F491150
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1170 | 454 | 2340 | 192 |
Family's Representative Sequence
| Representative Sequence | 3300044684|Ga0466966_0102198|Ga0466966_0102198_579_1157 |
| Length | 192 |
| Sequence | VLLSDKDIRAELDSGRVVLDPWDPEMVQPSSVDVRLDKFFRLFDNHKYPFIDPAEEQPDLTRLVEVDGEEEAFVLHPGEFVLASTFETVTLPDDLAARVEGKSSLGRLGLLTHATAGFVDPGFSGHVTLELSNVATLPIKLYPGMKIGQLCFFRLTSPAEHPYGSGKYGSHYQGQRGPTASRSFQNFHRTHV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 77 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 78 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 97 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 117 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 118 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 120 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 121 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 178 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 179 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 181 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 182 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 183 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 184 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 185 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 186 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 187 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 189 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 190 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 191 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 192 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 195 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 196 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 199 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 200 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 203 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 206 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 209 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 210 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 211 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 212 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 213 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 215 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 216 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 220 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 225 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 229 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 234 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 236 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 237 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 239 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 240 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 241 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 242 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 243 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 244 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 245 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 246 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 247 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 248 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 251 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 252 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 253 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 254 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 255 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 256 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 257 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 258 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 259 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 260 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 261 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 262 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 263 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 264 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 265 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 266 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 267 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 270 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 271 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 272 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 273 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 274 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 275 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 276 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 277 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 278 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 348 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 349 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 350 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 351 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 354 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 355 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 356 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 357 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 358 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 359 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 360 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 361 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 362 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 363 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 364 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 365 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 366 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 367 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 368 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 399 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 400 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 416 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 417 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 418 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 419 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 420 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 421 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 422 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 423 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 424 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 425 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 426 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 427 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 428 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 429 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 430 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 431 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 432 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 433 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 434 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 435 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 436 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 437 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 438 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 439 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 440 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 441 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 444 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 445 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 446 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 447 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 448 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 449 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 450 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 451 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 452 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 453 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 454 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.55 |
| Metatranscriptomes | 0.6 |
| Isolates | 0.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.09 |
| Bulb | 0 |
| Endosphere | 3.42 |
| Nodule | 0.09 |
| Rhizoplane | 3.68 |
| Rhizosphere | 86.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466966_0102198 | 3300044684 | Bacteria | 1772 |
| 2 | JGI24738J21930_10008425 | 3300002075 | Bacteria | 2346 |
| 3 | JGI25406J46586_10004301 | 3300003203 | Bacteria | 6648 |
| 4 | rootH1_10032962 | 3300003323 | Bacteria | 3520 |
| 5 | JGI25404J52841_10000840 | 3300003659 | Bacteria | 4923 |
| 6 | Ga0070658_10376890 | 3300005327 | Bacteria | 1217 |
| 7 | Ga0070658_10849975 | 3300005327 | Bacteria | 793 |
| 8 | Ga0070683_100149075 | 3300005329 | Bacteria | 2217 |
| 9 | Ga0068869_100372631 | 3300005334 | Bacteria | 1168 |
| 10 | Ga0070680_100412007 | 3300005336 | Bacteria | 1153 |
| 11 | Ga0068868_100463071 | 3300005338 | Bacteria | 1105 |
| 12 | Ga0070689_100436095 | 3300005340 | Bacteria | 1113 |
| 13 | Ga0070691_10043293 | 3300005341 | Bacteria | 2133 |
| 14 | Ga0070661_100115318 | 3300005344 | Bacteria | 2009 |
| 15 | Ga0070671_100174458 | 3300005355 | Bacteria | 1818 |
| 16 | Ga0070674_100268267 | 3300005356 | Bacteria | 1348 |
| 17 | Ga0070688_100480771 | 3300005365 | Bacteria | 934 |
| 18 | Ga0070659_100361431 | 3300005366 | Bacteria | 1220 |
| 19 | Ga0070667_100342896 | 3300005367 | Bacteria | 1351 |
| 20 | Ga0070667_100562470 | 3300005367 | Bacteria | 1049 |
| 21 | Ga0070709_10004323 | 3300005434 | Bacteria | 7659 |
| 22 | Ga0070709_10027218 | 3300005434 | Bacteria | 3398 |
| 23 | Ga0070709_10071763 | 3300005434 | Bacteria | 2236 |
| 24 | Ga0070709_10165665 | 3300005434 | Bacteria | 1540 |
| 25 | Ga0070709_10233263 | 3300005434 | Bacteria | 1318 |
| 26 | Ga0070709_10280081 | 3300005434 | Bacteria | 1211 |
| 27 | Ga0070709_10287678 | 3300005434 | Bacteria | 1196 |
| 28 | Ga0070709_10369094 | 3300005434 | Bacteria | 1064 |
| 29 | Ga0070714_100001697 | 3300005435 | Bacteria | 16017 |
| 30 | Ga0070714_100047065 | 3300005435 | Bacteria | 3662 |
| 31 | Ga0070714_100081825 | 3300005435 | Bacteria | 2812 |
| 32 | Ga0070714_100219601 | 3300005435 | Bacteria | 1746 |
| 33 | Ga0070714_100351597 | 3300005435 | Bacteria | 1384 |
| 34 | Ga0070713_100050913 | 3300005436 | Bacteria | 3423 |
| 35 | Ga0070713_100067512 | 3300005436 | Bacteria | 3011 |
| 36 | Ga0070713_100070007 | 3300005436 | Bacteria | 2960 |
| 37 | Ga0070713_100379717 | 3300005436 | Bacteria | 1316 |
| 38 | Ga0070713_100403878 | 3300005436 | Bacteria | 1276 |
| 39 | Ga0070713_100728926 | 3300005436 | Bacteria | 947 |
| 40 | Ga0070710_10030286 | 3300005437 | Bacteria | 2910 |
| 41 | Ga0070710_10042309 | 3300005437 | Bacteria | 2518 |
| 42 | Ga0070710_10518263 | 3300005437 | Bacteria | 819 |
| 43 | Ga0070711_100003207 | 3300005439 | Bacteria | 9494 |
| 44 | Ga0070711_100104503 | 3300005439 | Bacteria | 2066 |
| 45 | Ga0070711_100408588 | 3300005439 | Bacteria | 1103 |
| 46 | Ga0070705_100662064 | 3300005440 | Bacteria | 815 |
| 47 | Ga0070694_100252097 | 3300005444 | Bacteria | 1335 |
| 48 | Ga0070708_100035975 | 3300005445 | Bacteria | 4317 |
| 49 | Ga0070708_100070626 | 3300005445 | Bacteria | 3142 |
| 50 | Ga0070708_100097588 | 3300005445 | Bacteria | 2686 |
| 51 | Ga0070708_100331166 | 3300005445 | Bacteria | 1435 |
| 52 | Ga0070708_100698818 | 3300005445 | Bacteria | 955 |
| 53 | Ga0070663_100052981 | 3300005455 | Bacteria | 2895 |
| 54 | Ga0070678_100269342 | 3300005456 | Bacteria | 1436 |
| 55 | Ga0070678_100451871 | 3300005456 | Bacteria | 1125 |
| 56 | Ga0070681_10364410 | 3300005458 | Bacteria | 1355 |
| 57 | Ga0070706_100026879 | 3300005467 | Bacteria | 5295 |
| 58 | Ga0070706_100056913 | 3300005467 | Bacteria | 3608 |
| 59 | Ga0070706_100227311 | 3300005467 | Bacteria | 1742 |
| 60 | Ga0070706_100381013 | 3300005467 | Bacteria | 1313 |
| 61 | Ga0070707_100001995 | 3300005468 | Bacteria | 19532 |
| 62 | Ga0070707_100012337 | 3300005468 | Bacteria | 7978 |
| 63 | Ga0070707_100044553 | 3300005468 | Bacteria | 4248 |
| 64 | Ga0070707_100152894 | 3300005468 | Bacteria | 2247 |
| 65 | Ga0070707_100418862 | 3300005468 | Bacteria | 1300 |
| 66 | Ga0070707_100446700 | 3300005468 | Bacteria | 1254 |
| 67 | Ga0070698_100014291 | 3300005471 | Bacteria | 8394 |
| 68 | Ga0070698_100047878 | 3300005471 | Bacteria | 4370 |
| 69 | Ga0070698_100052393 | 3300005471 | Bacteria | 4151 |
| 70 | Ga0070698_100093936 | 3300005471 | Bacteria | 2979 |
| 71 | Ga0070699_100007506 | 3300005518 | Bacteria | 9483 |
| 72 | Ga0070699_100103497 | 3300005518 | Bacteria | 2497 |
| 73 | Ga0070699_101059651 | 3300005518 | Bacteria | 744 |
| 74 | Ga0070679_100238057 | 3300005530 | Bacteria | 1778 |
| 75 | Ga0070679_100619123 | 3300005530 | Bacteria | 1026 |
| 76 | Ga0070684_100172021 | 3300005535 | Bacteria | 1967 |
| 77 | Ga0070684_100390342 | 3300005535 | Bacteria | 1283 |
| 78 | Ga0070684_101003214 | 3300005535 | Bacteria | 784 |
| 79 | Ga0070697_100016077 | 3300005536 | Bacteria | 5884 |
| 80 | Ga0070697_100402463 | 3300005536 | Bacteria | 1188 |
| 81 | Ga0070697_100550488 | 3300005536 | Bacteria | 1012 |
| 82 | Ga0070697_101187562 | 3300005536 | Bacteria | 680 |
| 83 | Ga0068853_100399200 | 3300005539 | Bacteria | 1287 |
| 84 | Ga0070672_100405167 | 3300005543 | Bacteria | 1169 |
| 85 | Ga0070686_100209337 | 3300005544 | Bacteria | 1403 |
| 86 | Ga0070696_100075087 | 3300005546 | Bacteria | 2384 |
| 87 | Ga0070665_100139911 | 3300005548 | Bacteria | 2424 |
| 88 | Ga0070665_100593436 | 3300005548 | Bacteria | 1121 |
| 89 | Ga0070704_100789789 | 3300005549 | Bacteria | 848 |
| 90 | Ga0068855_100002619 | 3300005563 | Bacteria | 22181 |
| 91 | Ga0068855_100043217 | 3300005563 | Bacteria | 5338 |
| 92 | Ga0068855_100453229 | 3300005563 | Bacteria | 1399 |
| 93 | Ga0068855_101480033 | 3300005563 | Bacteria | 698 |
| 94 | Ga0070664_100292852 | 3300005564 | Bacteria | 1470 |
| 95 | Ga0068857_100619858 | 3300005577 | Bacteria | 1024 |
| 96 | Ga0068854_100213330 | 3300005578 | Bacteria | 1524 |
| 97 | Ga0068854_100326466 | 3300005578 | Bacteria | 1249 |
| 98 | Ga0068854_100597878 | 3300005578 | Bacteria | 941 |
| 99 | Ga0068856_100057624 | 3300005614 | Bacteria | 3836 |
| 100 | Ga0068856_100139155 | 3300005614 | Bacteria | 2434 |
| 101 | Ga0068856_100185530 | 3300005614 | Bacteria | 2094 |
| 102 | Ga0068856_100221639 | 3300005614 | Bacteria | 1907 |
| 103 | Ga0068856_100373226 | 3300005614 | Bacteria | 1445 |
| 104 | Ga0068856_100434112 | 3300005614 | Bacteria | 1333 |
| 105 | Ga0068856_101037793 | 3300005614 | Bacteria | 838 |
| 106 | Ga0070702_100544254 | 3300005615 | Bacteria | 860 |
| 107 | Ga0068852_100208988 | 3300005616 | Bacteria | 1851 |
| 108 | Ga0068852_100266065 | 3300005616 | Bacteria | 1648 |
| 109 | Ga0068852_100339167 | 3300005616 | Bacteria | 1464 |
| 110 | Ga0068852_100778777 | 3300005616 | Bacteria | 970 |
| 111 | Ga0068859_100916700 | 3300005617 | Bacteria | 960 |
| 112 | Ga0068864_100234066 | 3300005618 | Bacteria | 1700 |
| 113 | Ga0068861_100584634 | 3300005719 | Bacteria | 1023 |
| 114 | Ga0068863_100111862 | 3300005841 | Bacteria | 2601 |
| 115 | Ga0068863_100152405 | 3300005841 | Bacteria | 2212 |
| 116 | Ga0068858_100242725 | 3300005842 | Bacteria | 1710 |
| 117 | Ga0068858_100369424 | 3300005842 | Bacteria | 1375 |
| 118 | Ga0081455_10009126 | 3300005937 | Bacteria | 10230 |
| 119 | Ga0081455_10018583 | 3300005937 | Bacteria | 6611 |
| 120 | Ga0081455_10078759 | 3300005937 | Bacteria | 2708 |
| 121 | Ga0081455_10181009 | 3300005937 | Bacteria | 1596 |
| 122 | Ga0081538_10001630 | 3300005981 | Bacteria | 22997 |
| 123 | Ga0081538_10053443 | 3300005981 | Bacteria | 2401 |
| 124 | Ga0081540_1000501 | 3300005983 | Bacteria | 38501 |
| 125 | Ga0081539_10001034 | 3300005985 | Bacteria | 51315 |
| 126 | Ga0081539_10032443 | 3300005985 | Bacteria | 3198 |
| 127 | Ga0070717_10004815 | 3300006028 | Bacteria | 9816 |
| 128 | Ga0070717_10016256 | 3300006028 | Bacteria | 5766 |
| 129 | Ga0070717_10021586 | 3300006028 | Bacteria | 5076 |
| 130 | Ga0070717_10048994 | 3300006028 | Bacteria | 3467 |
| 131 | Ga0070717_10171121 | 3300006028 | Bacteria | 1889 |
| 132 | Ga0070717_10209905 | 3300006028 | Bacteria | 1708 |
| 133 | Ga0070717_10252170 | 3300006028 | Bacteria | 1559 |
| 134 | Ga0070717_10255738 | 3300006028 | Bacteria | 1548 |
| 135 | Ga0070717_10906621 | 3300006028 | Bacteria | 802 |
| 136 | Ga0070715_10006344 | 3300006163 | Bacteria | 4017 |
| 137 | Ga0070715_10309079 | 3300006163 | Bacteria | 849 |
| 138 | Ga0070716_100005123 | 3300006173 | Bacteria | 6332 |
| 139 | Ga0070716_100153627 | 3300006173 | Bacteria | 1483 |
| 140 | Ga0070716_100214914 | 3300006173 | Bacteria | 1287 |
| 141 | Ga0070716_100456722 | 3300006173 | Bacteria | 932 |
| 142 | Ga0070712_100013279 | 3300006175 | Bacteria | 5260 |
| 143 | Ga0070712_100020373 | 3300006175 | Bacteria | 4340 |
| 144 | Ga0070712_100043254 | 3300006175 | Bacteria | 3100 |
| 145 | Ga0070712_100243508 | 3300006175 | Bacteria | 1433 |
| 146 | Ga0070712_100581319 | 3300006175 | Bacteria | 946 |
| 147 | Ga0097621_100342599 | 3300006237 | Bacteria | 1328 |
| 148 | Ga0097621_100652738 | 3300006237 | Bacteria | 965 |
| 149 | Ga0075370_10143241 | 3300006353 | Bacteria | 1398 |
| 150 | Ga0068871_100218194 | 3300006358 | Bacteria | 1651 |
| 151 | Ga0075428_100005648 | 3300006844 | Bacteria | 13901 |
| 152 | Ga0075428_100069717 | 3300006844 | Bacteria | 3844 |
| 153 | Ga0075428_100675731 | 3300006844 | Bacteria | 1101 |
| 154 | Ga0075430_100449785 | 3300006846 | Bacteria | 1063 |
| 155 | Ga0075431_100003397 | 3300006847 | Bacteria | 15429 |
| 156 | Ga0075431_100005592 | 3300006847 | Bacteria | 12411 |
| 157 | Ga0075431_101311137 | 3300006847 | Bacteria | 685 |
| 158 | Ga0075433_10023752 | 3300006852 | Bacteria | 5164 |
| 159 | Ga0075434_100095600 | 3300006871 | Bacteria | 2976 |
| 160 | Ga0075434_100700017 | 3300006871 | Bacteria | 1031 |
| 161 | Ga0075429_100000465 | 3300006880 | Bacteria | 30271 |
| 162 | Ga0075429_100245097 | 3300006880 | Bacteria | 1569 |
| 163 | Ga0075436_100037340 | 3300006914 | Bacteria | 3353 |
| 164 | Ga0075436_100082583 | 3300006914 | Bacteria | 2229 |
| 165 | Ga0097620_100916670 | 3300006931 | Bacteria | 960 |
| 166 | Ga0099826_10183442 | 3300006948 | Bacteria | 1161 |
| 167 | Ga0075435_100127257 | 3300007076 | Bacteria | 2130 |
| 168 | Ga0075435_100878277 | 3300007076 | Bacteria | 782 |
| 169 | Ga0075435_100965960 | 3300007076 | Bacteria | 744 |
| 170 | Ga0099794_10055401 | 3300007265 | Bacteria | 1916 |
| 171 | Ga0099795_10092663 | 3300007788 | Bacteria | 1173 |
| 172 | Ga0105251_10003298 | 3300009011 | Bacteria | 11807 |
| 173 | Ga0105251_10148277 | 3300009011 | Bacteria | 1060 |
| 174 | Ga0105251_10202506 | 3300009011 | Bacteria | 894 |
| 175 | Ga0105244_10020236 | 3300009036 | Bacteria | 3699 |
| 176 | Ga0105250_10173311 | 3300009092 | Bacteria | 904 |
| 177 | Ga0105240_10200120 | 3300009093 | Bacteria | 2341 |
| 178 | Ga0105240_10331071 | 3300009093 | Bacteria | 1733 |
| 179 | Ga0105240_10340055 | 3300009093 | Bacteria | 1705 |
| 180 | Ga0111539_10007454 | 3300009094 | Bacteria | 14017 |
| 181 | Ga0111539_10523042 | 3300009094 | Bacteria | 1382 |
| 182 | Ga0105245_10007847 | 3300009098 | Bacteria | 9344 |
| 183 | Ga0105245_10009889 | 3300009098 | Bacteria | 8306 |
| 184 | Ga0105245_10064466 | 3300009098 | Bacteria | 3311 |
| 185 | Ga0105245_10565169 | 3300009098 | Bacteria | 1161 |
| 186 | Ga0105247_10052554 | 3300009101 | Bacteria | 2512 |
| 187 | Ga0105247_10120371 | 3300009101 | Bacteria | 1700 |
| 188 | Ga0105247_10275138 | 3300009101 | Bacteria | 1160 |
| 189 | Ga0105247_10468154 | 3300009101 | Bacteria | 912 |
| 190 | Ga0114129_10039817 | 3300009147 | Bacteria | 6629 |
| 191 | Ga0114129_10079888 | 3300009147 | Bacteria | 4547 |
| 192 | Ga0114129_10623716 | 3300009147 | Bacteria | 1394 |
| 193 | Ga0105243_10138335 | 3300009148 | Bacteria | 2075 |
| 194 | Ga0105243_10251191 | 3300009148 | Bacteria | 1579 |
| 195 | Ga0105241_10023257 | 3300009174 | Bacteria | 4595 |
| 196 | Ga0105242_10373070 | 3300009176 | Bacteria | 1324 |
| 197 | Ga0105248_10291107 | 3300009177 | Bacteria | 1839 |
| 198 | Ga0105248_11002245 | 3300009177 | Bacteria | 944 |
| 199 | Ga0105237_10176955 | 3300009545 | Bacteria | 2134 |
| 200 | Ga0105237_10333879 | 3300009545 | Bacteria | 1520 |
| 201 | Ga0105237_11449872 | 3300009545 | Bacteria | 693 |
| 202 | Ga0105238_10533674 | 3300009551 | Bacteria | 1177 |
| 203 | Ga0105238_10637307 | 3300009551 | Bacteria | 1075 |
| 204 | Ga0105249_10147737 | 3300009553 | Bacteria | 2260 |
| 205 | Ga0105249_10382605 | 3300009553 | Bacteria | 1433 |
| 206 | Ga0105249_11581046 | 3300009553 | Bacteria | 728 |
| 207 | Ga0099796_10092221 | 3300010159 | Bacteria | 1128 |
| 208 | Ga0105239_10125494 | 3300010375 | Bacteria | 2852 |
| 209 | Ga0105239_10152243 | 3300010375 | Bacteria | 2581 |
| 210 | Ga0105239_10650373 | 3300010375 | Bacteria | 1204 |
| 211 | Ga0105246_10000725 | 3300011119 | Bacteria | 18696 |
| 212 | Ga0157343_1005416 | 3300012488 | Bacteria | 828 |
| 213 | Ga0157342_1010233 | 3300012507 | Bacteria | 956 |
| 214 | Ga0157373_10205675 | 3300013100 | Bacteria | 1388 |
| 215 | Ga0157371_10156176 | 3300013102 | Bacteria | 1628 |
| 216 | Ga0157370_10035794 | 3300013104 | Bacteria | 4822 |
| 217 | Ga0157370_10319265 | 3300013104 | Bacteria | 1433 |
| 218 | Ga0157370_10376872 | 3300013104 | Bacteria | 1307 |
| 219 | Ga0157369_10000499 | 3300013105 | Bacteria | 51849 |
| 220 | Ga0157369_10011608 | 3300013105 | Bacteria | 10002 |
| 221 | Ga0157369_10077765 | 3300013105 | Bacteria | 3556 |
| 222 | Ga0157369_10093367 | 3300013105 | Bacteria | 3212 |
| 223 | Ga0157369_10096226 | 3300013105 | Bacteria | 3159 |
| 224 | Ga0157369_10194318 | 3300013105 | Bacteria | 2131 |
| 225 | Ga0157369_10267052 | 3300013105 | Bacteria | 1784 |
| 226 | Ga0157369_10424803 | 3300013105 | Bacteria | 1378 |
| 227 | Ga0157369_10489011 | 3300013105 | Bacteria | 1273 |
| 228 | Ga0157369_10812217 | 3300013105 | Bacteria | 961 |
| 229 | Ga0157369_10960618 | 3300013105 | Bacteria | 875 |
| 230 | Ga0157374_10051858 | 3300013296 | Bacteria | 3819 |
| 231 | Ga0157374_10128120 | 3300013296 | Bacteria | 2455 |
| 232 | Ga0157378_10182712 | 3300013297 | Bacteria | 1974 |
| 233 | Ga0157378_11643860 | 3300013297 | Bacteria | 689 |
| 234 | Ga0163162_10985117 | 3300013306 | Bacteria | 953 |
| 235 | Ga0157372_10070679 | 3300013307 | Bacteria | 3928 |
| 236 | Ga0157375_10026292 | 3300013308 | Bacteria | 5421 |
| 237 | Ga0157375_10145638 | 3300013308 | Bacteria | 2499 |
| 238 | Ga0157375_10270216 | 3300013308 | Bacteria | 1862 |
| 239 | Ga0157375_10611153 | 3300013308 | Bacteria | 1249 |
| 240 | Ga0182008_10025311 | 3300014497 | Bacteria | 3014 |
| 241 | Ga0157377_10182353 | 3300014745 | Bacteria | 1321 |
| 242 | Ga0157379_10244745 | 3300014968 | Bacteria | 1627 |
| 243 | Ga0157379_10252377 | 3300014968 | Bacteria | 1601 |
| 244 | Ga0182006_1075348 | 3300015261 | Bacteria | 1242 |
| 245 | Ga0182007_10000669 | 3300015262 | Bacteria | 19672 |
| 246 | Ga0183367_1015 | 3300015688 | Bacteria | 298435 |
| 247 | Ga0163161_10287909 | 3300017792 | Bacteria | 1291 |
| 248 | Ga0163161_10402296 | 3300017792 | Bacteria | 1098 |
| 249 | Ga0206356_11633797 | 3300020070 | Bacteria | 774 |
| 250 | Ga0206353_10418018 | 3300020082 | Bacteria | 866 |
| 251 | Ga0206353_11592386 | 3300020082 | Bacteria | 1414 |
| 252 | Ga0206353_11865961 | 3300020082 | Bacteria | 2792 |
| 253 | Ga0213874_10004260 | 3300021377 | Bacteria | 3245 |
| 254 | Ga0213875_10000989 | 3300021388 | Bacteria | 20317 |
| 255 | Ga0213875_10041640 | 3300021388 | Bacteria | 2161 |
| 256 | Ga0213875_10128178 | 3300021388 | Bacteria | 1186 |
| 257 | Ga0224712_10220279 | 3300022467 | Bacteria | 868 |
| 258 | Ga0224712_10296545 | 3300022467 | Bacteria | 755 |
| 259 | Ga0224572_1014734 | 3300024225 | Bacteria | 1494 |
| 260 | Ga0228598_1016371 | 3300024227 | Bacteria | 1463 |
| 261 | Ga0209563_102036 | 3300025230 | Bacteria | 4805 |
| 262 | Ga0209758_1009592 | 3300025297 | Bacteria | 5979 |
| 263 | Ga0207713_1005912 | 3300025735 | Bacteria | 7554 |
| 264 | Ga0207692_10087021 | 3300025898 | Bacteria | 1685 |
| 265 | Ga0207692_10198841 | 3300025898 | Bacteria | 1177 |
| 266 | Ga0207692_10224273 | 3300025898 | Bacteria | 1115 |
| 267 | Ga0207710_10136124 | 3300025900 | Bacteria | 1183 |
| 268 | Ga0207680_10398698 | 3300025903 | Bacteria | 972 |
| 269 | Ga0207647_10016868 | 3300025904 | Bacteria | 4975 |
| 270 | Ga0207647_10154334 | 3300025904 | Bacteria | 1341 |
| 271 | Ga0207685_10015085 | 3300025905 | Bacteria | 2439 |
| 272 | Ga0207699_10034945 | 3300025906 | Bacteria | 2856 |
| 273 | Ga0207699_10155981 | 3300025906 | Bacteria | 1515 |
| 274 | Ga0207699_10201018 | 3300025906 | Bacteria | 1350 |
| 275 | Ga0207699_10831576 | 3300025906 | Bacteria | 680 |
| 276 | Ga0207705_10148584 | 3300025909 | Bacteria | 1754 |
| 277 | Ga0207705_10679467 | 3300025909 | Bacteria | 800 |
| 278 | Ga0207705_10721975 | 3300025909 | Bacteria | 774 |
| 279 | Ga0207684_10018360 | 3300025910 | Bacteria | 5988 |
| 280 | Ga0207684_10032219 | 3300025910 | Bacteria | 4458 |
| 281 | Ga0207684_10167406 | 3300025910 | Bacteria | 1894 |
| 282 | Ga0207684_10222277 | 3300025910 | Bacteria | 1629 |
| 283 | Ga0207684_10401708 | 3300025910 | Bacteria | 1178 |
| 284 | Ga0207684_11045369 | 3300025910 | Bacteria | 682 |
| 285 | Ga0207654_10068002 | 3300025911 | Bacteria | 2107 |
| 286 | Ga0207695_10002619 | 3300025913 | Bacteria | 26347 |
| 287 | Ga0207695_10094794 | 3300025913 | Bacteria | 2991 |
| 288 | Ga0207671_10000859 | 3300025914 | Bacteria | 38501 |
| 289 | Ga0207671_10351728 | 3300025914 | Bacteria | 1168 |
| 290 | Ga0207693_10013690 | 3300025915 | Bacteria | 6535 |
| 291 | Ga0207693_10035163 | 3300025915 | Bacteria | 3950 |
| 292 | Ga0207693_10049315 | 3300025915 | Bacteria | 3306 |
| 293 | Ga0207693_10096636 | 3300025915 | Bacteria | 2316 |
| 294 | Ga0207693_10103315 | 3300025915 | Bacteria | 2235 |
| 295 | Ga0207693_10249211 | 3300025915 | Bacteria | 1394 |
| 296 | Ga0207663_10030774 | 3300025916 | Bacteria | 3169 |
| 297 | Ga0207663_10044704 | 3300025916 | Bacteria | 2720 |
| 298 | Ga0207663_10065845 | 3300025916 | Bacteria | 2317 |
| 299 | Ga0207663_10167736 | 3300025916 | Bacteria | 1556 |
| 300 | Ga0207662_10134796 | 3300025918 | Bacteria | 1560 |
| 301 | Ga0207657_10536501 | 3300025919 | Bacteria | 915 |
| 302 | Ga0207652_10265815 | 3300025921 | Bacteria | 1547 |
| 303 | Ga0207646_10002609 | 3300025922 | Bacteria | 21196 |
| 304 | Ga0207646_10014615 | 3300025922 | Bacteria | 7443 |
| 305 | Ga0207646_10044426 | 3300025922 | Bacteria | 3988 |
| 306 | Ga0207646_10220795 | 3300025922 | Bacteria | 1712 |
| 307 | Ga0207646_10274715 | 3300025922 | Bacteria | 1523 |
| 308 | Ga0207646_10391882 | 3300025922 | Bacteria | 1255 |
| 309 | Ga0207646_10480455 | 3300025922 | Bacteria | 1120 |
| 310 | Ga0207694_10002482 | 3300025924 | Bacteria | 15012 |
| 311 | Ga0207659_10158434 | 3300025926 | Bacteria | 1775 |
| 312 | Ga0207687_10034173 | 3300025927 | Bacteria | 3452 |
| 313 | Ga0207687_10062622 | 3300025927 | Bacteria | 2631 |
| 314 | Ga0207687_10612260 | 3300025927 | Bacteria | 919 |
| 315 | Ga0207700_10020875 | 3300025928 | Bacteria | 4459 |
| 316 | Ga0207700_10059269 | 3300025928 | Bacteria | 2895 |
| 317 | Ga0207700_10080429 | 3300025928 | Bacteria | 2541 |
| 318 | Ga0207700_10427183 | 3300025928 | Bacteria | 1165 |
| 319 | Ga0207700_10596038 | 3300025928 | Bacteria | 983 |
| 320 | Ga0207700_11004445 | 3300025928 | Bacteria | 747 |
| 321 | Ga0207664_10001035 | 3300025929 | Bacteria | 18634 |
| 322 | Ga0207664_10015616 | 3300025929 | Bacteria | 5518 |
| 323 | Ga0207664_10040879 | 3300025929 | Bacteria | 3609 |
| 324 | Ga0207664_10063522 | 3300025929 | Bacteria | 2951 |
| 325 | Ga0207664_10140191 | 3300025929 | Bacteria | 2044 |
| 326 | Ga0207664_10416578 | 3300025929 | Bacteria | 1196 |
| 327 | Ga0207664_10602950 | 3300025929 | Bacteria | 986 |
| 328 | Ga0207664_10654901 | 3300025929 | Bacteria | 944 |
| 329 | Ga0207664_10678737 | 3300025929 | Bacteria | 926 |
| 330 | Ga0207664_10809760 | 3300025929 | Bacteria | 842 |
| 331 | Ga0207644_10191076 | 3300025931 | Bacteria | 1610 |
| 332 | Ga0207709_10488363 | 3300025935 | Bacteria | 959 |
| 333 | Ga0207669_10198535 | 3300025937 | Bacteria | 1454 |
| 334 | Ga0207669_10472713 | 3300025937 | Bacteria | 998 |
| 335 | Ga0207704_10839378 | 3300025938 | Bacteria | 769 |
| 336 | Ga0207665_10001452 | 3300025939 | Bacteria | 15942 |
| 337 | Ga0207665_10001502 | 3300025939 | Bacteria | 15679 |
| 338 | Ga0207665_10023079 | 3300025939 | Bacteria | 4098 |
| 339 | Ga0207665_10058692 | 3300025939 | Bacteria | 2602 |
| 340 | Ga0207691_10749314 | 3300025940 | Bacteria | 822 |
| 341 | Ga0207691_10885721 | 3300025940 | Bacteria | 748 |
| 342 | Ga0207711_10018303 | 3300025941 | Bacteria | 5823 |
| 343 | Ga0207689_10071805 | 3300025942 | Bacteria | 2843 |
| 344 | Ga0207661_10074221 | 3300025944 | Bacteria | 2788 |
| 345 | Ga0207661_10318834 | 3300025944 | Bacteria | 1397 |
| 346 | Ga0207661_10837823 | 3300025944 | Bacteria | 847 |
| 347 | Ga0207667_10042250 | 3300025949 | Bacteria | 4847 |
| 348 | Ga0207667_10189998 | 3300025949 | Bacteria | 2107 |
| 349 | Ga0207712_10095294 | 3300025961 | Bacteria | 2200 |
| 350 | Ga0207712_10147226 | 3300025961 | Bacteria | 1815 |
| 351 | Ga0207712_11108896 | 3300025961 | Bacteria | 704 |
| 352 | Ga0207668_10135099 | 3300025972 | Bacteria | 1889 |
| 353 | Ga0207668_10404760 | 3300025972 | Bacteria | 1154 |
| 354 | Ga0207640_10150742 | 3300025981 | Bacteria | 1708 |
| 355 | Ga0207640_10238306 | 3300025981 | Bacteria | 1404 |
| 356 | Ga0207658_10316003 | 3300025986 | Bacteria | 1351 |
| 357 | Ga0207677_10434204 | 3300026023 | Bacteria | 1122 |
| 358 | Ga0207703_10060917 | 3300026035 | Bacteria | 3088 |
| 359 | Ga0207639_10059310 | 3300026041 | Bacteria | 2948 |
| 360 | Ga0207639_10523852 | 3300026041 | Bacteria | 1086 |
| 361 | Ga0207678_10009111 | 3300026067 | Bacteria | 8741 |
| 362 | Ga0207702_10048478 | 3300026078 | Bacteria | 3583 |
| 363 | Ga0207702_10087270 | 3300026078 | Bacteria | 2723 |
| 364 | Ga0207702_10231058 | 3300026078 | Bacteria | 1729 |
| 365 | Ga0207702_10245159 | 3300026078 | Bacteria | 1680 |
| 366 | Ga0207702_10703008 | 3300026078 | Bacteria | 996 |
| 367 | Ga0207702_10778005 | 3300026078 | Bacteria | 945 |
| 368 | Ga0207702_11040238 | 3300026078 | Bacteria | 812 |
| 369 | Ga0207641_10054631 | 3300026088 | Bacteria | 3390 |
| 370 | Ga0207676_10509161 | 3300026095 | Bacteria | 1144 |
| 371 | Ga0207676_10634010 | 3300026095 | Bacteria | 1030 |
| 372 | Ga0207676_10816796 | 3300026095 | Bacteria | 910 |
| 373 | Ga0207674_10151813 | 3300026116 | Bacteria | 2273 |
| 374 | Ga0207674_10406519 | 3300026116 | Bacteria | 1316 |
| 375 | Ga0207675_100080881 | 3300026118 | Bacteria | 3046 |
| 376 | Ga0207675_100182260 | 3300026118 | Bacteria | 2011 |
| 377 | Ga0207675_101671918 | 3300026118 | Bacteria | 657 |
| 378 | Ga0207683_10124879 | 3300026121 | Bacteria | 2312 |
| 379 | Ga0207683_10241243 | 3300026121 | Bacteria | 1649 |
| 380 | Ga0207698_10158043 | 3300026142 | Bacteria | 1978 |
| 381 | Ga0209371_1032899 | 3300027312 | Bacteria | 1112 |
| 382 | Ga0209588_1101257 | 3300027671 | Bacteria | 927 |
| 383 | Ga0207428_10006504 | 3300027907 | Bacteria | 10785 |
| 384 | Ga0268266_10075243 | 3300028379 | Bacteria | 2933 |
| 385 | Ga0268266_10396119 | 3300028379 | Bacteria | 1305 |
| 386 | Ga0268266_10775591 | 3300028379 | Bacteria | 926 |
| 387 | Ga0268265_10590731 | 3300028380 | Bacteria | 1060 |
| 388 | Ga0268264_10488130 | 3300028381 | Bacteria | 1199 |
| 389 | Ga0307517_10075499 | 3300028786 | Bacteria | 2955 |
| 390 | Ga0307515_10014891 | 3300028794 | Bacteria | 14377 |
| 391 | Ga0307515_10162171 | 3300028794 | Bacteria | 2274 |
| 392 | Ga0265338_10001130 | 3300028800 | Bacteria | 44217 |
| 393 | Ga0268256_1037440 | 3300030500 | Bacteria | 1112 |
| 394 | Ga0307511_10000029 | 3300030521 | Bacteria | 108570 |
| 395 | Ga0307511_10091665 | 3300030521 | Bacteria | 2055 |
| 396 | Ga0307512_10003228 | 3300030522 | Bacteria | 19272 |
| 397 | Ga0307512_10011081 | 3300030522 | Bacteria | 8560 |
| 398 | Ga0316177_1221734 | 3300030731 | Bacteria | 2254 |
| 399 | Ga0316176_1068858 | 3300030732 | Bacteria | 2150 |
| 400 | Ga0314311_1078233 | 3300030733 | Bacteria | 2028 |
| 401 | Ga0316179_1056778 | 3300030734 | Bacteria | 2067 |
| 402 | Ga0265763_1007959 | 3300030763 | Bacteria | 939 |
| 403 | Ga0265325_10015843 | 3300031241 | Bacteria | 4228 |
| 404 | Ga0265340_10030432 | 3300031247 | Bacteria | 2705 |
| 405 | Ga0265327_10000125 | 3300031251 | Bacteria | 167832 |
| 406 | Ga0265327_10032023 | 3300031251 | Bacteria | 2948 |
| 407 | Ga0307513_10001602 | 3300031456 | Bacteria | 32485 |
| 408 | Ga0307513_10023643 | 3300031456 | Bacteria | 7175 |
| 409 | Ga0307509_10013741 | 3300031507 | Bacteria | 9560 |
| 410 | Ga0307509_10033598 | 3300031507 | Bacteria | 5646 |
| 411 | Ga0307408_100483261 | 3300031548 | Bacteria | 1081 |
| 412 | Ga0307508_10008497 | 3300031616 | Bacteria | 9485 |
| 413 | Ga0307508_10017888 | 3300031616 | Bacteria | 6442 |
| 414 | Ga0307508_10023761 | 3300031616 | Bacteria | 5565 |
| 415 | Ga0307508_10238293 | 3300031616 | Bacteria | 1417 |
| 416 | Ga0307514_10003328 | 3300031649 | Bacteria | 15567 |
| 417 | Ga0307514_10005036 | 3300031649 | Bacteria | 11954 |
| 418 | Ga0307514_10064296 | 3300031649 | Bacteria | 2783 |
| 419 | Ga0307514_10323710 | 3300031649 | Bacteria | 844 |
| 420 | Ga0316575_10000004 | 3300031665 | Bacteria | 116505 |
| 421 | Ga0265314_10308469 | 3300031711 | Bacteria | 885 |
| 422 | Ga0316576_10003726 | 3300031727 | Bacteria | 8998 |
| 423 | Ga0316576_10005029 | 3300031727 | Bacteria | 8011 |
| 424 | Ga0316576_10073932 | 3300031727 | Bacteria | 2519 |
| 425 | Ga0316576_10570502 | 3300031727 | Bacteria | 828 |
| 426 | Ga0316578_10014563 | 3300031728 | Bacteria | 4206 |
| 427 | Ga0316578_10114663 | 3300031728 | Bacteria | 1619 |
| 428 | Ga0307516_10005315 | 3300031730 | Bacteria | 15496 |
| 429 | Ga0307516_10024874 | 3300031730 | Bacteria | 6109 |
| 430 | Ga0307516_10059173 | 3300031730 | Bacteria | 3727 |
| 431 | Ga0307516_10404495 | 3300031730 | Bacteria | 1024 |
| 432 | Ga0307413_10096162 | 3300031824 | Bacteria | 1944 |
| 433 | Ga0307518_10078872 | 3300031838 | Bacteria | 2378 |
| 434 | Ga0307518_10223755 | 3300031838 | Bacteria | 1225 |
| 435 | Ga0307410_10271906 | 3300031852 | Bacteria | 1326 |
| 436 | Ga0307406_10204985 | 3300031901 | Bacteria | 1455 |
| 437 | Ga0307406_10216661 | 3300031901 | Bacteria | 1420 |
| 438 | Ga0307406_10402030 | 3300031901 | Bacteria | 1086 |
| 439 | Ga0307407_10266075 | 3300031903 | Bacteria | 1181 |
| 440 | Ga0307407_10492292 | 3300031903 | Bacteria | 897 |
| 441 | Ga0307409_100134687 | 3300031995 | Bacteria | 2118 |
| 442 | Ga0307409_100176188 | 3300031995 | Bacteria | 1888 |
| 443 | Ga0307409_101029367 | 3300031995 | Bacteria | 842 |
| 444 | Ga0307416_100116514 | 3300032002 | Bacteria | 2369 |
| 445 | Ga0307416_101085501 | 3300032002 | Bacteria | 905 |
| 446 | Ga0307415_100040118 | 3300032126 | Bacteria | 3100 |
| 447 | Ga0307415_100102738 | 3300032126 | Bacteria | 2101 |
| 448 | Ga0307507_10041134 | 3300033179 | Bacteria | 4631 |
| 449 | Ga0307507_10041576 | 3300033179 | Bacteria | 4596 |
| 450 | Ga0307507_10200653 | 3300033179 | Bacteria | 1381 |
| 451 | Ga0307510_10015231 | 3300033180 | Bacteria | 9090 |
| 452 | Ga0307510_10044243 | 3300033180 | Bacteria | 4826 |
| 453 | Ga0307510_10113562 | 3300033180 | Bacteria | 2441 |
| 454 | Ga0316214_1032490 | 3300033545 | Bacteria | 742 |
| 455 | Ga0373930_0056299 | 3300034816 | Bacteria | 869 |
| 456 | Ga0373958_0071359 | 3300034819 | Bacteria | 771 |
| 457 | Ga0373926_0000170 | 3300035083 | Bacteria | 14467 |
| 458 | Ga0373926_0005176 | 3300035083 | Bacteria | 4292 |
| 459 | Ga0373926_0006409 | 3300035083 | Bacteria | 3909 |
| 460 | Ga0373929_0063085 | 3300035085 | Bacteria | 872 |
| 461 | Ga0373934_0026026 | 3300035086 | Bacteria | 2269 |
| 462 | Ga0373934_0100822 | 3300035086 | Bacteria | 1168 |
| 463 | Ga0373944_0000752 | 3300035089 | Bacteria | 7876 |
| 464 | Ga0373944_0158924 | 3300035089 | Bacteria | 801 |
| 465 | Ga0373923_0000684 | 3300035111 | Bacteria | 8625 |
| 466 | Ga0373923_0006064 | 3300035111 | Bacteria | 4150 |
| 467 | Ga0373923_0078035 | 3300035111 | Bacteria | 1433 |
| 468 | Ga0373923_0242864 | 3300035111 | Bacteria | 841 |
| 469 | Ga0373936_0004356 | 3300035113 | Bacteria | 5350 |
| 470 | Ga0373936_0009278 | 3300035113 | Bacteria | 3706 |
| 471 | Ga0373945_0000905 | 3300035116 | Bacteria | 8774 |
| 472 | Ga0373945_0001739 | 3300035116 | Bacteria | 6724 |
| 473 | Ga0373953_0043135 | 3300035117 | Bacteria | 1799 |
| 474 | Ga0373953_0106813 | 3300035117 | Bacteria | 1181 |
| 475 | Ga0373953_0221865 | 3300035117 | Bacteria | 819 |
| 476 | Ga0373954_0061604 | 3300035118 | Bacteria | 1771 |
| 477 | Ga0373954_0285494 | 3300035118 | Bacteria | 813 |
| 478 | Ga0373954_0402460 | 3300035118 | Bacteria | 677 |
| 479 | Ga0373956_0009402 | 3300035119 | Bacteria | 3977 |
| 480 | Ga0373956_0012461 | 3300035119 | Bacteria | 3526 |
| 481 | Ga0373956_0154077 | 3300035119 | Bacteria | 1082 |
| 482 | Ga0373957_0039081 | 3300035120 | Bacteria | 1779 |
| 483 | Ga0373957_0175531 | 3300035120 | Bacteria | 887 |
| 484 | Ga0373943_0002847 | 3300035170 | Bacteria | 7859 |
| 485 | Ga0373943_0002993 | 3300035170 | Bacteria | 7676 |
| 486 | Ga0373943_0048327 | 3300035170 | Bacteria | 2084 |
| 487 | Ga0373946_0002040 | 3300035171 | Bacteria | 7088 |
| 488 | Ga0373946_0005679 | 3300035171 | Bacteria | 4510 |
| 489 | Ga0373955_0009135 | 3300035172 | Bacteria | 4631 |
| 490 | Ga0373955_0023797 | 3300035172 | Bacteria | 3125 |
| 491 | Ga0373955_0101129 | 3300035172 | Bacteria | 1655 |
| 492 | Ga0373955_0109720 | 3300035172 | Bacteria | 1594 |
| 493 | Ga0373955_0243003 | 3300035172 | Bacteria | 1078 |
| 494 | Ga0316574_0008888 | 3300035398 | Bacteria | 5604 |
| 495 | Ga0316574_0027835 | 3300035398 | Bacteria | 3406 |
| 496 | Ga0316574_0352280 | 3300035398 | Bacteria | 931 |
| 497 | Ga0373924_0010452 | 3300035410 | Bacteria | 3422 |
| 498 | Ga0373924_0025616 | 3300035410 | Bacteria | 2332 |
| 499 | Ga0373924_0042315 | 3300035410 | Bacteria | 1868 |
| 500 | Ga0373924_0065690 | 3300035410 | Bacteria | 1524 |
| 501 | Ga0373935_0000585 | 3300035692 | Bacteria | 18987 |
| 502 | Ga0373935_0000925 | 3300035692 | Bacteria | 15851 |
| 503 | Ga0373935_0012498 | 3300035692 | Bacteria | 5105 |
| 504 | Ga0373927_0001256 | 3300035695 | Bacteria | 19246 |
| 505 | Ga0373927_0012374 | 3300035695 | Bacteria | 5679 |
| 506 | Ga0373927_0236113 | 3300035695 | Bacteria | 1201 |
| 507 | Ga0373927_0563742 | 3300035695 | Bacteria | 753 |
| 508 | Ga0373933_0016337 | 3300035724 | Bacteria | 4148 |
| 509 | Ga0373933_0121739 | 3300035724 | Bacteria | 1634 |
| 510 | Ga0373933_0126130 | 3300035724 | Bacteria | 1606 |
| 511 | Ga0373947_0000285 | 3300035725 | Bacteria | 28726 |
| 512 | Ga0373947_0004745 | 3300035725 | Bacteria | 7970 |
| 513 | Ga0373947_0038584 | 3300035725 | Bacteria | 2838 |
| 514 | Ga0373947_0097265 | 3300035725 | Bacteria | 1845 |
| 515 | Ga0373947_0847609 | 3300035725 | Bacteria | 624 |
| 516 | Ga0373937_0030477 | 3300036401 | Bacteria | 4885 |
| 517 | Ga0373937_0055981 | 3300036401 | Bacteria | 3621 |
| 518 | Ga0373937_0154482 | 3300036401 | Bacteria | 2150 |
| 519 | Ga0373937_0163309 | 3300036401 | Bacteria | 2088 |
| 520 | Ga0373937_0215587 | 3300036401 | Bacteria | 1806 |
| 521 | Ga0316582_0639592 | 3300036647 | Bacteria | 731 |
| 522 | Ga0316584_0747821 | 3300036712 | Bacteria | 667 |
| 523 | Ga0373925_0001910 | 3300037068 | Bacteria | 17290 |
| 524 | Ga0373925_0014948 | 3300037068 | Bacteria | 5611 |
| 525 | Ga0373925_0028939 | 3300037068 | Bacteria | 4062 |
| 526 | Ga0373925_0164052 | 3300037068 | Bacteria | 1751 |
| 527 | Ga0373925_0460067 | 3300037068 | Bacteria | 1042 |
| 528 | Ga0395899_0156073 | 3300037312 | Bacteria | 1615 |
| 529 | Ga0395900_0027051 | 3300037418 | Bacteria | 5872 |
| 530 | Ga0395898_0011730 | 3300037466 | Bacteria | 9085 |
| 531 | Ga0395898_0191058 | 3300037466 | Bacteria | 1956 |
| 532 | Ga0436364_0454301 | 3300037853 | Bacteria | 1701 |
| 533 | Ga0436364_0841312 | 3300037853 | Bacteria | 10277 |
| 534 | Ga0436364_0912466 | 3300037853 | Bacteria | 3344 |
| 535 | Ga0436364_0937718 | 3300037853 | Bacteria | 1190 |
| 536 | Ga0436364_1073971 | 3300037853 | Bacteria | 13298 |
| 537 | Ga0436364_1347787 | 3300037853 | Bacteria | 939 |
| 538 | Ga0436364_1503455 | 3300037853 | Bacteria | 4497 |
| 539 | Ga0436364_1544337 | 3300037853 | Bacteria | 1036 |
| 540 | Ga0395901_0047110 | 3300038443 | Bacteria | 4477 |
| 541 | Ga0395901_0063285 | 3300038443 | Bacteria | 3850 |
| 542 | Ga0436365_0595644 | 3300039437 | Bacteria | 3908 |
| 543 | Ga0436360_0005371 | 3300039438 | Bacteria | 939 |
| 544 | Ga0436363_0002297 | 3300039450 | Bacteria | 902 |
| 545 | Ga0436363_0169319 | 3300039450 | Bacteria | 2981 |
| 546 | Ga0436363_0232657 | 3300039450 | Bacteria | 720 |
| 547 | Ga0436363_1064625 | 3300039450 | Bacteria | 1174 |
| 548 | Ga0439436_0006090 | 3300041404 | Bacteria | 3700 |
| 549 | Ga0439439_0030632 | 3300041406 | Bacteria | 1368 |
| 550 | Ga0451797_1461308 | 3300041453 | Bacteria | 1083 |
| 551 | Ga0451807_2562875 | 3300041486 | Bacteria | 1044 |
| 552 | Ga0451833_1112365 | 3300041491 | Bacteria | 1337 |
| 553 | Ga0451837_0454087 | 3300041494 | Bacteria | 2900 |
| 554 | Ga0451841_0471427 | 3300041498 | Bacteria | 1246 |
| 555 | Ga0451853_0334494 | 3300041512 | Bacteria | 7161 |
| 556 | Ga0451853_2740783 | 3300041512 | Bacteria | 2512 |
| 557 | Ga0451853_3121249 | 3300041512 | Bacteria | 1115 |
| 558 | Ga0439432_079878 | 3300042006 | Bacteria | 991 |
| 559 | Ga0439449_0004271 | 3300042007 | Bacteria | 5522 |
| 560 | Ga0439449_0067602 | 3300042007 | Bacteria | 1317 |
| 561 | Ga0439457_002218 | 3300042014 | Bacteria | 5622 |
| 562 | Ga0450894_000953 | 3300042131 | Bacteria | 4550 |
| 563 | Ga0450898_000877 | 3300042134 | Bacteria | 3763 |
| 564 | Ga0450899_001207 | 3300042135 | Bacteria | 2934 |
| 565 | Ga0450900_044651 | 3300042136 | Bacteria | 669 |
| 566 | Ga0450903_000200 | 3300042138 | Bacteria | 13259 |
| 567 | Ga0450906_000555 | 3300042145 | Bacteria | 7884 |
| 568 | Ga0450907_033465 | 3300042146 | Bacteria | 876 |
| 569 | Ga0466969_0012742 | 3300044656 | Bacteria | 4430 |
| 570 | Ga0466969_0072606 | 3300044656 | Bacteria | 1652 |
| 571 | Ga0466969_0077513 | 3300044656 | Bacteria | 1590 |
| 572 | Ga0466972_0032963 | 3300044658 | Bacteria | 2541 |
| 573 | Ga0466972_0048025 | 3300044658 | Bacteria | 2063 |
| 574 | Ga0466972_0058433 | 3300044658 | Bacteria | 1851 |
| 575 | Ga0466972_0059694 | 3300044658 | Bacteria | 1830 |
| 576 | Ga0466972_0078797 | 3300044658 | Bacteria | 1569 |
| 577 | Ga0466965_0002184 | 3300044683 | Bacteria | 8231 |
| 578 | Ga0466965_0099239 | 3300044683 | Bacteria | 1488 |
| 579 | Ga0466966_0005485 | 3300044684 | Bacteria | 8335 |
| 580 | Ga0466966_0015625 | 3300044684 | Bacteria | 5018 |
| 581 | Ga0466966_0077165 | 3300044684 | Bacteria | 2079 |
| 582 | Ga0466966_0093000 | 3300044684 | Bacteria | 1870 |
| 583 | Ga0466966_0112624 | 3300044684 | Bacteria | 1676 |
| 584 | Ga0466961_0004352 | 3300044693 | Bacteria | 8873 |
| 585 | Ga0466961_0009683 | 3300044693 | Bacteria | 6131 |
| 586 | Ga0466961_0031272 | 3300044693 | Bacteria | 3422 |
| 587 | Ga0466961_0180555 | 3300044693 | Bacteria | 1310 |
| 588 | Ga0466961_0183769 | 3300044693 | Bacteria | 1297 |
| 589 | Ga0466963_0004623 | 3300044694 | Bacteria | 8025 |
| 590 | Ga0466963_0196081 | 3300044694 | Bacteria | 1412 |
| 591 | Ga0466964_0035392 | 3300044706 | Bacteria | 1996 |
| 592 | Ga0466971_0000731 | 3300044719 | Bacteria | 13157 |
| 593 | Ga0466971_0029407 | 3300044719 | Bacteria | 2457 |
| 594 | Ga0466971_0045827 | 3300044719 | Bacteria | 1964 |
| 595 | Ga0466971_0092094 | 3300044719 | Bacteria | 1389 |
| 596 | Ga0466971_0097165 | 3300044719 | Bacteria | 1351 |
| 597 | Ga0466968_0008647 | 3300044735 | Bacteria | 3902 |
| 598 | Ga0466970_0000891 | 3300044765 | Bacteria | 14413 |
| 599 | Ga0466970_0007398 | 3300044765 | Bacteria | 5502 |
| 600 | Ga0466970_0007838 | 3300044765 | Bacteria | 5361 |
| 601 | Ga0466970_0138245 | 3300044765 | Bacteria | 1341 |
| 602 | Ga0466970_0175804 | 3300044765 | Bacteria | 1187 |
| 603 | Ga0466957_0000553 | 3300044842 | Bacteria | 18838 |
| 604 | Ga0466957_0097799 | 3300044842 | Bacteria | 1846 |
| 605 | Ga0466957_0223446 | 3300044842 | Bacteria | 1244 |
| 606 | Ga0466960_0089672 | 3300044901 | Bacteria | 1565 |
| 607 | Ga0466959_0002672 | 3300045049 | Bacteria | 11442 |
| 608 | Ga0466959_0003442 | 3300045049 | Bacteria | 10356 |
| 609 | Ga0466959_0025188 | 3300045049 | Bacteria | 4407 |
| 610 | Ga0466959_0156759 | 3300045049 | Bacteria | 1602 |
| 611 | Ga0466958_0017827 | 3300045836 | Bacteria | 4112 |
| 612 | Ga0466958_0513665 | 3300045836 | Bacteria | 778 |
| 613 | Ga0466967_0042072 | 3300045976 | Bacteria | 3945 |
| 614 | Ga0466967_0114528 | 3300045976 | Bacteria | 2482 |
| 615 | Ga0466967_0299084 | 3300045976 | Bacteria | 1548 |
| 616 | Ga0466967_0708642 | 3300045976 | Bacteria | 997 |
| 617 | Ga0495627_014698 | 3300046453 | Bacteria | 2724 |
| 618 | Ga0495627_043162 | 3300046453 | Bacteria | 1380 |
| 619 | Ga0495592_0002271 | 3300046454 | Bacteria | 13551 |
| 620 | Ga0495592_0003737 | 3300046454 | Bacteria | 10974 |
| 621 | Ga0495592_0040543 | 3300046454 | Bacteria | 3495 |
| 622 | Ga0495592_0055075 | 3300046454 | Bacteria | 2943 |
| 623 | Ga0495592_0065729 | 3300046454 | Bacteria | 2654 |
| 624 | Ga0495592_0127132 | 3300046454 | Bacteria | 1786 |
| 625 | Ga0495592_0145161 | 3300046454 | Bacteria | 1646 |
| 626 | Ga0495592_0397598 | 3300046454 | Bacteria | 873 |
| 627 | Ga0495592_0584936 | 3300046454 | Bacteria | 682 |
| 628 | Ga0495603_0002831 | 3300046455 | Bacteria | 10247 |
| 629 | Ga0495603_0005656 | 3300046455 | Bacteria | 7467 |
| 630 | Ga0495603_0011462 | 3300046455 | Bacteria | 5366 |
| 631 | Ga0495603_0023323 | 3300046455 | Bacteria | 3746 |
| 632 | Ga0495603_0240253 | 3300046455 | Bacteria | 1043 |
| 633 | Ga0495603_0390470 | 3300046455 | Bacteria | 798 |
| 634 | Ga0495603_0466101 | 3300046455 | Bacteria | 723 |
| 635 | Ga0495629_0001126 | 3300046459 | Bacteria | 21176 |
| 636 | Ga0495629_0003859 | 3300046459 | Bacteria | 11299 |
| 637 | Ga0495629_0006498 | 3300046459 | Bacteria | 8661 |
| 638 | Ga0495629_0021301 | 3300046459 | Bacteria | 4625 |
| 639 | Ga0495629_0036334 | 3300046459 | Bacteria | 3478 |
| 640 | Ga0495629_0101287 | 3300046459 | Bacteria | 2010 |
| 641 | Ga0495629_0124429 | 3300046459 | Bacteria | 1796 |
| 642 | Ga0495629_0181995 | 3300046459 | Bacteria | 1456 |
| 643 | Ga0495638_0042577 | 3300046460 | Bacteria | 2867 |
| 644 | Ga0495638_0069420 | 3300046460 | Bacteria | 2160 |
| 645 | Ga0495638_0109151 | 3300046460 | Bacteria | 1645 |
| 646 | Ga0495638_0124370 | 3300046460 | Bacteria | 1521 |
| 647 | Ga0495641_0002343 | 3300046461 | Bacteria | 15046 |
| 648 | Ga0495641_0014347 | 3300046461 | Bacteria | 4292 |
| 649 | Ga0495651_0010645 | 3300046462 | Bacteria | 7076 |
| 650 | Ga0495651_0028367 | 3300046462 | Bacteria | 4362 |
| 651 | Ga0495651_0048595 | 3300046462 | Bacteria | 3276 |
| 652 | Ga0495651_0072280 | 3300046462 | Bacteria | 2620 |
| 653 | Ga0495651_0076100 | 3300046462 | Bacteria | 2543 |
| 654 | Ga0495651_0151434 | 3300046462 | Bacteria | 1671 |
| 655 | Ga0495651_0159825 | 3300046462 | Bacteria | 1615 |
| 656 | Ga0495651_0324899 | 3300046462 | Bacteria | 1024 |
| 657 | Ga0495651_0517848 | 3300046462 | Bacteria | 761 |
| 658 | Ga0495653_0006927 | 3300046463 | Bacteria | 9312 |
| 659 | Ga0495653_0008832 | 3300046463 | Bacteria | 8250 |
| 660 | Ga0495653_0010809 | 3300046463 | Bacteria | 7471 |
| 661 | Ga0495653_0016905 | 3300046463 | Bacteria | 5934 |
| 662 | Ga0495653_0028580 | 3300046463 | Bacteria | 4458 |
| 663 | Ga0495653_0104005 | 3300046463 | Bacteria | 2052 |
| 664 | Ga0495653_0300443 | 3300046463 | Bacteria | 1047 |
| 665 | Ga0495580_0005592 | 3300046472 | Bacteria | 10358 |
| 666 | Ga0495580_0025433 | 3300046472 | Bacteria | 4326 |
| 667 | Ga0495582_0003441 | 3300046473 | Bacteria | 8922 |
| 668 | Ga0495582_0027255 | 3300046473 | Bacteria | 3131 |
| 669 | Ga0495582_0041255 | 3300046473 | Bacteria | 2543 |
| 670 | Ga0495582_0102471 | 3300046473 | Bacteria | 1603 |
| 671 | Ga0495639_0005098 | 3300046475 | Bacteria | 5643 |
| 672 | Ga0495639_0142985 | 3300046475 | Bacteria | 1151 |
| 673 | Ga0495662_0000778 | 3300046476 | Bacteria | 15442 |
| 674 | Ga0495662_0002509 | 3300046476 | Bacteria | 9261 |
| 675 | Ga0495662_0004864 | 3300046476 | Bacteria | 6729 |
| 676 | Ga0495662_0009607 | 3300046476 | Bacteria | 4743 |
| 677 | Ga0495662_0011366 | 3300046476 | Bacteria | 4351 |
| 678 | Ga0495662_0014930 | 3300046476 | Bacteria | 3773 |
| 679 | Ga0495662_0017662 | 3300046476 | Bacteria | 3453 |
| 680 | Ga0495662_0069482 | 3300046476 | Bacteria | 1706 |
| 681 | Ga0495662_0074306 | 3300046476 | Bacteria | 1649 |
| 682 | Ga0495664_0000391 | 3300046477 | Bacteria | 21456 |
| 683 | Ga0495664_0006849 | 3300046477 | Bacteria | 6309 |
| 684 | Ga0495664_0015064 | 3300046477 | Bacteria | 4392 |
| 685 | Ga0495664_0018080 | 3300046477 | Bacteria | 4032 |
| 686 | Ga0495664_0093898 | 3300046477 | Bacteria | 1805 |
| 687 | Ga0495664_0146869 | 3300046477 | Bacteria | 1430 |
| 688 | Ga0495664_0227240 | 3300046477 | Bacteria | 1129 |
| 689 | Ga0495664_0256009 | 3300046477 | Bacteria | 1058 |
| 690 | Ga0495585_0034278 | 3300046492 | Bacteria | 2870 |
| 691 | Ga0495594_0005801 | 3300046499 | Bacteria | 6338 |
| 692 | Ga0495594_0007517 | 3300046499 | Bacteria | 5607 |
| 693 | Ga0495594_0023705 | 3300046499 | Bacteria | 3290 |
| 694 | Ga0495594_0216489 | 3300046499 | Bacteria | 1092 |
| 695 | Ga0495594_0383090 | 3300046499 | Bacteria | 800 |
| 696 | Ga0495608_0001231 | 3300046511 | Bacteria | 18151 |
| 697 | Ga0495608_0015515 | 3300046511 | Bacteria | 5283 |
| 698 | Ga0495608_0044086 | 3300046511 | Bacteria | 2978 |
| 699 | Ga0495608_0143318 | 3300046511 | Bacteria | 1524 |
| 700 | Ga0495608_0220098 | 3300046511 | Bacteria | 1191 |
| 701 | Ga0495618_0043137 | 3300046514 | Bacteria | 2845 |
| 702 | Ga0495618_0049082 | 3300046514 | Bacteria | 2666 |
| 703 | Ga0495618_0072533 | 3300046514 | Bacteria | 2191 |
| 704 | Ga0495618_0104235 | 3300046514 | Bacteria | 1816 |
| 705 | Ga0495618_0177683 | 3300046514 | Bacteria | 1353 |
| 706 | Ga0495618_0284593 | 3300046514 | Bacteria | 1030 |
| 707 | Ga0495628_0002991 | 3300046516 | Bacteria | 15148 |
| 708 | Ga0495628_0014635 | 3300046516 | Bacteria | 6571 |
| 709 | Ga0495628_0121244 | 3300046516 | Bacteria | 2005 |
| 710 | Ga0495628_0133599 | 3300046516 | Bacteria | 1897 |
| 711 | Ga0495628_0216717 | 3300046516 | Bacteria | 1439 |
| 712 | Ga0495628_0217030 | 3300046516 | Bacteria | 1437 |
| 713 | Ga0495628_0260591 | 3300046516 | Bacteria | 1292 |
| 714 | Ga0495628_0395195 | 3300046516 | Bacteria | 1011 |
| 715 | Ga0495630_0000703 | 3300046517 | Bacteria | 23814 |
| 716 | Ga0495630_0018884 | 3300046517 | Bacteria | 5067 |
| 717 | Ga0495630_0130447 | 3300046517 | Bacteria | 1909 |
| 718 | Ga0495630_0264684 | 3300046517 | Bacteria | 1313 |
| 719 | Ga0495630_0542491 | 3300046517 | Bacteria | 892 |
| 720 | Ga0495631_0283925 | 3300046518 | Bacteria | 705 |
| 721 | Ga0495632_0054684 | 3300046519 | Bacteria | 1956 |
| 722 | Ga0495637_0099018 | 3300046520 | Bacteria | 1141 |
| 723 | Ga0495643_0001615 | 3300046522 | Bacteria | 19965 |
| 724 | Ga0495643_0177995 | 3300046522 | Bacteria | 1035 |
| 725 | Ga0495666_0012169 | 3300046526 | Bacteria | 4294 |
| 726 | Ga0495652_0001872 | 3300046529 | Bacteria | 22363 |
| 727 | Ga0495652_0014592 | 3300046529 | Bacteria | 7044 |
| 728 | Ga0495652_0027773 | 3300046529 | Bacteria | 4984 |
| 729 | Ga0495652_0074965 | 3300046529 | Bacteria | 2812 |
| 730 | Ga0495652_0108941 | 3300046529 | Bacteria | 2231 |
| 731 | Ga0495652_0153565 | 3300046529 | Bacteria | 1795 |
| 732 | Ga0495652_0165159 | 3300046529 | Bacteria | 1714 |
| 733 | Ga0495652_0194738 | 3300046529 | Bacteria | 1544 |
| 734 | Ga0495652_0297261 | 3300046529 | Bacteria | 1175 |
| 735 | Ga0495652_0319829 | 3300046529 | Bacteria | 1121 |
| 736 | Ga0495665_0043023 | 3300046531 | Bacteria | 2402 |
| 737 | Ga0495665_0053415 | 3300046531 | Bacteria | 2136 |
| 738 | Ga0495665_0307616 | 3300046531 | Bacteria | 811 |
| 739 | Ga0495640_0001053 | 3300046533 | Bacteria | 21443 |
| 740 | Ga0495640_0029936 | 3300046533 | Bacteria | 3901 |
| 741 | Ga0495640_0030511 | 3300046533 | Bacteria | 3858 |
| 742 | Ga0495640_0045950 | 3300046533 | Bacteria | 3028 |
| 743 | Ga0495640_0069695 | 3300046533 | Bacteria | 2365 |
| 744 | Ga0495640_0105120 | 3300046533 | Bacteria | 1850 |
| 745 | Ga0495640_0291198 | 3300046533 | Bacteria | 1015 |
| 746 | Ga0495586_0007632 | 3300046535 | Bacteria | 5771 |
| 747 | Ga0495586_0012479 | 3300046535 | Bacteria | 4507 |
| 748 | Ga0495586_0104890 | 3300046535 | Bacteria | 1571 |
| 749 | Ga0495586_0324136 | 3300046535 | Bacteria | 884 |
| 750 | Ga0495587_0003902 | 3300046536 | Bacteria | 9895 |
| 751 | Ga0495587_0004174 | 3300046536 | Bacteria | 9564 |
| 752 | Ga0495587_0006375 | 3300046536 | Bacteria | 7696 |
| 753 | Ga0495587_0013196 | 3300046536 | Bacteria | 5194 |
| 754 | Ga0495587_0019644 | 3300046536 | Bacteria | 4179 |
| 755 | Ga0495587_0033613 | 3300046536 | Bacteria | 3095 |
| 756 | Ga0495645_0000506 | 3300046543 | Bacteria | 26907 |
| 757 | Ga0495645_0010307 | 3300046543 | Bacteria | 6551 |
| 758 | Ga0495645_0028178 | 3300046543 | Bacteria | 4081 |
| 759 | Ga0495645_0199310 | 3300046543 | Bacteria | 1359 |
| 760 | Ga0495645_0224325 | 3300046543 | Bacteria | 1262 |
| 761 | Ga0495645_0233777 | 3300046543 | Bacteria | 1230 |
| 762 | Ga0495645_0233954 | 3300046543 | Bacteria | 1229 |
| 763 | Ga0495645_0296287 | 3300046543 | Bacteria | 1058 |
| 764 | Ga0495622_0017899 | 3300046557 | Bacteria | 3301 |
| 765 | Ga0495622_0047424 | 3300046557 | Bacteria | 1996 |
| 766 | Ga0495622_0066701 | 3300046557 | Bacteria | 1663 |
| 767 | Ga0495622_0124324 | 3300046557 | Bacteria | 1177 |
| 768 | Ga0495633_0095871 | 3300046558 | Bacteria | 1378 |
| 769 | Ga0495667_0001397 | 3300046559 | Bacteria | 15910 |
| 770 | Ga0495667_0023079 | 3300046559 | Bacteria | 4191 |
| 771 | Ga0495667_0026280 | 3300046559 | Bacteria | 3922 |
| 772 | Ga0495667_0047033 | 3300046559 | Bacteria | 2851 |
| 773 | Ga0495667_0142129 | 3300046559 | Bacteria | 1546 |
| 774 | Ga0495634_0001317 | 3300046642 | Bacteria | 22654 |
| 775 | Ga0495634_0017477 | 3300046642 | Bacteria | 5116 |
| 776 | Ga0495634_0017724 | 3300046642 | Bacteria | 5078 |
| 777 | Ga0495634_0019430 | 3300046642 | Bacteria | 4828 |
| 778 | Ga0495634_0039209 | 3300046642 | Bacteria | 3226 |
| 779 | Ga0495634_0399756 | 3300046642 | Bacteria | 816 |
| 780 | Ga0495625_0126680 | 3300046660 | Bacteria | 1733 |
| 781 | Ga0495635_0001470 | 3300046663 | Bacteria | 15756 |
| 782 | Ga0495635_0004171 | 3300046663 | Bacteria | 10027 |
| 783 | Ga0495635_0007010 | 3300046663 | Bacteria | 7871 |
| 784 | Ga0495635_0009525 | 3300046663 | Bacteria | 6791 |
| 785 | Ga0495635_0011615 | 3300046663 | Bacteria | 6172 |
| 786 | Ga0495635_0106079 | 3300046663 | Bacteria | 1919 |
| 787 | Ga0495635_0166724 | 3300046663 | Bacteria | 1498 |
| 788 | Ga0495661_0097353 | 3300046665 | Bacteria | 1662 |
| 789 | Ga0495588_0003831 | 3300046674 | Bacteria | 6590 |
| 790 | Ga0495588_0003953 | 3300046674 | Bacteria | 6506 |
| 791 | Ga0495588_0053089 | 3300046674 | Bacteria | 2089 |
| 792 | Ga0495588_0152226 | 3300046674 | Bacteria | 1222 |
| 793 | Ga0495657_0001306 | 3300046675 | Bacteria | 21707 |
| 794 | Ga0495657_0002997 | 3300046675 | Bacteria | 13974 |
| 795 | Ga0495657_0015844 | 3300046675 | Bacteria | 5506 |
| 796 | Ga0495657_0018069 | 3300046675 | Bacteria | 5110 |
| 797 | Ga0495657_0026868 | 3300046675 | Bacteria | 4070 |
| 798 | Ga0495657_0031240 | 3300046675 | Bacteria | 3723 |
| 799 | Ga0495657_0117127 | 3300046675 | Bacteria | 1681 |
| 800 | Ga0495657_0119109 | 3300046675 | Bacteria | 1664 |
| 801 | Ga0495599_0000586 | 3300046678 | Bacteria | 20765 |
| 802 | Ga0495599_0013786 | 3300046678 | Bacteria | 5000 |
| 803 | Ga0495599_0017225 | 3300046678 | Bacteria | 4491 |
| 804 | Ga0495599_0032875 | 3300046678 | Bacteria | 3257 |
| 805 | Ga0495599_0157154 | 3300046678 | Bacteria | 1406 |
| 806 | Ga0495599_0276741 | 3300046678 | Bacteria | 1017 |
| 807 | Ga0495599_0286370 | 3300046678 | Bacteria | 997 |
| 808 | Ga0495623_0011033 | 3300046679 | Bacteria | 5846 |
| 809 | Ga0495623_0025608 | 3300046679 | Bacteria | 3800 |
| 810 | Ga0495623_0028084 | 3300046679 | Bacteria | 3622 |
| 811 | Ga0495623_0105210 | 3300046679 | Bacteria | 1715 |
| 812 | Ga0495623_0222949 | 3300046679 | Bacteria | 1073 |
| 813 | Ga0495646_0001997 | 3300046680 | Bacteria | 12331 |
| 814 | Ga0495646_0004086 | 3300046680 | Bacteria | 9157 |
| 815 | Ga0495646_0077433 | 3300046680 | Bacteria | 1945 |
| 816 | Ga0495646_0078280 | 3300046680 | Bacteria | 1932 |
| 817 | Ga0495646_0125386 | 3300046680 | Bacteria | 1449 |
| 818 | Ga0495647_0071573 | 3300046681 | Bacteria | 1389 |
| 819 | Ga0495658_0176417 | 3300046683 | Bacteria | 1324 |
| 820 | Ga0495658_0190920 | 3300046683 | Bacteria | 1273 |
| 821 | Ga0495658_0211170 | 3300046683 | Bacteria | 1213 |
| 822 | Ga0495613_0004734 | 3300046689 | Bacteria | 10209 |
| 823 | Ga0495613_0007501 | 3300046689 | Bacteria | 8125 |
| 824 | Ga0495613_0020520 | 3300046689 | Bacteria | 4926 |
| 825 | Ga0495613_0021391 | 3300046689 | Bacteria | 4822 |
| 826 | Ga0495613_0099713 | 3300046689 | Bacteria | 2098 |
| 827 | Ga0495613_0160610 | 3300046689 | Bacteria | 1599 |
| 828 | Ga0495613_0294506 | 3300046689 | Bacteria | 1124 |
| 829 | Ga0495624_0002479 | 3300046690 | Bacteria | 13997 |
| 830 | Ga0495624_0003841 | 3300046690 | Bacteria | 11079 |
| 831 | Ga0495624_0099414 | 3300046690 | Bacteria | 1791 |
| 832 | Ga0495624_0177106 | 3300046690 | Bacteria | 1300 |
| 833 | Ga0495671_0003057 | 3300046692 | Bacteria | 10391 |
| 834 | Ga0495649_0050387 | 3300046694 | Bacteria | 2260 |
| 835 | Ga0495589_0077632 | 3300046794 | Bacteria | 1618 |
| 836 | Ga0495589_0085818 | 3300046794 | Bacteria | 1529 |
| 837 | Ga0495600_0011071 | 3300046809 | Bacteria | 5613 |
| 838 | Ga0495600_0020662 | 3300046809 | Bacteria | 4210 |
| 839 | Ga0495600_0023159 | 3300046809 | Bacteria | 3994 |
| 840 | Ga0495600_0042841 | 3300046809 | Bacteria | 2952 |
| 841 | Ga0495600_0053588 | 3300046809 | Bacteria | 2634 |
| 842 | Ga0495600_0083600 | 3300046809 | Bacteria | 2083 |
| 843 | Ga0495600_0107389 | 3300046809 | Bacteria | 1818 |
| 844 | Ga0495600_0116552 | 3300046809 | Bacteria | 1738 |
| 845 | Ga0495600_0167578 | 3300046809 | Bacteria | 1419 |
| 846 | Ga0495600_0624131 | 3300046809 | Bacteria | 653 |
| 847 | Ga0495660_0001963 | 3300046810 | Bacteria | 13373 |
| 848 | Ga0495581_0000387 | 3300047315 | Bacteria | 22065 |
| 849 | Ga0495581_0130899 | 3300047315 | Bacteria | 1462 |
| 850 | Ga0495581_0164789 | 3300047315 | Bacteria | 1296 |
| 851 | Ga0495581_0544050 | 3300047315 | Bacteria | 674 |
| 852 | Ga0495604_0001106 | 3300047317 | Bacteria | 22387 |
| 853 | Ga0495604_0003229 | 3300047317 | Bacteria | 13031 |
| 854 | Ga0495604_0009136 | 3300047317 | Bacteria | 7843 |
| 855 | Ga0495604_0012046 | 3300047317 | Bacteria | 6874 |
| 856 | Ga0495604_0104715 | 3300047317 | Bacteria | 2072 |
| 857 | Ga0495604_0160908 | 3300047317 | Bacteria | 1586 |
| 858 | Ga0495604_0170364 | 3300047317 | Bacteria | 1532 |
| 859 | Ga0495636_0000438 | 3300047318 | Bacteria | 15441 |
| 860 | Ga0495636_0035808 | 3300047318 | Bacteria | 2045 |
| 861 | Ga0495636_0143436 | 3300047318 | Bacteria | 1068 |
| 862 | Ga0495674_0001552 | 3300047319 | Bacteria | 22475 |
| 863 | Ga0495674_0005450 | 3300047319 | Bacteria | 12224 |
| 864 | Ga0495674_0009699 | 3300047319 | Bacteria | 9140 |
| 865 | Ga0495674_0017433 | 3300047319 | Bacteria | 6681 |
| 866 | Ga0495674_0043980 | 3300047319 | Bacteria | 3971 |
| 867 | Ga0495674_0075032 | 3300047319 | Bacteria | 2910 |
| 868 | Ga0495674_0095085 | 3300047319 | Bacteria | 2541 |
| 869 | Ga0495674_0379806 | 3300047319 | Bacteria | 1143 |
| 870 | Ga0495674_0482257 | 3300047319 | Bacteria | 993 |
| 871 | Ga0495674_0625097 | 3300047319 | Bacteria | 851 |
| 872 | Ga0495676_0005414 | 3300047321 | Bacteria | 11704 |
| 873 | Ga0495676_0009385 | 3300047321 | Bacteria | 8914 |
| 874 | Ga0495676_0011404 | 3300047321 | Bacteria | 8022 |
| 875 | Ga0495676_0032408 | 3300047321 | Bacteria | 4411 |
| 876 | Ga0495676_0041863 | 3300047321 | Bacteria | 3766 |
| 877 | Ga0495676_0092220 | 3300047321 | Bacteria | 2261 |
| 878 | Ga0495676_0115225 | 3300047321 | Bacteria | 1965 |
| 879 | Ga0495680_0010224 | 3300047322 | Bacteria | 8377 |
| 880 | Ga0495680_0019620 | 3300047322 | Bacteria | 5703 |
| 881 | Ga0495680_0025003 | 3300047322 | Bacteria | 4945 |
| 882 | Ga0495680_0032803 | 3300047322 | Bacteria | 4211 |
| 883 | Ga0495680_0079882 | 3300047322 | Bacteria | 2472 |
| 884 | Ga0495680_0081140 | 3300047322 | Bacteria | 2449 |
| 885 | Ga0495680_0440802 | 3300047322 | Bacteria | 893 |
| 886 | Ga0495687_005938 | 3300047443 | Bacteria | 7628 |
| 887 | Ga0495687_028003 | 3300047443 | Bacteria | 2627 |
| 888 | Ga0495687_031007 | 3300047443 | Bacteria | 2457 |
| 889 | Ga0495675_0003847 | 3300047444 | Bacteria | 9091 |
| 890 | Ga0495675_0008548 | 3300047444 | Bacteria | 6345 |
| 891 | Ga0495675_0013329 | 3300047444 | Bacteria | 5188 |
| 892 | Ga0495675_0022945 | 3300047444 | Bacteria | 3977 |
| 893 | Ga0495675_0115463 | 3300047444 | Bacteria | 1674 |
| 894 | Ga0495675_0127804 | 3300047444 | Bacteria | 1581 |
| 895 | Ga0495675_0136363 | 3300047444 | Bacteria | 1523 |
| 896 | Ga0495675_0593601 | 3300047444 | Bacteria | 628 |
| 897 | Ga0495679_038092 | 3300047446 | Bacteria | 1508 |
| 898 | Ga0495685_001997 | 3300047447 | Bacteria | 6326 |
| 899 | Ga0495685_005377 | 3300047447 | Bacteria | 4178 |
| 900 | Ga0495685_013011 | 3300047447 | Bacteria | 2822 |
| 901 | Ga0495685_042817 | 3300047447 | Bacteria | 1545 |
| 902 | Ga0495681_0001290 | 3300047470 | Bacteria | 18959 |
| 903 | Ga0495681_0001442 | 3300047470 | Bacteria | 17856 |
| 904 | Ga0495681_0293147 | 3300047470 | Bacteria | 631 |
| 905 | Ga0495684_0001120 | 3300047471 | Bacteria | 21587 |
| 906 | Ga0495684_0007472 | 3300047471 | Bacteria | 8463 |
| 907 | Ga0495684_0024914 | 3300047471 | Bacteria | 4601 |
| 908 | Ga0495684_0037692 | 3300047471 | Bacteria | 3708 |
| 909 | Ga0495684_0061765 | 3300047471 | Bacteria | 2850 |
| 910 | Ga0495684_0065307 | 3300047471 | Bacteria | 2766 |
| 911 | Ga0495684_0081691 | 3300047471 | Bacteria | 2452 |
| 912 | Ga0495686_0093942 | 3300047472 | Bacteria | 1818 |
| 913 | Ga0495686_0109940 | 3300047472 | Bacteria | 1654 |
| 914 | Ga0495686_0136991 | 3300047472 | Bacteria | 1447 |
| 915 | Ga0495593_0012039 | 3300047673 | Bacteria | 4958 |
| 916 | Ga0495593_0064534 | 3300047673 | Bacteria | 1911 |
| 917 | Ga0495602_0002436 | 3300048088 | Bacteria | 18952 |
| 918 | Ga0495602_0009848 | 3300048088 | Bacteria | 9917 |
| 919 | Ga0495602_0036211 | 3300048088 | Bacteria | 4594 |
| 920 | Ga0495602_0062413 | 3300048088 | Bacteria | 3233 |
| 921 | Ga0495602_0069291 | 3300048088 | Bacteria | 3024 |
| 922 | Ga0495602_0185647 | 3300048088 | Bacteria | 1599 |
| 923 | Ga0495602_0205249 | 3300048088 | Bacteria | 1500 |
| 924 | Ga0495614_0005911 | 3300048089 | Bacteria | 5513 |
| 925 | Ga0495614_0013438 | 3300048089 | Bacteria | 3591 |
| 926 | Ga0495614_0022455 | 3300048089 | Bacteria | 2723 |
| 927 | Ga0495614_0045019 | 3300048089 | Bacteria | 1892 |
| 928 | Ga0495614_0213870 | 3300048089 | Bacteria | 875 |
| 929 | Ga0495626_0039673 | 3300048091 | Bacteria | 2227 |
| 930 | Ga0496101_0220533 | 3300048904 | Bacteria | 1472 |
| 931 | Ga0496102_0278313 | 3300048905 | Bacteria | 1577 |
| 932 | Ga0496102_0523586 | 3300048905 | Bacteria | 1108 |
| 933 | Ga0496102_0752197 | 3300048905 | Bacteria | 897 |
| 934 | Ga0496104_0049596 | 3300048907 | Bacteria | 3958 |
| 935 | Ga0496104_0068915 | 3300048907 | Bacteria | 3361 |
| 936 | Ga0496104_0134924 | 3300048907 | Bacteria | 2371 |
| 937 | Ga0496104_0210680 | 3300048907 | Bacteria | 1855 |
| 938 | Ga0496105_0049682 | 3300048908 | Bacteria | 3463 |
| 939 | Ga0496105_0112081 | 3300048908 | Bacteria | 2251 |
| 940 | Ga0496105_0367101 | 3300048908 | Bacteria | 1147 |
| 941 | Ga0496106_0318370 | 3300048909 | Bacteria | 1248 |
| 942 | Ga0496106_0450811 | 3300048909 | Bacteria | 1033 |
| 943 | Ga0496108_0008336 | 3300048911 | Bacteria | 8406 |
| 944 | Ga0496108_0019781 | 3300048911 | Bacteria | 5531 |
| 945 | Ga0496108_0081819 | 3300048911 | Bacteria | 2737 |
| 946 | Ga0496108_0394038 | 3300048911 | Bacteria | 1209 |
| 947 | Ga0496108_0529145 | 3300048911 | Bacteria | 1029 |
| 948 | Ga0496109_0139668 | 3300048912 | Bacteria | 2265 |
| 949 | Ga0496109_0144818 | 3300048912 | Bacteria | 2222 |
| 950 | Ga0496109_0327779 | 3300048912 | Bacteria | 1445 |
| 951 | Ga0496109_0393385 | 3300048912 | Bacteria | 1309 |
| 952 | Ga0496109_0949058 | 3300048912 | Bacteria | 798 |
| 953 | Ga0496110_0014330 | 3300048913 | Bacteria | 6578 |
| 954 | Ga0496110_0125396 | 3300048913 | Bacteria | 2316 |
| 955 | Ga0496110_0271977 | 3300048913 | Bacteria | 1542 |
| 956 | Ga0496110_0308725 | 3300048913 | Bacteria | 1441 |
| 957 | Ga0496110_0648454 | 3300048913 | Bacteria | 956 |
| 958 | Ga0496111_0076344 | 3300048914 | Bacteria | 2442 |
| 959 | Ga0496111_0282713 | 3300048914 | Bacteria | 1230 |
| 960 | Ga0496112_0070472 | 3300048915 | Bacteria | 3455 |
| 961 | Ga0496112_0457162 | 3300048915 | Bacteria | 1214 |
| 962 | Ga0496113_0064948 | 3300048916 | Bacteria | 2761 |
| 963 | Ga0496113_0429293 | 3300048916 | Bacteria | 1061 |
| 964 | Ga0496113_1063887 | 3300048916 | Bacteria | 635 |
| 965 | Ga0496114_0263897 | 3300048917 | Bacteria | 1517 |
| 966 | Ga0496114_0515116 | 3300048917 | Bacteria | 1058 |
| 967 | Ga0496114_0688441 | 3300048917 | Bacteria | 897 |
| 968 | Ga0496114_0737975 | 3300048917 | Bacteria | 862 |
| 969 | Ga0496115_0018146 | 3300048918 | Bacteria | 5395 |
| 970 | Ga0496115_0156044 | 3300048918 | Bacteria | 1886 |
| 971 | Ga0496117_0001948 | 3300048920 | Bacteria | 27543 |
| 972 | Ga0496118_0000281 | 3300048921 | Bacteria | 89915 |
| 973 | Ga0496118_0031647 | 3300048921 | Bacteria | 4380 |
| 974 | Ga0496119_0217594 | 3300048922 | Bacteria | 979 |
| 975 | Ga0496120_0077938 | 3300048923 | Bacteria | 1803 |
| 976 | Ga0496120_0087380 | 3300048923 | Bacteria | 1674 |
| 977 | Ga0496120_0140231 | 3300048923 | Bacteria | 1228 |
| 978 | Ga0496122_0000932 | 3300048925 | Bacteria | 53407 |
| 979 | Ga0496122_0017130 | 3300048925 | Bacteria | 6796 |
| 980 | Ga0496122_0112660 | 3300048925 | Bacteria | 1781 |
| 981 | Ga0496123_0143950 | 3300048926 | Bacteria | 1298 |
| 982 | Ga0496124_0000323 | 3300048927 | Bacteria | 88352 |
| 983 | Ga0496124_0078850 | 3300048927 | Bacteria | 2713 |
| 984 | Ga0496125_0000046 | 3300048928 | Bacteria | 295288 |
| 985 | Ga0496126_0095047 | 3300048929 | Bacteria | 2615 |
| 986 | Ga0496126_0237989 | 3300048929 | Bacteria | 1522 |
| 987 | Ga0496126_0601875 | 3300048929 | Bacteria | 866 |
| 988 | Ga0501031_0017192 | 3300049568 | Bacteria | 4699 |
| 989 | Ga0501031_0018698 | 3300049568 | Bacteria | 4511 |
| 990 | Ga0501031_0372960 | 3300049568 | Bacteria | 923 |
| 991 | Ga0501032_0012448 | 3300049569 | Bacteria | 6078 |
| 992 | Ga0501032_0014613 | 3300049569 | Bacteria | 5561 |
| 993 | Ga0501033_0010578 | 3300049570 | Bacteria | 7073 |
| 994 | Ga0501033_0017508 | 3300049570 | Bacteria | 5413 |
| 995 | Ga0501033_0018702 | 3300049570 | Bacteria | 5237 |
| 996 | Ga0501033_0072888 | 3300049570 | Bacteria | 2521 |
| 997 | Ga0501033_0201237 | 3300049570 | Bacteria | 1422 |
| 998 | Ga0501033_0291511 | 3300049570 | Bacteria | 1150 |
| 999 | Ga0501033_0543808 | 3300049570 | Bacteria | 800 |
| 1000 | Ga0501034_0011151 | 3300049571 | Bacteria | 9326 |
| 1001 | Ga0501034_0198578 | 3300049571 | Bacteria | 1964 |
| 1002 | Ga0501034_0428811 | 3300049571 | Bacteria | 1242 |
| 1003 | Ga0501034_0464413 | 3300049571 | Bacteria | 1182 |
| 1004 | Ga0501034_0580020 | 3300049571 | Bacteria | 1028 |
| 1005 | Ga0501036_0007744 | 3300049572 | Bacteria | 8779 |
| 1006 | Ga0501036_0023838 | 3300049572 | Bacteria | 5156 |
| 1007 | Ga0501036_0038163 | 3300049572 | Bacteria | 4065 |
| 1008 | Ga0501036_0096722 | 3300049572 | Bacteria | 2496 |
| 1009 | Ga0501036_0100920 | 3300049572 | Bacteria | 2441 |
| 1010 | Ga0501036_0183614 | 3300049572 | Bacteria | 1760 |
| 1011 | Ga0501036_0352950 | 3300049572 | Bacteria | 1228 |
| 1012 | Ga0501037_0016357 | 3300049573 | Bacteria | 5458 |
| 1013 | Ga0501037_0165035 | 3300049573 | Bacteria | 1577 |
| 1014 | Ga0501037_0180642 | 3300049573 | Bacteria | 1497 |
| 1015 | Ga0501038_0007000 | 3300049574 | Bacteria | 10415 |
| 1016 | Ga0501038_0077247 | 3300049574 | Bacteria | 2811 |
| 1017 | Ga0501038_0142158 | 3300049574 | Bacteria | 1962 |
| 1018 | Ga0501038_0281814 | 3300049574 | Bacteria | 1308 |
| 1019 | Ga0501038_0346303 | 3300049574 | Bacteria | 1158 |
| 1020 | Ga0501038_0372844 | 3300049574 | Bacteria | 1108 |
| 1021 | Ga0501038_0949855 | 3300049574 | Bacteria | 633 |
| 1022 | Ga0501039_0019320 | 3300049575 | Bacteria | 5223 |
| 1023 | Ga0501039_0154222 | 3300049575 | Bacteria | 1804 |
| 1024 | Ga0501039_0172719 | 3300049575 | Bacteria | 1699 |
| 1025 | Ga0501039_0641901 | 3300049575 | Bacteria | 831 |
| 1026 | Ga0501040_0031362 | 3300049576 | Bacteria | 3591 |
| 1027 | Ga0501041_0080366 | 3300049577 | Bacteria | 2007 |
| 1028 | Ga0501042_0011553 | 3300049578 | Bacteria | 5960 |
| 1029 | Ga0501042_0018216 | 3300049578 | Bacteria | 4859 |
| 1030 | Ga0501042_0495654 | 3300049578 | Bacteria | 887 |
| 1031 | Ga0501043_0020241 | 3300049579 | Bacteria | 5225 |
| 1032 | Ga0501043_0034914 | 3300049579 | Bacteria | 3955 |
| 1033 | Ga0501043_0099583 | 3300049579 | Bacteria | 2285 |
| 1034 | Ga0501043_0160839 | 3300049579 | Bacteria | 1754 |
| 1035 | Ga0501043_0214430 | 3300049579 | Bacteria | 1491 |
| 1036 | Ga0501043_0546083 | 3300049579 | Bacteria | 861 |
| 1037 | Ga0501046_0031801 | 3300049580 | Bacteria | 4275 |
| 1038 | Ga0501046_0607840 | 3300049580 | Bacteria | 775 |
| 1039 | Ga0501047_0011205 | 3300049581 | Bacteria | 8484 |
| 1040 | Ga0501047_0127689 | 3300049581 | Bacteria | 2423 |
| 1041 | Ga0501047_0151546 | 3300049581 | Bacteria | 2194 |
| 1042 | Ga0501047_0156882 | 3300049581 | Bacteria | 2149 |
| 1043 | Ga0501047_0254936 | 3300049581 | Bacteria | 1603 |
| 1044 | Ga0501047_0421341 | 3300049581 | Bacteria | 1166 |
| 1045 | Ga0501047_0580488 | 3300049581 | Bacteria | 944 |
| 1046 | Ga0501048_0096500 | 3300049582 | Bacteria | 2085 |
| 1047 | Ga0501048_0271001 | 3300049582 | Bacteria | 1206 |
| 1048 | Ga0501067_0008473 | 3300049583 | Bacteria | 5701 |
| 1049 | Ga0501067_0033286 | 3300049583 | Bacteria | 2860 |
| 1050 | Ga0501068_0030878 | 3300049584 | Bacteria | 3180 |
| 1051 | Ga0501069_0004252 | 3300049585 | Bacteria | 7398 |
| 1052 | Ga0501069_0130868 | 3300049585 | Bacteria | 1437 |
| 1053 | Ga0501070_0000136 | 3300049586 | Bacteria | 66212 |
| 1054 | Ga0501070_0001146 | 3300049586 | Bacteria | 23760 |
| 1055 | Ga0501070_0031259 | 3300049586 | Bacteria | 4460 |
| 1056 | Ga0501070_0268684 | 3300049586 | Bacteria | 1393 |
| 1057 | Ga0501070_1079592 | 3300049586 | Bacteria | 620 |
| 1058 | Ga0501071_0224432 | 3300049587 | Bacteria | 1414 |
| 1059 | Ga0501072_0001836 | 3300049588 | Bacteria | 15818 |
| 1060 | Ga0501072_0394521 | 3300049588 | Bacteria | 1098 |
| 1061 | Ga0501073_0041443 | 3300049589 | Bacteria | 3253 |
| 1062 | Ga0501074_0032353 | 3300049590 | Bacteria | 3789 |
| 1063 | Ga0501074_0244197 | 3300049590 | Bacteria | 1277 |
| 1064 | Ga0501076_0015385 | 3300049592 | Bacteria | 5781 |
| 1065 | Ga0501079_0032262 | 3300049741 | Bacteria | 4026 |
| 1066 | Ga0501080_0797301 | 3300049742 | Bacteria | 828 |
| 1067 | Ga0501083_0000054 | 3300049744 | Bacteria | 82311 |
| 1068 | Ga0501083_0032265 | 3300049744 | Bacteria | 3593 |
| 1069 | Ga0501083_0037458 | 3300049744 | Bacteria | 3303 |
| 1070 | Ga0501083_0045706 | 3300049744 | Bacteria | 2961 |
| 1071 | Ga0501035_0022720 | 3300049822 | Bacteria | 5760 |
| 1072 | Ga0501035_0126701 | 3300049822 | Bacteria | 2229 |
| 1073 | Ga0501035_0195494 | 3300049822 | Bacteria | 1737 |
| 1074 | Ga0501035_0366323 | 3300049822 | Bacteria | 1203 |
| 1075 | Ga0501035_0382666 | 3300049822 | Bacteria | 1173 |
| 1076 | Ga0501035_0710052 | 3300049822 | Bacteria | 810 |
| 1077 | Ga0501035_0858576 | 3300049822 | Bacteria | 721 |
| 1078 | Ga0501044_0011787 | 3300049823 | Bacteria | 9471 |
| 1079 | Ga0501044_0013803 | 3300049823 | Bacteria | 8731 |
| 1080 | Ga0501044_0050248 | 3300049823 | Bacteria | 4304 |
| 1081 | Ga0501044_0066464 | 3300049823 | Bacteria | 3676 |
| 1082 | Ga0501044_0115433 | 3300049823 | Bacteria | 2690 |
| 1083 | Ga0501044_0154204 | 3300049823 | Bacteria | 2277 |
| 1084 | Ga0501044_0267730 | 3300049823 | Bacteria | 1645 |
| 1085 | Ga0501044_0270793 | 3300049823 | Bacteria | 1634 |
| 1086 | Ga0501044_0773640 | 3300049823 | Bacteria | 841 |
| 1087 | Ga0501045_0054329 | 3300049824 | Bacteria | 2928 |
| 1088 | Ga0501045_0061161 | 3300049824 | Bacteria | 2762 |
| 1089 | Ga0501045_0459643 | 3300049824 | Bacteria | 946 |
| 1090 | Ga0501045_0986226 | 3300049824 | Bacteria | 618 |
| 1091 | nmdc:mga0yw44_569802_c1 | 3300050492 | Bacteria | 769 |
| 1092 | nmdc:mga06z11_24830_c1 | 3300050494 | Bacteria | 2833 |
| 1093 | nmdc:mga07m45_76877_c1 | 3300050496 | Bacteria | 1021 |
| 1094 | nmdc:mga05p37_157_c1 | 3300050507 | Bacteria | 65045 |
| 1095 | nmdc:mga05p37_342930_c1 | 3300050507 | Bacteria | 1761 |
| 1096 | nmdc:mga09592_79_c1 | 3300050508 | Bacteria | 56100 |
| 1097 | nmdc:mga0qj67_3105_c1 | 3300050509 | Bacteria | 11948 |
| 1098 | nmdc:mga06r32_122_c1 | 3300050510 | Bacteria | 55812 |
| 1099 | nmdc:mga06r32_13530_c1 | 3300050510 | Bacteria | 7395 |
| 1100 | nmdc:mga06r32_634560_c1 | 3300050510 | Bacteria | 1037 |
| 1101 | nmdc:mga08y16_48899_c1 | 3300050511 | Bacteria | 4426 |
| 1102 | nmdc:mga0n895_721235_c1 | 3300050512 | Bacteria | 992 |
| 1103 | nmdc:mga0rr50_129393_c1 | 3300050513 | Bacteria | 2019 |
| 1104 | nmdc:mga08x19_379702_c1 | 3300050514 | Bacteria | 989 |
| 1105 | nmdc:mga0a205_81869_c1 | 3300050515 | Bacteria | 3118 |
| 1106 | Ga0495601_0000332 | 3300053077 | Bacteria | 25050 |
| 1107 | Ga0495601_0038831 | 3300053077 | Bacteria | 2978 |
| 1108 | Ga0495612_0102143 | 3300053078 | Bacteria | 1221 |
| 1109 | Ga0495612_0129500 | 3300053078 | Bacteria | 1090 |
| 1110 | Ga0495612_0205760 | 3300053078 | Bacteria | 869 |
| 1111 | Ga0495655_0152085 | 3300053083 | Bacteria | 728 |
| 1112 | Ga0495655_0159222 | 3300053083 | Bacteria | 715 |
| 1113 | Ga0495595_0013001 | 3300053084 | Bacteria | 3512 |
| 1114 | Ga0495595_0048713 | 3300053084 | Bacteria | 1957 |
| 1115 | Ga0495619_0000631 | 3300053085 | Bacteria | 23277 |
| 1116 | Ga0495619_0093989 | 3300053085 | Bacteria | 2033 |
| 1117 | Ga0495619_0230653 | 3300053085 | Bacteria | 1283 |
| 1118 | Ga0495619_0346501 | 3300053085 | Bacteria | 1028 |
| 1119 | Ga0500578_0089792 | 3300053086 | Bacteria | 1950 |
| 1120 | Ga0500643_104316 | 3300053087 | Bacteria | 768 |
| 1121 | Ga0500646_0019355 | 3300053090 | Bacteria | 1801 |
| 1122 | Ga0500566_0099411 | 3300053094 | Bacteria | 1597 |
| 1123 | Ga0500640_054127 | 3300053095 | Bacteria | 1750 |
| 1124 | Ga0500641_0171518 | 3300053096 | Bacteria | 934 |
| 1125 | Ga0500650_0073898 | 3300053098 | Bacteria | 1594 |
| 1126 | Ga0500654_083773 | 3300053099 | Bacteria | 1467 |
| 1127 | Ga0500660_173794 | 3300053100 | Bacteria | 791 |
| 1128 | Ga0500660_174544 | 3300053100 | Bacteria | 788 |
| 1129 | Ga0500553_109891 | 3300053101 | Bacteria | 1163 |
| 1130 | Ga0500560_023614 | 3300053107 | Bacteria | 1785 |
| 1131 | Ga0500569_030598 | 3300053109 | Bacteria | 1507 |
| 1132 | Ga0500572_042620 | 3300053111 | Bacteria | 1323 |
| 1133 | Ga0500628_002033 | 3300053129 | Bacteria | 3401 |
| 1134 | Ga0500652_005655 | 3300053131 | Bacteria | 3957 |
| 1135 | Ga0500652_259779 | 3300053131 | Bacteria | 685 |
| 1136 | Ga0500658_0007329 | 3300053134 | Bacteria | 4073 |
| 1137 | Ga0500568_0038991 | 3300053139 | Bacteria | 1921 |
| 1138 | Ga0500573_0024379 | 3300053140 | Bacteria | 3478 |
| 1139 | Ga0500573_0052883 | 3300053140 | Bacteria | 2335 |
| 1140 | Ga0500573_0167612 | 3300053140 | Bacteria | 1190 |
| 1141 | Ga0500579_115997 | 3300053143 | Bacteria | 1323 |
| 1142 | Ga0500600_0009314 | 3300053149 | Bacteria | 5924 |
| 1143 | Ga0500600_0078916 | 3300053149 | Bacteria | 1785 |
| 1144 | Ga0500600_0152559 | 3300053149 | Bacteria | 1147 |
| 1145 | Ga0500616_0000937 | 3300053153 | Bacteria | 31832 |
| 1146 | Ga0500616_0002537 | 3300053153 | Bacteria | 15081 |
| 1147 | Ga0500616_0011011 | 3300053153 | Bacteria | 5383 |
| 1148 | Ga0500633_0014440 | 3300053160 | Bacteria | 2241 |
| 1149 | Ga0500634_0013772 | 3300053161 | Bacteria | 4250 |
| 1150 | Ga0500636_0126981 | 3300053177 | Bacteria | 1425 |
| 1151 | Ga0500656_000948 | 3300053732 | Bacteria | 2349 |
| 1152 | Ga0500587_023946 | 3300053739 | Bacteria | 808 |
| 1153 | Ga0501084_0020440 | 3300054114 | Bacteria | 5520 |
| 1154 | Ga0501082_0040131 | 3300060353 | Bacteria | 4038 |
| 1155 | Ga0501082_0140328 | 3300060353 | Bacteria | 2097 |
| 1156 | Ga0466962_0001961 | 3300061719 | Bacteria | 9700 |
| 1157 | Ga0466962_0031313 | 3300061719 | Bacteria | 2547 |
| 1158 | Ga0466962_0113769 | 3300061719 | Bacteria | 1303 |
| 1159 | Ga0530510_0133200 | 3300061734 | Bacteria | 1829 |
| 1160 | Ga0530510_0624987 | 3300061734 | Bacteria | 820 |
| 1161 | 2644112798 | 2643221619 | Bacteria | 4158469 |
| 1162 | 2739325385 | 2738543027 | Bacteria | 6409078 |
| 1163 | 2753300611 | 2751185788 | Bacteria | 4541048 |
| 1164 | 2811845544 | 2808606982 | Bacteria | 7791042 |
| 1165 | 2919045287 | 2919042368 | Bacteria | 3905917 |
| 1166 | 2928107243 | 2928104781 | Bacteria | 3877447 |
| 1167 | 2984552693 | 2984551494 | Bacteria | 3877562 |
| 1168 | 2997454644 | 2997451912 | Bacteria | 8492419 |
| 1169 | 3006488735 | 3006486233 | Bacteria | 8157040 |
| 1170 | 8056584292 | 8056579771 | Bacteria | 5840325 |
| 1171 | Ga0466966_0102198 | |||
| 1172 | JGI24738J21930_10008425 | |||
| 1173 | JGI25406J46586_10004301 | |||
| 1174 | rootH1_10032962 | |||
| 1175 | JGI25404J52841_10000840 | |||
| 1176 | Ga0070658_10376890 | |||
| 1177 | Ga0070658_10849975 | |||
| 1178 | Ga0070683_100149075 | |||
| 1179 | Ga0068869_100372631 | |||
| 1180 | Ga0070680_100412007 | |||
| 1181 | Ga0068868_100463071 | |||
| 1182 | Ga0070689_100436095 | |||
| 1183 | Ga0070691_10043293 | |||
| 1184 | Ga0070661_100115318 | |||
| 1185 | Ga0070671_100174458 | |||
| 1186 | Ga0070674_100268267 | |||
| 1187 | Ga0070688_100480771 | |||
| 1188 | Ga0070659_100361431 | |||
| 1189 | Ga0070667_100342896 | |||
| 1190 | Ga0070667_100562470 | |||
| 1191 | Ga0070709_10004323 | |||
| 1192 | Ga0070709_10027218 | |||
| 1193 | Ga0070709_10071763 | |||
| 1194 | Ga0070709_10165665 | |||
| 1195 | Ga0070709_10233263 | |||
| 1196 | Ga0070709_10280081 | |||
| 1197 | Ga0070709_10287678 | |||
| 1198 | Ga0070709_10369094 | |||
| 1199 | Ga0070714_100001697 | |||
| 1200 | Ga0070714_100047065 | |||
| 1201 | Ga0070714_100081825 | |||
| 1202 | Ga0070714_100219601 | |||
| 1203 | Ga0070714_100351597 | |||
| 1204 | Ga0070713_100050913 | |||
| 1205 | Ga0070713_100067512 | |||
| 1206 | Ga0070713_100070007 | |||
| 1207 | Ga0070713_100379717 | |||
| 1208 | Ga0070713_100403878 | |||
| 1209 | Ga0070713_100728926 | |||
| 1210 | Ga0070710_10030286 | |||
| 1211 | Ga0070710_10042309 | |||
| 1212 | Ga0070710_10518263 | |||
| 1213 | Ga0070711_100003207 | |||
| 1214 | Ga0070711_100104503 | |||
| 1215 | Ga0070711_100408588 | |||
| 1216 | Ga0070705_100662064 | |||
| 1217 | Ga0070694_100252097 | |||
| 1218 | Ga0070708_100035975 | |||
| 1219 | Ga0070708_100070626 | |||
| 1220 | Ga0070708_100097588 | |||
| 1221 | Ga0070708_100331166 | |||
| 1222 | Ga0070708_100698818 | |||
| 1223 | Ga0070663_100052981 | |||
| 1224 | Ga0070678_100269342 | |||
| 1225 | Ga0070678_100451871 | |||
| 1226 | Ga0070681_10364410 | |||
| 1227 | Ga0070706_100026879 | |||
| 1228 | Ga0070706_100056913 | |||
| 1229 | Ga0070706_100227311 | |||
| 1230 | Ga0070706_100381013 | |||
| 1231 | Ga0070707_100001995 | |||
| 1232 | Ga0070707_100012337 | |||
| 1233 | Ga0070707_100044553 | |||
| 1234 | Ga0070707_100152894 | |||
| 1235 | Ga0070707_100418862 | |||
| 1236 | Ga0070707_100446700 | |||
| 1237 | Ga0070698_100014291 | |||
| 1238 | Ga0070698_100047878 | |||
| 1239 | Ga0070698_100052393 | |||
| 1240 | Ga0070698_100093936 | |||
| 1241 | Ga0070699_100007506 | |||
| 1242 | Ga0070699_100103497 | |||
| 1243 | Ga0070699_101059651 | |||
| 1244 | Ga0070679_100238057 | |||
| 1245 | Ga0070679_100619123 | |||
| 1246 | Ga0070684_100172021 | |||
| 1247 | Ga0070684_100390342 | |||
| 1248 | Ga0070684_101003214 | |||
| 1249 | Ga0070697_100016077 | |||
| 1250 | Ga0070697_100402463 | |||
| 1251 | Ga0070697_100550488 | |||
| 1252 | Ga0070697_101187562 | |||
| 1253 | Ga0068853_100399200 | |||
| 1254 | Ga0070672_100405167 | |||
| 1255 | Ga0070686_100209337 | |||
| 1256 | Ga0070696_100075087 | |||
| 1257 | Ga0070665_100139911 | |||
| 1258 | Ga0070665_100593436 | |||
| 1259 | Ga0070704_100789789 | |||
| 1260 | Ga0068855_100002619 | |||
| 1261 | Ga0068855_100043217 | |||
| 1262 | Ga0068855_100453229 | |||
| 1263 | Ga0068855_101480033 | |||
| 1264 | Ga0070664_100292852 | |||
| 1265 | Ga0068857_100619858 | |||
| 1266 | Ga0068854_100213330 | |||
| 1267 | Ga0068854_100326466 | |||
| 1268 | Ga0068854_100597878 | |||
| 1269 | Ga0068856_100057624 | |||
| 1270 | Ga0068856_100139155 | |||
| 1271 | Ga0068856_100185530 | |||
| 1272 | Ga0068856_100221639 | |||
| 1273 | Ga0068856_100373226 | |||
| 1274 | Ga0068856_100434112 | |||
| 1275 | Ga0068856_101037793 | |||
| 1276 | Ga0070702_100544254 | |||
| 1277 | Ga0068852_100208988 | |||
| 1278 | Ga0068852_100266065 | |||
| 1279 | Ga0068852_100339167 | |||
| 1280 | Ga0068852_100778777 | |||
| 1281 | Ga0068859_100916700 | |||
| 1282 | Ga0068864_100234066 | |||
| 1283 | Ga0068861_100584634 | |||
| 1284 | Ga0068863_100111862 | |||
| 1285 | Ga0068863_100152405 | |||
| 1286 | Ga0068858_100242725 | |||
| 1287 | Ga0068858_100369424 | |||
| 1288 | Ga0081455_10009126 | |||
| 1289 | Ga0081455_10018583 | |||
| 1290 | Ga0081455_10078759 | |||
| 1291 | Ga0081455_10181009 | |||
| 1292 | Ga0081538_10001630 | |||
| 1293 | Ga0081538_10053443 | |||
| 1294 | Ga0081540_1000501 | |||
| 1295 | Ga0081539_10001034 | |||
| 1296 | Ga0081539_10032443 | |||
| 1297 | Ga0070717_10004815 | |||
| 1298 | Ga0070717_10016256 | |||
| 1299 | Ga0070717_10021586 | |||
| 1300 | Ga0070717_10048994 | |||
| 1301 | Ga0070717_10171121 | |||
| 1302 | Ga0070717_10209905 | |||
| 1303 | Ga0070717_10252170 | |||
| 1304 | Ga0070717_10255738 | |||
| 1305 | Ga0070717_10906621 | |||
| 1306 | Ga0070715_10006344 | |||
| 1307 | Ga0070715_10309079 | |||
| 1308 | Ga0070716_100005123 | |||
| 1309 | Ga0070716_100153627 | |||
| 1310 | Ga0070716_100214914 | |||
| 1311 | Ga0070716_100456722 | |||
| 1312 | Ga0070712_100013279 | |||
| 1313 | Ga0070712_100020373 | |||
| 1314 | Ga0070712_100043254 | |||
| 1315 | Ga0070712_100243508 | |||
| 1316 | Ga0070712_100581319 | |||
| 1317 | Ga0097621_100342599 | |||
| 1318 | Ga0097621_100652738 | |||
| 1319 | Ga0075370_10143241 | |||
| 1320 | Ga0068871_100218194 | |||
| 1321 | Ga0075428_100005648 | |||
| 1322 | Ga0075428_100069717 | |||
| 1323 | Ga0075428_100675731 | |||
| 1324 | Ga0075430_100449785 | |||
| 1325 | Ga0075431_100003397 | |||
| 1326 | Ga0075431_100005592 | |||
| 1327 | Ga0075431_101311137 | |||
| 1328 | Ga0075433_10023752 | |||
| 1329 | Ga0075434_100095600 | |||
| 1330 | Ga0075434_100700017 | |||
| 1331 | Ga0075429_100000465 | |||
| 1332 | Ga0075429_100245097 | |||
| 1333 | Ga0075436_100037340 | |||
| 1334 | Ga0075436_100082583 | |||
| 1335 | Ga0097620_100916670 | |||
| 1336 | Ga0099826_10183442 | |||
| 1337 | Ga0075435_100127257 | |||
| 1338 | Ga0075435_100878277 | |||
| 1339 | Ga0075435_100965960 | |||
| 1340 | Ga0099794_10055401 | |||
| 1341 | Ga0099795_10092663 | |||
| 1342 | Ga0105251_10003298 | |||
| 1343 | Ga0105251_10148277 | |||
| 1344 | Ga0105251_10202506 | |||
| 1345 | Ga0105244_10020236 | |||
| 1346 | Ga0105250_10173311 | |||
| 1347 | Ga0105240_10200120 | |||
| 1348 | Ga0105240_10331071 | |||
| 1349 | Ga0105240_10340055 | |||
| 1350 | Ga0111539_10007454 | |||
| 1351 | Ga0111539_10523042 | |||
| 1352 | Ga0105245_10007847 | |||
| 1353 | Ga0105245_10009889 | |||
| 1354 | Ga0105245_10064466 | |||
| 1355 | Ga0105245_10565169 | |||
| 1356 | Ga0105247_10052554 | |||
| 1357 | Ga0105247_10120371 | |||
| 1358 | Ga0105247_10275138 | |||
| 1359 | Ga0105247_10468154 | |||
| 1360 | Ga0114129_10039817 | |||
| 1361 | Ga0114129_10079888 | |||
| 1362 | Ga0114129_10623716 | |||
| 1363 | Ga0105243_10138335 | |||
| 1364 | Ga0105243_10251191 | |||
| 1365 | Ga0105241_10023257 | |||
| 1366 | Ga0105242_10373070 | |||
| 1367 | Ga0105248_10291107 | |||
| 1368 | Ga0105248_11002245 | |||
| 1369 | Ga0105237_10176955 | |||
| 1370 | Ga0105237_10333879 | |||
| 1371 | Ga0105237_11449872 | |||
| 1372 | Ga0105238_10533674 | |||
| 1373 | Ga0105238_10637307 | |||
| 1374 | Ga0105249_10147737 | |||
| 1375 | Ga0105249_10382605 | |||
| 1376 | Ga0105249_11581046 | |||
| 1377 | Ga0099796_10092221 | |||
| 1378 | Ga0105239_10125494 | |||
| 1379 | Ga0105239_10152243 | |||
| 1380 | Ga0105239_10650373 | |||
| 1381 | Ga0105246_10000725 | |||
| 1382 | Ga0157343_1005416 | |||
| 1383 | Ga0157342_1010233 | |||
| 1384 | Ga0157373_10205675 | |||
| 1385 | Ga0157371_10156176 | |||
| 1386 | Ga0157370_10035794 | |||
| 1387 | Ga0157370_10319265 | |||
| 1388 | Ga0157370_10376872 | |||
| 1389 | Ga0157369_10000499 | |||
| 1390 | Ga0157369_10011608 | |||
| 1391 | Ga0157369_10077765 | |||
| 1392 | Ga0157369_10093367 | |||
| 1393 | Ga0157369_10096226 | |||
| 1394 | Ga0157369_10194318 | |||
| 1395 | Ga0157369_10267052 | |||
| 1396 | Ga0157369_10424803 | |||
| 1397 | Ga0157369_10489011 | |||
| 1398 | Ga0157369_10812217 | |||
| 1399 | Ga0157369_10960618 | |||
| 1400 | Ga0157374_10051858 | |||
| 1401 | Ga0157374_10128120 | |||
| 1402 | Ga0157378_10182712 | |||
| 1403 | Ga0157378_11643860 | |||
| 1404 | Ga0163162_10985117 | |||
| 1405 | Ga0157372_10070679 | |||
| 1406 | Ga0157375_10026292 | |||
| 1407 | Ga0157375_10145638 | |||
| 1408 | Ga0157375_10270216 | |||
| 1409 | Ga0157375_10611153 | |||
| 1410 | Ga0182008_10025311 | |||
| 1411 | Ga0157377_10182353 | |||
| 1412 | Ga0157379_10244745 | |||
| 1413 | Ga0157379_10252377 | |||
| 1414 | Ga0182006_1075348 | |||
| 1415 | Ga0182007_10000669 | |||
| 1416 | Ga0183367_1015 | |||
| 1417 | Ga0163161_10287909 | |||
| 1418 | Ga0163161_10402296 | |||
| 1419 | Ga0206356_11633797 | |||
| 1420 | Ga0206353_10418018 | |||
| 1421 | Ga0206353_11592386 | |||
| 1422 | Ga0206353_11865961 | |||
| 1423 | Ga0213874_10004260 | |||
| 1424 | Ga0213875_10000989 | |||
| 1425 | Ga0213875_10041640 | |||
| 1426 | Ga0213875_10128178 | |||
| 1427 | Ga0224712_10220279 | |||
| 1428 | Ga0224712_10296545 | |||
| 1429 | Ga0224572_1014734 | |||
| 1430 | Ga0228598_1016371 | |||
| 1431 | Ga0209563_102036 | |||
| 1432 | Ga0209758_1009592 | |||
| 1433 | Ga0207713_1005912 | |||
| 1434 | Ga0207692_10087021 | |||
| 1435 | Ga0207692_10198841 | |||
| 1436 | Ga0207692_10224273 | |||
| 1437 | Ga0207710_10136124 | |||
| 1438 | Ga0207680_10398698 | |||
| 1439 | Ga0207647_10016868 | |||
| 1440 | Ga0207647_10154334 | |||
| 1441 | Ga0207685_10015085 | |||
| 1442 | Ga0207699_10034945 | |||
| 1443 | Ga0207699_10155981 | |||
| 1444 | Ga0207699_10201018 | |||
| 1445 | Ga0207699_10831576 | |||
| 1446 | Ga0207705_10148584 | |||
| 1447 | Ga0207705_10679467 | |||
| 1448 | Ga0207705_10721975 | |||
| 1449 | Ga0207684_10018360 | |||
| 1450 | Ga0207684_10032219 | |||
| 1451 | Ga0207684_10167406 | |||
| 1452 | Ga0207684_10222277 | |||
| 1453 | Ga0207684_10401708 | |||
| 1454 | Ga0207684_11045369 | |||
| 1455 | Ga0207654_10068002 | |||
| 1456 | Ga0207695_10002619 | |||
| 1457 | Ga0207695_10094794 | |||
| 1458 | Ga0207671_10000859 | |||
| 1459 | Ga0207671_10351728 | |||
| 1460 | Ga0207693_10013690 | |||
| 1461 | Ga0207693_10035163 | |||
| 1462 | Ga0207693_10049315 | |||
| 1463 | Ga0207693_10096636 | |||
| 1464 | Ga0207693_10103315 | |||
| 1465 | Ga0207693_10249211 | |||
| 1466 | Ga0207663_10030774 | |||
| 1467 | Ga0207663_10044704 | |||
| 1468 | Ga0207663_10065845 | |||
| 1469 | Ga0207663_10167736 | |||
| 1470 | Ga0207662_10134796 | |||
| 1471 | Ga0207657_10536501 | |||
| 1472 | Ga0207652_10265815 | |||
| 1473 | Ga0207646_10002609 | |||
| 1474 | Ga0207646_10014615 | |||
| 1475 | Ga0207646_10044426 | |||
| 1476 | Ga0207646_10220795 | |||
| 1477 | Ga0207646_10274715 | |||
| 1478 | Ga0207646_10391882 | |||
| 1479 | Ga0207646_10480455 | |||
| 1480 | Ga0207694_10002482 | |||
| 1481 | Ga0207659_10158434 | |||
| 1482 | Ga0207687_10034173 | |||
| 1483 | Ga0207687_10062622 | |||
| 1484 | Ga0207687_10612260 | |||
| 1485 | Ga0207700_10020875 | |||
| 1486 | Ga0207700_10059269 | |||
| 1487 | Ga0207700_10080429 | |||
| 1488 | Ga0207700_10427183 | |||
| 1489 | Ga0207700_10596038 | |||
| 1490 | Ga0207700_11004445 | |||
| 1491 | Ga0207664_10001035 | |||
| 1492 | Ga0207664_10015616 | |||
| 1493 | Ga0207664_10040879 | |||
| 1494 | Ga0207664_10063522 | |||
| 1495 | Ga0207664_10140191 | |||
| 1496 | Ga0207664_10416578 | |||
| 1497 | Ga0207664_10602950 | |||
| 1498 | Ga0207664_10654901 | |||
| 1499 | Ga0207664_10678737 | |||
| 1500 | Ga0207664_10809760 | |||
| 1501 | Ga0207644_10191076 | |||
| 1502 | Ga0207709_10488363 | |||
| 1503 | Ga0207669_10198535 | |||
| 1504 | Ga0207669_10472713 | |||
| 1505 | Ga0207704_10839378 | |||
| 1506 | Ga0207665_10001452 | |||
| 1507 | Ga0207665_10001502 | |||
| 1508 | Ga0207665_10023079 | |||
| 1509 | Ga0207665_10058692 | |||
| 1510 | Ga0207691_10749314 | |||
| 1511 | Ga0207691_10885721 | |||
| 1512 | Ga0207711_10018303 | |||
| 1513 | Ga0207689_10071805 | |||
| 1514 | Ga0207661_10074221 | |||
| 1515 | Ga0207661_10318834 | |||
| 1516 | Ga0207661_10837823 | |||
| 1517 | Ga0207667_10042250 | |||
| 1518 | Ga0207667_10189998 | |||
| 1519 | Ga0207712_10095294 | |||
| 1520 | Ga0207712_10147226 | |||
| 1521 | Ga0207712_11108896 | |||
| 1522 | Ga0207668_10135099 | |||
| 1523 | Ga0207668_10404760 | |||
| 1524 | Ga0207640_10150742 | |||
| 1525 | Ga0207640_10238306 | |||
| 1526 | Ga0207658_10316003 | |||
| 1527 | Ga0207677_10434204 | |||
| 1528 | Ga0207703_10060917 | |||
| 1529 | Ga0207639_10059310 | |||
| 1530 | Ga0207639_10523852 | |||
| 1531 | Ga0207678_10009111 | |||
| 1532 | Ga0207702_10048478 | |||
| 1533 | Ga0207702_10087270 | |||
| 1534 | Ga0207702_10231058 | |||
| 1535 | Ga0207702_10245159 | |||
| 1536 | Ga0207702_10703008 | |||
| 1537 | Ga0207702_10778005 | |||
| 1538 | Ga0207702_11040238 | |||
| 1539 | Ga0207641_10054631 | |||
| 1540 | Ga0207676_10509161 | |||
| 1541 | Ga0207676_10634010 | |||
| 1542 | Ga0207676_10816796 | |||
| 1543 | Ga0207674_10151813 | |||
| 1544 | Ga0207674_10406519 | |||
| 1545 | Ga0207675_100080881 | |||
| 1546 | Ga0207675_100182260 | |||
| 1547 | Ga0207675_101671918 | |||
| 1548 | Ga0207683_10124879 | |||
| 1549 | Ga0207683_10241243 | |||
| 1550 | Ga0207698_10158043 | |||
| 1551 | Ga0209371_1032899 | |||
| 1552 | Ga0209588_1101257 | |||
| 1553 | Ga0207428_10006504 | |||
| 1554 | Ga0268266_10075243 | |||
| 1555 | Ga0268266_10396119 | |||
| 1556 | Ga0268266_10775591 | |||
| 1557 | Ga0268265_10590731 | |||
| 1558 | Ga0268264_10488130 | |||
| 1559 | Ga0307517_10075499 | |||
| 1560 | Ga0307515_10014891 | |||
| 1561 | Ga0307515_10162171 | |||
| 1562 | Ga0265338_10001130 | |||
| 1563 | Ga0268256_1037440 | |||
| 1564 | Ga0307511_10000029 | |||
| 1565 | Ga0307511_10091665 | |||
| 1566 | Ga0307512_10003228 | |||
| 1567 | Ga0307512_10011081 | |||
| 1568 | Ga0316177_1221734 | |||
| 1569 | Ga0316176_1068858 | |||
| 1570 | Ga0314311_1078233 | |||
| 1571 | Ga0316179_1056778 | |||
| 1572 | Ga0265763_1007959 | |||
| 1573 | Ga0265325_10015843 | |||
| 1574 | Ga0265340_10030432 | |||
| 1575 | Ga0265327_10000125 | |||
| 1576 | Ga0265327_10032023 | |||
| 1577 | Ga0307513_10001602 | |||
| 1578 | Ga0307513_10023643 | |||
| 1579 | Ga0307509_10013741 | |||
| 1580 | Ga0307509_10033598 | |||
| 1581 | Ga0307408_100483261 | |||
| 1582 | Ga0307508_10008497 | |||
| 1583 | Ga0307508_10017888 | |||
| 1584 | Ga0307508_10023761 | |||
| 1585 | Ga0307508_10238293 | |||
| 1586 | Ga0307514_10003328 | |||
| 1587 | Ga0307514_10005036 | |||
| 1588 | Ga0307514_10064296 | |||
| 1589 | Ga0307514_10323710 | |||
| 1590 | Ga0316575_10000004 | |||
| 1591 | Ga0265314_10308469 | |||
| 1592 | Ga0316576_10003726 | |||
| 1593 | Ga0316576_10005029 | |||
| 1594 | Ga0316576_10073932 | |||
| 1595 | Ga0316576_10570502 | |||
| 1596 | Ga0316578_10014563 | |||
| 1597 | Ga0316578_10114663 | |||
| 1598 | Ga0307516_10005315 | |||
| 1599 | Ga0307516_10024874 | |||
| 1600 | Ga0307516_10059173 | |||
| 1601 | Ga0307516_10404495 | |||
| 1602 | Ga0307413_10096162 | |||
| 1603 | Ga0307518_10078872 | |||
| 1604 | Ga0307518_10223755 | |||
| 1605 | Ga0307410_10271906 | |||
| 1606 | Ga0307406_10204985 | |||
| 1607 | Ga0307406_10216661 | |||
| 1608 | Ga0307406_10402030 | |||
| 1609 | Ga0307407_10266075 | |||
| 1610 | Ga0307407_10492292 | |||
| 1611 | Ga0307409_100134687 | |||
| 1612 | Ga0307409_100176188 | |||
| 1613 | Ga0307409_101029367 | |||
| 1614 | Ga0307416_100116514 | |||
| 1615 | Ga0307416_101085501 | |||
| 1616 | Ga0307415_100040118 | |||
| 1617 | Ga0307415_100102738 | |||
| 1618 | Ga0307507_10041134 | |||
| 1619 | Ga0307507_10041576 | |||
| 1620 | Ga0307507_10200653 | |||
| 1621 | Ga0307510_10015231 | |||
| 1622 | Ga0307510_10044243 | |||
| 1623 | Ga0307510_10113562 | |||
| 1624 | Ga0316214_1032490 | |||
| 1625 | Ga0373930_0056299 | |||
| 1626 | Ga0373958_0071359 | |||
| 1627 | Ga0373926_0000170 | |||
| 1628 | Ga0373926_0005176 | |||
| 1629 | Ga0373926_0006409 | |||
| 1630 | Ga0373929_0063085 | |||
| 1631 | Ga0373934_0026026 | |||
| 1632 | Ga0373934_0100822 | |||
| 1633 | Ga0373944_0000752 | |||
| 1634 | Ga0373944_0158924 | |||
| 1635 | Ga0373923_0000684 | |||
| 1636 | Ga0373923_0006064 | |||
| 1637 | Ga0373923_0078035 | |||
| 1638 | Ga0373923_0242864 | |||
| 1639 | Ga0373936_0004356 | |||
| 1640 | Ga0373936_0009278 | |||
| 1641 | Ga0373945_0000905 | |||
| 1642 | Ga0373945_0001739 | |||
| 1643 | Ga0373953_0043135 | |||
| 1644 | Ga0373953_0106813 | |||
| 1645 | Ga0373953_0221865 | |||
| 1646 | Ga0373954_0061604 | |||
| 1647 | Ga0373954_0285494 | |||
| 1648 | Ga0373954_0402460 | |||
| 1649 | Ga0373956_0009402 | |||
| 1650 | Ga0373956_0012461 | |||
| 1651 | Ga0373956_0154077 | |||
| 1652 | Ga0373957_0039081 | |||
| 1653 | Ga0373957_0175531 | |||
| 1654 | Ga0373943_0002847 | |||
| 1655 | Ga0373943_0002993 | |||
| 1656 | Ga0373943_0048327 | |||
| 1657 | Ga0373946_0002040 | |||
| 1658 | Ga0373946_0005679 | |||
| 1659 | Ga0373955_0009135 | |||
| 1660 | Ga0373955_0023797 | |||
| 1661 | Ga0373955_0101129 | |||
| 1662 | Ga0373955_0109720 | |||
| 1663 | Ga0373955_0243003 | |||
| 1664 | Ga0316574_0008888 | |||
| 1665 | Ga0316574_0027835 | |||
| 1666 | Ga0316574_0352280 | |||
| 1667 | Ga0373924_0010452 | |||
| 1668 | Ga0373924_0025616 | |||
| 1669 | Ga0373924_0042315 | |||
| 1670 | Ga0373924_0065690 | |||
| 1671 | Ga0373935_0000585 | |||
| 1672 | Ga0373935_0000925 | |||
| 1673 | Ga0373935_0012498 | |||
| 1674 | Ga0373927_0001256 | |||
| 1675 | Ga0373927_0012374 | |||
| 1676 | Ga0373927_0236113 | |||
| 1677 | Ga0373927_0563742 | |||
| 1678 | Ga0373933_0016337 | |||
| 1679 | Ga0373933_0121739 | |||
| 1680 | Ga0373933_0126130 | |||
| 1681 | Ga0373947_0000285 | |||
| 1682 | Ga0373947_0004745 | |||
| 1683 | Ga0373947_0038584 | |||
| 1684 | Ga0373947_0097265 | |||
| 1685 | Ga0373947_0847609 | |||
| 1686 | Ga0373937_0030477 | |||
| 1687 | Ga0373937_0055981 | |||
| 1688 | Ga0373937_0154482 | |||
| 1689 | Ga0373937_0163309 | |||
| 1690 | Ga0373937_0215587 | |||
| 1691 | Ga0316582_0639592 | |||
| 1692 | Ga0316584_0747821 | |||
| 1693 | Ga0373925_0001910 | |||
| 1694 | Ga0373925_0014948 | |||
| 1695 | Ga0373925_0028939 | |||
| 1696 | Ga0373925_0164052 | |||
| 1697 | Ga0373925_0460067 | |||
| 1698 | Ga0395899_0156073 | |||
| 1699 | Ga0395900_0027051 | |||
| 1700 | Ga0395898_0011730 | |||
| 1701 | Ga0395898_0191058 | |||
| 1702 | Ga0436364_0454301 | |||
| 1703 | Ga0436364_0841312 | |||
| 1704 | Ga0436364_0912466 | |||
| 1705 | Ga0436364_0937718 | |||
| 1706 | Ga0436364_1073971 | |||
| 1707 | Ga0436364_1347787 | |||
| 1708 | Ga0436364_1503455 | |||
| 1709 | Ga0436364_1544337 | |||
| 1710 | Ga0395901_0047110 | |||
| 1711 | Ga0395901_0063285 | |||
| 1712 | Ga0436365_0595644 | |||
| 1713 | Ga0436360_0005371 | |||
| 1714 | Ga0436363_0002297 | |||
| 1715 | Ga0436363_0169319 | |||
| 1716 | Ga0436363_0232657 | |||
| 1717 | Ga0436363_1064625 | |||
| 1718 | Ga0439436_0006090 | |||
| 1719 | Ga0439439_0030632 | |||
| 1720 | Ga0451797_1461308 | |||
| 1721 | Ga0451807_2562875 | |||
| 1722 | Ga0451833_1112365 | |||
| 1723 | Ga0451837_0454087 | |||
| 1724 | Ga0451841_0471427 | |||
| 1725 | Ga0451853_0334494 | |||
| 1726 | Ga0451853_2740783 | |||
| 1727 | Ga0451853_3121249 | |||
| 1728 | Ga0439432_079878 | |||
| 1729 | Ga0439449_0004271 | |||
| 1730 | Ga0439449_0067602 | |||
| 1731 | Ga0439457_002218 | |||
| 1732 | Ga0450894_000953 | |||
| 1733 | Ga0450898_000877 | |||
| 1734 | Ga0450899_001207 | |||
| 1735 | Ga0450900_044651 | |||
| 1736 | Ga0450903_000200 | |||
| 1737 | Ga0450906_000555 | |||
| 1738 | Ga0450907_033465 | |||
| 1739 | Ga0466969_0012742 | |||
| 1740 | Ga0466969_0072606 | |||
| 1741 | Ga0466969_0077513 | |||
| 1742 | Ga0466972_0032963 | |||
| 1743 | Ga0466972_0048025 | |||
| 1744 | Ga0466972_0058433 | |||
| 1745 | Ga0466972_0059694 | |||
| 1746 | Ga0466972_0078797 | |||
| 1747 | Ga0466965_0002184 | |||
| 1748 | Ga0466965_0099239 | |||
| 1749 | Ga0466966_0005485 | |||
| 1750 | Ga0466966_0015625 | |||
| 1751 | Ga0466966_0077165 | |||
| 1752 | Ga0466966_0093000 | |||
| 1753 | Ga0466966_0112624 | |||
| 1754 | Ga0466961_0004352 | |||
| 1755 | Ga0466961_0009683 | |||
| 1756 | Ga0466961_0031272 | |||
| 1757 | Ga0466961_0180555 | |||
| 1758 | Ga0466961_0183769 | |||
| 1759 | Ga0466963_0004623 | |||
| 1760 | Ga0466963_0196081 | |||
| 1761 | Ga0466964_0035392 | |||
| 1762 | Ga0466971_0000731 | |||
| 1763 | Ga0466971_0029407 | |||
| 1764 | Ga0466971_0045827 | |||
| 1765 | Ga0466971_0092094 | |||
| 1766 | Ga0466971_0097165 | |||
| 1767 | Ga0466968_0008647 | |||
| 1768 | Ga0466970_0000891 | |||
| 1769 | Ga0466970_0007398 | |||
| 1770 | Ga0466970_0007838 | |||
| 1771 | Ga0466970_0138245 | |||
| 1772 | Ga0466970_0175804 | |||
| 1773 | Ga0466957_0000553 | |||
| 1774 | Ga0466957_0097799 | |||
| 1775 | Ga0466957_0223446 | |||
| 1776 | Ga0466960_0089672 | |||
| 1777 | Ga0466959_0002672 | |||
| 1778 | Ga0466959_0003442 | |||
| 1779 | Ga0466959_0025188 | |||
| 1780 | Ga0466959_0156759 | |||
| 1781 | Ga0466958_0017827 | |||
| 1782 | Ga0466958_0513665 | |||
| 1783 | Ga0466967_0042072 | |||
| 1784 | Ga0466967_0114528 | |||
| 1785 | Ga0466967_0299084 | |||
| 1786 | Ga0466967_0708642 | |||
| 1787 | Ga0495627_014698 | |||
| 1788 | Ga0495627_043162 | |||
| 1789 | Ga0495592_0002271 | |||
| 1790 | Ga0495592_0003737 | |||
| 1791 | Ga0495592_0040543 | |||
| 1792 | Ga0495592_0055075 | |||
| 1793 | Ga0495592_0065729 | |||
| 1794 | Ga0495592_0127132 | |||
| 1795 | Ga0495592_0145161 | |||
| 1796 | Ga0495592_0397598 | |||
| 1797 | Ga0495592_0584936 | |||
| 1798 | Ga0495603_0002831 | |||
| 1799 | Ga0495603_0005656 | |||
| 1800 | Ga0495603_0011462 | |||
| 1801 | Ga0495603_0023323 | |||
| 1802 | Ga0495603_0240253 | |||
| 1803 | Ga0495603_0390470 | |||
| 1804 | Ga0495603_0466101 | |||
| 1805 | Ga0495629_0001126 | |||
| 1806 | Ga0495629_0003859 | |||
| 1807 | Ga0495629_0006498 | |||
| 1808 | Ga0495629_0021301 | |||
| 1809 | Ga0495629_0036334 | |||
| 1810 | Ga0495629_0101287 | |||
| 1811 | Ga0495629_0124429 | |||
| 1812 | Ga0495629_0181995 | |||
| 1813 | Ga0495638_0042577 | |||
| 1814 | Ga0495638_0069420 | |||
| 1815 | Ga0495638_0109151 | |||
| 1816 | Ga0495638_0124370 | |||
| 1817 | Ga0495641_0002343 | |||
| 1818 | Ga0495641_0014347 | |||
| 1819 | Ga0495651_0010645 | |||
| 1820 | Ga0495651_0028367 | |||
| 1821 | Ga0495651_0048595 | |||
| 1822 | Ga0495651_0072280 | |||
| 1823 | Ga0495651_0076100 | |||
| 1824 | Ga0495651_0151434 | |||
| 1825 | Ga0495651_0159825 | |||
| 1826 | Ga0495651_0324899 | |||
| 1827 | Ga0495651_0517848 | |||
| 1828 | Ga0495653_0006927 | |||
| 1829 | Ga0495653_0008832 | |||
| 1830 | Ga0495653_0010809 | |||
| 1831 | Ga0495653_0016905 | |||
| 1832 | Ga0495653_0028580 | |||
| 1833 | Ga0495653_0104005 | |||
| 1834 | Ga0495653_0300443 | |||
| 1835 | Ga0495580_0005592 | |||
| 1836 | Ga0495580_0025433 | |||
| 1837 | Ga0495582_0003441 | |||
| 1838 | Ga0495582_0027255 | |||
| 1839 | Ga0495582_0041255 | |||
| 1840 | Ga0495582_0102471 | |||
| 1841 | Ga0495639_0005098 | |||
| 1842 | Ga0495639_0142985 | |||
| 1843 | Ga0495662_0000778 | |||
| 1844 | Ga0495662_0002509 | |||
| 1845 | Ga0495662_0004864 | |||
| 1846 | Ga0495662_0009607 | |||
| 1847 | Ga0495662_0011366 | |||
| 1848 | Ga0495662_0014930 | |||
| 1849 | Ga0495662_0017662 | |||
| 1850 | Ga0495662_0069482 | |||
| 1851 | Ga0495662_0074306 | |||
| 1852 | Ga0495664_0000391 | |||
| 1853 | Ga0495664_0006849 | |||
| 1854 | Ga0495664_0015064 | |||
| 1855 | Ga0495664_0018080 | |||
| 1856 | Ga0495664_0093898 | |||
| 1857 | Ga0495664_0146869 | |||
| 1858 | Ga0495664_0227240 | |||
| 1859 | Ga0495664_0256009 | |||
| 1860 | Ga0495585_0034278 | |||
| 1861 | Ga0495594_0005801 | |||
| 1862 | Ga0495594_0007517 | |||
| 1863 | Ga0495594_0023705 | |||
| 1864 | Ga0495594_0216489 | |||
| 1865 | Ga0495594_0383090 | |||
| 1866 | Ga0495608_0001231 | |||
| 1867 | Ga0495608_0015515 | |||
| 1868 | Ga0495608_0044086 | |||
| 1869 | Ga0495608_0143318 | |||
| 1870 | Ga0495608_0220098 | |||
| 1871 | Ga0495618_0043137 | |||
| 1872 | Ga0495618_0049082 | |||
| 1873 | Ga0495618_0072533 | |||
| 1874 | Ga0495618_0104235 | |||
| 1875 | Ga0495618_0177683 | |||
| 1876 | Ga0495618_0284593 | |||
| 1877 | Ga0495628_0002991 | |||
| 1878 | Ga0495628_0014635 | |||
| 1879 | Ga0495628_0121244 | |||
| 1880 | Ga0495628_0133599 | |||
| 1881 | Ga0495628_0216717 | |||
| 1882 | Ga0495628_0217030 | |||
| 1883 | Ga0495628_0260591 | |||
| 1884 | Ga0495628_0395195 | |||
| 1885 | Ga0495630_0000703 | |||
| 1886 | Ga0495630_0018884 | |||
| 1887 | Ga0495630_0130447 | |||
| 1888 | Ga0495630_0264684 | |||
| 1889 | Ga0495630_0542491 | |||
| 1890 | Ga0495631_0283925 | |||
| 1891 | Ga0495632_0054684 | |||
| 1892 | Ga0495637_0099018 | |||
| 1893 | Ga0495643_0001615 | |||
| 1894 | Ga0495643_0177995 | |||
| 1895 | Ga0495666_0012169 | |||
| 1896 | Ga0495652_0001872 | |||
| 1897 | Ga0495652_0014592 | |||
| 1898 | Ga0495652_0027773 | |||
| 1899 | Ga0495652_0074965 | |||
| 1900 | Ga0495652_0108941 | |||
| 1901 | Ga0495652_0153565 | |||
| 1902 | Ga0495652_0165159 | |||
| 1903 | Ga0495652_0194738 | |||
| 1904 | Ga0495652_0297261 | |||
| 1905 | Ga0495652_0319829 | |||
| 1906 | Ga0495665_0043023 | |||
| 1907 | Ga0495665_0053415 | |||
| 1908 | Ga0495665_0307616 | |||
| 1909 | Ga0495640_0001053 | |||
| 1910 | Ga0495640_0029936 | |||
| 1911 | Ga0495640_0030511 | |||
| 1912 | Ga0495640_0045950 | |||
| 1913 | Ga0495640_0069695 | |||
| 1914 | Ga0495640_0105120 | |||
| 1915 | Ga0495640_0291198 | |||
| 1916 | Ga0495586_0007632 | |||
| 1917 | Ga0495586_0012479 | |||
| 1918 | Ga0495586_0104890 | |||
| 1919 | Ga0495586_0324136 | |||
| 1920 | Ga0495587_0003902 | |||
| 1921 | Ga0495587_0004174 | |||
| 1922 | Ga0495587_0006375 | |||
| 1923 | Ga0495587_0013196 | |||
| 1924 | Ga0495587_0019644 | |||
| 1925 | Ga0495587_0033613 | |||
| 1926 | Ga0495645_0000506 | |||
| 1927 | Ga0495645_0010307 | |||
| 1928 | Ga0495645_0028178 | |||
| 1929 | Ga0495645_0199310 | |||
| 1930 | Ga0495645_0224325 | |||
| 1931 | Ga0495645_0233777 | |||
| 1932 | Ga0495645_0233954 | |||
| 1933 | Ga0495645_0296287 | |||
| 1934 | Ga0495622_0017899 | |||
| 1935 | Ga0495622_0047424 | |||
| 1936 | Ga0495622_0066701 | |||
| 1937 | Ga0495622_0124324 | |||
| 1938 | Ga0495633_0095871 | |||
| 1939 | Ga0495667_0001397 | |||
| 1940 | Ga0495667_0023079 | |||
| 1941 | Ga0495667_0026280 | |||
| 1942 | Ga0495667_0047033 | |||
| 1943 | Ga0495667_0142129 | |||
| 1944 | Ga0495634_0001317 | |||
| 1945 | Ga0495634_0017477 | |||
| 1946 | Ga0495634_0017724 | |||
| 1947 | Ga0495634_0019430 | |||
| 1948 | Ga0495634_0039209 | |||
| 1949 | Ga0495634_0399756 | |||
| 1950 | Ga0495625_0126680 | |||
| 1951 | Ga0495635_0001470 | |||
| 1952 | Ga0495635_0004171 | |||
| 1953 | Ga0495635_0007010 | |||
| 1954 | Ga0495635_0009525 | |||
| 1955 | Ga0495635_0011615 | |||
| 1956 | Ga0495635_0106079 | |||
| 1957 | Ga0495635_0166724 | |||
| 1958 | Ga0495661_0097353 | |||
| 1959 | Ga0495588_0003831 | |||
| 1960 | Ga0495588_0003953 | |||
| 1961 | Ga0495588_0053089 | |||
| 1962 | Ga0495588_0152226 | |||
| 1963 | Ga0495657_0001306 | |||
| 1964 | Ga0495657_0002997 | |||
| 1965 | Ga0495657_0015844 | |||
| 1966 | Ga0495657_0018069 | |||
| 1967 | Ga0495657_0026868 | |||
| 1968 | Ga0495657_0031240 | |||
| 1969 | Ga0495657_0117127 | |||
| 1970 | Ga0495657_0119109 | |||
| 1971 | Ga0495599_0000586 | |||
| 1972 | Ga0495599_0013786 | |||
| 1973 | Ga0495599_0017225 | |||
| 1974 | Ga0495599_0032875 | |||
| 1975 | Ga0495599_0157154 | |||
| 1976 | Ga0495599_0276741 | |||
| 1977 | Ga0495599_0286370 | |||
| 1978 | Ga0495623_0011033 | |||
| 1979 | Ga0495623_0025608 | |||
| 1980 | Ga0495623_0028084 | |||
| 1981 | Ga0495623_0105210 | |||
| 1982 | Ga0495623_0222949 | |||
| 1983 | Ga0495646_0001997 | |||
| 1984 | Ga0495646_0004086 | |||
| 1985 | Ga0495646_0077433 | |||
| 1986 | Ga0495646_0078280 | |||
| 1987 | Ga0495646_0125386 | |||
| 1988 | Ga0495647_0071573 | |||
| 1989 | Ga0495658_0176417 | |||
| 1990 | Ga0495658_0190920 | |||
| 1991 | Ga0495658_0211170 | |||
| 1992 | Ga0495613_0004734 | |||
| 1993 | Ga0495613_0007501 | |||
| 1994 | Ga0495613_0020520 | |||
| 1995 | Ga0495613_0021391 | |||
| 1996 | Ga0495613_0099713 | |||
| 1997 | Ga0495613_0160610 | |||
| 1998 | Ga0495613_0294506 | |||
| 1999 | Ga0495624_0002479 | |||
| 2000 | Ga0495624_0003841 | |||
| 2001 | Ga0495624_0099414 | |||
| 2002 | Ga0495624_0177106 | |||
| 2003 | Ga0495671_0003057 | |||
| 2004 | Ga0495649_0050387 | |||
| 2005 | Ga0495589_0077632 | |||
| 2006 | Ga0495589_0085818 | |||
| 2007 | Ga0495600_0011071 | |||
| 2008 | Ga0495600_0020662 | |||
| 2009 | Ga0495600_0023159 | |||
| 2010 | Ga0495600_0042841 | |||
| 2011 | Ga0495600_0053588 | |||
| 2012 | Ga0495600_0083600 | |||
| 2013 | Ga0495600_0107389 | |||
| 2014 | Ga0495600_0116552 | |||
| 2015 | Ga0495600_0167578 | |||
| 2016 | Ga0495600_0624131 | |||
| 2017 | Ga0495660_0001963 | |||
| 2018 | Ga0495581_0000387 | |||
| 2019 | Ga0495581_0130899 | |||
| 2020 | Ga0495581_0164789 | |||
| 2021 | Ga0495581_0544050 | |||
| 2022 | Ga0495604_0001106 | |||
| 2023 | Ga0495604_0003229 | |||
| 2024 | Ga0495604_0009136 | |||
| 2025 | Ga0495604_0012046 | |||
| 2026 | Ga0495604_0104715 | |||
| 2027 | Ga0495604_0160908 | |||
| 2028 | Ga0495604_0170364 | |||
| 2029 | Ga0495636_0000438 | |||
| 2030 | Ga0495636_0035808 | |||
| 2031 | Ga0495636_0143436 | |||
| 2032 | Ga0495674_0001552 | |||
| 2033 | Ga0495674_0005450 | |||
| 2034 | Ga0495674_0009699 | |||
| 2035 | Ga0495674_0017433 | |||
| 2036 | Ga0495674_0043980 | |||
| 2037 | Ga0495674_0075032 | |||
| 2038 | Ga0495674_0095085 | |||
| 2039 | Ga0495674_0379806 | |||
| 2040 | Ga0495674_0482257 | |||
| 2041 | Ga0495674_0625097 | |||
| 2042 | Ga0495676_0005414 | |||
| 2043 | Ga0495676_0009385 | |||
| 2044 | Ga0495676_0011404 | |||
| 2045 | Ga0495676_0032408 | |||
| 2046 | Ga0495676_0041863 | |||
| 2047 | Ga0495676_0092220 | |||
| 2048 | Ga0495676_0115225 | |||
| 2049 | Ga0495680_0010224 | |||
| 2050 | Ga0495680_0019620 | |||
| 2051 | Ga0495680_0025003 | |||
| 2052 | Ga0495680_0032803 | |||
| 2053 | Ga0495680_0079882 | |||
| 2054 | Ga0495680_0081140 | |||
| 2055 | Ga0495680_0440802 | |||
| 2056 | Ga0495687_005938 | |||
| 2057 | Ga0495687_028003 | |||
| 2058 | Ga0495687_031007 | |||
| 2059 | Ga0495675_0003847 | |||
| 2060 | Ga0495675_0008548 | |||
| 2061 | Ga0495675_0013329 | |||
| 2062 | Ga0495675_0022945 | |||
| 2063 | Ga0495675_0115463 | |||
| 2064 | Ga0495675_0127804 | |||
| 2065 | Ga0495675_0136363 | |||
| 2066 | Ga0495675_0593601 | |||
| 2067 | Ga0495679_038092 | |||
| 2068 | Ga0495685_001997 | |||
| 2069 | Ga0495685_005377 | |||
| 2070 | Ga0495685_013011 | |||
| 2071 | Ga0495685_042817 | |||
| 2072 | Ga0495681_0001290 | |||
| 2073 | Ga0495681_0001442 | |||
| 2074 | Ga0495681_0293147 | |||
| 2075 | Ga0495684_0001120 | |||
| 2076 | Ga0495684_0007472 | |||
| 2077 | Ga0495684_0024914 | |||
| 2078 | Ga0495684_0037692 | |||
| 2079 | Ga0495684_0061765 | |||
| 2080 | Ga0495684_0065307 | |||
| 2081 | Ga0495684_0081691 | |||
| 2082 | Ga0495686_0093942 | |||
| 2083 | Ga0495686_0109940 | |||
| 2084 | Ga0495686_0136991 | |||
| 2085 | Ga0495593_0012039 | |||
| 2086 | Ga0495593_0064534 | |||
| 2087 | Ga0495602_0002436 | |||
| 2088 | Ga0495602_0009848 | |||
| 2089 | Ga0495602_0036211 | |||
| 2090 | Ga0495602_0062413 | |||
| 2091 | Ga0495602_0069291 | |||
| 2092 | Ga0495602_0185647 | |||
| 2093 | Ga0495602_0205249 | |||
| 2094 | Ga0495614_0005911 | |||
| 2095 | Ga0495614_0013438 | |||
| 2096 | Ga0495614_0022455 | |||
| 2097 | Ga0495614_0045019 | |||
| 2098 | Ga0495614_0213870 | |||
| 2099 | Ga0495626_0039673 | |||
| 2100 | Ga0496101_0220533 | |||
| 2101 | Ga0496102_0278313 | |||
| 2102 | Ga0496102_0523586 | |||
| 2103 | Ga0496102_0752197 | |||
| 2104 | Ga0496104_0049596 | |||
| 2105 | Ga0496104_0068915 | |||
| 2106 | Ga0496104_0134924 | |||
| 2107 | Ga0496104_0210680 | |||
| 2108 | Ga0496105_0049682 | |||
| 2109 | Ga0496105_0112081 | |||
| 2110 | Ga0496105_0367101 | |||
| 2111 | Ga0496106_0318370 | |||
| 2112 | Ga0496106_0450811 | |||
| 2113 | Ga0496108_0008336 | |||
| 2114 | Ga0496108_0019781 | |||
| 2115 | Ga0496108_0081819 | |||
| 2116 | Ga0496108_0394038 | |||
| 2117 | Ga0496108_0529145 | |||
| 2118 | Ga0496109_0139668 | |||
| 2119 | Ga0496109_0144818 | |||
| 2120 | Ga0496109_0327779 | |||
| 2121 | Ga0496109_0393385 | |||
| 2122 | Ga0496109_0949058 | |||
| 2123 | Ga0496110_0014330 | |||
| 2124 | Ga0496110_0125396 | |||
| 2125 | Ga0496110_0271977 | |||
| 2126 | Ga0496110_0308725 | |||
| 2127 | Ga0496110_0648454 | |||
| 2128 | Ga0496111_0076344 | |||
| 2129 | Ga0496111_0282713 | |||
| 2130 | Ga0496112_0070472 | |||
| 2131 | Ga0496112_0457162 | |||
| 2132 | Ga0496113_0064948 | |||
| 2133 | Ga0496113_0429293 | |||
| 2134 | Ga0496113_1063887 | |||
| 2135 | Ga0496114_0263897 | |||
| 2136 | Ga0496114_0515116 | |||
| 2137 | Ga0496114_0688441 | |||
| 2138 | Ga0496114_0737975 | |||
| 2139 | Ga0496115_0018146 | |||
| 2140 | Ga0496115_0156044 | |||
| 2141 | Ga0496117_0001948 | |||
| 2142 | Ga0496118_0000281 | |||
| 2143 | Ga0496118_0031647 | |||
| 2144 | Ga0496119_0217594 | |||
| 2145 | Ga0496120_0077938 | |||
| 2146 | Ga0496120_0087380 | |||
| 2147 | Ga0496120_0140231 | |||
| 2148 | Ga0496122_0000932 | |||
| 2149 | Ga0496122_0017130 | |||
| 2150 | Ga0496122_0112660 | |||
| 2151 | Ga0496123_0143950 | |||
| 2152 | Ga0496124_0000323 | |||
| 2153 | Ga0496124_0078850 | |||
| 2154 | Ga0496125_0000046 | |||
| 2155 | Ga0496126_0095047 | |||
| 2156 | Ga0496126_0237989 | |||
| 2157 | Ga0496126_0601875 | |||
| 2158 | Ga0501031_0017192 | |||
| 2159 | Ga0501031_0018698 | |||
| 2160 | Ga0501031_0372960 | |||
| 2161 | Ga0501032_0012448 | |||
| 2162 | Ga0501032_0014613 | |||
| 2163 | Ga0501033_0010578 | |||
| 2164 | Ga0501033_0017508 | |||
| 2165 | Ga0501033_0018702 | |||
| 2166 | Ga0501033_0072888 | |||
| 2167 | Ga0501033_0201237 | |||
| 2168 | Ga0501033_0291511 | |||
| 2169 | Ga0501033_0543808 | |||
| 2170 | Ga0501034_0011151 | |||
| 2171 | Ga0501034_0198578 | |||
| 2172 | Ga0501034_0428811 | |||
| 2173 | Ga0501034_0464413 | |||
| 2174 | Ga0501034_0580020 | |||
| 2175 | Ga0501036_0007744 | |||
| 2176 | Ga0501036_0023838 | |||
| 2177 | Ga0501036_0038163 | |||
| 2178 | Ga0501036_0096722 | |||
| 2179 | Ga0501036_0100920 | |||
| 2180 | Ga0501036_0183614 | |||
| 2181 | Ga0501036_0352950 | |||
| 2182 | Ga0501037_0016357 | |||
| 2183 | Ga0501037_0165035 | |||
| 2184 | Ga0501037_0180642 | |||
| 2185 | Ga0501038_0007000 | |||
| 2186 | Ga0501038_0077247 | |||
| 2187 | Ga0501038_0142158 | |||
| 2188 | Ga0501038_0281814 | |||
| 2189 | Ga0501038_0346303 | |||
| 2190 | Ga0501038_0372844 | |||
| 2191 | Ga0501038_0949855 | |||
| 2192 | Ga0501039_0019320 | |||
| 2193 | Ga0501039_0154222 | |||
| 2194 | Ga0501039_0172719 | |||
| 2195 | Ga0501039_0641901 | |||
| 2196 | Ga0501040_0031362 | |||
| 2197 | Ga0501041_0080366 | |||
| 2198 | Ga0501042_0011553 | |||
| 2199 | Ga0501042_0018216 | |||
| 2200 | Ga0501042_0495654 | |||
| 2201 | Ga0501043_0020241 | |||
| 2202 | Ga0501043_0034914 | |||
| 2203 | Ga0501043_0099583 | |||
| 2204 | Ga0501043_0160839 | |||
| 2205 | Ga0501043_0214430 | |||
| 2206 | Ga0501043_0546083 | |||
| 2207 | Ga0501046_0031801 | |||
| 2208 | Ga0501046_0607840 | |||
| 2209 | Ga0501047_0011205 | |||
| 2210 | Ga0501047_0127689 | |||
| 2211 | Ga0501047_0151546 | |||
| 2212 | Ga0501047_0156882 | |||
| 2213 | Ga0501047_0254936 | |||
| 2214 | Ga0501047_0421341 | |||
| 2215 | Ga0501047_0580488 | |||
| 2216 | Ga0501048_0096500 | |||
| 2217 | Ga0501048_0271001 | |||
| 2218 | Ga0501067_0008473 | |||
| 2219 | Ga0501067_0033286 | |||
| 2220 | Ga0501068_0030878 | |||
| 2221 | Ga0501069_0004252 | |||
| 2222 | Ga0501069_0130868 | |||
| 2223 | Ga0501070_0000136 | |||
| 2224 | Ga0501070_0001146 | |||
| 2225 | Ga0501070_0031259 | |||
| 2226 | Ga0501070_0268684 | |||
| 2227 | Ga0501070_1079592 | |||
| 2228 | Ga0501071_0224432 | |||
| 2229 | Ga0501072_0001836 | |||
| 2230 | Ga0501072_0394521 | |||
| 2231 | Ga0501073_0041443 | |||
| 2232 | Ga0501074_0032353 | |||
| 2233 | Ga0501074_0244197 | |||
| 2234 | Ga0501076_0015385 | |||
| 2235 | Ga0501079_0032262 | |||
| 2236 | Ga0501080_0797301 | |||
| 2237 | Ga0501083_0000054 | |||
| 2238 | Ga0501083_0032265 | |||
| 2239 | Ga0501083_0037458 | |||
| 2240 | Ga0501083_0045706 | |||
| 2241 | Ga0501035_0022720 | |||
| 2242 | Ga0501035_0126701 | |||
| 2243 | Ga0501035_0195494 | |||
| 2244 | Ga0501035_0366323 | |||
| 2245 | Ga0501035_0382666 | |||
| 2246 | Ga0501035_0710052 | |||
| 2247 | Ga0501035_0858576 | |||
| 2248 | Ga0501044_0011787 | |||
| 2249 | Ga0501044_0013803 | |||
| 2250 | Ga0501044_0050248 | |||
| 2251 | Ga0501044_0066464 | |||
| 2252 | Ga0501044_0115433 | |||
| 2253 | Ga0501044_0154204 | |||
| 2254 | Ga0501044_0267730 | |||
| 2255 | Ga0501044_0270793 | |||
| 2256 | Ga0501044_0773640 | |||
| 2257 | Ga0501045_0054329 | |||
| 2258 | Ga0501045_0061161 | |||
| 2259 | Ga0501045_0459643 | |||
| 2260 | Ga0501045_0986226 | |||
| 2261 | nmdc:mga0yw44_569802_c1 | |||
| 2262 | nmdc:mga06z11_24830_c1 | |||
| 2263 | nmdc:mga07m45_76877_c1 | |||
| 2264 | nmdc:mga05p37_157_c1 | |||
| 2265 | nmdc:mga05p37_342930_c1 | |||
| 2266 | nmdc:mga09592_79_c1 | |||
| 2267 | nmdc:mga0qj67_3105_c1 | |||
| 2268 | nmdc:mga06r32_122_c1 | |||
| 2269 | nmdc:mga06r32_13530_c1 | |||
| 2270 | nmdc:mga06r32_634560_c1 | |||
| 2271 | nmdc:mga08y16_48899_c1 | |||
| 2272 | nmdc:mga0n895_721235_c1 | |||
| 2273 | nmdc:mga0rr50_129393_c1 | |||
| 2274 | nmdc:mga08x19_379702_c1 | |||
| 2275 | nmdc:mga0a205_81869_c1 | |||
| 2276 | Ga0495601_0000332 | |||
| 2277 | Ga0495601_0038831 | |||
| 2278 | Ga0495612_0102143 | |||
| 2279 | Ga0495612_0129500 | |||
| 2280 | Ga0495612_0205760 | |||
| 2281 | Ga0495655_0152085 | |||
| 2282 | Ga0495655_0159222 | |||
| 2283 | Ga0495595_0013001 | |||
| 2284 | Ga0495595_0048713 | |||
| 2285 | Ga0495619_0000631 | |||
| 2286 | Ga0495619_0093989 | |||
| 2287 | Ga0495619_0230653 | |||
| 2288 | Ga0495619_0346501 | |||
| 2289 | Ga0500578_0089792 | |||
| 2290 | Ga0500643_104316 | |||
| 2291 | Ga0500646_0019355 | |||
| 2292 | Ga0500566_0099411 | |||
| 2293 | Ga0500640_054127 | |||
| 2294 | Ga0500641_0171518 | |||
| 2295 | Ga0500650_0073898 | |||
| 2296 | Ga0500654_083773 | |||
| 2297 | Ga0500660_173794 | |||
| 2298 | Ga0500660_174544 | |||
| 2299 | Ga0500553_109891 | |||
| 2300 | Ga0500560_023614 | |||
| 2301 | Ga0500569_030598 | |||
| 2302 | Ga0500572_042620 | |||
| 2303 | Ga0500628_002033 | |||
| 2304 | Ga0500652_005655 | |||
| 2305 | Ga0500652_259779 | |||
| 2306 | Ga0500658_0007329 | |||
| 2307 | Ga0500568_0038991 | |||
| 2308 | Ga0500573_0024379 | |||
| 2309 | Ga0500573_0052883 | |||
| 2310 | Ga0500573_0167612 | |||
| 2311 | Ga0500579_115997 | |||
| 2312 | Ga0500600_0009314 | |||
| 2313 | Ga0500600_0078916 | |||
| 2314 | Ga0500600_0152559 | |||
| 2315 | Ga0500616_0000937 | |||
| 2316 | Ga0500616_0002537 | |||
| 2317 | Ga0500616_0011011 | |||
| 2318 | Ga0500633_0014440 | |||
| 2319 | Ga0500634_0013772 | |||
| 2320 | Ga0500636_0126981 | |||
| 2321 | Ga0500656_000948 | |||
| 2322 | Ga0500587_023946 | |||
| 2323 | Ga0501084_0020440 | |||
| 2324 | Ga0501082_0040131 | |||
| 2325 | Ga0501082_0140328 | |||
| 2326 | Ga0466962_0001961 | |||
| 2327 | Ga0466962_0031313 | |||
| 2328 | Ga0466962_0113769 | |||
| 2329 | Ga0530510_0133200 | |||
| 2330 | Ga0530510_0624987 | |||
| 2331 | 2644112798 | |||
| 2332 | 2739325385 | |||
| 2333 | 2753300611 | |||
| 2334 | 2811845544 | |||
| 2335 | 2919045287 | |||
| 2336 | 2928107243 | |||
| 2337 | 2984552693 | |||
| 2338 | 2997454644 | |||
| 2339 | 3006488735 | |||
| 2340 | 8056584292 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qlp-assembly2.cif.gz_E | bifunctional dctp deaminase:dutpase from mycobacterium tuberculosis, apo form | 0.9582 | 1 | 159 |
| 2qxx-assembly1.cif.gz_A | bifunctional dctp deaminase: dutpase from mycobacterium tuberculosis in complex with dttp | 0.9546 | 1 | 189 |
| 2qlp-assembly2.cif.gz_E | bifunctional dctp deaminase:dutpase from mycobacterium tuberculosis, apo form | 0.9524 | 1 | 159 |
| 2qxx-assembly1.cif.gz_A | bifunctional dctp deaminase: dutpase from mycobacterium tuberculosis in complex with dttp | 0.9497 | 1 | 189 |
| 2v9x-assembly1.cif.gz_J | e138d variant of escherichia coli dctp deaminase in complex with dutp | 0.9456 | 1 | 162 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2qlpA01 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.957 | 1 | 154 | 2.70.40.10 |
| 2qlpA01 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.951 | 1 | 154 | 2.70.40.10 |
| 2v9xJ01 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9429 | 1 | 154 | 2.70.40.10 |
| 4a6aA00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9407 | 1 | 189 | 2.70.40.10 |
| 2v9xJ01 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.937 | 1 | 154 | 2.70.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I3CM42-F1-model_v4 | dCTP deaminase (EC 3.5.4.13) | 0.9759 | 1 | 146 |
GO:0006229
GO:0008829 GO:0015949 |
| AF-A0A536AAP7-F1-model_v4 | dCTP deaminase (EC 3.5.4.13) | 0.9759 | 1 | 105 |
GO:0006229
GO:0008829 GO:0015949 |
| AF-A0A7X6EQA7-F1-model_v4 | deleted | 0.9727 | 74 | 163 |
|
| AF-A0A7K0VV81-F1-model_v4 | dCTP deaminase (EC 3.5.4.13) | 0.9711 | 1 | 159 |
GO:0006229
GO:0008829 GO:0015949 |
| AF-A0A6I3CM42-F1-model_v4 | dCTP deaminase (EC 3.5.4.13) | 0.9694 | 1 | 146 |
GO:0006229
GO:0008829 GO:0015949 |