | Ga0068868_100013211 | Ga0068868_1000132112 | 575 |
| 757 | 3300005344 | Ga0070661_100002466 | Ga0070661_1000024669 | 575 |
| 758 | 3300005344 | Ga0070661_100003469 | Ga0070661_1000034699 | 575 |
| 759 | 3300005354 | Ga0070675_100013806 | Ga0070675_1000138062 | 575 |
| 760 | 3300005355 | Ga0070671_100042034 | Ga0070671_1000420342 | 575 |
| 761 | 3300005367 | Ga0070667_100023268 | Ga0070667_1000232682 | 575 |
| 762 | 3300005367 | Ga0070667_100062831 | Ga0070667_1000628313 | 575 |
| 763 | 3300005455 | Ga0070663_100001316 | Ga0070663_10000131611 | 575 |
| 764 | 3300005456 | Ga0070678_100008016 | Ga0070678_1000080162 | 575 |
| 765 | 3300005457 | Ga0070662_100071153 | Ga0070662_1000711532 | 575 |
| 766 | 3300005458 | Ga0070681_10039612 | Ga0070681_100396122 | 575 |
| 767 | 3300005530 | Ga0070679_100000397 | Ga0070679_10000039712 | 575 |
| 768 | 3300005535 | Ga0070684_100000172 | Ga0070684_10000017215 | 575 |
| 769 | 3300005535 | Ga0070684_100035442 | Ga0070684_1000354425 | 575 |
| 770 | 3300005539 | Ga0068853_100004535 | Ga0068853_1000045358 | 575 |
| 771 | 3300005547 | Ga0070693_100003549 | Ga0070693_1000035497 | 575 |
| 772 | 3300005563 | Ga0068855_100008545 | Ga0068855_1000085452 | 575 |
| 773 | 3300005563 | Ga0068855_100011078 | Ga0068855_1000110782 | 575 |
| 774 | 3300005564 | Ga0070664_100001323 | Ga0070664_1000013234 | 575 |
| 775 | 3300005564 | Ga0070664_100131548 | Ga0070664_1001315482 | 575 |
| 776 | 3300005577 | Ga0068857_100005435 | Ga0068857_1000054357 | 575 |
| 777 | 3300005578 | Ga0068854_100088051 | Ga0068854_1000880512 | 575 |
| 778 | 3300005614 | Ga0068856_100022607 | Ga0068856_1000226072 | 575 |
| 779 | 3300005616 | Ga0068852_100065148 | Ga0068852_1000651482 | 575 |
| 780 | 3300005842 | Ga0068858_100015037 | Ga0068858_1000150376 | 575 |
| 781 | 3300005843 | Ga0068860_100001122 | Ga0068860_1000011225 | 575 |
| 782 | 3300006195 | Ga0075366_10000234 | Ga0075366_1000023412 | 575 |
| 783 | 3300006195 | Ga0075366_10049783 | Ga0075366_100497832 | 575 |
| 784 | 3300006237 | Ga0097621_100000027 | Ga0097621_10000002737 | 575 |
| 785 | 3300006237 | Ga0097621_100039988 | Ga0097621_1000399882 | 575 |
| 786 | 3300006358 | Ga0068871_100000338 | Ga0068871_10000033819 | 575 |
| 787 | 3300009093 | Ga0105240_10072040 | Ga0105240_100720402 | 575 |
| 788 | 3300009101 | Ga0105247_10075280 | Ga0105247_100752801 | 575 |
| 789 | 3300009147 | Ga0114129_10006547 | Ga0114129_100065478 | 575 |
| 790 | 3300009148 | Ga0105243_10000003 | Ga0105243_10000003382 | 575 |
| 791 | 3300009174 | Ga0105241_10000105 | Ga0105241_1000010531 | 575 |
| 792 | 3300009174 | Ga0105241_10002088 | Ga0105241_100020882 | 575 |
| 793 | 3300009174 | Ga0105241_10149235 | Ga0105241_101492352 | 575 |
| 794 | 3300009176 | Ga0105242_10042190 | Ga0105242_100421902 | 575 |
| 795 | 3300009177 | Ga0105248_10018861 | Ga0105248_100188612 | 575 |
| 796 | 3300009545 | Ga0105237_10001172 | Ga0105237_1000117218 | 575 |
| 797 | 3300009545 | Ga0105237_10048644 | Ga0105237_100486443 | 575 |
| 798 | 3300009553 | Ga0105249_10126995 | Ga0105249_101269952 | 575 |
| 799 | 3300010375 | Ga0105239_10000015 | Ga0105239_10000015252 | 575 |
| 800 | 3300010375 | Ga0105239_10000045 | Ga0105239_10000045136 | 575 |
| 801 | 3300010375 | Ga0105239_10089158 | Ga0105239_100891583 | 575 |
| 802 | 3300010375 | Ga0105239_10096422 | Ga0105239_100964223 | 575 |
| 803 | 3300013100 | Ga0157373_10000990 | Ga0157373_100009902 | 575 |
| 804 | 3300013100 | Ga0157373_10007645 | Ga0157373_100076455 | 575 |
| 805 | 3300013102 | Ga0157371_10001756 | Ga0157371_100017567 | 575 |
| 806 | 3300013102 | Ga0157371_10012771 | Ga0157371_100127713 | 575 |
| 807 | 3300013102 | Ga0157371_10013704 | Ga0157371_100137043 | 575 |
| 808 | 3300013102 | Ga0157371_10015504 | Ga0157371_100155046 | 575 |
| 809 | 3300013102 | Ga0157371_10053757 | Ga0157371_100537572 | 575 |
| 810 | 3300013105 | Ga0157369_10003069 | Ga0157369_1000306913 | 575 |
| 811 | 3300013296 | Ga0157374_10000001 | Ga0157374_10000001494 | 575 |
| 812 | 3300013296 | Ga0157374_10016264 | Ga0157374_100162644 | 575 |
| 813 | 3300013306 | Ga0163162_10000437 | Ga0163162_100004378 | 575 |
| 814 | 3300013306 | Ga0163162_10000699 | Ga0163162_1000069913 | 575 |
| 815 | 3300013306 | Ga0163162_10006527 | Ga0163162_100065272 | 575 |
| 816 | 3300013306 | Ga0163162_10019461 | Ga0163162_100194616 | 575 |
| 817 | 3300013306 | Ga0163162_10024561 | Ga0163162_100245615 | 575 |
| 818 | 3300013306 | Ga0163162_10026678 | Ga0163162_100266784 | 575 |
| 819 | 3300013306 | Ga0163162_10037865 | Ga0163162_100378652 | 575 |
| 820 | 3300013307 | Ga0157372_10000026 | Ga0157372_10000026136 | 575 |
| 821 | 3300013307 | Ga0157372_10000514 | Ga0157372_1000051433 | 575 |
| 822 | 3300013307 | Ga0157372_10006860 | Ga0157372_100068603 | 575 |
| 823 | 3300013307 | Ga0157372_10072039 | Ga0157372_100720393 | 575 |
| 824 | 3300013308 | Ga0157375_10003798 | Ga0157375_100037985 | 575 |
| 825 | 3300013308 | Ga0157375_10105930 | Ga0157375_101059302 | 575 |
| 826 | 3300014325 | Ga0163163_10000193 | Ga0163163_1000019312 | 575 |
| 827 | 3300014968 | Ga0157379_10038151 | Ga0157379_100381512 | 575 |
| 828 | 3300014968 | Ga0157379_10100003 | Ga0157379_101000032 | 575 |
| 829 | 3300014969 | Ga0157376_10000808 | Ga0157376_100008089 | 575 |
| 830 | 3300014969 | Ga0157376_10027846 | Ga0157376_100278462 | 575 |
| 831 | 3300014969 | Ga0157376_10109907 | Ga0157376_101099071 | 575 |
| 832 | 3300014969 | Ga0157376_10119911 | Ga0157376_101199112 | 575 |
| 833 | 3300017792 | Ga0163161_10004913 | Ga0163161_100049135 | 575 |
| 834 | 3300017792 | Ga0163161_10018046 | Ga0163161_100180463 | 575 |
| 835 | 3300020077 | Ga0206351_10906282 | Ga0206351_109062823 | 575 |
| 836 | 3300025231 | Ga0207427_100072 | Ga0207427_100072116 | 575 |
| 837 | 3300025233 | Ga0209437_100026 | Ga0209437_100026226 | 575 |
| 838 | 3300025233 | Ga0209437_100251 | Ga0209437_10025129 | 575 |
| 839 | 3300025250 | Ga0209026_1000633 | Ga0209026_10006332 | 575 |
| 840 | 3300025261 | Ga0209233_1000111 | Ga0209233_1000111120 | 575 |
| 841 | 3300025304 | Ga0209257_1000025 | Ga0209257_100002577 | 575 |
| 842 | 3300025907 | Ga0207645_10063460 | Ga0207645_100634602 | 575 |
| 843 | 3300025909 | Ga0207705_10006335 | Ga0207705_100063354 | 575 |
| 844 | 3300025912 | Ga0207707_10000205 | Ga0207707_1000020522 | 575 |
| 845 | 3300025913 | Ga0207695_10003840 | Ga0207695_100038408 | 575 |
| 846 | 3300025913 | Ga0207695_10033370 | Ga0207695_100333704 | 575 |
| 847 | 3300025914 | Ga0207671_10003343 | Ga0207671_100033435 | 575 |
| 848 | 3300025914 | Ga0207671_10007556 | Ga0207671_100075563 | 575 |
| 849 | 3300025914 | Ga0207671_10064837 | Ga0207671_100648371 | 575 |
| 850 | 3300025917 | Ga0207660_10000843 | Ga0207660_1000084313 | 575 |
| 851 | 3300025917 | Ga0207660_10009061 | Ga0207660_100090617 | 575 |
| 852 | 3300025920 | Ga0207649_10011811 | Ga0207649_100118113 | 575 |
| 853 | 3300025921 | Ga0207652_10000186 | Ga0207652_1000018645 | 575 |
| 854 | 3300025921 | Ga0207652_10000967 | Ga0207652_100009679 | 575 |
| 855 | 3300025924 | Ga0207694_10011944 | Ga0207694_100119443 | 575 |
| 856 | 3300025924 | Ga0207694_10045907 | Ga0207694_100459072 | 575 |
| 857 | 3300025926 | Ga0207659_10075500 | Ga0207659_100755002 | 575 |
| 858 | 3300025933 | Ga0207706_10002722 | Ga0207706_100027229 | 575 |
| 859 | 3300025933 | Ga0207706_10014390 | Ga0207706_100143902 | 575 |
| 860 | 3300025933 | Ga0207706_10099925 | Ga0207706_100999251 | 575 |
| 861 | 3300025934 | Ga0207686_10033120 | Ga0207686_100331202 | 575 |
| 862 | 3300025935 | Ga0207709_10000008 | Ga0207709_10000008192 | 575 |
| 863 | 3300025941 | Ga0207711_10016320 | Ga0207711_100163202 | 575 |
| 864 | 3300025942 | Ga0207689_10003632 | Ga0207689_100036326 | 575 |
| 865 | 3300025944 | Ga0207661_10004721 | Ga0207661_100047216 | 575 |
| 866 | 3300025944 | Ga0207661_10083211 | Ga0207661_100832112 | 575 |
| 867 | 3300025945 | Ga0207679_10003237 | Ga0207679_100032378 | 575 |
| 868 | 3300025949 | Ga0207667_10000218 | Ga0207667_1000021829 | 575 |
| 869 | 3300025949 | Ga0207667_10000549 | Ga0207667_1000054917 | 575 |
| 870 | 3300025949 | Ga0207667_10037487 | Ga0207667_100374874 | 575 |
| 871 | 3300025949 | Ga0207667_10060470 | Ga0207667_100604703 | 575 |
| 872 | 3300025960 | Ga0207651_10027303 | Ga0207651_100273031 | 575 |
| 873 | 3300025986 | Ga0207658_10013024 | Ga0207658_100130244 | 575 |
| 874 | 3300026023 | Ga0207677_10060048 | Ga0207677_100600482 | 575 |
| 875 | 3300026035 | Ga0207703_10038402 | Ga0207703_100384022 | 575 |
| 876 | 3300026041 | Ga0207639_10002247 | Ga0207639_100022479 | 575 |
| 877 | 3300026067 | Ga0207678_10025327 | Ga0207678_100253273 | 575 |
| 878 | 3300026078 | Ga0207702_10005834 | Ga0207702_100058347 | 575 |
| 879 | 3300026089 | Ga0207648_10015000 | Ga0207648_100150005 | 575 |
| 880 | 3300026089 | Ga0207648_10059941 | Ga0207648_100599412 | 575 |
| 881 | 3300026089 | Ga0207648_10101376 | Ga0207648_101013762 | 575 |
| 882 | 3300026116 | Ga0207674_10026118 | Ga0207674_100261182 | 575 |
| 883 | 3300026121 | Ga0207683_10004166 | Ga0207683_100041668 | 575 |
| 884 | 3300026142 | Ga0207698_10076880 | Ga0207698_100768802 | 575 |
| 885 | 3300026142 | Ga0207698_10086515 | Ga0207698_100865151 | 575 |
| 886 | 3300028381 | Ga0268264_10001678 | Ga0268264_100016785 | 575 |
| 887 | 3300028794 | Ga0307515_10002716 | Ga0307515_1000271621 | 575 |
| 888 | 3300028794 | Ga0307515_10016696 | Ga0307515_100166963 | 575 |
| 889 | 3300030521 | Ga0307511_10000673 | Ga0307511_100006739 | 575 |
| 890 | 3300030731 | Ga0316177_1067390 | Ga0316177_10673905 | 575 |
| 891 | 3300030732 | Ga0316176_1102439 | Ga0316176_11024395 | 575 |
| 892 | 3300030742 | Ga0316183_1003610 | Ga0316183_100361017 | 575 |
| 893 | 3300030744 | Ga0316181_1144023 | Ga0316181_11440237 | 575 |
| 894 | 3300035172 | Ga0373955_0023593 | Ga0373955_0023593_495_2273 | 575 |
| 895 | 3300035410 | Ga0373924_0036055 | Ga0373924_0036055_131_1909 | 575 |
| 896 | 3300035724 | Ga0373933_0049108 | Ga0373933_0049108_601_2379 | 575 |
| 897 | 3300037312 | Ga0395899_0000055 | Ga0395899_0000055_88284_90020 | 575 |
| 898 | 3300037312 | Ga0395899_0010495 | Ga0395899_0010495_1374_3113 | 575 |
| 899 | 3300042014 | Ga0439457_000620 | Ga0439457_000620_4126_5937 | 575 |
| 900 | 3300044658 | Ga0466972_0000095 | Ga0466972_0000095_70686_72431 | 575 |
| 901 | 3300046471 | Ga0495650_0000107 | Ga0495650_0000107_115783_117519 | 575 |
| 902 | 3300046471 | Ga0495650_0030127 | Ga0495650_0030127_453_2189 | 575 |
| 903 | 3300046472 | Ga0495580_0062746 | Ga0495580_0062746_810_2552 | 575 |
| 904 | 3300046492 | Ga0495585_0000014 | Ga0495585_0000014_25433_27169 | 575 |
| 905 | 3300046507 | Ga0495606_0000303 | Ga0495606_0000303_67886_69622 | 575 |
| 906 | 3300046507 | Ga0495606_0019559 | Ga0495606_0019559_996_2735 | 575 |
| 907 | 3300046512 | Ga0495610_0003739 | Ga0495610_0003739_1284_3020 | 575 |
| 908 | 3300046513 | Ga0495616_0011517 | Ga0495616_0011517_2211_3947 | 575 |
| 909 | 3300046517 | Ga0495630_0052405 | Ga0495630_0052405_453_2195 | 575 |
| 910 | 3300046558 | Ga0495633_0000021 | Ga0495633_0000021_10786_12525 | 575 |
| 911 | 3300046558 | Ga0495633_0013940 | Ga0495633_0013940_1070_2806 | 575 |
| 912 | 3300046642 | Ga0495634_0014817 | Ga0495634_0014817_3747_5525 | 575 |
| 913 | 3300046660 | Ga0495625_0000021 | Ga0495625_0000021_108004_109740 | 575 |
| 914 | 3300046660 | Ga0495625_0006168 | Ga0495625_0006168_6601_8337 | 575 |
| 915 | 3300046665 | Ga0495661_0002333 | Ga0495661_0002333_11400_13136 | 575 |
| 916 | 3300046665 | Ga0495661_0008530 | Ga0495661_0008530_944_2680 | 575 |
| 917 | 3300046683 | Ga0495658_0009737 | Ga0495658_0009737_198_1940 | 575 |
| 918 | 3300046694 | Ga0495649_0000009 | Ga0495649_0000009_349787_351523 | 575 |
| 919 | 3300046810 | Ga0495660_0009017 | Ga0495660_0009017_86_1822 | 575 |
| 920 | 3300047319 | Ga0495674_0076464 | Ga0495674_0076464_990_2732 | 575 |
| 921 | 3300047443 | Ga0495687_000586 | Ga0495687_000586_28579_30315 | 575 |
| 922 | 3300047469 | Ga0495673_0011664 | Ga0495673_0011664_85_1821 | 575 |
| 923 | 3300047471 | Ga0495684_0120639 | Ga0495684_0120639_203_1945 | 575 |
| 924 | 3300047472 | Ga0495686_0001407 | Ga0495686_0001407_18546_20282 | 575 |
| 925 | 3300048904 | Ga0496101_0012662 | Ga0496101_0012662_334_2109 | 575 |
| 926 | 3300048919 | Ga0496116_0024733 | Ga0496116_0024733_2339_4081 | 575 |
| 927 | 3300048920 | Ga0496117_0004347 | Ga0496117_0004347_10133_11875 | 575 |
| 928 | 3300048921 | Ga0496118_0022333 | Ga0496118_0022333_1639_3381 | 575 |
| 929 | 3300048925 | Ga0496122_0025946 | Ga0496122_0025946_2031_3773 | 575 |
| 930 | 3300048926 | Ga0496123_0033074 | Ga0496123_0033074_1735_3477 | 575 |
| 931 | 3300049459 | Ga0495678_002150 | Ga0495678_002150_1237_2973 | 575 |
| 932 | 3300049571 | Ga0501034_0009300 | Ga0501034_0009300_741_2504 | 575 |
| 933 | 3300049571 | Ga0501034_0038864 | Ga0501034_0038864_437_2179 | 575 |
| 934 | 3300049580 | Ga0501046_0116134 | Ga0501046_0116134_239_1981 | 575 |
| 935 | 3300049581 | Ga0501047_0032779 | Ga0501047_0032779_1580_3325 | 575 |
| 936 | 3300049581 | Ga0501047_0042741 | Ga0501047_0042741_226_1989 | 575 |
| 937 | 3300049582 | Ga0501048_0010094 | Ga0501048_0010094_4162_5904 | 575 |
| 938 | 3300049582 | Ga0501048_0030544 | Ga0501048_0030544_1008_2771 | 575 |
| 939 | 3300049583 | Ga0501067_0014825 | Ga0501067_0014825_264_2006 | 575 |
| 940 | 3300049586 | Ga0501070_0032613 | Ga0501070_0032613_982_2724 | 575 |
| 941 | 3300049589 | Ga0501073_0013211 | Ga0501073_0013211_1325_3088 | 575 |
| 942 | 3300049589 | Ga0501073_0087081 | Ga0501073_0087081_319_2061 | 575 |
| 943 | 3300049742 | Ga0501080_0083240 | Ga0501080_0083240_1152_2915 | 575 |
| 944 | 3300049823 | Ga0501044_0009540 | Ga0501044_0009540_7696_9441 | 575 |
| 945 | 3300049823 | Ga0501044_0019651 | Ga0501044_0019651_2876_4618 | 575 |
| 946 | 3300050493 | nmdc:mga0k408_32055_c1 | nmdc:mga0k408_32055_c1_320_2065 | 575 |
| 947 | 3300050493 | nmdc:mga0k408_372_c1 | nmdc:mga0k408_372_c1_12874_14613 | 575 |
| 948 | 3300053080 | Ga0500635_0004277 | Ga0500635_0004277_607_2346 | 575 |
| 949 | 3300053088 | Ga0500644_0021667 | Ga0500644_0021667_82_1827 | 575 |
| 950 | 3300053125 | Ga0500618_006010 | Ga0500618_006010_516_2252 | 575 |
| 951 | 3300060353 | Ga0501082_0026906 | Ga0501082_0026906_3202_4944 | 575 |
| 952 | iso_pu_bacteria | 2585427687 | 2586208658 | 575 |
| 953 | iso_pu_bacteria | 2738541283 | 2738756903 | 575 |
| 954 | iso_pu_bacteria | 2738541284 | 2738760158 | 575 |
| 955 | iso_pu_bacteria | 2738541302 | 2738856606 | 575 |
| 956 | iso_pu_bacteria | 2739367651 | 2739588144 | 575 |
| 957 | iso_pu_bacteria | 2739367656 | 2739616241 | 575 |
| 958 | iso_pu_bacteria | 2775506987 | 2776612140 | 575 |
| 959 | iso_pu_bacteria | 2842722452 | 2842724058 | 575 |
| 960 | iso_pu_bacteria | 2842909656 | 2842912210 | 575 |
| 961 | iso_pu_bacteria | 2849281842 | 2849286949 | 575 |
| 962 | iso_pu_bacteria | 2852627209 | 2852631197 | 575 |
| 963 | iso_pu_bacteria | 2857627736 | 2857631345 | 575 |
| 964 | iso_pu_bacteria | 2895498888 | 2895500259 | 575 |
| 965 | iso_pu_bacteria | 2904445276 | 2904446307 | 575 |
| 966 | iso_pu_bacteria | 2919186247 | 2919191466 | 575 |
| 967 | iso_pu_bacteria | 2939664404 | 2939669615 | 575 |
| 968 | iso_pu_bacteria | 2945997725 | 2945999131 | 575 |
| 969 | iso_pu_bacteria | 2954016120 | 2954021582 | 575 |
| 970 | 3300003781 | Ga0055536_1000004 | Ga0055536_1000004310 | 576 |
| 971 | 3300003791 | Ga0055530_10001535 | Ga0055530_100015355 | 576 |
| 972 | 3300005288 | Ga0065714_10002421 | Ga0065714_1000242111 | 576 |
| 973 | 3300005288 | Ga0065714_10067466 | Ga0065714_100674663 | 576 |
| 974 | 3300005327 | Ga0070658_10009107 | Ga0070658_100091073 | 576 |
| 975 | 3300005327 | Ga0070658_10103514 | Ga0070658_101035141 | 576 |
| 976 | 3300005331 | Ga0070670_100047585 | Ga0070670_1000475852 | 576 |
| 977 | 3300005331 | Ga0070670_100074309 | Ga0070670_1000743092 | 576 |
| 978 | 3300005334 | Ga0068869_100065305 | Ga0068869_1000653052 | 576 |
| 979 | 3300005339 | Ga0070660_100006797 | Ga0070660_1000067976 | 576 |
| 980 | 3300005339 | Ga0070660_100027413 | Ga0070660_1000274134 | 576 |
| 981 | 3300005354 | Ga0070675_100007608 | Ga0070675_1000076085 | 576 |
| 982 | 3300005366 | Ga0070659_100027708 | Ga0070659_1000277082 | 576 |
| 983 | 3300005530 | Ga0070679_100000880 | Ga0070679_1000008802 | 576 |
| 984 | 3300005530 | Ga0070679_100042733 | Ga0070679_1000427334 | 576 |
| 985 | 3300005535 | Ga0070684_100044547 | Ga0070684_1000445474 | 576 |
| 986 | 3300005563 | Ga0068855_100000139 | Ga0068855_10000013967 | 576 |
| 987 | 3300005563 | Ga0068855_100004391 | Ga0068855_1000043912 | 576 |
| 988 | 3300005563 | Ga0068855_100011554 | Ga0068855_1000115545 | 576 |
| 989 | 3300005577 | Ga0068857_100000719 | Ga0068857_1000007198 | 576 |
| 990 | 3300005577 | Ga0068857_100081050 | Ga0068857_1000810502 | 576 |
| 991 | 3300005578 | Ga0068854_100018287 | Ga0068854_1000182872 | 576 |
| 992 | 3300005614 | Ga0068856_100000118 | Ga0068856_10000011844 | 576 |
| 993 | 3300005614 | Ga0068856_100032875 | Ga0068856_1000328754 | 576 |
| 994 | 3300005616 | Ga0068852_100002172 | Ga0068852_1000021726 | 576 |
| 995 | 3300005843 | Ga0068860_100000241 | Ga0068860_10000024112 | 576 |
| 996 | 3300005843 | Ga0068860_100019411 | Ga0068860_1000194115 | 576 |
| 997 | 3300005843 | Ga0068860_100026735 | Ga0068860_1000267352 | 576 |
| 998 | 3300005844 | Ga0068862_100010218 | Ga0068862_1000102182 | 576 |
| 999 | 3300006847 | Ga0075431_100000860 | Ga0075431_1000008606 | 576 |
| 1000 | 3300006931 | Ga0097620_100009741 | Ga0097620_1000097417 | 576 |
| 1001 | 3300009093 | Ga0105240_10017211 | Ga0105240_100172117 | 576 |
| 1002 | 3300009093 | Ga0105240_10040050 | Ga0105240_100400502 | 576 |
| 1003 | 3300009147 | Ga0114129_10017693 | Ga0114129_100176935 | 576 |
| 1004 | 3300009174 | Ga0105241_10014095 | Ga0105241_100140955 | 576 |
| 1005 | 3300009545 | Ga0105237_10000247 | Ga0105237_1000024753 | 576 |
| 1006 | 3300009545 | Ga0105237_10023685 | Ga0105237_100236853 | 576 |
| 1007 | 3300010375 | Ga0105239_10000169 | Ga0105239_1000016927 | 576 |
| 1008 | 3300013100 | Ga0157373_10008001 | Ga0157373_100080012 | 576 |
| 1009 | 3300013100 | Ga0157373_10044213 | Ga0157373_100442132 | 576 |
| 1010 | 3300013104 | Ga0157370_10006253 | Ga0157370_100062538 | 576 |
| 1011 | 3300013104 | Ga0157370_10013165 | Ga0157370_100131658 | 576 |
| 1012 | 3300013104 | Ga0157370_10020699 | Ga0157370_100206995 | 576 |
| 1013 | 3300013104 | Ga0157370_10027089 | Ga0157370_100270895 | 576 |
| 1014 | 3300013307 | Ga0157372_10001013 | Ga0157372_100010138 | 576 |
| 1015 | 3300015682 | Ga0183373_1004 | Ga0183373_1004252 | 576 |
| 1016 | 3300025292 | Ga0209676_1000009 | Ga0209676_1000009245 | 576 |
| 1017 | 3300025298 | Ga0209050_1000048 | Ga0209050_100004840 | 576 |
| 1018 | 3300025904 | Ga0207647_10007727 | Ga0207647_100077276 | 576 |
| 1019 | 3300025913 | Ga0207695_10005627 | Ga0207695_1000562712 | 576 |
| 1020 | 3300025913 | Ga0207695_10023123 | Ga0207695_100231234 | 576 |
| 1021 | 3300025914 | Ga0207671_10000441 | Ga0207671_100004415 | 576 |
| 1022 | 3300025914 | Ga0207671_10008216 | Ga0207671_100082164 | 576 |
| 1023 | 3300025919 | Ga0207657_10041978 | Ga0207657_100419781 | 576 |
| 1024 | 3300025919 | Ga0207657_10081451 | Ga0207657_100814512 | 576 |
| 1025 | 3300025921 | Ga0207652_10000064 | Ga0207652_1000006430 | 576 |
| 1026 | 3300025921 | Ga0207652_10053242 | Ga0207652_100532423 | 576 |
| 1027 | 3300025949 | Ga0207667_10000033 | Ga0207667_1000003365 | 576 |
| 1028 | 3300025949 | Ga0207667_10001284 | Ga0207667_100012848 | 576 |
| 1029 | 3300025949 | Ga0207667_10021551 | Ga0207667_100215513 | 576 |
| 1030 | 3300025981 | Ga0207640_10017605 | Ga0207640_100176053 | 576 |
| 1031 | 3300025986 | Ga0207658_10054583 | Ga0207658_100545831 | 576 |
| 1032 | 3300026078 | Ga0207702_10000194 | Ga0207702_1000019410 | 576 |
| 1033 | 3300026078 | Ga0207702_10059674 | Ga0207702_100596742 | 576 |
| 1034 | 3300026116 | Ga0207674_10001723 | Ga0207674_1000172315 | 576 |
| 1035 | 3300026116 | Ga0207674_10078689 | Ga0207674_100786892 | 576 |
| 1036 | 3300026142 | Ga0207698_10005000 | Ga0207698_100050004 | 576 |
| 1037 | 3300028381 | Ga0268264_10000011 | Ga0268264_10000011420 | 576 |
| 1038 | 3300028381 | Ga0268264_10011706 | Ga0268264_100117062 | 576 |
| 1039 | 3300028786 | Ga0307517_10047742 | Ga0307517_100477422 | 576 |
| 1040 | 3300028794 | Ga0307515_10000074 | Ga0307515_10000074151 | 576 |
| 1041 | 3300028794 | Ga0307515_10029646 | Ga0307515_100296464 | 576 |
| 1042 | 3300031548 | Ga0307408_100000143 | Ga0307408_10000014341 | 576 |
| 1043 | 3300037312 | Ga0395899_0009107 | Ga0395899_0009107_5094_6836 | 576 |
| 1044 | 3300037312 | Ga0395899_0011086 | Ga0395899_0011086_4625_6367 | 576 |
| 1045 | 3300037312 | Ga0395899_0028035 | Ga0395899_0028035_2109_3848 | 576 |
| 1046 | 3300037418 | Ga0395900_0000541 | Ga0395900_0000541_11663_13411 | 576 |
| 1047 | 3300037418 | Ga0395900_0007879 | Ga0395900_0007879_7187_8929 | 576 |
| 1048 | 3300037418 | Ga0395900_0013989 | Ga0395900_0013989_1671_3413 | 576 |
| 1049 | 3300037418 | Ga0395900_0045279 | Ga0395900_0045279_403_2142 | 576 |
| 1050 | 3300037466 | Ga0395898_0002029 | Ga0395898_0002029_9771_11513 | 576 |
| 1051 | 3300037466 | Ga0395898_0011571 | Ga0395898_0011571_525_2267 | 576 |
| 1052 | 3300037471 | Ga0395905_0002917 | Ga0395905_0002917_11122_12861 | 576 |
| 1053 | 3300037471 | Ga0395905_0053430 | Ga0395905_0053430_1251_2996 | 576 |
| 1054 | 3300038443 | Ga0395901_0003913 | Ga0395901_0003913_11193_12932 | 576 |
| 1055 | 3300038443 | Ga0395901_0068624 | Ga0395901_0068624_860_2602 | 576 |
| 1056 | 3300044656 | Ga0466969_0000778 | Ga0466969_0000778_4548_6320 | 576 |
| 1057 | 3300044693 | Ga0466961_0004336 | Ga0466961_0004336_4379_6151 | 576 |
| 1058 | 3300045049 | Ga0466959_0000125 | Ga0466959_0000125_36756_38528 | 576 |
| 1059 | 3300045049 | Ga0466959_0102215 | Ga0466959_0102215_21_1793 | 576 |
| 1060 | 3300046512 | Ga0495610_0000967 | Ga0495610_0000967_7108_8856 | 576 |
| 1061 | 3300047443 | Ga0495687_000001 | Ga0495687_000001_855029_856825 | 576 |
| 1062 | 3300049570 | Ga0501033_0086365 | Ga0501033_0086365_144_1889 | 576 |
| 1063 | 3300049571 | Ga0501034_0023079 | Ga0501034_0023079_1221_2966 | 576 |
| 1064 | 3300049571 | Ga0501034_0025486 | Ga0501034_0025486_3841_5586 | 576 |
| 1065 | 3300049586 | Ga0501070_0030975 | Ga0501070_0030975_2212_3957 | 576 |
| 1066 | 3300049664 | Ga0501224_002098 | Ga0501224_002098_746_2656 | 576 |
| 1067 | 3300049688 | Ga0501259_000442 | Ga0501259_000442_4515_6425 | 576 |
| 1068 | 3300049822 | Ga0501035_0050648 | Ga0501035_0050648_1086_2831 | 576 |
| 1069 | 3300050510 | nmdc:mga06r32_8029_c1 | nmdc:mga06r32_8029_c1_803_2551 | 576 |
| 1070 | iso_pu_bacteria | 2852623160 | 2852625216 | 576 |
| 1071 | iso_pu_bacteria | 2884933994 | 2884934229 | 576 |
| 1072 | 3300002774 | JGI25150J39212_1000001 | JGI25150J39212_1000001101 | 577 |
| 1073 | 3300003187 | JGI25151J46595_10000001 | JGI25151J46595_10000001692 | 577 |
| 1074 | 3300003215 | JGI25153J46596_10000001 | JGI25153J46596_10000001581 | 577 |
| 1075 | 3300005288 | Ga0065714_10006014 | Ga0065714_100060148 | 577 |
| 1076 | 3300005327 | Ga0070658_10000160 | Ga0070658_1000016040 | 577 |
| 1077 | 3300005563 | Ga0068855_100049584 | Ga0068855_1000495844 | 577 |
| 1078 | 3300013100 | Ga0157373_10057711 | Ga0157373_100577113 | 577 |
| 1079 | 3300013102 | Ga0157371_10000074 | Ga0157371_1000007427 | 577 |
| 1080 | 3300013102 | Ga0157371_10013976 | Ga0157371_100139762 | 577 |
| 1081 | 3300013104 | Ga0157370_10001419 | Ga0157370_100014196 | 577 |
| 1082 | 3300013105 | Ga0157369_10000016 | Ga0157369_100000169 | 577 |
| 1083 | 3300013297 | Ga0157378_10026271 | Ga0157378_100262713 | 577 |
| 1084 | 3300013308 | Ga0157375_10111743 | Ga0157375_101117432 | 577 |
| 1085 | 3300014497 | Ga0182008_10001858 | Ga0182008_100018589 | 577 |
| 1086 | 3300015261 | Ga0182006_1001293 | Ga0182006_10012939 | 577 |
| 1087 | 3300015262 | Ga0182007_10000002 | Ga0182007_10000002212 | 577 |
| 1088 | 3300017792 | Ga0163161_10000545 | Ga0163161_1000054526 | 577 |
| 1089 | 3300017792 | Ga0163161_10004401 | Ga0163161_100044015 | 577 |
| 1090 | 3300025245 | Ga0207425_1000002 | Ga0207425_10000021057 | 577 |
| 1091 | 3300025258 | Ga0209129_1000002 | Ga0209129_10000021057 | 577 |
| 1092 | 3300025294 | Ga0209025_1000004 | Ga0209025_1000004135 | 577 |
| 1093 | 3300025297 | Ga0209758_1000006 | Ga0209758_1000006135 | 577 |
| 1094 | 3300025909 | Ga0207705_10000210 | Ga0207705_1000021040 | 577 |
| 1095 | 3300025949 | Ga0207667_10064852 | Ga0207667_100648522 | 577 |
| 1096 | 3300031731 | Ga0307405_10000006 | Ga0307405_10000006287 | 577 |
| 1097 | 3300031903 | Ga0307407_10000031 | Ga0307407_1000003174 | 577 |
| 1098 | 3300031995 | Ga0307409_100023026 | Ga0307409_1000230264 | 577 |
| 1099 | 3300032002 | Ga0307416_100000002 | Ga0307416_100000002195 | 577 |
| 1100 | 3300046507 | Ga0495606_0019848 | Ga0495606_0019848_1753_3501 | 577 |
| 1101 | 3300046520 | Ga0495637_0004191 | Ga0495637_0004191_3279_5069 | 577 |
| 1102 | 3300005364 | Ga0070673_100049315 | Ga0070673_1000493152 | 578 |
| 1103 | 3300005366 | Ga0070659_100056061 | Ga0070659_1000560612 | 578 |
| 1104 | 3300005457 | Ga0070662_100000013 | Ga0070662_10000001366 | 578 |
| 1105 | 3300005543 | Ga0070672_100045119 | Ga0070672_1000451192 | 578 |
| 1106 | 3300009093 | Ga0105240_10001477 | Ga0105240_100014779 | 578 |
| 1107 | 3300009174 | Ga0105241_10004581 | Ga0105241_100045814 | 578 |
| 1108 | 3300009545 | Ga0105237_10148523 | Ga0105237_101485232 | 578 |
| 1109 | 3300013296 | Ga0157374_10007387 | Ga0157374_100073877 | 578 |
| 1110 | 3300013307 | Ga0157372_10115472 | Ga0157372_101154723 | 578 |
| 1111 | 3300025904 | Ga0207647_10000044 | Ga0207647_1000004467 | 578 |
| 1112 | 3300025913 | Ga0207695_10003319 | Ga0207695_1000331914 | 578 |
| 1113 | 3300025919 | Ga0207657_10047164 | Ga0207657_100471642 | 578 |
| 1114 | 3300025926 | Ga0207659_10046657 | Ga0207659_100466572 | 578 |
| 1115 | 3300025932 | Ga0207690_10049287 | Ga0207690_100492872 | 578 |
| 1116 | 3300025933 | Ga0207706_10007721 | Ga0207706_100077219 | 578 |
| 1117 | 3300025940 | Ga0207691_10007147 | Ga0207691_100071473 | 578 |
| 1118 | 3300025960 | Ga0207651_10007315 | Ga0207651_100073152 | 578 |
| 1119 | 3300033179 | Ga0307507_10000034 | Ga0307507_1000003464 | 578 |
| 1120 | 3300046524 | Ga0495648_0017653 | Ga0495648_0017653_2949_4703 | 578 |
| 1121 | 3300046616 | Ga0495668_0000165 | Ga0495668_0000165_64804_66558 | 578 |
| 1122 | 3300046660 | Ga0495625_0002553 | Ga0495625_0002553_14094_15848 | 578 |
| 1123 | 3300046660 | Ga0495625_0090890 | Ga0495625_0090890_188_1954 | 578 |
| 1124 | 3300046665 | Ga0495661_0004477 | Ga0495661_0004477_1755_3503 | 578 |
| 1125 | 3300053125 | Ga0500618_000245 | Ga0500618_000245_18349_20103 | 578 |
| 1126 | 3300053156 | Ga0500622_0002381 | Ga0500622_0002381_3073_4839 | 578 |
| 1127 | 2162886007 | SwRhRL2b_contig_1018414 | SwRhRL2b_0723.00008410 | 579 |
| 1128 | 3300003320 | rootH2_10000336 | rootH2_1000033660 | 579 |
| 1129 | 3300004799 | Ga0058863_11434785 | Ga0058863_114347852 | 579 |
| 1130 | 3300005288 | Ga0065714_10003183 | Ga0065714_100031837 | 579 |
| 1131 | 3300005288 | Ga0065714_10008525 | Ga0065714_100085251 | 579 |
| 1132 | 3300005289 | Ga0065704_10000302 | Ga0065704_1000030214 | 579 |
| 1133 | 3300005289 | Ga0065704_10078149 | Ga0065704_100781492 | 579 |
| 1134 | 3300005458 | Ga0070681_10024467 | Ga0070681_100244673 | 579 |
| 1135 | 3300005539 | Ga0068853_100027183 | Ga0068853_1000271832 | 579 |
| 1136 | 3300005548 | Ga0070665_100000010 | Ga0070665_100000010415 | 579 |
| 1137 | 3300005563 | Ga0068855_100017608 | Ga0068855_1000176087 | 579 |
| 1138 | 3300006195 | Ga0075366_10010036 | Ga0075366_100100362 | 579 |
| 1139 | 3300009093 | Ga0105240_10007004 | Ga0105240_100070042 | 579 |
| 1140 | 3300009545 | Ga0105237_10029831 | Ga0105237_100298313 | 579 |
| 1141 | 3300013100 | Ga0157373_10001325 | Ga0157373_1000132512 | 579 |
| 1142 | 3300013100 | Ga0157373_10036310 | Ga0157373_100363102 | 579 |
| 1143 | 3300013102 | Ga0157371_10022297 | Ga0157371_100222972 | 579 |
| 1144 | 3300013102 | Ga0157371_10035060 | Ga0157371_100350604 | 579 |
| 1145 | 3300013104 | Ga0157370_10003017 | Ga0157370_100030173 | 579 |
| 1146 | 3300013306 | Ga0163162_10000005 | Ga0163162_10000005366 | 579 |
| 1147 | 3300013308 | Ga0157375_10063235 | Ga0157375_100632353 | 579 |
| 1148 | 3300014497 | Ga0182008_10000014 | Ga0182008_1000001417 | 579 |
| 1149 | 3300014497 | Ga0182008_10000358 | Ga0182008_100003586 | 579 |
| 1150 | 3300017792 | Ga0163161_10009805 | Ga0163161_100098053 | 579 |
| 1151 | 3300021361 | Ga0213872_10014693 | Ga0213872_100146934 | 579 |
| 1152 | 3300025911 | Ga0207654_10028058 | Ga0207654_100280582 | 579 |
| 1153 | 3300025912 | Ga0207707_10046982 | Ga0207707_100469822 | 579 |
| 1154 | 3300025913 | Ga0207695_10079295 | Ga0207695_100792952 | 579 |
| 1155 | 3300025921 | Ga0207652_10008524 | Ga0207652_100085246 | 579 |
| 1156 | 3300025949 | Ga0207667_10025511 | Ga0207667_100255112 | 579 |
| 1157 | 3300026041 | Ga0207639_10022322 | Ga0207639_100223224 | 579 |
| 1158 | 3300028379 | Ga0268266_10000032 | Ga0268266_10000032162 | 579 |
| 1159 | 3300031911 | Ga0307412_10000029 | Ga0307412_10000029138 | 579 |
| 1160 | 3300032004 | Ga0307414_10000776 | Ga0307414_100007762 | 579 |
| 1161 | 3300032004 | Ga0307414_10005750 | Ga0307414_100057505 | 579 |
| 1162 | 3300032004 | Ga0307414_10038059 | Ga0307414_100380593 | 579 |
| 1163 | 3300037312 | Ga0395899_0000011 | Ga0395899_0000011_472764_474515 | 579 |
| 1164 | 3300037312 | Ga0395899_0000726 | Ga0395899_0000726_10468_12225 | 579 |
| 1165 | 3300037418 | Ga0395900_0000173 | Ga0395900_0000173_2753_4510 | 579 |
| 1166 | 3300037466 | Ga0395898_0002849 | Ga0395898_0002849_10764_12521 | 579 |
| 1167 | 3300037471 | Ga0395905_0014577 | Ga0395905_0014577_2625_4382 | 579 |
| 1168 | 3300048925 | Ga0496122_0001365 | Ga0496122_0001365_26254_27993 | 579 |
| 1169 | 3300049758 | Ga0501241_003128 | Ga0501241_003128_812_2551 | 579 |
| 1170 | 3300053093 | Ga0500651_0000302 | Ga0500651_0000302_8585_10324 | 579 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6lpi-assembly4.cif.gz_D | crystal structure of ahas holo-enzyme | 0.9647 | 18 | 577 |
| 6lpi-assembly4.cif.gz_D | crystal structure of ahas holo-enzyme | 0.9629 | 18 | 577 |
| 6lpi-assembly3.cif.gz_C | crystal structure of ahas holo-enzyme | 0.9607 | 18 | 577 |
| 6lpi-assembly2.cif.gz_B | crystal structure of ahas holo-enzyme | 0.9591 | 19 | 577 |
| 6lpi-assembly3.cif.gz_C | crystal structure of ahas holo-enzyme | 0.9589 | 18 | 577 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0DP89_182_327_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9808 | 208 | 348 | 3.40.50.1220 |
| af_P08142_199_364_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9691 | 211 | 369 | 3.40.50.1220 |
| 1yhzA03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9687 | 383 | 563 | 3.40.50.970 |
| af_P0DP89_1_170_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9622 | 20 | 185 | 3.40.50.970 |
| af_A0A1D8PJF9_456_683_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9582 | 379 | 579 | 3.40.50.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F3FB36-F1-model_v4 | Acetolactate synthase (EC 2.2.1.6) | 0.9888 | 67 | 579 |
GO:0000287
GO:0003984 GO:0005948 GO:0009097 GO:0009099 GO:0030976 GO:0050660 |
| AF-A0A357JGG1-F1-model_v4 | Acetolactate synthase large subunit (EC 2.2.1.6) | 0.9874 | 18 | 346 |
GO:0000287
GO:0003984 GO:0005948 GO:0009097 GO:0009099 GO:0030976 GO:0050660 |
| AF-A0A2E9DU44-F1-model_v4 | Thiamine pyrophosphate enzyme TPP-binding domain-containing protein | 0.9864 | 317 | 579 |
GO:0000287
GO:0003984 GO:0005948 GO:0009097 GO:0009099 GO:0030976 GO:0050660 |
| AF-A0A3D2IC13-F1-model_v4 | Acetolactate synthase large subunit (EC 2.2.1.6) | 0.985 | 73 | 420 |
GO:0000287
GO:0003984 GO:0005948 GO:0009097 GO:0009099 GO:0030976 GO:0050660 |
| AF-A0A1F3FB36-F1-model_v4 | Acetolactate synthase (EC 2.2.1.6) | 0.9849 | 67 | 579 |
GO:0000287
GO:0003984 GO:0005948 GO:0009097 GO:0009099 GO:0030976 GO:0050660 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar