F491150

General Info

Members Datasets Scaffolds Average Seq Length
1170 454 2340 192

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0102198|Ga0466966_0102198_579_1157
Length 192
Sequence VLLSDKDIRAELDSGRVVLDPWDPEMVQPSSVDVRLDKFFRLFDNHKYPFIDPAEEQPDLTRLVEVDGEEEAFVLHPGEFVLASTFETVTLPDDLAARVEGKSSLGRLGLLTHATAGFVDPGFSGHVTLELSNVATLPIKLYPGMKIGQLCFFRLTSPAEHPYGSGKYGSHYQGQRGPTASRSFQNFHRTHV

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
97 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
120 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
121 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
181 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
182 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
183 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
184 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
185 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
186 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
187 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
195 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
196 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
199 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
200 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
210 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
211 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
212 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
213 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
214 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
215 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
216 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
217 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
218 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
221 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
222 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
223 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
224 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
225 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
226 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
227 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
228 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
229 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
234 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
235 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
236 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
237 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
239 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
240 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
241 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
242 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
245 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
246 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
247 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
248 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
249 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
250 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
251 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
252 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
253 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
254 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
255 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
256 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
257 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
258 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
259 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
260 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
261 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
262 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
263 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
264 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
265 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
266 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
267 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
270 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
271 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
272 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
273 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
274 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
275 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
276 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
277 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
278 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
279 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
280 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
281 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
282 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
283 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
284 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
285 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
286 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
287 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
288 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
289 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
290 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
291 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
292 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
293 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
294 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
295 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
296 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
297 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
298 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
299 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
300 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
301 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
302 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
303 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
304 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
305 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
306 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
307 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
308 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
309 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
310 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
311 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
312 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
313 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
314 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
315 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
316 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
317 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
318 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
319 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
320 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
321 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
322 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
323 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
324 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
325 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
326 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
327 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
328 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
329 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
330 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
331 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
334 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
335 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
336 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
337 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
338 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
339 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
340 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
341 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
342 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
343 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
344 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
345 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
346 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
349 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
350 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
351 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
352 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
353 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
354 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
355 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
356 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
357 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
358 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
359 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
360 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
361 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
362 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
363 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
364 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
365 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
366 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
367 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
368 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
384 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
385 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
386 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
387 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
388 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
389 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
390 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
391 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
392 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
393 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
394 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
395 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
398 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
399 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
400 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
401 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
402 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
403 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
404 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
405 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
406 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
407 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
408 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
409 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
410 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
411 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
412 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
413 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
414 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
415 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
416 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
417 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
418 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
419 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
420 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
421 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
422 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
423 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
424 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
425 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
426 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
427 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
428 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
429 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
430 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
431 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
432 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
433 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
434 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
435 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
436 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
437 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
438 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
439 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
440 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
441 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
442 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
443 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
444 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
445 2643221619 Agromyces sp. Root81 Isolate Unclassified
446 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
447 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
448 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
449 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
450 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
451 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
452 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
453 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
454 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 0.6
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 3.42
Nodule 0.09
Rhizoplane 3.68
Rhizosphere 86.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0102198 3300044684 Bacteria 1772
2 JGI24738J21930_10008425 3300002075 Bacteria 2346
3 JGI25406J46586_10004301 3300003203 Bacteria 6648
4 rootH1_10032962 3300003323 Bacteria 3520
5 JGI25404J52841_10000840 3300003659 Bacteria 4923
6 Ga0070658_10376890 3300005327 Bacteria 1217
7 Ga0070658_10849975 3300005327 Bacteria 793
8 Ga0070683_100149075 3300005329 Bacteria 2217
9 Ga0068869_100372631 3300005334 Bacteria 1168
10 Ga0070680_100412007 3300005336 Bacteria 1153
11 Ga0068868_100463071 3300005338 Bacteria 1105
12 Ga0070689_100436095 3300005340 Bacteria 1113
13 Ga0070691_10043293 3300005341 Bacteria 2133
14 Ga0070661_100115318 3300005344 Bacteria 2009
15 Ga0070671_100174458 3300005355 Bacteria 1818
16 Ga0070674_100268267 3300005356 Bacteria 1348
17 Ga0070688_100480771 3300005365 Bacteria 934
18 Ga0070659_100361431 3300005366 Bacteria 1220
19 Ga0070667_100342896 3300005367 Bacteria 1351
20 Ga0070667_100562470 3300005367 Bacteria 1049
21 Ga0070709_10004323 3300005434 Bacteria 7659
22 Ga0070709_10027218 3300005434 Bacteria 3398
23 Ga0070709_10071763 3300005434 Bacteria 2236
24 Ga0070709_10165665 3300005434 Bacteria 1540
25 Ga0070709_10233263 3300005434 Bacteria 1318
26 Ga0070709_10280081 3300005434 Bacteria 1211
27 Ga0070709_10287678 3300005434 Bacteria 1196
28 Ga0070709_10369094 3300005434 Bacteria 1064
29 Ga0070714_100001697 3300005435 Bacteria 16017
30 Ga0070714_100047065 3300005435 Bacteria 3662
31 Ga0070714_100081825 3300005435 Bacteria 2812
32 Ga0070714_100219601 3300005435 Bacteria 1746
33 Ga0070714_100351597 3300005435 Bacteria 1384
34 Ga0070713_100050913 3300005436 Bacteria 3423
35 Ga0070713_100067512 3300005436 Bacteria 3011
36 Ga0070713_100070007 3300005436 Bacteria 2960
37 Ga0070713_100379717 3300005436 Bacteria 1316
38 Ga0070713_100403878 3300005436 Bacteria 1276
39 Ga0070713_100728926 3300005436 Bacteria 947
40 Ga0070710_10030286 3300005437 Bacteria 2910
41 Ga0070710_10042309 3300005437 Bacteria 2518
42 Ga0070710_10518263 3300005437 Bacteria 819
43 Ga0070711_100003207 3300005439 Bacteria 9494
44 Ga0070711_100104503 3300005439 Bacteria 2066
45 Ga0070711_100408588 3300005439 Bacteria 1103
46 Ga0070705_100662064 3300005440 Bacteria 815
47 Ga0070694_100252097 3300005444 Bacteria 1335
48 Ga0070708_100035975 3300005445 Bacteria 4317
49 Ga0070708_100070626 3300005445 Bacteria 3142
50 Ga0070708_100097588 3300005445 Bacteria 2686
51 Ga0070708_100331166 3300005445 Bacteria 1435
52 Ga0070708_100698818 3300005445 Bacteria 955
53 Ga0070663_100052981 3300005455 Bacteria 2895
54 Ga0070678_100269342 3300005456 Bacteria 1436
55 Ga0070678_100451871 3300005456 Bacteria 1125
56 Ga0070681_10364410 3300005458 Bacteria 1355
57 Ga0070706_100026879 3300005467 Bacteria 5295
58 Ga0070706_100056913 3300005467 Bacteria 3608
59 Ga0070706_100227311 3300005467 Bacteria 1742
60 Ga0070706_100381013 3300005467 Bacteria 1313
61 Ga0070707_100001995 3300005468 Bacteria 19532
62 Ga0070707_100012337 3300005468 Bacteria 7978
63 Ga0070707_100044553 3300005468 Bacteria 4248
64 Ga0070707_100152894 3300005468 Bacteria 2247
65 Ga0070707_100418862 3300005468 Bacteria 1300
66 Ga0070707_100446700 3300005468 Bacteria 1254
67 Ga0070698_100014291 3300005471 Bacteria 8394
68 Ga0070698_100047878 3300005471 Bacteria 4370
69 Ga0070698_100052393 3300005471 Bacteria 4151
70 Ga0070698_100093936 3300005471 Bacteria 2979
71 Ga0070699_100007506 3300005518 Bacteria 9483
72 Ga0070699_100103497 3300005518 Bacteria 2497
73 Ga0070699_101059651 3300005518 Bacteria 744
74 Ga0070679_100238057 3300005530 Bacteria 1778
75 Ga0070679_100619123 3300005530 Bacteria 1026
76 Ga0070684_100172021 3300005535 Bacteria 1967
77 Ga0070684_100390342 3300005535 Bacteria 1283
78 Ga0070684_101003214 3300005535 Bacteria 784
79 Ga0070697_100016077 3300005536 Bacteria 5884
80 Ga0070697_100402463 3300005536 Bacteria 1188
81 Ga0070697_100550488 3300005536 Bacteria 1012
82 Ga0070697_101187562 3300005536 Bacteria 680
83 Ga0068853_100399200 3300005539 Bacteria 1287
84 Ga0070672_100405167 3300005543 Bacteria 1169
85 Ga0070686_100209337 3300005544 Bacteria 1403
86 Ga0070696_100075087 3300005546 Bacteria 2384
87 Ga0070665_100139911 3300005548 Bacteria 2424
88 Ga0070665_100593436 3300005548 Bacteria 1121
89 Ga0070704_100789789 3300005549 Bacteria 848
90 Ga0068855_100002619 3300005563 Bacteria 22181
91 Ga0068855_100043217 3300005563 Bacteria 5338
92 Ga0068855_100453229 3300005563 Bacteria 1399
93 Ga0068855_101480033 3300005563 Bacteria 698
94 Ga0070664_100292852 3300005564 Bacteria 1470
95 Ga0068857_100619858 3300005577 Bacteria 1024
96 Ga0068854_100213330 3300005578 Bacteria 1524
97 Ga0068854_100326466 3300005578 Bacteria 1249
98 Ga0068854_100597878 3300005578 Bacteria 941
99 Ga0068856_100057624 3300005614 Bacteria 3836
100 Ga0068856_100139155 3300005614 Bacteria 2434
101 Ga0068856_100185530 3300005614 Bacteria 2094
102 Ga0068856_100221639 3300005614 Bacteria 1907
103 Ga0068856_100373226 3300005614 Bacteria 1445
104 Ga0068856_100434112 3300005614 Bacteria 1333
105 Ga0068856_101037793 3300005614 Bacteria 838
106 Ga0070702_100544254 3300005615 Bacteria 860
107 Ga0068852_100208988 3300005616 Bacteria 1851
108 Ga0068852_100266065 3300005616 Bacteria 1648
109 Ga0068852_100339167 3300005616 Bacteria 1464
110 Ga0068852_100778777 3300005616 Bacteria 970
111 Ga0068859_100916700 3300005617 Bacteria 960
112 Ga0068864_100234066 3300005618 Bacteria 1700
113 Ga0068861_100584634 3300005719 Bacteria 1023
114 Ga0068863_100111862 3300005841 Bacteria 2601
115 Ga0068863_100152405 3300005841 Bacteria 2212
116 Ga0068858_100242725 3300005842 Bacteria 1710
117 Ga0068858_100369424 3300005842 Bacteria 1375
118 Ga0081455_10009126 3300005937 Bacteria 10230
119 Ga0081455_10018583 3300005937 Bacteria 6611
120 Ga0081455_10078759 3300005937 Bacteria 2708
121 Ga0081455_10181009 3300005937 Bacteria 1596
122 Ga0081538_10001630 3300005981 Bacteria 22997
123 Ga0081538_10053443 3300005981 Bacteria 2401
124 Ga0081540_1000501 3300005983 Bacteria 38501
125 Ga0081539_10001034 3300005985 Bacteria 51315
126 Ga0081539_10032443 3300005985 Bacteria 3198
127 Ga0070717_10004815 3300006028 Bacteria 9816
128 Ga0070717_10016256 3300006028 Bacteria 5766
129 Ga0070717_10021586 3300006028 Bacteria 5076
130 Ga0070717_10048994 3300006028 Bacteria 3467
131 Ga0070717_10171121 3300006028 Bacteria 1889
132 Ga0070717_10209905 3300006028 Bacteria 1708
133 Ga0070717_10252170 3300006028 Bacteria 1559
134 Ga0070717_10255738 3300006028 Bacteria 1548
135 Ga0070717_10906621 3300006028 Bacteria 802
136 Ga0070715_10006344 3300006163 Bacteria 4017
137 Ga0070715_10309079 3300006163 Bacteria 849
138 Ga0070716_100005123 3300006173 Bacteria 6332
139 Ga0070716_100153627 3300006173 Bacteria 1483
140 Ga0070716_100214914 3300006173 Bacteria 1287
141 Ga0070716_100456722 3300006173 Bacteria 932
142 Ga0070712_100013279 3300006175 Bacteria 5260
143 Ga0070712_100020373 3300006175 Bacteria 4340
144 Ga0070712_100043254 3300006175 Bacteria 3100
145 Ga0070712_100243508 3300006175 Bacteria 1433
146 Ga0070712_100581319 3300006175 Bacteria 946
147 Ga0097621_100342599 3300006237 Bacteria 1328
148 Ga0097621_100652738 3300006237 Bacteria 965
149 Ga0075370_10143241 3300006353 Bacteria 1398
150 Ga0068871_100218194 3300006358 Bacteria 1651
151 Ga0075428_100005648 3300006844 Bacteria 13901
152 Ga0075428_100069717 3300006844 Bacteria 3844
153 Ga0075428_100675731 3300006844 Bacteria 1101
154 Ga0075430_100449785 3300006846 Bacteria 1063
155 Ga0075431_100003397 3300006847 Bacteria 15429
156 Ga0075431_100005592 3300006847 Bacteria 12411
157 Ga0075431_101311137 3300006847 Bacteria 685
158 Ga0075433_10023752 3300006852 Bacteria 5164
159 Ga0075434_100095600 3300006871 Bacteria 2976
160 Ga0075434_100700017 3300006871 Bacteria 1031
161 Ga0075429_100000465 3300006880 Bacteria 30271
162 Ga0075429_100245097 3300006880 Bacteria 1569
163 Ga0075436_100037340 3300006914 Bacteria 3353
164 Ga0075436_100082583 3300006914 Bacteria 2229
165 Ga0097620_100916670 3300006931 Bacteria 960
166 Ga0099826_10183442 3300006948 Bacteria 1161
167 Ga0075435_100127257 3300007076 Bacteria 2130
168 Ga0075435_100878277 3300007076 Bacteria 782
169 Ga0075435_100965960 3300007076 Bacteria 744
170 Ga0099794_10055401 3300007265 Bacteria 1916
171 Ga0099795_10092663 3300007788 Bacteria 1173
172 Ga0105251_10003298 3300009011 Bacteria 11807
173 Ga0105251_10148277 3300009011 Bacteria 1060
174 Ga0105251_10202506 3300009011 Bacteria 894
175 Ga0105244_10020236 3300009036 Bacteria 3699
176 Ga0105250_10173311 3300009092 Bacteria 904
177 Ga0105240_10200120 3300009093 Bacteria 2341
178 Ga0105240_10331071 3300009093 Bacteria 1733
179 Ga0105240_10340055 3300009093 Bacteria 1705
180 Ga0111539_10007454 3300009094 Bacteria 14017
181 Ga0111539_10523042 3300009094 Bacteria 1382
182 Ga0105245_10007847 3300009098 Bacteria 9344
183 Ga0105245_10009889 3300009098 Bacteria 8306
184 Ga0105245_10064466 3300009098 Bacteria 3311
185 Ga0105245_10565169 3300009098 Bacteria 1161
186 Ga0105247_10052554 3300009101 Bacteria 2512
187 Ga0105247_10120371 3300009101 Bacteria 1700
188 Ga0105247_10275138 3300009101 Bacteria 1160
189 Ga0105247_10468154 3300009101 Bacteria 912
190 Ga0114129_10039817 3300009147 Bacteria 6629
191 Ga0114129_10079888 3300009147 Bacteria 4547
192 Ga0114129_10623716 3300009147 Bacteria 1394
193 Ga0105243_10138335 3300009148 Bacteria 2075
194 Ga0105243_10251191 3300009148 Bacteria 1579
195 Ga0105241_10023257 3300009174 Bacteria 4595
196 Ga0105242_10373070 3300009176 Bacteria 1324
197 Ga0105248_10291107 3300009177 Bacteria 1839
198 Ga0105248_11002245 3300009177 Bacteria 944
199 Ga0105237_10176955 3300009545 Bacteria 2134
200 Ga0105237_10333879 3300009545 Bacteria 1520
201 Ga0105237_11449872 3300009545 Bacteria 693
202 Ga0105238_10533674 3300009551 Bacteria 1177
203 Ga0105238_10637307 3300009551 Bacteria 1075
204 Ga0105249_10147737 3300009553 Bacteria 2260
205 Ga0105249_10382605 3300009553 Bacteria 1433
206 Ga0105249_11581046 3300009553 Bacteria 728
207 Ga0099796_10092221 3300010159 Bacteria 1128
208 Ga0105239_10125494 3300010375 Bacteria 2852
209 Ga0105239_10152243 3300010375 Bacteria 2581
210 Ga0105239_10650373 3300010375 Bacteria 1204
211 Ga0105246_10000725 3300011119 Bacteria 18696
212 Ga0157343_1005416 3300012488 Bacteria 828
213 Ga0157342_1010233 3300012507 Bacteria 956
214 Ga0157373_10205675 3300013100 Bacteria 1388
215 Ga0157371_10156176 3300013102 Bacteria 1628
216 Ga0157370_10035794 3300013104 Bacteria 4822
217 Ga0157370_10319265 3300013104 Bacteria 1433
218 Ga0157370_10376872 3300013104 Bacteria 1307
219 Ga0157369_10000499 3300013105 Bacteria 51849
220 Ga0157369_10011608 3300013105 Bacteria 10002
221 Ga0157369_10077765 3300013105 Bacteria 3556
222 Ga0157369_10093367 3300013105 Bacteria 3212
223 Ga0157369_10096226 3300013105 Bacteria 3159
224 Ga0157369_10194318 3300013105 Bacteria 2131
225 Ga0157369_10267052 3300013105 Bacteria 1784
226 Ga0157369_10424803 3300013105 Bacteria 1378
227 Ga0157369_10489011 3300013105 Bacteria 1273
228 Ga0157369_10812217 3300013105 Bacteria 961
229 Ga0157369_10960618 3300013105 Bacteria 875
230 Ga0157374_10051858 3300013296 Bacteria 3819
231 Ga0157374_10128120 3300013296 Bacteria 2455
232 Ga0157378_10182712 3300013297 Bacteria 1974
233 Ga0157378_11643860 3300013297 Bacteria 689
234 Ga0163162_10985117 3300013306 Bacteria 953
235 Ga0157372_10070679 3300013307 Bacteria 3928
236 Ga0157375_10026292 3300013308 Bacteria 5421
237 Ga0157375_10145638 3300013308 Bacteria 2499
238 Ga0157375_10270216 3300013308 Bacteria 1862
239 Ga0157375_10611153 3300013308 Bacteria 1249
240 Ga0182008_10025311 3300014497 Bacteria 3014
241 Ga0157377_10182353 3300014745 Bacteria 1321
242 Ga0157379_10244745 3300014968 Bacteria 1627
243 Ga0157379_10252377 3300014968 Bacteria 1601
244 Ga0182006_1075348 3300015261 Bacteria 1242
245 Ga0182007_10000669 3300015262 Bacteria 19672
246 Ga0183367_1015 3300015688 Bacteria 298435
247 Ga0163161_10287909 3300017792 Bacteria 1291
248 Ga0163161_10402296 3300017792 Bacteria 1098
249 Ga0206356_11633797 3300020070 Bacteria 774
250 Ga0206353_10418018 3300020082 Bacteria 866
251 Ga0206353_11592386 3300020082 Bacteria 1414
252 Ga0206353_11865961 3300020082 Bacteria 2792
253 Ga0213874_10004260 3300021377 Bacteria 3245
254 Ga0213875_10000989 3300021388 Bacteria 20317
255 Ga0213875_10041640 3300021388 Bacteria 2161
256 Ga0213875_10128178 3300021388 Bacteria 1186
257 Ga0224712_10220279 3300022467 Bacteria 868
258 Ga0224712_10296545 3300022467 Bacteria 755
259 Ga0224572_1014734 3300024225 Bacteria 1494
260 Ga0228598_1016371 3300024227 Bacteria 1463
261 Ga0209563_102036 3300025230 Bacteria 4805
262 Ga0209758_1009592 3300025297 Bacteria 5979
263 Ga0207713_1005912 3300025735 Bacteria 7554
264 Ga0207692_10087021 3300025898 Bacteria 1685
265 Ga0207692_10198841 3300025898 Bacteria 1177
266 Ga0207692_10224273 3300025898 Bacteria 1115
267 Ga0207710_10136124 3300025900 Bacteria 1183
268 Ga0207680_10398698 3300025903 Bacteria 972
269 Ga0207647_10016868 3300025904 Bacteria 4975
270 Ga0207647_10154334 3300025904 Bacteria 1341
271 Ga0207685_10015085 3300025905 Bacteria 2439
272 Ga0207699_10034945 3300025906 Bacteria 2856
273 Ga0207699_10155981 3300025906 Bacteria 1515
274 Ga0207699_10201018 3300025906 Bacteria 1350
275 Ga0207699_10831576 3300025906 Bacteria 680
276 Ga0207705_10148584 3300025909 Bacteria 1754
277 Ga0207705_10679467 3300025909 Bacteria 800
278 Ga0207705_10721975 3300025909 Bacteria 774
279 Ga0207684_10018360 3300025910 Bacteria 5988
280 Ga0207684_10032219 3300025910 Bacteria 4458
281 Ga0207684_10167406 3300025910 Bacteria 1894
282 Ga0207684_10222277 3300025910 Bacteria 1629
283 Ga0207684_10401708 3300025910 Bacteria 1178
284 Ga0207684_11045369 3300025910 Bacteria 682
285 Ga0207654_10068002 3300025911 Bacteria 2107
286 Ga0207695_10002619 3300025913 Bacteria 26347
287 Ga0207695_10094794 3300025913 Bacteria 2991
288 Ga0207671_10000859 3300025914 Bacteria 38501
289 Ga0207671_10351728 3300025914 Bacteria 1168
290 Ga0207693_10013690 3300025915 Bacteria 6535
291 Ga0207693_10035163 3300025915 Bacteria 3950
292 Ga0207693_10049315 3300025915 Bacteria 3306
293 Ga0207693_10096636 3300025915 Bacteria 2316
294 Ga0207693_10103315 3300025915 Bacteria 2235
295 Ga0207693_10249211 3300025915 Bacteria 1394
296 Ga0207663_10030774 3300025916 Bacteria 3169
297 Ga0207663_10044704 3300025916 Bacteria 2720
298 Ga0207663_10065845 3300025916 Bacteria 2317
299 Ga0207663_10167736 3300025916 Bacteria 1556
300 Ga0207662_10134796 3300025918 Bacteria 1560
301 Ga0207657_10536501 3300025919 Bacteria 915
302 Ga0207652_10265815 3300025921 Bacteria 1547
303 Ga0207646_10002609 3300025922 Bacteria 21196
304 Ga0207646_10014615 3300025922 Bacteria 7443
305 Ga0207646_10044426 3300025922 Bacteria 3988
306 Ga0207646_10220795 3300025922 Bacteria 1712
307 Ga0207646_10274715 3300025922 Bacteria 1523
308 Ga0207646_10391882 3300025922 Bacteria 1255
309 Ga0207646_10480455 3300025922 Bacteria 1120
310 Ga0207694_10002482 3300025924 Bacteria 15012
311 Ga0207659_10158434 3300025926 Bacteria 1775
312 Ga0207687_10034173 3300025927 Bacteria 3452
313 Ga0207687_10062622 3300025927 Bacteria 2631
314 Ga0207687_10612260 3300025927 Bacteria 919
315 Ga0207700_10020875 3300025928 Bacteria 4459
316 Ga0207700_10059269 3300025928 Bacteria 2895
317 Ga0207700_10080429 3300025928 Bacteria 2541
318 Ga0207700_10427183 3300025928 Bacteria 1165
319 Ga0207700_10596038 3300025928 Bacteria 983
320 Ga0207700_11004445 3300025928 Bacteria 747
321 Ga0207664_10001035 3300025929 Bacteria 18634
322 Ga0207664_10015616 3300025929 Bacteria 5518
323 Ga0207664_10040879 3300025929 Bacteria 3609
324 Ga0207664_10063522 3300025929 Bacteria 2951
325 Ga0207664_10140191 3300025929 Bacteria 2044
326 Ga0207664_10416578 3300025929 Bacteria 1196
327 Ga0207664_10602950 3300025929 Bacteria 986
328 Ga0207664_10654901 3300025929 Bacteria 944
329 Ga0207664_10678737 3300025929 Bacteria 926
330 Ga0207664_10809760 3300025929 Bacteria 842
331 Ga0207644_10191076 3300025931 Bacteria 1610
332 Ga0207709_10488363 3300025935 Bacteria 959
333 Ga0207669_10198535 3300025937 Bacteria 1454
334 Ga0207669_10472713 3300025937 Bacteria 998
335 Ga0207704_10839378 3300025938 Bacteria 769
336 Ga0207665_10001452 3300025939 Bacteria 15942
337 Ga0207665_10001502 3300025939 Bacteria 15679
338 Ga0207665_10023079 3300025939 Bacteria 4098
339 Ga0207665_10058692 3300025939 Bacteria 2602
340 Ga0207691_10749314 3300025940 Bacteria 822
341 Ga0207691_10885721 3300025940 Bacteria 748
342 Ga0207711_10018303 3300025941 Bacteria 5823
343 Ga0207689_10071805 3300025942 Bacteria 2843
344 Ga0207661_10074221 3300025944 Bacteria 2788
345 Ga0207661_10318834 3300025944 Bacteria 1397
346 Ga0207661_10837823 3300025944 Bacteria 847
347 Ga0207667_10042250 3300025949 Bacteria 4847
348 Ga0207667_10189998 3300025949 Bacteria 2107
349 Ga0207712_10095294 3300025961 Bacteria 2200
350 Ga0207712_10147226 3300025961 Bacteria 1815
351 Ga0207712_11108896 3300025961 Bacteria 704
352 Ga0207668_10135099 3300025972 Bacteria 1889
353 Ga0207668_10404760 3300025972 Bacteria 1154
354 Ga0207640_10150742 3300025981 Bacteria 1708
355 Ga0207640_10238306 3300025981 Bacteria 1404
356 Ga0207658_10316003 3300025986 Bacteria 1351
357 Ga0207677_10434204 3300026023 Bacteria 1122
358 Ga0207703_10060917 3300026035 Bacteria 3088
359 Ga0207639_10059310 3300026041 Bacteria 2948
360 Ga0207639_10523852 3300026041 Bacteria 1086
361 Ga0207678_10009111 3300026067 Bacteria 8741
362 Ga0207702_10048478 3300026078 Bacteria 3583
363 Ga0207702_10087270 3300026078 Bacteria 2723
364 Ga0207702_10231058 3300026078 Bacteria 1729
365 Ga0207702_10245159 3300026078 Bacteria 1680
366 Ga0207702_10703008 3300026078 Bacteria 996
367 Ga0207702_10778005 3300026078 Bacteria 945
368 Ga0207702_11040238 3300026078 Bacteria 812
369 Ga0207641_10054631 3300026088 Bacteria 3390
370 Ga0207676_10509161 3300026095 Bacteria 1144
371 Ga0207676_10634010 3300026095 Bacteria 1030
372 Ga0207676_10816796 3300026095 Bacteria 910
373 Ga0207674_10151813 3300026116 Bacteria 2273
374 Ga0207674_10406519 3300026116 Bacteria 1316
375 Ga0207675_100080881 3300026118 Bacteria 3046
376 Ga0207675_100182260 3300026118 Bacteria 2011
377 Ga0207675_101671918 3300026118 Bacteria 657
378 Ga0207683_10124879 3300026121 Bacteria 2312
379 Ga0207683_10241243 3300026121 Bacteria 1649
380 Ga0207698_10158043 3300026142 Bacteria 1978
381 Ga0209371_1032899 3300027312 Bacteria 1112
382 Ga0209588_1101257 3300027671 Bacteria 927
383 Ga0207428_10006504 3300027907 Bacteria 10785
384 Ga0268266_10075243 3300028379 Bacteria 2933
385 Ga0268266_10396119 3300028379 Bacteria 1305
386 Ga0268266_10775591 3300028379 Bacteria 926
387 Ga0268265_10590731 3300028380 Bacteria 1060
388 Ga0268264_10488130 3300028381 Bacteria 1199
389 Ga0307517_10075499 3300028786 Bacteria 2955
390 Ga0307515_10014891 3300028794 Bacteria 14377
391 Ga0307515_10162171 3300028794 Bacteria 2274
392 Ga0265338_10001130 3300028800 Bacteria 44217
393 Ga0268256_1037440 3300030500 Bacteria 1112
394 Ga0307511_10000029 3300030521 Bacteria 108570
395 Ga0307511_10091665 3300030521 Bacteria 2055
396 Ga0307512_10003228 3300030522 Bacteria 19272
397 Ga0307512_10011081 3300030522 Bacteria 8560
398 Ga0316177_1221734 3300030731 Bacteria 2254
399 Ga0316176_1068858 3300030732 Bacteria 2150
400 Ga0314311_1078233 3300030733 Bacteria 2028
401 Ga0316179_1056778 3300030734 Bacteria 2067
402 Ga0265763_1007959 3300030763 Bacteria 939
403 Ga0265325_10015843 3300031241 Bacteria 4228
404 Ga0265340_10030432 3300031247 Bacteria 2705
405 Ga0265327_10000125 3300031251 Bacteria 167832
406 Ga0265327_10032023 3300031251 Bacteria 2948
407 Ga0307513_10001602 3300031456 Bacteria 32485
408 Ga0307513_10023643 3300031456 Bacteria 7175
409 Ga0307509_10013741 3300031507 Bacteria 9560
410 Ga0307509_10033598 3300031507 Bacteria 5646
411 Ga0307408_100483261 3300031548 Bacteria 1081
412 Ga0307508_10008497 3300031616 Bacteria 9485
413 Ga0307508_10017888 3300031616 Bacteria 6442
414 Ga0307508_10023761 3300031616 Bacteria 5565
415 Ga0307508_10238293 3300031616 Bacteria 1417
416 Ga0307514_10003328 3300031649 Bacteria 15567
417 Ga0307514_10005036 3300031649 Bacteria 11954
418 Ga0307514_10064296 3300031649 Bacteria 2783
419 Ga0307514_10323710 3300031649 Bacteria 844
420 Ga0316575_10000004 3300031665 Bacteria 116505
421 Ga0265314_10308469 3300031711 Bacteria 885
422 Ga0316576_10003726 3300031727 Bacteria 8998
423 Ga0316576_10005029 3300031727 Bacteria 8011
424 Ga0316576_10073932 3300031727 Bacteria 2519
425 Ga0316576_10570502 3300031727 Bacteria 828
426 Ga0316578_10014563 3300031728 Bacteria 4206
427 Ga0316578_10114663 3300031728 Bacteria 1619
428 Ga0307516_10005315 3300031730 Bacteria 15496
429 Ga0307516_10024874 3300031730 Bacteria 6109
430 Ga0307516_10059173 3300031730 Bacteria 3727
431 Ga0307516_10404495 3300031730 Bacteria 1024
432 Ga0307413_10096162 3300031824 Bacteria 1944
433 Ga0307518_10078872 3300031838 Bacteria 2378
434 Ga0307518_10223755 3300031838 Bacteria 1225
435 Ga0307410_10271906 3300031852 Bacteria 1326
436 Ga0307406_10204985 3300031901 Bacteria 1455
437 Ga0307406_10216661 3300031901 Bacteria 1420
438 Ga0307406_10402030 3300031901 Bacteria 1086
439 Ga0307407_10266075 3300031903 Bacteria 1181
440 Ga0307407_10492292 3300031903 Bacteria 897
441 Ga0307409_100134687 3300031995 Bacteria 2118
442 Ga0307409_100176188 3300031995 Bacteria 1888
443 Ga0307409_101029367 3300031995 Bacteria 842
444 Ga0307416_100116514 3300032002 Bacteria 2369
445 Ga0307416_101085501 3300032002 Bacteria 905
446 Ga0307415_100040118 3300032126 Bacteria 3100
447 Ga0307415_100102738 3300032126 Bacteria 2101
448 Ga0307507_10041134 3300033179 Bacteria 4631
449 Ga0307507_10041576 3300033179 Bacteria 4596
450 Ga0307507_10200653 3300033179 Bacteria 1381
451 Ga0307510_10015231 3300033180 Bacteria 9090
452 Ga0307510_10044243 3300033180 Bacteria 4826
453 Ga0307510_10113562 3300033180 Bacteria 2441
454 Ga0316214_1032490 3300033545 Bacteria 742
455 Ga0373930_0056299 3300034816 Bacteria 869
456 Ga0373958_0071359 3300034819 Bacteria 771
457 Ga0373926_0000170 3300035083 Bacteria 14467
458 Ga0373926_0005176 3300035083 Bacteria 4292
459 Ga0373926_0006409 3300035083 Bacteria 3909
460 Ga0373929_0063085 3300035085 Bacteria 872
461 Ga0373934_0026026 3300035086 Bacteria 2269
462 Ga0373934_0100822 3300035086 Bacteria 1168
463 Ga0373944_0000752 3300035089 Bacteria 7876
464 Ga0373944_0158924 3300035089 Bacteria 801
465 Ga0373923_0000684 3300035111 Bacteria 8625
466 Ga0373923_0006064 3300035111 Bacteria 4150
467 Ga0373923_0078035 3300035111 Bacteria 1433
468 Ga0373923_0242864 3300035111 Bacteria 841
469 Ga0373936_0004356 3300035113 Bacteria 5350
470 Ga0373936_0009278 3300035113 Bacteria 3706
471 Ga0373945_0000905 3300035116 Bacteria 8774
472 Ga0373945_0001739 3300035116 Bacteria 6724
473 Ga0373953_0043135 3300035117 Bacteria 1799
474 Ga0373953_0106813 3300035117 Bacteria 1181
475 Ga0373953_0221865 3300035117 Bacteria 819
476 Ga0373954_0061604 3300035118 Bacteria 1771
477 Ga0373954_0285494 3300035118 Bacteria 813
478 Ga0373954_0402460 3300035118 Bacteria 677
479 Ga0373956_0009402 3300035119 Bacteria 3977
480 Ga0373956_0012461 3300035119 Bacteria 3526
481 Ga0373956_0154077 3300035119 Bacteria 1082
482 Ga0373957_0039081 3300035120 Bacteria 1779
483 Ga0373957_0175531 3300035120 Bacteria 887
484 Ga0373943_0002847 3300035170 Bacteria 7859
485 Ga0373943_0002993 3300035170 Bacteria 7676
486 Ga0373943_0048327 3300035170 Bacteria 2084
487 Ga0373946_0002040 3300035171 Bacteria 7088
488 Ga0373946_0005679 3300035171 Bacteria 4510
489 Ga0373955_0009135 3300035172 Bacteria 4631
490 Ga0373955_0023797 3300035172 Bacteria 3125
491 Ga0373955_0101129 3300035172 Bacteria 1655
492 Ga0373955_0109720 3300035172 Bacteria 1594
493 Ga0373955_0243003 3300035172 Bacteria 1078
494 Ga0316574_0008888 3300035398 Bacteria 5604
495 Ga0316574_0027835 3300035398 Bacteria 3406
496 Ga0316574_0352280 3300035398 Bacteria 931
497 Ga0373924_0010452 3300035410 Bacteria 3422
498 Ga0373924_0025616 3300035410 Bacteria 2332
499 Ga0373924_0042315 3300035410 Bacteria 1868
500 Ga0373924_0065690 3300035410 Bacteria 1524
501 Ga0373935_0000585 3300035692 Bacteria 18987
502 Ga0373935_0000925 3300035692 Bacteria 15851
503 Ga0373935_0012498 3300035692 Bacteria 5105
504 Ga0373927_0001256 3300035695 Bacteria 19246
505 Ga0373927_0012374 3300035695 Bacteria 5679
506 Ga0373927_0236113 3300035695 Bacteria 1201
507 Ga0373927_0563742 3300035695 Bacteria 753
508 Ga0373933_0016337 3300035724 Bacteria 4148
509 Ga0373933_0121739 3300035724 Bacteria 1634
510 Ga0373933_0126130 3300035724 Bacteria 1606
511 Ga0373947_0000285 3300035725 Bacteria 28726
512 Ga0373947_0004745 3300035725 Bacteria 7970
513 Ga0373947_0038584 3300035725 Bacteria 2838
514 Ga0373947_0097265 3300035725 Bacteria 1845
515 Ga0373947_0847609 3300035725 Bacteria 624
516 Ga0373937_0030477 3300036401 Bacteria 4885
517 Ga0373937_0055981 3300036401 Bacteria 3621
518 Ga0373937_0154482 3300036401 Bacteria 2150
519 Ga0373937_0163309 3300036401 Bacteria 2088
520 Ga0373937_0215587 3300036401 Bacteria 1806
521 Ga0316582_0639592 3300036647 Bacteria 731
522 Ga0316584_0747821 3300036712 Bacteria 667
523 Ga0373925_0001910 3300037068 Bacteria 17290
524 Ga0373925_0014948 3300037068 Bacteria 5611
525 Ga0373925_0028939 3300037068 Bacteria 4062
526 Ga0373925_0164052 3300037068 Bacteria 1751
527 Ga0373925_0460067 3300037068 Bacteria 1042
528 Ga0395899_0156073 3300037312 Bacteria 1615
529 Ga0395900_0027051 3300037418 Bacteria 5872
530 Ga0395898_0011730 3300037466 Bacteria 9085
531 Ga0395898_0191058 3300037466 Bacteria 1956
532 Ga0436364_0454301 3300037853 Bacteria 1701
533 Ga0436364_0841312 3300037853 Bacteria 10277
534 Ga0436364_0912466 3300037853 Bacteria 3344
535 Ga0436364_0937718 3300037853 Bacteria 1190
536 Ga0436364_1073971 3300037853 Bacteria 13298
537 Ga0436364_1347787 3300037853 Bacteria 939
538 Ga0436364_1503455 3300037853 Bacteria 4497
539 Ga0436364_1544337 3300037853 Bacteria 1036
540 Ga0395901_0047110 3300038443 Bacteria 4477
541 Ga0395901_0063285 3300038443 Bacteria 3850
542 Ga0436365_0595644 3300039437 Bacteria 3908
543 Ga0436360_0005371 3300039438 Bacteria 939
544 Ga0436363_0002297 3300039450 Bacteria 902
545 Ga0436363_0169319 3300039450 Bacteria 2981
546 Ga0436363_0232657 3300039450 Bacteria 720
547 Ga0436363_1064625 3300039450 Bacteria 1174
548 Ga0439436_0006090 3300041404 Bacteria 3700
549 Ga0439439_0030632 3300041406 Bacteria 1368
550 Ga0451797_1461308 3300041453 Bacteria 1083
551 Ga0451807_2562875 3300041486 Bacteria 1044
552 Ga0451833_1112365 3300041491 Bacteria 1337
553 Ga0451837_0454087 3300041494 Bacteria 2900
554 Ga0451841_0471427 3300041498 Bacteria 1246
555 Ga0451853_0334494 3300041512 Bacteria 7161
556 Ga0451853_2740783 3300041512 Bacteria 2512
557 Ga0451853_3121249 3300041512 Bacteria 1115
558 Ga0439432_079878 3300042006 Bacteria 991
559 Ga0439449_0004271 3300042007 Bacteria 5522
560 Ga0439449_0067602 3300042007 Bacteria 1317
561 Ga0439457_002218 3300042014 Bacteria 5622
562 Ga0450894_000953 3300042131 Bacteria 4550
563 Ga0450898_000877 3300042134 Bacteria 3763
564 Ga0450899_001207 3300042135 Bacteria 2934
565 Ga0450900_044651 3300042136 Bacteria 669
566 Ga0450903_000200 3300042138 Bacteria 13259
567 Ga0450906_000555 3300042145 Bacteria 7884
568 Ga0450907_033465 3300042146 Bacteria 876
569 Ga0466969_0012742 3300044656 Bacteria 4430
570 Ga0466969_0072606 3300044656 Bacteria 1652
571 Ga0466969_0077513 3300044656 Bacteria 1590
572 Ga0466972_0032963 3300044658 Bacteria 2541
573 Ga0466972_0048025 3300044658 Bacteria 2063
574 Ga0466972_0058433 3300044658 Bacteria 1851
575 Ga0466972_0059694 3300044658 Bacteria 1830
576 Ga0466972_0078797 3300044658 Bacteria 1569
577 Ga0466965_0002184 3300044683 Bacteria 8231
578 Ga0466965_0099239 3300044683 Bacteria 1488
579 Ga0466966_0005485 3300044684 Bacteria 8335
580 Ga0466966_0015625 3300044684 Bacteria 5018
581 Ga0466966_0077165 3300044684 Bacteria 2079
582 Ga0466966_0093000 3300044684 Bacteria 1870
583 Ga0466966_0112624 3300044684 Bacteria 1676
584 Ga0466961_0004352 3300044693 Bacteria 8873
585 Ga0466961_0009683 3300044693 Bacteria 6131
586 Ga0466961_0031272 3300044693 Bacteria 3422
587 Ga0466961_0180555 3300044693 Bacteria 1310
588 Ga0466961_0183769 3300044693 Bacteria 1297
589 Ga0466963_0004623 3300044694 Bacteria 8025
590 Ga0466963_0196081 3300044694 Bacteria 1412
591 Ga0466964_0035392 3300044706 Bacteria 1996
592 Ga0466971_0000731 3300044719 Bacteria 13157
593 Ga0466971_0029407 3300044719 Bacteria 2457
594 Ga0466971_0045827 3300044719 Bacteria 1964
595 Ga0466971_0092094 3300044719 Bacteria 1389
596 Ga0466971_0097165 3300044719 Bacteria 1351
597 Ga0466968_0008647 3300044735 Bacteria 3902
598 Ga0466970_0000891 3300044765 Bacteria 14413
599 Ga0466970_0007398 3300044765 Bacteria 5502
600 Ga0466970_0007838 3300044765 Bacteria 5361
601 Ga0466970_0138245 3300044765 Bacteria 1341
602 Ga0466970_0175804 3300044765 Bacteria 1187
603 Ga0466957_0000553 3300044842 Bacteria 18838
604 Ga0466957_0097799 3300044842 Bacteria 1846
605 Ga0466957_0223446 3300044842 Bacteria 1244
606 Ga0466960_0089672 3300044901 Bacteria 1565
607 Ga0466959_0002672 3300045049 Bacteria 11442
608 Ga0466959_0003442 3300045049 Bacteria 10356
609 Ga0466959_0025188 3300045049 Bacteria 4407
610 Ga0466959_0156759 3300045049 Bacteria 1602
611 Ga0466958_0017827 3300045836 Bacteria 4112
612 Ga0466958_0513665 3300045836 Bacteria 778
613 Ga0466967_0042072 3300045976 Bacteria 3945
614 Ga0466967_0114528 3300045976 Bacteria 2482
615 Ga0466967_0299084 3300045976 Bacteria 1548
616 Ga0466967_0708642 3300045976 Bacteria 997
617 Ga0495627_014698 3300046453 Bacteria 2724
618 Ga0495627_043162 3300046453 Bacteria 1380
619 Ga0495592_0002271 3300046454 Bacteria 13551
620 Ga0495592_0003737 3300046454 Bacteria 10974
621 Ga0495592_0040543 3300046454 Bacteria 3495
622 Ga0495592_0055075 3300046454 Bacteria 2943
623 Ga0495592_0065729 3300046454 Bacteria 2654
624 Ga0495592_0127132 3300046454 Bacteria 1786
625 Ga0495592_0145161 3300046454 Bacteria 1646
626 Ga0495592_0397598 3300046454 Bacteria 873
627 Ga0495592_0584936 3300046454 Bacteria 682
628 Ga0495603_0002831 3300046455 Bacteria 10247
629 Ga0495603_0005656 3300046455 Bacteria 7467
630 Ga0495603_0011462 3300046455 Bacteria 5366
631 Ga0495603_0023323 3300046455 Bacteria 3746
632 Ga0495603_0240253 3300046455 Bacteria 1043
633 Ga0495603_0390470 3300046455 Bacteria 798
634 Ga0495603_0466101 3300046455 Bacteria 723
635 Ga0495629_0001126 3300046459 Bacteria 21176
636 Ga0495629_0003859 3300046459 Bacteria 11299
637 Ga0495629_0006498 3300046459 Bacteria 8661
638 Ga0495629_0021301 3300046459 Bacteria 4625
639 Ga0495629_0036334 3300046459 Bacteria 3478
640 Ga0495629_0101287 3300046459 Bacteria 2010
641 Ga0495629_0124429 3300046459 Bacteria 1796
642 Ga0495629_0181995 3300046459 Bacteria 1456
643 Ga0495638_0042577 3300046460 Bacteria 2867
644 Ga0495638_0069420 3300046460 Bacteria 2160
645 Ga0495638_0109151 3300046460 Bacteria 1645
646 Ga0495638_0124370 3300046460 Bacteria 1521
647 Ga0495641_0002343 3300046461 Bacteria 15046
648 Ga0495641_0014347 3300046461 Bacteria 4292
649 Ga0495651_0010645 3300046462 Bacteria 7076
650 Ga0495651_0028367 3300046462 Bacteria 4362
651 Ga0495651_0048595 3300046462 Bacteria 3276
652 Ga0495651_0072280 3300046462 Bacteria 2620
653 Ga0495651_0076100 3300046462 Bacteria 2543
654 Ga0495651_0151434 3300046462 Bacteria 1671
655 Ga0495651_0159825 3300046462 Bacteria 1615
656 Ga0495651_0324899 3300046462 Bacteria 1024
657 Ga0495651_0517848 3300046462 Bacteria 761
658 Ga0495653_0006927 3300046463 Bacteria 9312
659 Ga0495653_0008832 3300046463 Bacteria 8250
660 Ga0495653_0010809 3300046463 Bacteria 7471
661 Ga0495653_0016905 3300046463 Bacteria 5934
662 Ga0495653_0028580 3300046463 Bacteria 4458
663 Ga0495653_0104005 3300046463 Bacteria 2052
664 Ga0495653_0300443 3300046463 Bacteria 1047
665 Ga0495580_0005592 3300046472 Bacteria 10358
666 Ga0495580_0025433 3300046472 Bacteria 4326
667 Ga0495582_0003441 3300046473 Bacteria 8922
668 Ga0495582_0027255 3300046473 Bacteria 3131
669 Ga0495582_0041255 3300046473 Bacteria 2543
670 Ga0495582_0102471 3300046473 Bacteria 1603
671 Ga0495639_0005098 3300046475 Bacteria 5643
672 Ga0495639_0142985 3300046475 Bacteria 1151
673 Ga0495662_0000778 3300046476 Bacteria 15442
674 Ga0495662_0002509 3300046476 Bacteria 9261
675 Ga0495662_0004864 3300046476 Bacteria 6729
676 Ga0495662_0009607 3300046476 Bacteria 4743
677 Ga0495662_0011366 3300046476 Bacteria 4351
678 Ga0495662_0014930 3300046476 Bacteria 3773
679 Ga0495662_0017662 3300046476 Bacteria 3453
680 Ga0495662_0069482 3300046476 Bacteria 1706
681 Ga0495662_0074306 3300046476 Bacteria 1649
682 Ga0495664_0000391 3300046477 Bacteria 21456
683 Ga0495664_0006849 3300046477 Bacteria 6309
684 Ga0495664_0015064 3300046477 Bacteria 4392
685 Ga0495664_0018080 3300046477 Bacteria 4032
686 Ga0495664_0093898 3300046477 Bacteria 1805
687 Ga0495664_0146869 3300046477 Bacteria 1430
688 Ga0495664_0227240 3300046477 Bacteria 1129
689 Ga0495664_0256009 3300046477 Bacteria 1058
690 Ga0495585_0034278 3300046492 Bacteria 2870
691 Ga0495594_0005801 3300046499 Bacteria 6338
692 Ga0495594_0007517 3300046499 Bacteria 5607
693 Ga0495594_0023705 3300046499 Bacteria 3290
694 Ga0495594_0216489 3300046499 Bacteria 1092
695 Ga0495594_0383090 3300046499 Bacteria 800
696 Ga0495608_0001231 3300046511 Bacteria 18151
697 Ga0495608_0015515 3300046511 Bacteria 5283
698 Ga0495608_0044086 3300046511 Bacteria 2978
699 Ga0495608_0143318 3300046511 Bacteria 1524
700 Ga0495608_0220098 3300046511 Bacteria 1191
701 Ga0495618_0043137 3300046514 Bacteria 2845
702 Ga0495618_0049082 3300046514 Bacteria 2666
703 Ga0495618_0072533 3300046514 Bacteria 2191
704 Ga0495618_0104235 3300046514 Bacteria 1816
705 Ga0495618_0177683 3300046514 Bacteria 1353
706 Ga0495618_0284593 3300046514 Bacteria 1030
707 Ga0495628_0002991 3300046516 Bacteria 15148
708 Ga0495628_0014635 3300046516 Bacteria 6571
709 Ga0495628_0121244 3300046516 Bacteria 2005
710 Ga0495628_0133599 3300046516 Bacteria 1897
711 Ga0495628_0216717 3300046516 Bacteria 1439
712 Ga0495628_0217030 3300046516 Bacteria 1437
713 Ga0495628_0260591 3300046516 Bacteria 1292
714 Ga0495628_0395195 3300046516 Bacteria 1011
715 Ga0495630_0000703 3300046517 Bacteria 23814
716 Ga0495630_0018884 3300046517 Bacteria 5067
717 Ga0495630_0130447 3300046517 Bacteria 1909
718 Ga0495630_0264684 3300046517 Bacteria 1313
719 Ga0495630_0542491 3300046517 Bacteria 892
720 Ga0495631_0283925 3300046518 Bacteria 705
721 Ga0495632_0054684 3300046519 Bacteria 1956
722 Ga0495637_0099018 3300046520 Bacteria 1141
723 Ga0495643_0001615 3300046522 Bacteria 19965
724 Ga0495643_0177995 3300046522 Bacteria 1035
725 Ga0495666_0012169 3300046526 Bacteria 4294
726 Ga0495652_0001872 3300046529 Bacteria 22363
727 Ga0495652_0014592 3300046529 Bacteria 7044
728 Ga0495652_0027773 3300046529 Bacteria 4984
729 Ga0495652_0074965 3300046529 Bacteria 2812
730 Ga0495652_0108941 3300046529 Bacteria 2231
731 Ga0495652_0153565 3300046529 Bacteria 1795
732 Ga0495652_0165159 3300046529 Bacteria 1714
733 Ga0495652_0194738 3300046529 Bacteria 1544
734 Ga0495652_0297261 3300046529 Bacteria 1175
735 Ga0495652_0319829 3300046529 Bacteria 1121
736 Ga0495665_0043023 3300046531 Bacteria 2402
737 Ga0495665_0053415 3300046531 Bacteria 2136
738 Ga0495665_0307616 3300046531 Bacteria 811
739 Ga0495640_0001053 3300046533 Bacteria 21443
740 Ga0495640_0029936 3300046533 Bacteria 3901
741 Ga0495640_0030511 3300046533 Bacteria 3858
742 Ga0495640_0045950 3300046533 Bacteria 3028
743 Ga0495640_0069695 3300046533 Bacteria 2365
744 Ga0495640_0105120 3300046533 Bacteria 1850
745 Ga0495640_0291198 3300046533 Bacteria 1015
746 Ga0495586_0007632 3300046535 Bacteria 5771
747 Ga0495586_0012479 3300046535 Bacteria 4507
748 Ga0495586_0104890 3300046535 Bacteria 1571
749 Ga0495586_0324136 3300046535 Bacteria 884
750 Ga0495587_0003902 3300046536 Bacteria 9895
751 Ga0495587_0004174 3300046536 Bacteria 9564
752 Ga0495587_0006375 3300046536 Bacteria 7696
753 Ga0495587_0013196 3300046536 Bacteria 5194
754 Ga0495587_0019644 3300046536 Bacteria 4179
755 Ga0495587_0033613 3300046536 Bacteria 3095
756 Ga0495645_0000506 3300046543 Bacteria 26907
757 Ga0495645_0010307 3300046543 Bacteria 6551
758 Ga0495645_0028178 3300046543 Bacteria 4081
759 Ga0495645_0199310 3300046543 Bacteria 1359
760 Ga0495645_0224325 3300046543 Bacteria 1262
761 Ga0495645_0233777 3300046543 Bacteria 1230
762 Ga0495645_0233954 3300046543 Bacteria 1229
763 Ga0495645_0296287 3300046543 Bacteria 1058
764 Ga0495622_0017899 3300046557 Bacteria 3301
765 Ga0495622_0047424 3300046557 Bacteria 1996
766 Ga0495622_0066701 3300046557 Bacteria 1663
767 Ga0495622_0124324 3300046557 Bacteria 1177
768 Ga0495633_0095871 3300046558 Bacteria 1378
769 Ga0495667_0001397 3300046559 Bacteria 15910
770 Ga0495667_0023079 3300046559 Bacteria 4191
771 Ga0495667_0026280 3300046559 Bacteria 3922
772 Ga0495667_0047033 3300046559 Bacteria 2851
773 Ga0495667_0142129 3300046559 Bacteria 1546
774 Ga0495634_0001317 3300046642 Bacteria 22654
775 Ga0495634_0017477 3300046642 Bacteria 5116
776 Ga0495634_0017724 3300046642 Bacteria 5078
777 Ga0495634_0019430 3300046642 Bacteria 4828
778 Ga0495634_0039209 3300046642 Bacteria 3226
779 Ga0495634_0399756 3300046642 Bacteria 816
780 Ga0495625_0126680 3300046660 Bacteria 1733
781 Ga0495635_0001470 3300046663 Bacteria 15756
782 Ga0495635_0004171 3300046663 Bacteria 10027
783 Ga0495635_0007010 3300046663 Bacteria 7871
784 Ga0495635_0009525 3300046663 Bacteria 6791
785 Ga0495635_0011615 3300046663 Bacteria 6172
786 Ga0495635_0106079 3300046663 Bacteria 1919
787 Ga0495635_0166724 3300046663 Bacteria 1498
788 Ga0495661_0097353 3300046665 Bacteria 1662
789 Ga0495588_0003831 3300046674 Bacteria 6590
790 Ga0495588_0003953 3300046674 Bacteria 6506
791 Ga0495588_0053089 3300046674 Bacteria 2089
792 Ga0495588_0152226 3300046674 Bacteria 1222
793 Ga0495657_0001306 3300046675 Bacteria 21707
794 Ga0495657_0002997 3300046675 Bacteria 13974
795 Ga0495657_0015844 3300046675 Bacteria 5506
796 Ga0495657_0018069 3300046675 Bacteria 5110
797 Ga0495657_0026868 3300046675 Bacteria 4070
798 Ga0495657_0031240 3300046675 Bacteria 3723
799 Ga0495657_0117127 3300046675 Bacteria 1681
800 Ga0495657_0119109 3300046675 Bacteria 1664
801 Ga0495599_0000586 3300046678 Bacteria 20765
802 Ga0495599_0013786 3300046678 Bacteria 5000
803 Ga0495599_0017225 3300046678 Bacteria 4491
804 Ga0495599_0032875 3300046678 Bacteria 3257
805 Ga0495599_0157154 3300046678 Bacteria 1406
806 Ga0495599_0276741 3300046678 Bacteria 1017
807 Ga0495599_0286370 3300046678 Bacteria 997
808 Ga0495623_0011033 3300046679 Bacteria 5846
809 Ga0495623_0025608 3300046679 Bacteria 3800
810 Ga0495623_0028084 3300046679 Bacteria 3622
811 Ga0495623_0105210 3300046679 Bacteria 1715
812 Ga0495623_0222949 3300046679 Bacteria 1073
813 Ga0495646_0001997 3300046680 Bacteria 12331
814 Ga0495646_0004086 3300046680 Bacteria 9157
815 Ga0495646_0077433 3300046680 Bacteria 1945
816 Ga0495646_0078280 3300046680 Bacteria 1932
817 Ga0495646_0125386 3300046680 Bacteria 1449
818 Ga0495647_0071573 3300046681 Bacteria 1389
819 Ga0495658_0176417 3300046683 Bacteria 1324
820 Ga0495658_0190920 3300046683 Bacteria 1273
821 Ga0495658_0211170 3300046683 Bacteria 1213
822 Ga0495613_0004734 3300046689 Bacteria 10209
823 Ga0495613_0007501 3300046689 Bacteria 8125
824 Ga0495613_0020520 3300046689 Bacteria 4926
825 Ga0495613_0021391 3300046689 Bacteria 4822
826 Ga0495613_0099713 3300046689 Bacteria 2098
827 Ga0495613_0160610 3300046689 Bacteria 1599
828 Ga0495613_0294506 3300046689 Bacteria 1124
829 Ga0495624_0002479 3300046690 Bacteria 13997
830 Ga0495624_0003841 3300046690 Bacteria 11079
831 Ga0495624_0099414 3300046690 Bacteria 1791
832 Ga0495624_0177106 3300046690 Bacteria 1300
833 Ga0495671_0003057 3300046692 Bacteria 10391
834 Ga0495649_0050387 3300046694 Bacteria 2260
835 Ga0495589_0077632 3300046794 Bacteria 1618
836 Ga0495589_0085818 3300046794 Bacteria 1529
837 Ga0495600_0011071 3300046809 Bacteria 5613
838 Ga0495600_0020662 3300046809 Bacteria 4210
839 Ga0495600_0023159 3300046809 Bacteria 3994
840 Ga0495600_0042841 3300046809 Bacteria 2952
841 Ga0495600_0053588 3300046809 Bacteria 2634
842 Ga0495600_0083600 3300046809 Bacteria 2083
843 Ga0495600_0107389 3300046809 Bacteria 1818
844 Ga0495600_0116552 3300046809 Bacteria 1738
845 Ga0495600_0167578 3300046809 Bacteria 1419
846 Ga0495600_0624131 3300046809 Bacteria 653
847 Ga0495660_0001963 3300046810 Bacteria 13373
848 Ga0495581_0000387 3300047315 Bacteria 22065
849 Ga0495581_0130899 3300047315 Bacteria 1462
850 Ga0495581_0164789 3300047315 Bacteria 1296
851 Ga0495581_0544050 3300047315 Bacteria 674
852 Ga0495604_0001106 3300047317 Bacteria 22387
853 Ga0495604_0003229 3300047317 Bacteria 13031
854 Ga0495604_0009136 3300047317 Bacteria 7843
855 Ga0495604_0012046 3300047317 Bacteria 6874
856 Ga0495604_0104715 3300047317 Bacteria 2072
857 Ga0495604_0160908 3300047317 Bacteria 1586
858 Ga0495604_0170364 3300047317 Bacteria 1532
859 Ga0495636_0000438 3300047318 Bacteria 15441
860 Ga0495636_0035808 3300047318 Bacteria 2045
861 Ga0495636_0143436 3300047318 Bacteria 1068
862 Ga0495674_0001552 3300047319 Bacteria 22475
863 Ga0495674_0005450 3300047319 Bacteria 12224
864 Ga0495674_0009699 3300047319 Bacteria 9140
865 Ga0495674_0017433 3300047319 Bacteria 6681
866 Ga0495674_0043980 3300047319 Bacteria 3971
867 Ga0495674_0075032 3300047319 Bacteria 2910
868 Ga0495674_0095085 3300047319 Bacteria 2541
869 Ga0495674_0379806 3300047319 Bacteria 1143
870 Ga0495674_0482257 3300047319 Bacteria 993
871 Ga0495674_0625097 3300047319 Bacteria 851
872 Ga0495676_0005414 3300047321 Bacteria 11704
873 Ga0495676_0009385 3300047321 Bacteria 8914
874 Ga0495676_0011404 3300047321 Bacteria 8022
875 Ga0495676_0032408 3300047321 Bacteria 4411
876 Ga0495676_0041863 3300047321 Bacteria 3766
877 Ga0495676_0092220 3300047321 Bacteria 2261
878 Ga0495676_0115225 3300047321 Bacteria 1965
879 Ga0495680_0010224 3300047322 Bacteria 8377
880 Ga0495680_0019620 3300047322 Bacteria 5703
881 Ga0495680_0025003 3300047322 Bacteria 4945
882 Ga0495680_0032803 3300047322 Bacteria 4211
883 Ga0495680_0079882 3300047322 Bacteria 2472
884 Ga0495680_0081140 3300047322 Bacteria 2449
885 Ga0495680_0440802 3300047322 Bacteria 893
886 Ga0495687_005938 3300047443 Bacteria 7628
887 Ga0495687_028003 3300047443 Bacteria 2627
888 Ga0495687_031007 3300047443 Bacteria 2457
889 Ga0495675_0003847 3300047444 Bacteria 9091
890 Ga0495675_0008548 3300047444 Bacteria 6345
891 Ga0495675_0013329 3300047444 Bacteria 5188
892 Ga0495675_0022945 3300047444 Bacteria 3977
893 Ga0495675_0115463 3300047444 Bacteria 1674
894 Ga0495675_0127804 3300047444 Bacteria 1581
895 Ga0495675_0136363 3300047444 Bacteria 1523
896 Ga0495675_0593601 3300047444 Bacteria 628
897 Ga0495679_038092 3300047446 Bacteria 1508
898 Ga0495685_001997 3300047447 Bacteria 6326
899 Ga0495685_005377 3300047447 Bacteria 4178
900 Ga0495685_013011 3300047447 Bacteria 2822
901 Ga0495685_042817 3300047447 Bacteria 1545
902 Ga0495681_0001290 3300047470 Bacteria 18959
903 Ga0495681_0001442 3300047470 Bacteria 17856
904 Ga0495681_0293147 3300047470 Bacteria 631
905 Ga0495684_0001120 3300047471 Bacteria 21587
906 Ga0495684_0007472 3300047471 Bacteria 8463
907 Ga0495684_0024914 3300047471 Bacteria 4601
908 Ga0495684_0037692 3300047471 Bacteria 3708
909 Ga0495684_0061765 3300047471 Bacteria 2850
910 Ga0495684_0065307 3300047471 Bacteria 2766
911 Ga0495684_0081691 3300047471 Bacteria 2452
912 Ga0495686_0093942 3300047472 Bacteria 1818
913 Ga0495686_0109940 3300047472 Bacteria 1654
914 Ga0495686_0136991 3300047472 Bacteria 1447
915 Ga0495593_0012039 3300047673 Bacteria 4958
916 Ga0495593_0064534 3300047673 Bacteria 1911
917 Ga0495602_0002436 3300048088 Bacteria 18952
918 Ga0495602_0009848 3300048088 Bacteria 9917
919 Ga0495602_0036211 3300048088 Bacteria 4594
920 Ga0495602_0062413 3300048088 Bacteria 3233
921 Ga0495602_0069291 3300048088 Bacteria 3024
922 Ga0495602_0185647 3300048088 Bacteria 1599
923 Ga0495602_0205249 3300048088 Bacteria 1500
924 Ga0495614_0005911 3300048089 Bacteria 5513
925 Ga0495614_0013438 3300048089 Bacteria 3591
926 Ga0495614_0022455 3300048089 Bacteria 2723
927 Ga0495614_0045019 3300048089 Bacteria 1892
928 Ga0495614_0213870 3300048089 Bacteria 875
929 Ga0495626_0039673 3300048091 Bacteria 2227
930 Ga0496101_0220533 3300048904 Bacteria 1472
931 Ga0496102_0278313 3300048905 Bacteria 1577
932 Ga0496102_0523586 3300048905 Bacteria 1108
933 Ga0496102_0752197 3300048905 Bacteria 897
934 Ga0496104_0049596 3300048907 Bacteria 3958
935 Ga0496104_0068915 3300048907 Bacteria 3361
936 Ga0496104_0134924 3300048907 Bacteria 2371
937 Ga0496104_0210680 3300048907 Bacteria 1855
938 Ga0496105_0049682 3300048908 Bacteria 3463
939 Ga0496105_0112081 3300048908 Bacteria 2251
940 Ga0496105_0367101 3300048908 Bacteria 1147
941 Ga0496106_0318370 3300048909 Bacteria 1248
942 Ga0496106_0450811 3300048909 Bacteria 1033
943 Ga0496108_0008336 3300048911 Bacteria 8406
944 Ga0496108_0019781 3300048911 Bacteria 5531
945 Ga0496108_0081819 3300048911 Bacteria 2737
946 Ga0496108_0394038 3300048911 Bacteria 1209
947 Ga0496108_0529145 3300048911 Bacteria 1029
948 Ga0496109_0139668 3300048912 Bacteria 2265
949 Ga0496109_0144818 3300048912 Bacteria 2222
950 Ga0496109_0327779 3300048912 Bacteria 1445
951 Ga0496109_0393385 3300048912 Bacteria 1309
952 Ga0496109_0949058 3300048912 Bacteria 798
953 Ga0496110_0014330 3300048913 Bacteria 6578
954 Ga0496110_0125396 3300048913 Bacteria 2316
955 Ga0496110_0271977 3300048913 Bacteria 1542
956 Ga0496110_0308725 3300048913 Bacteria 1441
957 Ga0496110_0648454 3300048913 Bacteria 956
958 Ga0496111_0076344 3300048914 Bacteria 2442
959 Ga0496111_0282713 3300048914 Bacteria 1230
960 Ga0496112_0070472 3300048915 Bacteria 3455
961 Ga0496112_0457162 3300048915 Bacteria 1214
962 Ga0496113_0064948 3300048916 Bacteria 2761
963 Ga0496113_0429293 3300048916 Bacteria 1061
964 Ga0496113_1063887 3300048916 Bacteria 635
965 Ga0496114_0263897 3300048917 Bacteria 1517
966 Ga0496114_0515116 3300048917 Bacteria 1058
967 Ga0496114_0688441 3300048917 Bacteria 897
968 Ga0496114_0737975 3300048917 Bacteria 862
969 Ga0496115_0018146 3300048918 Bacteria 5395
970 Ga0496115_0156044 3300048918 Bacteria 1886
971 Ga0496117_0001948 3300048920 Bacteria 27543
972 Ga0496118_0000281 3300048921 Bacteria 89915
973 Ga0496118_0031647 3300048921 Bacteria 4380
974 Ga0496119_0217594 3300048922 Bacteria 979
975 Ga0496120_0077938 3300048923 Bacteria 1803
976 Ga0496120_0087380 3300048923 Bacteria 1674
977 Ga0496120_0140231 3300048923 Bacteria 1228
978 Ga0496122_0000932 3300048925 Bacteria 53407
979 Ga0496122_0017130 3300048925 Bacteria 6796
980 Ga0496122_0112660 3300048925 Bacteria 1781
981 Ga0496123_0143950 3300048926 Bacteria 1298
982 Ga0496124_0000323 3300048927 Bacteria 88352
983 Ga0496124_0078850 3300048927 Bacteria 2713
984 Ga0496125_0000046 3300048928 Bacteria 295288
985 Ga0496126_0095047 3300048929 Bacteria 2615
986 Ga0496126_0237989 3300048929 Bacteria 1522
987 Ga0496126_0601875 3300048929 Bacteria 866
988 Ga0501031_0017192 3300049568 Bacteria 4699
989 Ga0501031_0018698 3300049568 Bacteria 4511
990 Ga0501031_0372960 3300049568 Bacteria 923
991 Ga0501032_0012448 3300049569 Bacteria 6078
992 Ga0501032_0014613 3300049569 Bacteria 5561
993 Ga0501033_0010578 3300049570 Bacteria 7073
994 Ga0501033_0017508 3300049570 Bacteria 5413
995 Ga0501033_0018702 3300049570 Bacteria 5237
996 Ga0501033_0072888 3300049570 Bacteria 2521
997 Ga0501033_0201237 3300049570 Bacteria 1422
998 Ga0501033_0291511 3300049570 Bacteria 1150
999 Ga0501033_0543808 3300049570 Bacteria 800
1000 Ga0501034_0011151 3300049571 Bacteria 9326
1001 Ga0501034_0198578 3300049571 Bacteria 1964
1002 Ga0501034_0428811 3300049571 Bacteria 1242
1003 Ga0501034_0464413 3300049571 Bacteria 1182
1004 Ga0501034_0580020 3300049571 Bacteria 1028
1005 Ga0501036_0007744 3300049572 Bacteria 8779
1006 Ga0501036_0023838 3300049572 Bacteria 5156
1007 Ga0501036_0038163 3300049572 Bacteria 4065
1008 Ga0501036_0096722 3300049572 Bacteria 2496
1009 Ga0501036_0100920 3300049572 Bacteria 2441
1010 Ga0501036_0183614 3300049572 Bacteria 1760
1011 Ga0501036_0352950 3300049572 Bacteria 1228
1012 Ga0501037_0016357 3300049573 Bacteria 5458
1013 Ga0501037_0165035 3300049573 Bacteria 1577
1014 Ga0501037_0180642 3300049573 Bacteria 1497
1015 Ga0501038_0007000 3300049574 Bacteria 10415
1016 Ga0501038_0077247 3300049574 Bacteria 2811
1017 Ga0501038_0142158 3300049574 Bacteria 1962
1018 Ga0501038_0281814 3300049574 Bacteria 1308
1019 Ga0501038_0346303 3300049574 Bacteria 1158
1020 Ga0501038_0372844 3300049574 Bacteria 1108
1021 Ga0501038_0949855 3300049574 Bacteria 633
1022 Ga0501039_0019320 3300049575 Bacteria 5223
1023 Ga0501039_0154222 3300049575 Bacteria 1804
1024 Ga0501039_0172719 3300049575 Bacteria 1699
1025 Ga0501039_0641901 3300049575 Bacteria 831
1026 Ga0501040_0031362 3300049576 Bacteria 3591
1027 Ga0501041_0080366 3300049577 Bacteria 2007
1028 Ga0501042_0011553 3300049578 Bacteria 5960
1029 Ga0501042_0018216 3300049578 Bacteria 4859
1030 Ga0501042_0495654 3300049578 Bacteria 887
1031 Ga0501043_0020241 3300049579 Bacteria 5225
1032 Ga0501043_0034914 3300049579 Bacteria 3955
1033 Ga0501043_0099583 3300049579 Bacteria 2285
1034 Ga0501043_0160839 3300049579 Bacteria 1754
1035 Ga0501043_0214430 3300049579 Bacteria 1491
1036 Ga0501043_0546083 3300049579 Bacteria 861
1037 Ga0501046_0031801 3300049580 Bacteria 4275
1038 Ga0501046_0607840 3300049580 Bacteria 775
1039 Ga0501047_0011205 3300049581 Bacteria 8484
1040 Ga0501047_0127689 3300049581 Bacteria 2423
1041 Ga0501047_0151546 3300049581 Bacteria 2194
1042 Ga0501047_0156882 3300049581 Bacteria 2149
1043 Ga0501047_0254936 3300049581 Bacteria 1603
1044 Ga0501047_0421341 3300049581 Bacteria 1166
1045 Ga0501047_0580488 3300049581 Bacteria 944
1046 Ga0501048_0096500 3300049582 Bacteria 2085
1047 Ga0501048_0271001 3300049582 Bacteria 1206
1048 Ga0501067_0008473 3300049583 Bacteria 5701
1049 Ga0501067_0033286 3300049583 Bacteria 2860
1050 Ga0501068_0030878 3300049584 Bacteria 3180
1051 Ga0501069_0004252 3300049585 Bacteria 7398
1052 Ga0501069_0130868 3300049585 Bacteria 1437
1053 Ga0501070_0000136 3300049586 Bacteria 66212
1054 Ga0501070_0001146 3300049586 Bacteria 23760
1055 Ga0501070_0031259 3300049586 Bacteria 4460
1056 Ga0501070_0268684 3300049586 Bacteria 1393
1057 Ga0501070_1079592 3300049586 Bacteria 620
1058 Ga0501071_0224432 3300049587 Bacteria 1414
1059 Ga0501072_0001836 3300049588 Bacteria 15818
1060 Ga0501072_0394521 3300049588 Bacteria 1098
1061 Ga0501073_0041443 3300049589 Bacteria 3253
1062 Ga0501074_0032353 3300049590 Bacteria 3789
1063 Ga0501074_0244197 3300049590 Bacteria 1277
1064 Ga0501076_0015385 3300049592 Bacteria 5781
1065 Ga0501079_0032262 3300049741 Bacteria 4026
1066 Ga0501080_0797301 3300049742 Bacteria 828
1067 Ga0501083_0000054 3300049744 Bacteria 82311
1068 Ga0501083_0032265 3300049744 Bacteria 3593
1069 Ga0501083_0037458 3300049744 Bacteria 3303
1070 Ga0501083_0045706 3300049744 Bacteria 2961
1071 Ga0501035_0022720 3300049822 Bacteria 5760
1072 Ga0501035_0126701 3300049822 Bacteria 2229
1073 Ga0501035_0195494 3300049822 Bacteria 1737
1074 Ga0501035_0366323 3300049822 Bacteria 1203
1075 Ga0501035_0382666 3300049822 Bacteria 1173
1076 Ga0501035_0710052 3300049822 Bacteria 810
1077 Ga0501035_0858576 3300049822 Bacteria 721
1078 Ga0501044_0011787 3300049823 Bacteria 9471
1079 Ga0501044_0013803 3300049823 Bacteria 8731
1080 Ga0501044_0050248 3300049823 Bacteria 4304
1081 Ga0501044_0066464 3300049823 Bacteria 3676
1082 Ga0501044_0115433 3300049823 Bacteria 2690
1083 Ga0501044_0154204 3300049823 Bacteria 2277
1084 Ga0501044_0267730 3300049823 Bacteria 1645
1085 Ga0501044_0270793 3300049823 Bacteria 1634
1086 Ga0501044_0773640 3300049823 Bacteria 841
1087 Ga0501045_0054329 3300049824 Bacteria 2928
1088 Ga0501045_0061161 3300049824 Bacteria 2762
1089 Ga0501045_0459643 3300049824 Bacteria 946
1090 Ga0501045_0986226 3300049824 Bacteria 618
1091 nmdc:mga0yw44_569802_c1 3300050492 Bacteria 769
1092 nmdc:mga06z11_24830_c1 3300050494 Bacteria 2833
1093 nmdc:mga07m45_76877_c1 3300050496 Bacteria 1021
1094 nmdc:mga05p37_157_c1 3300050507 Bacteria 65045
1095 nmdc:mga05p37_342930_c1 3300050507 Bacteria 1761
1096 nmdc:mga09592_79_c1 3300050508 Bacteria 56100
1097 nmdc:mga0qj67_3105_c1 3300050509 Bacteria 11948
1098 nmdc:mga06r32_122_c1 3300050510 Bacteria 55812
1099 nmdc:mga06r32_13530_c1 3300050510 Bacteria 7395
1100 nmdc:mga06r32_634560_c1 3300050510 Bacteria 1037
1101 nmdc:mga08y16_48899_c1 3300050511 Bacteria 4426
1102 nmdc:mga0n895_721235_c1 3300050512 Bacteria 992
1103 nmdc:mga0rr50_129393_c1 3300050513 Bacteria 2019
1104 nmdc:mga08x19_379702_c1 3300050514 Bacteria 989
1105 nmdc:mga0a205_81869_c1 3300050515 Bacteria 3118
1106 Ga0495601_0000332 3300053077 Bacteria 25050
1107 Ga0495601_0038831 3300053077 Bacteria 2978
1108 Ga0495612_0102143 3300053078 Bacteria 1221
1109 Ga0495612_0129500 3300053078 Bacteria 1090
1110 Ga0495612_0205760 3300053078 Bacteria 869
1111 Ga0495655_0152085 3300053083 Bacteria 728
1112 Ga0495655_0159222 3300053083 Bacteria 715
1113 Ga0495595_0013001 3300053084 Bacteria 3512
1114 Ga0495595_0048713 3300053084 Bacteria 1957
1115 Ga0495619_0000631 3300053085 Bacteria 23277
1116 Ga0495619_0093989 3300053085 Bacteria 2033
1117 Ga0495619_0230653 3300053085 Bacteria 1283
1118 Ga0495619_0346501 3300053085 Bacteria 1028
1119 Ga0500578_0089792 3300053086 Bacteria 1950
1120 Ga0500643_104316 3300053087 Bacteria 768
1121 Ga0500646_0019355 3300053090 Bacteria 1801
1122 Ga0500566_0099411 3300053094 Bacteria 1597
1123 Ga0500640_054127 3300053095 Bacteria 1750
1124 Ga0500641_0171518 3300053096 Bacteria 934
1125 Ga0500650_0073898 3300053098 Bacteria 1594
1126 Ga0500654_083773 3300053099 Bacteria 1467
1127 Ga0500660_173794 3300053100 Bacteria 791
1128 Ga0500660_174544 3300053100 Bacteria 788
1129 Ga0500553_109891 3300053101 Bacteria 1163
1130 Ga0500560_023614 3300053107 Bacteria 1785
1131 Ga0500569_030598 3300053109 Bacteria 1507
1132 Ga0500572_042620 3300053111 Bacteria 1323
1133 Ga0500628_002033 3300053129 Bacteria 3401
1134 Ga0500652_005655 3300053131 Bacteria 3957
1135 Ga0500652_259779 3300053131 Bacteria 685
1136 Ga0500658_0007329 3300053134 Bacteria 4073
1137 Ga0500568_0038991 3300053139 Bacteria 1921
1138 Ga0500573_0024379 3300053140 Bacteria 3478
1139 Ga0500573_0052883 3300053140 Bacteria 2335
1140 Ga0500573_0167612 3300053140 Bacteria 1190
1141 Ga0500579_115997 3300053143 Bacteria 1323
1142 Ga0500600_0009314 3300053149 Bacteria 5924
1143 Ga0500600_0078916 3300053149 Bacteria 1785
1144 Ga0500600_0152559 3300053149 Bacteria 1147
1145 Ga0500616_0000937 3300053153 Bacteria 31832
1146 Ga0500616_0002537 3300053153 Bacteria 15081
1147 Ga0500616_0011011 3300053153 Bacteria 5383
1148 Ga0500633_0014440 3300053160 Bacteria 2241
1149 Ga0500634_0013772 3300053161 Bacteria 4250
1150 Ga0500636_0126981 3300053177 Bacteria 1425
1151 Ga0500656_000948 3300053732 Bacteria 2349
1152 Ga0500587_023946 3300053739 Bacteria 808
1153 Ga0501084_0020440 3300054114 Bacteria 5520
1154 Ga0501082_0040131 3300060353 Bacteria 4038
1155 Ga0501082_0140328 3300060353 Bacteria 2097
1156 Ga0466962_0001961 3300061719 Bacteria 9700
1157 Ga0466962_0031313 3300061719 Bacteria 2547
1158 Ga0466962_0113769 3300061719 Bacteria 1303
1159 Ga0530510_0133200 3300061734 Bacteria 1829
1160 Ga0530510_0624987 3300061734 Bacteria 820
1161 2644112798 2643221619 Bacteria 4158469
1162 2739325385 2738543027 Bacteria 6409078
1163 2753300611 2751185788 Bacteria 4541048
1164 2811845544 2808606982 Bacteria 7791042
1165 2919045287 2919042368 Bacteria 3905917
1166 2928107243 2928104781 Bacteria 3877447
1167 2984552693 2984551494 Bacteria 3877562
1168 2997454644 2997451912 Bacteria 8492419
1169 3006488735 3006486233 Bacteria 8157040
1170 8056584292 8056579771 Bacteria 5840325
1171 Ga0466966_0102198
1172 JGI24738J21930_10008425
1173 JGI25406J46586_10004301
1174 rootH1_10032962
1175 JGI25404J52841_10000840
1176 Ga0070658_10376890
1177 Ga0070658_10849975
1178 Ga0070683_100149075
1179 Ga0068869_100372631
1180 Ga0070680_100412007
1181 Ga0068868_100463071
1182 Ga0070689_100436095
1183 Ga0070691_10043293
1184 Ga0070661_100115318
1185 Ga0070671_100174458
1186 Ga0070674_100268267
1187 Ga0070688_100480771
1188 Ga0070659_100361431
1189 Ga0070667_100342896
1190 Ga0070667_100562470
1191 Ga0070709_10004323
1192 Ga0070709_10027218
1193 Ga0070709_10071763
1194 Ga0070709_10165665
1195 Ga0070709_10233263
1196 Ga0070709_10280081
1197 Ga0070709_10287678
1198 Ga0070709_10369094
1199 Ga0070714_100001697
1200 Ga0070714_100047065
1201 Ga0070714_100081825
1202 Ga0070714_100219601
1203 Ga0070714_100351597
1204 Ga0070713_100050913
1205 Ga0070713_100067512
1206 Ga0070713_100070007
1207 Ga0070713_100379717
1208 Ga0070713_100403878
1209 Ga0070713_100728926
1210 Ga0070710_10030286
1211 Ga0070710_10042309
1212 Ga0070710_10518263
1213 Ga0070711_100003207
1214 Ga0070711_100104503
1215 Ga0070711_100408588
1216 Ga0070705_100662064
1217 Ga0070694_100252097
1218 Ga0070708_100035975
1219 Ga0070708_100070626
1220 Ga0070708_100097588
1221 Ga0070708_100331166
1222 Ga0070708_100698818
1223 Ga0070663_100052981
1224 Ga0070678_100269342
1225 Ga0070678_100451871
1226 Ga0070681_10364410
1227 Ga0070706_100026879
1228 Ga0070706_100056913
1229 Ga0070706_100227311
1230 Ga0070706_100381013
1231 Ga0070707_100001995
1232 Ga0070707_100012337
1233 Ga0070707_100044553
1234 Ga0070707_100152894
1235 Ga0070707_100418862
1236 Ga0070707_100446700
1237 Ga0070698_100014291
1238 Ga0070698_100047878
1239 Ga0070698_100052393
1240 Ga0070698_100093936
1241 Ga0070699_100007506
1242 Ga0070699_100103497
1243 Ga0070699_101059651
1244 Ga0070679_100238057
1245 Ga0070679_100619123
1246 Ga0070684_100172021
1247 Ga0070684_100390342
1248 Ga0070684_101003214
1249 Ga0070697_100016077
1250 Ga0070697_100402463
1251 Ga0070697_100550488
1252 Ga0070697_101187562
1253 Ga0068853_100399200
1254 Ga0070672_100405167
1255 Ga0070686_100209337
1256 Ga0070696_100075087
1257 Ga0070665_100139911
1258 Ga0070665_100593436
1259 Ga0070704_100789789
1260 Ga0068855_100002619
1261 Ga0068855_100043217
1262 Ga0068855_100453229
1263 Ga0068855_101480033
1264 Ga0070664_100292852
1265 Ga0068857_100619858
1266 Ga0068854_100213330
1267 Ga0068854_100326466
1268 Ga0068854_100597878
1269 Ga0068856_100057624
1270 Ga0068856_100139155
1271 Ga0068856_100185530
1272 Ga0068856_100221639
1273 Ga0068856_100373226
1274 Ga0068856_100434112
1275 Ga0068856_101037793
1276 Ga0070702_100544254
1277 Ga0068852_100208988
1278 Ga0068852_100266065
1279 Ga0068852_100339167
1280 Ga0068852_100778777
1281 Ga0068859_100916700
1282 Ga0068864_100234066
1283 Ga0068861_100584634
1284 Ga0068863_100111862
1285 Ga0068863_100152405
1286 Ga0068858_100242725
1287 Ga0068858_100369424
1288 Ga0081455_10009126
1289 Ga0081455_10018583
1290 Ga0081455_10078759
1291 Ga0081455_10181009
1292 Ga0081538_10001630
1293 Ga0081538_10053443
1294 Ga0081540_1000501
1295 Ga0081539_10001034
1296 Ga0081539_10032443
1297 Ga0070717_10004815
1298 Ga0070717_10016256
1299 Ga0070717_10021586
1300 Ga0070717_10048994
1301 Ga0070717_10171121
1302 Ga0070717_10209905
1303 Ga0070717_10252170
1304 Ga0070717_10255738
1305 Ga0070717_10906621
1306 Ga0070715_10006344
1307 Ga0070715_10309079
1308 Ga0070716_100005123
1309 Ga0070716_100153627
1310 Ga0070716_100214914
1311 Ga0070716_100456722
1312 Ga0070712_100013279
1313 Ga0070712_100020373
1314 Ga0070712_100043254
1315 Ga0070712_100243508
1316 Ga0070712_100581319
1317 Ga0097621_100342599
1318 Ga0097621_100652738
1319 Ga0075370_10143241
1320 Ga0068871_100218194
1321 Ga0075428_100005648
1322 Ga0075428_100069717
1323 Ga0075428_100675731
1324 Ga0075430_100449785
1325 Ga0075431_100003397
1326 Ga0075431_100005592
1327 Ga0075431_101311137
1328 Ga0075433_10023752
1329 Ga0075434_100095600
1330 Ga0075434_100700017
1331 Ga0075429_100000465
1332 Ga0075429_100245097
1333 Ga0075436_100037340
1334 Ga0075436_100082583
1335 Ga0097620_100916670
1336 Ga0099826_10183442
1337 Ga0075435_100127257
1338 Ga0075435_100878277
1339 Ga0075435_100965960
1340 Ga0099794_10055401
1341 Ga0099795_10092663
1342 Ga0105251_10003298
1343 Ga0105251_10148277
1344 Ga0105251_10202506
1345 Ga0105244_10020236
1346 Ga0105250_10173311
1347 Ga0105240_10200120
1348 Ga0105240_10331071
1349 Ga0105240_10340055
1350 Ga0111539_10007454
1351 Ga0111539_10523042
1352 Ga0105245_10007847
1353 Ga0105245_10009889
1354 Ga0105245_10064466
1355 Ga0105245_10565169
1356 Ga0105247_10052554
1357 Ga0105247_10120371
1358 Ga0105247_10275138
1359 Ga0105247_10468154
1360 Ga0114129_10039817
1361 Ga0114129_10079888
1362 Ga0114129_10623716
1363 Ga0105243_10138335
1364 Ga0105243_10251191
1365 Ga0105241_10023257
1366 Ga0105242_10373070
1367 Ga0105248_10291107
1368 Ga0105248_11002245
1369 Ga0105237_10176955
1370 Ga0105237_10333879
1371 Ga0105237_11449872
1372 Ga0105238_10533674
1373 Ga0105238_10637307
1374 Ga0105249_10147737
1375 Ga0105249_10382605
1376 Ga0105249_11581046
1377 Ga0099796_10092221
1378 Ga0105239_10125494
1379 Ga0105239_10152243
1380 Ga0105239_10650373
1381 Ga0105246_10000725
1382 Ga0157343_1005416
1383 Ga0157342_1010233
1384 Ga0157373_10205675
1385 Ga0157371_10156176
1386 Ga0157370_10035794
1387 Ga0157370_10319265
1388 Ga0157370_10376872
1389 Ga0157369_10000499
1390 Ga0157369_10011608
1391 Ga0157369_10077765
1392 Ga0157369_10093367
1393 Ga0157369_10096226
1394 Ga0157369_10194318
1395 Ga0157369_10267052
1396 Ga0157369_10424803
1397 Ga0157369_10489011
1398 Ga0157369_10812217
1399 Ga0157369_10960618
1400 Ga0157374_10051858
1401 Ga0157374_10128120
1402 Ga0157378_10182712
1403 Ga0157378_11643860
1404 Ga0163162_10985117
1405 Ga0157372_10070679
1406 Ga0157375_10026292
1407 Ga0157375_10145638
1408 Ga0157375_10270216
1409 Ga0157375_10611153
1410 Ga0182008_10025311
1411 Ga0157377_10182353
1412 Ga0157379_10244745
1413 Ga0157379_10252377
1414 Ga0182006_1075348
1415 Ga0182007_10000669
1416 Ga0183367_1015
1417 Ga0163161_10287909
1418 Ga0163161_10402296
1419 Ga0206356_11633797
1420 Ga0206353_10418018
1421 Ga0206353_11592386
1422 Ga0206353_11865961
1423 Ga0213874_10004260
1424 Ga0213875_10000989
1425 Ga0213875_10041640
1426 Ga0213875_10128178
1427 Ga0224712_10220279
1428 Ga0224712_10296545
1429 Ga0224572_1014734
1430 Ga0228598_1016371
1431 Ga0209563_102036
1432 Ga0209758_1009592
1433 Ga0207713_1005912
1434 Ga0207692_10087021
1435 Ga0207692_10198841
1436 Ga0207692_10224273
1437 Ga0207710_10136124
1438 Ga0207680_10398698
1439 Ga0207647_10016868
1440 Ga0207647_10154334
1441 Ga0207685_10015085
1442 Ga0207699_10034945
1443 Ga0207699_10155981
1444 Ga0207699_10201018
1445 Ga0207699_10831576
1446 Ga0207705_10148584
1447 Ga0207705_10679467
1448 Ga0207705_10721975
1449 Ga0207684_10018360
1450 Ga0207684_10032219
1451 Ga0207684_10167406
1452 Ga0207684_10222277
1453 Ga0207684_10401708
1454 Ga0207684_11045369
1455 Ga0207654_10068002
1456 Ga0207695_10002619
1457 Ga0207695_10094794
1458 Ga0207671_10000859
1459 Ga0207671_10351728
1460 Ga0207693_10013690
1461 Ga0207693_10035163
1462 Ga0207693_10049315
1463 Ga0207693_10096636
1464 Ga0207693_10103315
1465 Ga0207693_10249211
1466 Ga0207663_10030774
1467 Ga0207663_10044704
1468 Ga0207663_10065845
1469 Ga0207663_10167736
1470 Ga0207662_10134796
1471 Ga0207657_10536501
1472 Ga0207652_10265815
1473 Ga0207646_10002609
1474 Ga0207646_10014615
1475 Ga0207646_10044426
1476 Ga0207646_10220795
1477 Ga0207646_10274715
1478 Ga0207646_10391882
1479 Ga0207646_10480455
1480 Ga0207694_10002482
1481 Ga0207659_10158434
1482 Ga0207687_10034173
1483 Ga0207687_10062622
1484 Ga0207687_10612260
1485 Ga0207700_10020875
1486 Ga0207700_10059269
1487 Ga0207700_10080429
1488 Ga0207700_10427183
1489 Ga0207700_10596038
1490 Ga0207700_11004445
1491 Ga0207664_10001035
1492 Ga0207664_10015616
1493 Ga0207664_10040879
1494 Ga0207664_10063522
1495 Ga0207664_10140191
1496 Ga0207664_10416578
1497 Ga0207664_10602950
1498 Ga0207664_10654901
1499 Ga0207664_10678737
1500 Ga0207664_10809760
1501 Ga0207644_10191076
1502 Ga0207709_10488363
1503 Ga0207669_10198535
1504 Ga0207669_10472713
1505 Ga0207704_10839378
1506 Ga0207665_10001452
1507 Ga0207665_10001502
1508 Ga0207665_10023079
1509 Ga0207665_10058692
1510 Ga0207691_10749314
1511 Ga0207691_10885721
1512 Ga0207711_10018303
1513 Ga0207689_10071805
1514 Ga0207661_10074221
1515 Ga0207661_10318834
1516 Ga0207661_10837823
1517 Ga0207667_10042250
1518 Ga0207667_10189998
1519 Ga0207712_10095294
1520 Ga0207712_10147226
1521 Ga0207712_11108896
1522 Ga0207668_10135099
1523 Ga0207668_10404760
1524 Ga0207640_10150742
1525 Ga0207640_10238306
1526 Ga0207658_10316003
1527 Ga0207677_10434204
1528 Ga0207703_10060917
1529 Ga0207639_10059310
1530 Ga0207639_10523852
1531 Ga0207678_10009111
1532 Ga0207702_10048478
1533 Ga0207702_10087270
1534 Ga0207702_10231058
1535 Ga0207702_10245159
1536 Ga0207702_10703008
1537 Ga0207702_10778005
1538 Ga0207702_11040238
1539 Ga0207641_10054631
1540 Ga0207676_10509161
1541 Ga0207676_10634010
1542 Ga0207676_10816796
1543 Ga0207674_10151813
1544 Ga0207674_10406519
1545 Ga0207675_100080881
1546 Ga0207675_100182260
1547 Ga0207675_101671918
1548 Ga0207683_10124879
1549 Ga0207683_10241243
1550 Ga0207698_10158043
1551 Ga0209371_1032899
1552 Ga0209588_1101257
1553 Ga0207428_10006504
1554 Ga0268266_10075243
1555 Ga0268266_10396119
1556 Ga0268266_10775591
1557 Ga0268265_10590731
1558 Ga0268264_10488130
1559 Ga0307517_10075499
1560 Ga0307515_10014891
1561 Ga0307515_10162171
1562 Ga0265338_10001130
1563 Ga0268256_1037440
1564 Ga0307511_10000029
1565 Ga0307511_10091665
1566 Ga0307512_10003228
1567 Ga0307512_10011081
1568 Ga0316177_1221734
1569 Ga0316176_1068858
1570 Ga0314311_1078233
1571 Ga0316179_1056778
1572 Ga0265763_1007959
1573 Ga0265325_10015843
1574 Ga0265340_10030432
1575 Ga0265327_10000125
1576 Ga0265327_10032023
1577 Ga0307513_10001602
1578 Ga0307513_10023643
1579 Ga0307509_10013741
1580 Ga0307509_10033598
1581 Ga0307408_100483261
1582 Ga0307508_10008497
1583 Ga0307508_10017888
1584 Ga0307508_10023761
1585 Ga0307508_10238293
1586 Ga0307514_10003328
1587 Ga0307514_10005036
1588 Ga0307514_10064296
1589 Ga0307514_10323710
1590 Ga0316575_10000004
1591 Ga0265314_10308469
1592 Ga0316576_10003726
1593 Ga0316576_10005029
1594 Ga0316576_10073932
1595 Ga0316576_10570502
1596 Ga0316578_10014563
1597 Ga0316578_10114663
1598 Ga0307516_10005315
1599 Ga0307516_10024874
1600 Ga0307516_10059173
1601 Ga0307516_10404495
1602 Ga0307413_10096162
1603 Ga0307518_10078872
1604 Ga0307518_10223755
1605 Ga0307410_10271906
1606 Ga0307406_10204985
1607 Ga0307406_10216661
1608 Ga0307406_10402030
1609 Ga0307407_10266075
1610 Ga0307407_10492292
1611 Ga0307409_100134687
1612 Ga0307409_100176188
1613 Ga0307409_101029367
1614 Ga0307416_100116514
1615 Ga0307416_101085501
1616 Ga0307415_100040118
1617 Ga0307415_100102738
1618 Ga0307507_10041134
1619 Ga0307507_10041576
1620 Ga0307507_10200653
1621 Ga0307510_10015231
1622 Ga0307510_10044243
1623 Ga0307510_10113562
1624 Ga0316214_1032490
1625 Ga0373930_0056299
1626 Ga0373958_0071359
1627 Ga0373926_0000170
1628 Ga0373926_0005176
1629 Ga0373926_0006409
1630 Ga0373929_0063085
1631 Ga0373934_0026026
1632 Ga0373934_0100822
1633 Ga0373944_0000752
1634 Ga0373944_0158924
1635 Ga0373923_0000684
1636 Ga0373923_0006064
1637 Ga0373923_0078035
1638 Ga0373923_0242864
1639 Ga0373936_0004356
1640 Ga0373936_0009278
1641 Ga0373945_0000905
1642 Ga0373945_0001739
1643 Ga0373953_0043135
1644 Ga0373953_0106813
1645 Ga0373953_0221865
1646 Ga0373954_0061604
1647 Ga0373954_0285494
1648 Ga0373954_0402460
1649 Ga0373956_0009402
1650 Ga0373956_0012461
1651 Ga0373956_0154077
1652 Ga0373957_0039081
1653 Ga0373957_0175531
1654 Ga0373943_0002847
1655 Ga0373943_0002993
1656 Ga0373943_0048327
1657 Ga0373946_0002040
1658 Ga0373946_0005679
1659 Ga0373955_0009135
1660 Ga0373955_0023797
1661 Ga0373955_0101129
1662 Ga0373955_0109720
1663 Ga0373955_0243003
1664 Ga0316574_0008888
1665 Ga0316574_0027835
1666 Ga0316574_0352280
1667 Ga0373924_0010452
1668 Ga0373924_0025616
1669 Ga0373924_0042315
1670 Ga0373924_0065690
1671 Ga0373935_0000585
1672 Ga0373935_0000925
1673 Ga0373935_0012498
1674 Ga0373927_0001256
1675 Ga0373927_0012374
1676 Ga0373927_0236113
1677 Ga0373927_0563742
1678 Ga0373933_0016337
1679 Ga0373933_0121739
1680 Ga0373933_0126130
1681 Ga0373947_0000285
1682 Ga0373947_0004745
1683 Ga0373947_0038584
1684 Ga0373947_0097265
1685 Ga0373947_0847609
1686 Ga0373937_0030477
1687 Ga0373937_0055981
1688 Ga0373937_0154482
1689 Ga0373937_0163309
1690 Ga0373937_0215587
1691 Ga0316582_0639592
1692 Ga0316584_0747821
1693 Ga0373925_0001910
1694 Ga0373925_0014948
1695 Ga0373925_0028939
1696 Ga0373925_0164052
1697 Ga0373925_0460067
1698 Ga0395899_0156073
1699 Ga0395900_0027051
1700 Ga0395898_0011730
1701 Ga0395898_0191058
1702 Ga0436364_0454301
1703 Ga0436364_0841312
1704 Ga0436364_0912466
1705 Ga0436364_0937718
1706 Ga0436364_1073971
1707 Ga0436364_1347787
1708 Ga0436364_1503455
1709 Ga0436364_1544337
1710 Ga0395901_0047110
1711 Ga0395901_0063285
1712 Ga0436365_0595644
1713 Ga0436360_0005371
1714 Ga0436363_0002297
1715 Ga0436363_0169319
1716 Ga0436363_0232657
1717 Ga0436363_1064625
1718 Ga0439436_0006090
1719 Ga0439439_0030632
1720 Ga0451797_1461308
1721 Ga0451807_2562875
1722 Ga0451833_1112365
1723 Ga0451837_0454087
1724 Ga0451841_0471427
1725 Ga0451853_0334494
1726 Ga0451853_2740783
1727 Ga0451853_3121249
1728 Ga0439432_079878
1729 Ga0439449_0004271
1730 Ga0439449_0067602
1731 Ga0439457_002218
1732 Ga0450894_000953
1733 Ga0450898_000877
1734 Ga0450899_001207
1735 Ga0450900_044651
1736 Ga0450903_000200
1737 Ga0450906_000555
1738 Ga0450907_033465
1739 Ga0466969_0012742
1740 Ga0466969_0072606
1741 Ga0466969_0077513
1742 Ga0466972_0032963
1743 Ga0466972_0048025
1744 Ga0466972_0058433
1745 Ga0466972_0059694
1746 Ga0466972_0078797
1747 Ga0466965_0002184
1748 Ga0466965_0099239
1749 Ga0466966_0005485
1750 Ga0466966_0015625
1751 Ga0466966_0077165
1752 Ga0466966_0093000
1753 Ga0466966_0112624
1754 Ga0466961_0004352
1755 Ga0466961_0009683
1756 Ga0466961_0031272
1757 Ga0466961_0180555
1758 Ga0466961_0183769
1759 Ga0466963_0004623
1760 Ga0466963_0196081
1761 Ga0466964_0035392
1762 Ga0466971_0000731
1763 Ga0466971_0029407
1764 Ga0466971_0045827
1765 Ga0466971_0092094
1766 Ga0466971_0097165
1767 Ga0466968_0008647
1768 Ga0466970_0000891
1769 Ga0466970_0007398
1770 Ga0466970_0007838
1771 Ga0466970_0138245
1772 Ga0466970_0175804
1773 Ga0466957_0000553
1774 Ga0466957_0097799
1775 Ga0466957_0223446
1776 Ga0466960_0089672
1777 Ga0466959_0002672
1778 Ga0466959_0003442
1779 Ga0466959_0025188
1780 Ga0466959_0156759
1781 Ga0466958_0017827
1782 Ga0466958_0513665
1783 Ga0466967_0042072
1784 Ga0466967_0114528
1785 Ga0466967_0299084
1786 Ga0466967_0708642
1787 Ga0495627_014698
1788 Ga0495627_043162
1789 Ga0495592_0002271
1790 Ga0495592_0003737
1791 Ga0495592_0040543
1792 Ga0495592_0055075
1793 Ga0495592_0065729
1794 Ga0495592_0127132
1795 Ga0495592_0145161
1796 Ga0495592_0397598
1797 Ga0495592_0584936
1798 Ga0495603_0002831
1799 Ga0495603_0005656
1800 Ga0495603_0011462
1801 Ga0495603_0023323
1802 Ga0495603_0240253
1803 Ga0495603_0390470
1804 Ga0495603_0466101
1805 Ga0495629_0001126
1806 Ga0495629_0003859
1807 Ga0495629_0006498
1808 Ga0495629_0021301
1809 Ga0495629_0036334
1810 Ga0495629_0101287
1811 Ga0495629_0124429
1812 Ga0495629_0181995
1813 Ga0495638_0042577
1814 Ga0495638_0069420
1815 Ga0495638_0109151
1816 Ga0495638_0124370
1817 Ga0495641_0002343
1818 Ga0495641_0014347
1819 Ga0495651_0010645
1820 Ga0495651_0028367
1821 Ga0495651_0048595
1822 Ga0495651_0072280
1823 Ga0495651_0076100
1824 Ga0495651_0151434
1825 Ga0495651_0159825
1826 Ga0495651_0324899
1827 Ga0495651_0517848
1828 Ga0495653_0006927
1829 Ga0495653_0008832
1830 Ga0495653_0010809
1831 Ga0495653_0016905
1832 Ga0495653_0028580
1833 Ga0495653_0104005
1834 Ga0495653_0300443
1835 Ga0495580_0005592
1836 Ga0495580_0025433
1837 Ga0495582_0003441
1838 Ga0495582_0027255
1839 Ga0495582_0041255
1840 Ga0495582_0102471
1841 Ga0495639_0005098
1842 Ga0495639_0142985
1843 Ga0495662_0000778
1844 Ga0495662_0002509
1845 Ga0495662_0004864
1846 Ga0495662_0009607
1847 Ga0495662_0011366
1848 Ga0495662_0014930
1849 Ga0495662_0017662
1850 Ga0495662_0069482
1851 Ga0495662_0074306
1852 Ga0495664_0000391
1853 Ga0495664_0006849
1854 Ga0495664_0015064
1855 Ga0495664_0018080
1856 Ga0495664_0093898
1857 Ga0495664_0146869
1858 Ga0495664_0227240
1859 Ga0495664_0256009
1860 Ga0495585_0034278
1861 Ga0495594_0005801
1862 Ga0495594_0007517
1863 Ga0495594_0023705
1864 Ga0495594_0216489
1865 Ga0495594_0383090
1866 Ga0495608_0001231
1867 Ga0495608_0015515
1868 Ga0495608_0044086
1869 Ga0495608_0143318
1870 Ga0495608_0220098
1871 Ga0495618_0043137
1872 Ga0495618_0049082
1873 Ga0495618_0072533
1874 Ga0495618_0104235
1875 Ga0495618_0177683
1876 Ga0495618_0284593
1877 Ga0495628_0002991
1878 Ga0495628_0014635
1879 Ga0495628_0121244
1880 Ga0495628_0133599
1881 Ga0495628_0216717
1882 Ga0495628_0217030
1883 Ga0495628_0260591
1884 Ga0495628_0395195
1885 Ga0495630_0000703
1886 Ga0495630_0018884
1887 Ga0495630_0130447
1888 Ga0495630_0264684
1889 Ga0495630_0542491
1890 Ga0495631_0283925
1891 Ga0495632_0054684
1892 Ga0495637_0099018
1893 Ga0495643_0001615
1894 Ga0495643_0177995
1895 Ga0495666_0012169
1896 Ga0495652_0001872
1897 Ga0495652_0014592
1898 Ga0495652_0027773
1899 Ga0495652_0074965
1900 Ga0495652_0108941
1901 Ga0495652_0153565
1902 Ga0495652_0165159
1903 Ga0495652_0194738
1904 Ga0495652_0297261
1905 Ga0495652_0319829
1906 Ga0495665_0043023
1907 Ga0495665_0053415
1908 Ga0495665_0307616
1909 Ga0495640_0001053
1910 Ga0495640_0029936
1911 Ga0495640_0030511
1912 Ga0495640_0045950
1913 Ga0495640_0069695
1914 Ga0495640_0105120
1915 Ga0495640_0291198
1916 Ga0495586_0007632
1917 Ga0495586_0012479
1918 Ga0495586_0104890
1919 Ga0495586_0324136
1920 Ga0495587_0003902
1921 Ga0495587_0004174
1922 Ga0495587_0006375
1923 Ga0495587_0013196
1924 Ga0495587_0019644
1925 Ga0495587_0033613
1926 Ga0495645_0000506
1927 Ga0495645_0010307
1928 Ga0495645_0028178
1929 Ga0495645_0199310
1930 Ga0495645_0224325
1931 Ga0495645_0233777
1932 Ga0495645_0233954
1933 Ga0495645_0296287
1934 Ga0495622_0017899
1935 Ga0495622_0047424
1936 Ga0495622_0066701
1937 Ga0495622_0124324
1938 Ga0495633_0095871
1939 Ga0495667_0001397
1940 Ga0495667_0023079
1941 Ga0495667_0026280
1942 Ga0495667_0047033
1943 Ga0495667_0142129
1944 Ga0495634_0001317
1945 Ga0495634_0017477
1946 Ga0495634_0017724
1947 Ga0495634_0019430
1948 Ga0495634_0039209
1949 Ga0495634_0399756
1950 Ga0495625_0126680
1951 Ga0495635_0001470
1952 Ga0495635_0004171
1953 Ga0495635_0007010
1954 Ga0495635_0009525
1955 Ga0495635_0011615
1956 Ga0495635_0106079
1957 Ga0495635_0166724
1958 Ga0495661_0097353
1959 Ga0495588_0003831
1960 Ga0495588_0003953
1961 Ga0495588_0053089
1962 Ga0495588_0152226
1963 Ga0495657_0001306
1964 Ga0495657_0002997
1965 Ga0495657_0015844
1966 Ga0495657_0018069
1967 Ga0495657_0026868
1968 Ga0495657_0031240
1969 Ga0495657_0117127
1970 Ga0495657_0119109
1971 Ga0495599_0000586
1972 Ga0495599_0013786
1973 Ga0495599_0017225
1974 Ga0495599_0032875
1975 Ga0495599_0157154
1976 Ga0495599_0276741
1977 Ga0495599_0286370
1978 Ga0495623_0011033
1979 Ga0495623_0025608
1980 Ga0495623_0028084
1981 Ga0495623_0105210
1982 Ga0495623_0222949
1983 Ga0495646_0001997
1984 Ga0495646_0004086
1985 Ga0495646_0077433
1986 Ga0495646_0078280
1987 Ga0495646_0125386
1988 Ga0495647_0071573
1989 Ga0495658_0176417
1990 Ga0495658_0190920
1991 Ga0495658_0211170
1992 Ga0495613_0004734
1993 Ga0495613_0007501
1994 Ga0495613_0020520
1995 Ga0495613_0021391
1996 Ga0495613_0099713
1997 Ga0495613_0160610
1998 Ga0495613_0294506
1999 Ga0495624_0002479
2000 Ga0495624_0003841
2001 Ga0495624_0099414
2002 Ga0495624_0177106
2003 Ga0495671_0003057
2004 Ga0495649_0050387
2005 Ga0495589_0077632
2006 Ga0495589_0085818
2007 Ga0495600_0011071
2008 Ga0495600_0020662
2009 Ga0495600_0023159
2010 Ga0495600_0042841
2011 Ga0495600_0053588
2012 Ga0495600_0083600
2013 Ga0495600_0107389
2014 Ga0495600_0116552
2015 Ga0495600_0167578
2016 Ga0495600_0624131
2017 Ga0495660_0001963
2018 Ga0495581_0000387
2019 Ga0495581_0130899
2020 Ga0495581_0164789
2021 Ga0495581_0544050
2022 Ga0495604_0001106
2023 Ga0495604_0003229
2024 Ga0495604_0009136
2025 Ga0495604_0012046
2026 Ga0495604_0104715
2027 Ga0495604_0160908
2028 Ga0495604_0170364
2029 Ga0495636_0000438
2030 Ga0495636_0035808
2031 Ga0495636_0143436
2032 Ga0495674_0001552
2033 Ga0495674_0005450
2034 Ga0495674_0009699
2035 Ga0495674_0017433
2036 Ga0495674_0043980
2037 Ga0495674_0075032
2038 Ga0495674_0095085
2039 Ga0495674_0379806
2040 Ga0495674_0482257
2041 Ga0495674_0625097
2042 Ga0495676_0005414
2043 Ga0495676_0009385
2044 Ga0495676_0011404
2045 Ga0495676_0032408
2046 Ga0495676_0041863
2047 Ga0495676_0092220
2048 Ga0495676_0115225
2049 Ga0495680_0010224
2050 Ga0495680_0019620
2051 Ga0495680_0025003
2052 Ga0495680_0032803
2053 Ga0495680_0079882
2054 Ga0495680_0081140
2055 Ga0495680_0440802
2056 Ga0495687_005938
2057 Ga0495687_028003
2058 Ga0495687_031007
2059 Ga0495675_0003847
2060 Ga0495675_0008548
2061 Ga0495675_0013329
2062 Ga0495675_0022945
2063 Ga0495675_0115463
2064 Ga0495675_0127804
2065 Ga0495675_0136363
2066 Ga0495675_0593601
2067 Ga0495679_038092
2068 Ga0495685_001997
2069 Ga0495685_005377
2070 Ga0495685_013011
2071 Ga0495685_042817
2072 Ga0495681_0001290
2073 Ga0495681_0001442
2074 Ga0495681_0293147
2075 Ga0495684_0001120
2076 Ga0495684_0007472
2077 Ga0495684_0024914
2078 Ga0495684_0037692
2079 Ga0495684_0061765
2080 Ga0495684_0065307
2081 Ga0495684_0081691
2082 Ga0495686_0093942
2083 Ga0495686_0109940
2084 Ga0495686_0136991
2085 Ga0495593_0012039
2086 Ga0495593_0064534
2087 Ga0495602_0002436
2088 Ga0495602_0009848
2089 Ga0495602_0036211
2090 Ga0495602_0062413
2091 Ga0495602_0069291
2092 Ga0495602_0185647
2093 Ga0495602_0205249
2094 Ga0495614_0005911
2095 Ga0495614_0013438
2096 Ga0495614_0022455
2097 Ga0495614_0045019
2098 Ga0495614_0213870
2099 Ga0495626_0039673
2100 Ga0496101_0220533
2101 Ga0496102_0278313
2102 Ga0496102_0523586
2103 Ga0496102_0752197
2104 Ga0496104_0049596
2105 Ga0496104_0068915
2106 Ga0496104_0134924
2107 Ga0496104_0210680
2108 Ga0496105_0049682
2109 Ga0496105_0112081
2110 Ga0496105_0367101
2111 Ga0496106_0318370
2112 Ga0496106_0450811
2113 Ga0496108_0008336
2114 Ga0496108_0019781
2115 Ga0496108_0081819
2116 Ga0496108_0394038
2117 Ga0496108_0529145
2118 Ga0496109_0139668
2119 Ga0496109_0144818
2120 Ga0496109_0327779
2121 Ga0496109_0393385
2122 Ga0496109_0949058
2123 Ga0496110_0014330
2124 Ga0496110_0125396
2125 Ga0496110_0271977
2126 Ga0496110_0308725
2127 Ga0496110_0648454
2128 Ga0496111_0076344
2129 Ga0496111_0282713
2130 Ga0496112_0070472
2131 Ga0496112_0457162
2132 Ga0496113_0064948
2133 Ga0496113_0429293
2134 Ga0496113_1063887
2135 Ga0496114_0263897
2136 Ga0496114_0515116
2137 Ga0496114_0688441
2138 Ga0496114_0737975
2139 Ga0496115_0018146
2140 Ga0496115_0156044
2141 Ga0496117_0001948
2142 Ga0496118_0000281
2143 Ga0496118_0031647
2144 Ga0496119_0217594
2145 Ga0496120_0077938
2146 Ga0496120_0087380
2147 Ga0496120_0140231
2148 Ga0496122_0000932
2149 Ga0496122_0017130
2150 Ga0496122_0112660
2151 Ga0496123_0143950
2152 Ga0496124_0000323
2153 Ga0496124_0078850
2154 Ga0496125_0000046
2155 Ga0496126_0095047
2156 Ga0496126_0237989
2157 Ga0496126_0601875
2158 Ga0501031_0017192
2159 Ga0501031_0018698
2160 Ga0501031_0372960
2161 Ga0501032_0012448
2162 Ga0501032_0014613
2163 Ga0501033_0010578
2164 Ga0501033_0017508
2165 Ga0501033_0018702
2166 Ga0501033_0072888
2167 Ga0501033_0201237
2168 Ga0501033_0291511
2169 Ga0501033_0543808
2170 Ga0501034_0011151
2171 Ga0501034_0198578
2172 Ga0501034_0428811
2173 Ga0501034_0464413
2174 Ga0501034_0580020
2175 Ga0501036_0007744
2176 Ga0501036_0023838
2177 Ga0501036_0038163
2178 Ga0501036_0096722
2179 Ga0501036_0100920
2180 Ga0501036_0183614
2181 Ga0501036_0352950
2182 Ga0501037_0016357
2183 Ga0501037_0165035
2184 Ga0501037_0180642
2185 Ga0501038_0007000
2186 Ga0501038_0077247
2187 Ga0501038_0142158
2188 Ga0501038_0281814
2189 Ga0501038_0346303
2190 Ga0501038_0372844
2191 Ga0501038_0949855
2192 Ga0501039_0019320
2193 Ga0501039_0154222
2194 Ga0501039_0172719
2195 Ga0501039_0641901
2196 Ga0501040_0031362
2197 Ga0501041_0080366
2198 Ga0501042_0011553
2199 Ga0501042_0018216
2200 Ga0501042_0495654
2201 Ga0501043_0020241
2202 Ga0501043_0034914
2203 Ga0501043_0099583
2204 Ga0501043_0160839
2205 Ga0501043_0214430
2206 Ga0501043_0546083
2207 Ga0501046_0031801
2208 Ga0501046_0607840
2209 Ga0501047_0011205
2210 Ga0501047_0127689
2211 Ga0501047_0151546
2212 Ga0501047_0156882
2213 Ga0501047_0254936
2214 Ga0501047_0421341
2215 Ga0501047_0580488
2216 Ga0501048_0096500
2217 Ga0501048_0271001
2218 Ga0501067_0008473
2219 Ga0501067_0033286
2220 Ga0501068_0030878
2221 Ga0501069_0004252
2222 Ga0501069_0130868
2223 Ga0501070_0000136
2224 Ga0501070_0001146
2225 Ga0501070_0031259
2226 Ga0501070_0268684
2227 Ga0501070_1079592
2228 Ga0501071_0224432
2229 Ga0501072_0001836
2230 Ga0501072_0394521
2231 Ga0501073_0041443
2232 Ga0501074_0032353
2233 Ga0501074_0244197
2234 Ga0501076_0015385
2235 Ga0501079_0032262
2236 Ga0501080_0797301
2237 Ga0501083_0000054
2238 Ga0501083_0032265
2239 Ga0501083_0037458
2240 Ga0501083_0045706
2241 Ga0501035_0022720
2242 Ga0501035_0126701
2243 Ga0501035_0195494
2244 Ga0501035_0366323
2245 Ga0501035_0382666
2246 Ga0501035_0710052
2247 Ga0501035_0858576
2248 Ga0501044_0011787
2249 Ga0501044_0013803
2250 Ga0501044_0050248
2251 Ga0501044_0066464
2252 Ga0501044_0115433
2253 Ga0501044_0154204
2254 Ga0501044_0267730
2255 Ga0501044_0270793
2256 Ga0501044_0773640
2257 Ga0501045_0054329
2258 Ga0501045_0061161
2259 Ga0501045_0459643
2260 Ga0501045_0986226
2261 nmdc:mga0yw44_569802_c1
2262 nmdc:mga06z11_24830_c1
2263 nmdc:mga07m45_76877_c1
2264 nmdc:mga05p37_157_c1
2265 nmdc:mga05p37_342930_c1
2266 nmdc:mga09592_79_c1
2267 nmdc:mga0qj67_3105_c1
2268 nmdc:mga06r32_122_c1
2269 nmdc:mga06r32_13530_c1
2270 nmdc:mga06r32_634560_c1
2271 nmdc:mga08y16_48899_c1
2272 nmdc:mga0n895_721235_c1
2273 nmdc:mga0rr50_129393_c1
2274 nmdc:mga08x19_379702_c1
2275 nmdc:mga0a205_81869_c1
2276 Ga0495601_0000332
2277 Ga0495601_0038831
2278 Ga0495612_0102143
2279 Ga0495612_0129500
2280 Ga0495612_0205760
2281 Ga0495655_0152085
2282 Ga0495655_0159222
2283 Ga0495595_0013001
2284 Ga0495595_0048713
2285 Ga0495619_0000631
2286 Ga0495619_0093989
2287 Ga0495619_0230653
2288 Ga0495619_0346501
2289 Ga0500578_0089792
2290 Ga0500643_104316
2291 Ga0500646_0019355
2292 Ga0500566_0099411
2293 Ga0500640_054127
2294 Ga0500641_0171518
2295 Ga0500650_0073898
2296 Ga0500654_083773
2297 Ga0500660_173794
2298 Ga0500660_174544
2299 Ga0500553_109891
2300 Ga0500560_023614
2301 Ga0500569_030598
2302 Ga0500572_042620
2303 Ga0500628_002033
2304 Ga0500652_005655
2305 Ga0500652_259779
2306 Ga0500658_0007329
2307 Ga0500568_0038991
2308 Ga0500573_0024379
2309 Ga0500573_0052883
2310 Ga0500573_0167612
2311 Ga0500579_115997
2312 Ga0500600_0009314
2313 Ga0500600_0078916
2314 Ga0500600_0152559
2315 Ga0500616_0000937
2316 Ga0500616_0002537
2317 Ga0500616_0011011
2318 Ga0500633_0014440
2319 Ga0500634_0013772
2320 Ga0500636_0126981
2321 Ga0500656_000948
2322 Ga0500587_023946
2323 Ga0501084_0020440
2324 Ga0501082_0040131
2325 Ga0501082_0140328
2326 Ga0466962_0001961
2327 Ga0466962_0031313
2328 Ga0466962_0113769
2329 Ga0530510_0133200
2330 Ga0530510_0624987
2331 2644112798
2332 2739325385
2333 2753300611
2334 2811845544
2335 2919045287
2336 2928107243
2337 2984552693
2338 2997454644
2339 3006488735
2340 8056584292

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22769

DCD

dCTP deaminase-like

2

155

0.97

PF00692

dUTPase

dUTPase

69

179

0.9

PF06559

DCD_N

2'-deoxycytidine 5'-triphosphate deaminase (DCD) N-terminal domain

1

156

0.84

PF22569

DCD_C

2'-deoxycytidine 5'-triphosphate deaminase (DCD), C-terminal domain

55

184

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qlp-assembly2.cif.gz_E bifunctional dctp deaminase:dutpase from mycobacterium tuberculosis, apo form 0.9582 1 159
2qxx-assembly1.cif.gz_A bifunctional dctp deaminase: dutpase from mycobacterium tuberculosis in complex with dttp 0.9546 1 189
2qlp-assembly2.cif.gz_E bifunctional dctp deaminase:dutpase from mycobacterium tuberculosis, apo form 0.9524 1 159
2qxx-assembly1.cif.gz_A bifunctional dctp deaminase: dutpase from mycobacterium tuberculosis in complex with dttp 0.9497 1 189
2v9x-assembly1.cif.gz_J e138d variant of escherichia coli dctp deaminase in complex with dutp 0.9456 1 162
ID Description Score Start End Superfamily
2qlpA01 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.957 1 154 2.70.40.10
2qlpA01 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.951 1 154 2.70.40.10
2v9xJ01 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9429 1 154 2.70.40.10
4a6aA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9407 1 189 2.70.40.10
2v9xJ01 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.937 1 154 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A6I3CM42-F1-model_v4 dCTP deaminase (EC 3.5.4.13) 0.9759 1 146 GO:0006229
GO:0008829
GO:0015949
AF-A0A536AAP7-F1-model_v4 dCTP deaminase (EC 3.5.4.13) 0.9759 1 105 GO:0006229
GO:0008829
GO:0015949
AF-A0A7X6EQA7-F1-model_v4 deleted 0.9727 74 163
AF-A0A7K0VV81-F1-model_v4 dCTP deaminase (EC 3.5.4.13) 0.9711 1 159 GO:0006229
GO:0008829
GO:0015949
AF-A0A6I3CM42-F1-model_v4 dCTP deaminase (EC 3.5.4.13) 0.9694 1 146 GO:0006229
GO:0008829
GO:0015949

Map