F491127

General Info

Members Datasets Scaffolds Average Seq Length
1169 604 985 214

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10661858|Ga0105239_106618581
Length 248
Sequence MMTADNVSAFPRRVASEYFGLRFANPPHNVTRTDMTMDAIFFDLDGTLTDPKPGITRSIQYALQKLGHHTIPTEDELTWCIGPPLRASLARILGAEEHADRALALYRERFSDIGLYENAVYDGIGEVLTTLGESGCRLFVATSKPHVFATRIVAHFALRHHFEHVFGSELDGRRVDKSDLLAYALKQAGVDPAKTLMIGDRSHDMAGAANNGMKGIGVLYGYGSREELIGAGALHVCATPQAILGCIS

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
8 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
17 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
18 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
19 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
20 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
21 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
22 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
23 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
24 2791355199
25 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
26 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
27 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
28 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
29 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
30 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
31 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
32 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
33 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
34 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
35 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
36 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
37 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
38 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
39 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
40 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
41 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
42 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
43 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
44 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
45 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
46 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
47 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
48 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
49 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
50 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
51 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
52 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
53 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
54 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
55 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
56 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
57 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
58 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
59 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
60 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
61 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
62 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
63 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
64 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
65 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
66 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
67 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
68 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
69 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
70 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
71 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
72 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
73 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
74 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
75 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
76 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
77 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
78 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
79 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
80 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
81 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
82 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
83 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
84 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
85 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
86 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
87 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
88 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
89 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
90 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
91 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
92 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
93 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
94 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
95 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
96 2922368715
97 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
98 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
99 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
100 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
101 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
102 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
103 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
104 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
105 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
106 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
107 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
108 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
109 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
110 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
111 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
112 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
113 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
114 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
115 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
116 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
117 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
118 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
119 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
120 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
121 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
122 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
123 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
124 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
125 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
126 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
127 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
128 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
129 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
130 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
131 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
132 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
133 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
134 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
135 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
136 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
137 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
138 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
139 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
140 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
141 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
142 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
143 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
144 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
145 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
146 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
147 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
148 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
149 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
150 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
151 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
152 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
153 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
154 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
155 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
156 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
157 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
158 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
159 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
160 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
161 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
162 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
163 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
164 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
165 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
166 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
167 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
168 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
169 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
170 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
171 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
172 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
173 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
174 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
175 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
176 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
177 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
178 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
179 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
180 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
181 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
182 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
183 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
184 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
185 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
186 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
187 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
188 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
189 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
190 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
191 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
192 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
193 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
194 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
195 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
196 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
197 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
198 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
199 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
200 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
201 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
202 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
203 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
204 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
205 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
206 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
207 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
208 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
209 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
210 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
211 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
212 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
213 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
214 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
215 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
216 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
217 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
218 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
219 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
220 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
221 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
222 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
223 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
224 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
225 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
226 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
227 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
228 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
229 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
230 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
231 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
232 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
233 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
234 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
235 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
236 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
237 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
238 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
239 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
240 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
241 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
242 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
243 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
244 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
245 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
246 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
247 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
248 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
249 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
250 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
251 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
252 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
253 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
254 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
255 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
256 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
257 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
258 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
259 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
260 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
261 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
262 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
263 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
264 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
265 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
266 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
267 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
268 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
269 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
270 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
271 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
272 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
273 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
274 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
275 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
276 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
277 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
278 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
279 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
280 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
281 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
282 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
283 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
284 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
285 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
286 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
287 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
288 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
289 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
290 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
291 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
292 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
293 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
294 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
295 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
296 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
297 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
298 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
299 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
300 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
301 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
302 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
303 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
304 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
305 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
365 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
366 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
367 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
368 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
372 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
373 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
374 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
375 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
376 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
377 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
378 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
379 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
380 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
381 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
382 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
383 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
384 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
385 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
386 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
387 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
388 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
389 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
390 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
391 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
392 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
393 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
394 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
395 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
396 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
397 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
398 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
399 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
400 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
401 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
402 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
403 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
404 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
405 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
406 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
407 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
408 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
409 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
410 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
411 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
412 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
413 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
414 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
415 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
416 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
417 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
418 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
419 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
420 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
421 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
422 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
423 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
424 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
425 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
426 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
427 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
428 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
429 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
430 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
431 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
432 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
433 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
434 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
435 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
436 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
437 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
438 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
439 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
440 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
441 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
442 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
443 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
444 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
445 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
446 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
447 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
448 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
449 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
450 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
451 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
452 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
453 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
454 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
455 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
456 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
457 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
458 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
459 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
460 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
461 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
462 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
463 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
464 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
465 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
466 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
467 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
468 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
469 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
470 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
471 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
472 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
473 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
474 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
475 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
476 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
477 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
478 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
479 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
480 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
481 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
482 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
483 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
484 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
485 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
486 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
487 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
488 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
489 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
490 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
491 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
492 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
493 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
494 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
495 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
496 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
497 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
498 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
499 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
500 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
501 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
502 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
503 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
504 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
505 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
506 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
507 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
508 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
509 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
510 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
511 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
512 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
513 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
514 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
515 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
516 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
517 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
518 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
519 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
520 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
521 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
522 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
523 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
524 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
525 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
526 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
527 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
528 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
529 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
530 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
531 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
532 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
533 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
534 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
535 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
536 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
537 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
538 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
539 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
540 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
541 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
542 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
543 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
544 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
545 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
546 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
547 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
548 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
549 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
550 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
551 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
552 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
553 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
554 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
555 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
556 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
557 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
558 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
559 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
560 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
561 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
562 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
563 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
564 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
565 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
566 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
567 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
568 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
569 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
570 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
571 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
572 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
573 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
574 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
575 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
576 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
577 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
578 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
579 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
580 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
581 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
582 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
583 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
584 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
585 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
586 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
587 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
588 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
589 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
590 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
591 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
592 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
593 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
594 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
595 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
596 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
597 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
598 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
599 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
600 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
601 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
602 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
603 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
604 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.4
Metatranscriptomes 0
Isolates 15.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13
Nodule 12.4
Rhizoplane 5.99
Rhizosphere 57.4
Stem 0
Stem Tuber 0
Unclassified 11.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1010209 3300002070 Bacteria 1221
2 JGI24742J22300_10009328 3300002244 Bacteria 1619
3 JGI25406J46586_10001420 3300003203 Bacteria 11290
4 JGI25153J46596_10000476 3300003215 Bacteria 25668
5 JGI25153J46596_10001154 3300003215 Bacteria 15990
6 JGI25153J46596_10003343 3300003215 Bacteria 9004
7 JGI25153J46596_10004553 3300003215 Bacteria 7444
8 JGI25153J46596_10011871 3300003215 Bacteria 3816
9 JGI25153J46596_10013642 3300003215 Bacteria 3422
10 rootH2_10017704 3300003320 Bacteria 1046
11 rootH2_10132730 3300003320 Bacteria 1046
12 rootH2_10283654 3300003320 Bacteria 1059
13 rootL2_10131868 3300003322 Bacteria 3866
14 JGI25160J50197_1000874 3300003354 Bacteria 15930
15 JGI25160J50197_1002069 3300003354 Bacteria 9546
16 JGI25160J50197_1047014 3300003354 Bacteria 942
17 JGI25404J52841_10014306 3300003659 Bacteria 1721
18 Ga0055526_1018859 3300003771 Bacteria 2547
19 Ga0055524_1054952 3300003775 Bacteria 868
20 Ga0055531_10004147 3300003794 Bacteria 8950
21 Ga0055543_1026444 3300004625 Bacteria 1032
22 Ga0055543_1039447 3300004625 Bacteria 801
23 Ga0065165_1001382 3300005262 Bacteria 26647
24 Ga0065165_1005174 3300005262 Bacteria 7533
25 Ga0065165_1007497 3300005262 Bacteria 5345
26 Ga0065715_10177401 3300005293 Bacteria 1501
27 Ga0070658_10037739 3300005327 Bacteria 3895
28 Ga0070658_10068536 3300005327 Bacteria 2900
29 Ga0070658_10676070 3300005327 Bacteria 896
30 Ga0070676_10187764 3300005328 Bacteria 1347
31 Ga0070676_10222772 3300005328 Bacteria 1247
32 Ga0070683_100003848 3300005329 Bacteria 12266
33 Ga0070670_100243984 3300005331 Bacteria 1564
34 Ga0070670_100443514 3300005331 Bacteria 1150
35 Ga0068869_100042626 3300005334 Bacteria 3254
36 Ga0068869_100046137 3300005334 Bacteria 3141
37 Ga0068869_100623999 3300005334 Bacteria 913
38 Ga0070666_10056060 3300005335 Bacteria 2661
39 Ga0070680_100013845 3300005336 Bacteria 6292
40 Ga0070680_100018157 3300005336 Bacteria 5556
41 Ga0070680_100524730 3300005336 Bacteria 1014
42 Ga0070682_100095905 3300005337 Bacteria 1948
43 Ga0068868_100147989 3300005338 Bacteria 1932
44 Ga0068868_100174197 3300005338 Bacteria 1782
45 Ga0068868_100382848 3300005338 Bacteria 1211
46 Ga0068868_100455915 3300005338 Bacteria 1113
47 Ga0070689_100148809 3300005340 Bacteria 1887
48 Ga0070689_100193978 3300005340 Bacteria 1655
49 Ga0070661_100072219 3300005344 Bacteria 2539
50 Ga0070661_100213456 3300005344 Bacteria 1478
51 Ga0070661_100943411 3300005344 Bacteria 714
52 Ga0070668_100029460 3300005347 Bacteria 4170
53 Ga0070668_100093136 3300005347 Bacteria 2377
54 Ga0070668_100201866 3300005347 Bacteria 1632
55 Ga0070668_100245523 3300005347 Bacteria 1484
56 Ga0070668_100254287 3300005347 Bacteria 1459
57 Ga0070669_100073703 3300005353 Bacteria 2530
58 Ga0070669_100308564 3300005353 Bacteria 1274
59 Ga0070669_100412469 3300005353 Bacteria 1107
60 Ga0070675_100143838 3300005354 Bacteria 2040
61 Ga0070671_100006368 3300005355 Bacteria 9425
62 Ga0070671_100398834 3300005355 Bacteria 1177
63 Ga0070674_100076493 3300005356 Bacteria 2380
64 Ga0070674_100244574 3300005356 Bacteria 1406
65 Ga0070688_100452898 3300005365 Bacteria 960
66 Ga0070659_100239995 3300005366 Bacteria 1499
67 Ga0070659_100537331 3300005366 Bacteria 1000
68 Ga0070659_100647809 3300005366 Bacteria 911
69 Ga0070667_100133687 3300005367 Bacteria 2167
70 Ga0070667_100541259 3300005367 Bacteria 1070
71 Ga0070709_10035930 3300005434 Bacteria 3014
72 Ga0070709_10193898 3300005434 Bacteria 1435
73 Ga0070709_10393134 3300005434 Bacteria 1034
74 Ga0070714_101160800 3300005435 Bacteria 753
75 Ga0070713_100450371 3300005436 Bacteria 1209
76 Ga0070710_10472116 3300005437 Bacteria 854
77 Ga0070701_10272194 3300005438 Bacteria 1031
78 Ga0070711_100071519 3300005439 Bacteria 2445
79 Ga0070705_100069562 3300005440 Bacteria 2123
80 Ga0070705_100255437 3300005440 Bacteria 1233
81 Ga0070708_100015641 3300005445 Bacteria 6271
82 Ga0070708_100137566 3300005445 Bacteria 2264
83 Ga0070663_100059790 3300005455 Bacteria 2739
84 Ga0070663_100061793 3300005455 Bacteria 2698
85 Ga0070663_100075935 3300005455 Bacteria 2456
86 Ga0070663_100147104 3300005455 Bacteria 1803
87 Ga0070663_100164837 3300005455 Bacteria 1708
88 Ga0070663_100222098 3300005455 Bacteria 1484
89 Ga0070663_100813719 3300005455 Bacteria 802
90 Ga0070678_100123878 3300005456 Bacteria 2043
91 Ga0070678_100181178 3300005456 Bacteria 1724
92 Ga0070662_100021115 3300005457 Bacteria 4443
93 Ga0070662_100080814 3300005457 Bacteria 2420
94 Ga0070662_100651254 3300005457 Bacteria 889
95 Ga0070681_10051259 3300005458 Bacteria 4117
96 Ga0070681_10132380 3300005458 Bacteria 2426
97 Ga0070681_10429181 3300005458 Bacteria 1234
98 Ga0068867_100044046 3300005459 Bacteria 3268
99 Ga0068867_100324494 3300005459 Bacteria 1276
100 Ga0068867_100703553 3300005459 Bacteria 892
101 Ga0070685_10028473 3300005466 Bacteria 3095
102 Ga0070685_10223924 3300005466 Bacteria 1234
103 Ga0070706_100011186 3300005467 Bacteria 8332
104 Ga0070706_100097360 3300005467 Unclassified 2733
105 Ga0070707_100179371 3300005468 Bacteria 2065
106 Ga0070698_100090792 3300005471 Bacteria 3037
107 Ga0070698_100228557 3300005471 Bacteria 1794
108 Ga0070699_100098649 3300005518 Bacteria 2560
109 Ga0070679_100008868 3300005530 Bacteria 9492
110 Ga0070684_100011240 3300005535 Bacteria 7127
111 Ga0070684_100115242 3300005535 Bacteria 2413
112 Ga0070684_100179997 3300005535 Bacteria 1922
113 Ga0070684_100269786 3300005535 Bacteria 1557
114 Ga0068853_100129622 3300005539 Bacteria 2257
115 Ga0068853_100135576 3300005539 Bacteria 2206
116 Ga0068853_100149354 3300005539 Bacteria 2102
117 Ga0068853_100444314 3300005539 Bacteria 1219
118 Ga0068853_100571092 3300005539 Bacteria 1072
119 Ga0070672_100017103 3300005543 Bacteria 5212
120 Ga0070672_100213424 3300005543 Bacteria 1617
121 Ga0070695_100193314 3300005545 Bacteria 1450
122 Ga0070696_100461411 3300005546 Bacteria 1004
123 Ga0070693_100023629 3300005547 Bacteria 3288
124 Ga0070693_100266035 3300005547 Bacteria 1142
125 Ga0070665_100048108 3300005548 Bacteria 4282
126 Ga0070665_100063529 3300005548 Bacteria 3702
127 Ga0070665_100143997 3300005548 Bacteria 2387
128 Ga0070665_100297744 3300005548 Bacteria 1616
129 Ga0070665_100308663 3300005548 Bacteria 1585
130 Ga0070665_100522321 3300005548 Bacteria 1199
131 Ga0070665_100654714 3300005548 Bacteria 1063
132 Ga0068855_100037453 3300005563 Bacteria 5766
133 Ga0068855_100062456 3300005563 Bacteria 4348
134 Ga0068855_100214780 3300005563 Bacteria 2160
135 Ga0068855_100223280 3300005563 Bacteria 2111
136 Ga0068855_101102957 3300005563 Bacteria 829
137 Ga0070664_100253929 3300005564 Bacteria 1581
138 Ga0070664_100334465 3300005564 Bacteria 1374
139 Ga0068857_100173468 3300005577 Bacteria 1961
140 Ga0068857_100215252 3300005577 Bacteria 1754
141 Ga0068854_100104017 3300005578 Bacteria 2132
142 Ga0068854_100511366 3300005578 Bacteria 1013
143 Ga0068856_100048216 3300005614 Bacteria 4196
144 Ga0068856_100173953 3300005614 Bacteria 2166
145 Ga0068856_100187899 3300005614 Bacteria 2080
146 Ga0070702_100082084 3300005615 Bacteria 1933
147 Ga0068852_100099808 3300005616 Bacteria 2618
148 Ga0068852_100142897 3300005616 Bacteria 2217
149 Ga0068852_100320270 3300005616 Bacteria 1506
150 Ga0068852_100462691 3300005616 Bacteria 1258
151 Ga0068852_100740399 3300005616 Bacteria 995
152 Ga0068859_100131914 3300005617 Bacteria 2570
153 Ga0068859_100292377 3300005617 Bacteria 1722
154 Ga0068859_100353023 3300005617 Bacteria 1565
155 Ga0068859_100474172 3300005617 Bacteria 1347
156 Ga0068864_100391349 3300005618 Bacteria 1319
157 Ga0068866_10054663 3300005718 Bacteria 2047
158 Ga0068866_10153029 3300005718 Bacteria 1338
159 Ga0068861_100020526 3300005719 Bacteria 4735
160 Ga0068861_100063438 3300005719 Bacteria 2840
161 Ga0068861_100419044 3300005719 Bacteria 1193
162 Ga0068861_100667086 3300005719 Bacteria 962
163 Ga0068863_100516105 3300005841 Bacteria 1178
164 Ga0068858_100091500 3300005842 Bacteria 2831
165 Ga0068858_100142639 3300005842 Bacteria 2249
166 Ga0068858_100325974 3300005842 Bacteria 1468
167 Ga0068860_100161081 3300005843 Bacteria 2163
168 Ga0068860_100250233 3300005843 Bacteria 1726
169 Ga0068860_100426867 3300005843 Bacteria 1315
170 Ga0068860_100501595 3300005843 Bacteria 1212
171 Ga0068862_100045914 3300005844 Bacteria 3728
172 Ga0068862_100062334 3300005844 Bacteria 3206
173 Ga0068862_100117710 3300005844 Bacteria 2338
174 Ga0068862_100183997 3300005844 Bacteria 1877
175 Ga0068862_100227586 3300005844 Bacteria 1690
176 Ga0068862_100900856 3300005844 Bacteria 869
177 Ga0081455_10015336 3300005937 Bacteria 7451
178 Ga0081455_10033478 3300005937 Bacteria 4618
179 Ga0081455_10181824 3300005937 Bacteria 1591
180 Ga0081538_10103094 3300005981 Bacteria 1429
181 Ga0081540_1004140 3300005983 Bacteria 11188
182 Ga0081540_1005687 3300005983 Bacteria 9252
183 Ga0081540_1010925 3300005983 Bacteria 6098
184 Ga0081540_1016563 3300005983 Bacteria 4604
185 Ga0081540_1017555 3300005983 Bacteria 4426
186 Ga0081540_1031580 3300005983 Bacteria 2909
187 Ga0081540_1079967 3300005983 Bacteria 1475
188 Ga0081539_10000199 3300005985 Bacteria 139305
189 Ga0081539_10019345 3300005985 Bacteria 4667
190 Ga0070717_10406377 3300006028 Bacteria 1224
191 Ga0075365_10057257 3300006038 Bacteria 2593
192 Ga0075365_10139884 3300006038 Bacteria 1680
193 Ga0075365_10146950 3300006038 Bacteria 1639
194 Ga0075365_10190875 3300006038 Bacteria 1434
195 Ga0075368_10038514 3300006042 Bacteria 1872
196 Ga0075363_100011602 3300006048 Bacteria 4225
197 Ga0075363_100018491 3300006048 Bacteria 3473
198 Ga0075363_100072184 3300006048 Bacteria 1877
199 Ga0075363_100108190 3300006048 Bacteria 1543
200 Ga0075364_10034925 3300006051 Bacteria 3247
201 Ga0075364_10175971 3300006051 Bacteria 1447
202 Ga0075364_10201057 3300006051 Bacteria 1350
203 Ga0075364_10495069 3300006051 Bacteria 836
204 Ga0070712_100255780 3300006175 Bacteria 1401
205 Ga0075362_10117977 3300006177 Bacteria 1254
206 Ga0075362_10151954 3300006177 Bacteria 1111
207 Ga0075367_10002456 3300006178 Bacteria 8481
208 Ga0075367_10012875 3300006178 Bacteria 4479
209 Ga0075367_10020273 3300006178 Bacteria 3699
210 Ga0075367_10042081 3300006178 Bacteria 2672
211 Ga0075367_10509307 3300006178 Bacteria 764
212 Ga0075369_10076970 3300006186 Bacteria 1475
213 Ga0075369_10091087 3300006186 Bacteria 1361
214 Ga0075369_10157575 3300006186 Bacteria 1040
215 Ga0075366_10010538 3300006195 Bacteria 5190
216 Ga0097621_100061776 3300006237 Bacteria 3073
217 Ga0097621_100316706 3300006237 Bacteria 1381
218 Ga0097621_100423091 3300006237 Bacteria 1196
219 Ga0075370_10034975 3300006353 Bacteria 2818
220 Ga0075370_10053723 3300006353 Bacteria 2286
221 Ga0075370_10126665 3300006353 Bacteria 1489
222 Ga0075370_10246371 3300006353 Bacteria 1058
223 Ga0068871_100051768 3300006358 Bacteria 3324
224 Ga0068871_100295356 3300006358 Bacteria 1421
225 Ga0068871_100388701 3300006358 Bacteria 1240
226 Ga0068871_100614222 3300006358 Bacteria 990
227 Ga0068871_100674142 3300006358 Bacteria 945
228 Ga0075428_100016072 3300006844 Bacteria 8275
229 Ga0075430_100106259 3300006846 Bacteria 2342
230 Ga0075430_100674765 3300006846 Bacteria 852
231 Ga0075431_100747870 3300006847 Bacteria 953
232 Ga0075433_10065291 3300006852 Bacteria 3192
233 Ga0075434_100227727 3300006871 Bacteria 1883
234 Ga0068865_100064851 3300006881 Bacteria 2571
235 Ga0097620_100131926 3300006931 Bacteria 2570
236 Ga0097620_100292378 3300006931 Bacteria 1722
237 Ga0097620_100353012 3300006931 Bacteria 1565
238 Ga0097620_100474217 3300006931 Bacteria 1347
239 Ga0099825_1023676 3300006941 Bacteria 3718
240 Ga0099824_1009133 3300006942 Bacteria 12334
241 Ga0099822_1041193 3300006943 Bacteria 2507
242 Ga0075435_100137799 3300007076 Bacteria 2045
243 Ga0099795_10028710 3300007788 Bacteria 1895
244 Ga0105240_10008787 3300009093 Bacteria 14390
245 Ga0105240_10016654 3300009093 Bacteria 9942
246 Ga0105240_10033152 3300009093 Bacteria 6675
247 Ga0105240_10182042 3300009093 Bacteria 2479
248 Ga0105240_10194966 3300009093 Bacteria 2379
249 Ga0105240_10415158 3300009093 Bacteria 1513
250 Ga0105240_11020604 3300009093 Bacteria 884
251 Ga0105240_11106718 3300009093 Bacteria 843
252 Ga0105245_10108637 3300009098 Bacteria 2576
253 Ga0105245_10201630 3300009098 Bacteria 1911
254 Ga0105245_10293884 3300009098 Bacteria 1592
255 Ga0105245_10364213 3300009098 Bacteria 1436
256 Ga0105245_10455014 3300009098 Bacteria 1289
257 Ga0105245_11706360 3300009098 Bacteria 682
258 Ga0105247_10032849 3300009101 Bacteria 3153
259 Ga0105247_10096820 3300009101 Bacteria 1881
260 Ga0105247_10150998 3300009101 Bacteria 1531
261 Ga0105247_10189651 3300009101 Bacteria 1376
262 Ga0105247_10473920 3300009101 Bacteria 907
263 Ga0114129_10068162 3300009147 Bacteria 4961
264 Ga0114129_10362293 3300009147 Bacteria 1918
265 Ga0105243_10255677 3300009148 Bacteria 1566
266 Ga0105243_10328799 3300009148 Bacteria 1395
267 Ga0105243_10329267 3300009148 Bacteria 1395
268 Ga0105243_10602031 3300009148 Bacteria 1058
269 Ga0105241_10020802 3300009174 Bacteria 4850
270 Ga0105241_10223481 3300009174 Bacteria 1584
271 Ga0105241_10752413 3300009174 Bacteria 894
272 Ga0105242_10137338 3300009176 Bacteria 2117
273 Ga0105242_10743671 3300009176 Bacteria 964
274 Ga0105242_10754450 3300009176 Bacteria 958
275 Ga0105242_11377082 3300009176 Bacteria 732
276 Ga0105248_10037450 3300009177 Bacteria 5426
277 Ga0105248_10144983 3300009177 Bacteria 2679
278 Ga0105248_10476762 3300009177 Bacteria 1406
279 Ga0105248_10658129 3300009177 Bacteria 1182
280 Ga0105237_10114688 3300009545 Bacteria 2687
281 Ga0105237_10218378 3300009545 Bacteria 1907
282 Ga0105237_10418915 3300009545 Bacteria 1345
283 Ga0105237_10443511 3300009545 Bacteria 1304
284 Ga0105237_10467682 3300009545 Bacteria 1267
285 Ga0105237_10610184 3300009545 Bacteria 1098
286 Ga0105238_10008642 3300009551 Bacteria 10191
287 Ga0105238_10029381 3300009551 Bacteria 5600
288 Ga0105238_10131091 3300009551 Bacteria 2485
289 Ga0105238_10225419 3300009551 Bacteria 1851
290 Ga0105238_10228161 3300009551 Bacteria 1839
291 Ga0105238_10359464 3300009551 Bacteria 1445
292 Ga0105238_10895422 3300009551 Bacteria 906
293 Ga0105249_10145325 3300009553 Bacteria 2278
294 Ga0105249_10226941 3300009553 Bacteria 1841
295 Ga0105249_10768991 3300009553 Bacteria 1026
296 Ga0105249_11091964 3300009553 Bacteria 868
297 Ga0105239_10047131 3300010375 Bacteria 4723
298 Ga0105239_10085044 3300010375 Bacteria 3485
299 Ga0105239_10099657 3300010375 Bacteria 3212
300 Ga0105239_10200628 3300010375 Bacteria 2235
301 Ga0105239_10359743 3300010375 Bacteria 1644
302 Ga0105239_10435494 3300010375 Bacteria 1486
303 Ga0105239_10661858 3300010375 Bacteria 1193
304 Ga0105239_11596544 3300010375 Bacteria 754
305 Ga0105246_10138536 3300011119 Bacteria 1827
306 Ga0105246_10172292 3300011119 Bacteria 1659
307 Ga0105246_10186368 3300011119 Bacteria 1602
308 Ga0105246_10410177 3300011119 Bacteria 1127
309 Ga0105246_10581249 3300011119 Bacteria 965
310 Ga0157370_10031400 3300013104 Bacteria 5196
311 Ga0157370_10206147 3300013104 Bacteria 1823
312 Ga0157370_10430444 3300013104 Bacteria 1213
313 Ga0157369_10007473 3300013105 Bacteria 12579
314 Ga0157369_10007917 3300013105 Bacteria 12218
315 Ga0157369_10122107 3300013105 Bacteria 2763
316 Ga0157369_10124770 3300013105 Bacteria 2731
317 Ga0157369_10211938 3300013105 Bacteria 2030
318 Ga0157369_10631350 3300013105 Bacteria 1105
319 Ga0157374_10062596 3300013296 Bacteria 3488
320 Ga0157374_10175385 3300013296 Bacteria 2092
321 Ga0157374_10341546 3300013296 Bacteria 1486
322 Ga0157374_10489587 3300013296 Bacteria 1233
323 Ga0157378_10104317 3300013297 Bacteria 2591
324 Ga0157378_10115924 3300013297 Bacteria 2463
325 Ga0163162_10028934 3300013306 Bacteria 5484
326 Ga0163162_10077525 3300013306 Bacteria 3387
327 Ga0163162_10202167 3300013306 Bacteria 2115
328 Ga0163162_10290394 3300013306 Bacteria 1767
329 Ga0163162_10383251 3300013306 Bacteria 1539
330 Ga0163162_10517807 3300013306 Bacteria 1322
331 Ga0157372_10012959 3300013307 Bacteria 8891
332 Ga0157372_10092414 3300013307 Bacteria 3442
333 Ga0157372_11178271 3300013307 Bacteria 886
334 Ga0157375_10017613 3300013308 Bacteria 6451
335 Ga0157375_10101448 3300013308 Bacteria 2961
336 Ga0163163_10033417 3300014325 Bacteria 4976
337 Ga0163163_10058631 3300014325 Bacteria 3807
338 Ga0163163_10218554 3300014325 Bacteria 1954
339 Ga0163163_10280029 3300014325 Bacteria 1719
340 Ga0163163_10292201 3300014325 Bacteria 1682
341 Ga0163163_10504256 3300014325 Bacteria 1272
342 Ga0157380_10149717 3300014326 Bacteria 2016
343 Ga0157380_10896436 3300014326 Bacteria 912
344 Ga0157377_10130905 3300014745 Bacteria 1532
345 Ga0157377_10151352 3300014745 Bacteria 1435
346 Ga0157377_10248961 3300014745 Bacteria 1151
347 Ga0157377_10469523 3300014745 Bacteria 873
348 Ga0157379_10240107 3300014968 Bacteria 1643
349 Ga0157379_10268995 3300014968 Bacteria 1550
350 Ga0157379_10567827 3300014968 Bacteria 1057
351 Ga0157379_10745659 3300014968 Bacteria 922
352 Ga0157376_10005581 3300014969 Bacteria 8802
353 Ga0157376_10127559 3300014969 Bacteria 2265
354 Ga0157376_10274276 3300014969 Bacteria 1586
355 Ga0163161_10288154 3300017792 Bacteria 1290
356 Ga0163161_10340276 3300017792 Bacteria 1190
357 Ga0163161_10399603 3300017792 Bacteria 1102
358 Ga0214544_1003958 3300021320 Bacteria 30115
359 Ga0214542_1000002 3300021321 Bacteria 720798
360 Ga0214545_1000002 3300021324 Bacteria 727485
361 Ga0214543_1000013 3300021327 Bacteria 329117
362 Ga0213874_10002013 3300021377 Bacteria 4292
363 Ga0213876_10017851 3300021384 Bacteria 3743
364 Ga0207425_1008878 3300025245 Bacteria 2537
365 Ga0209148_1000493 3300025254 Bacteria 40546
366 Ga0209233_1020253 3300025261 Bacteria 1748
367 Ga0209455_1004278 3300025272 Bacteria 4733
368 Ga0209564_1005921 3300025295 Bacteria 6772
369 Ga0209564_1007197 3300025295 Bacteria 5797
370 Ga0209758_1000100 3300025297 Bacteria 227948
371 Ga0209758_1000138 3300025297 Bacteria 175187
372 Ga0209758_1001321 3300025297 Bacteria 30110
373 Ga0209758_1012135 3300025297 Bacteria 4865
374 Ga0209758_1034945 3300025297 Bacteria 1989
375 Ga0209758_1117037 3300025297 Bacteria 726
376 Ga0209256_1003445 3300025299 Bacteria 11092
377 Ga0207426_1000382 3300025302 Bacteria 76034
378 Ga0207426_1001031 3300025302 Bacteria 26635
379 Ga0207426_1008616 3300025302 Bacteria 4096
380 Ga0209257_1001637 3300025304 Bacteria 25658
381 Ga0209257_1009407 3300025304 Bacteria 5247
382 Ga0207656_10366467 3300025321 Bacteria 721
383 Ga0207688_10074810 3300025901 Bacteria 1927
384 Ga0207688_10278094 3300025901 Bacteria 1019
385 Ga0207680_10128093 3300025903 Bacteria 1669
386 Ga0207680_10360301 3300025903 Bacteria 1023
387 Ga0207647_10001578 3300025904 Bacteria 17487
388 Ga0207685_10175985 3300025905 Bacteria 988
389 Ga0207699_10032852 3300025906 Bacteria 2927
390 Ga0207699_10134629 3300025906 Bacteria 1617
391 Ga0207645_10072377 3300025907 Bacteria 2206
392 Ga0207645_10228146 3300025907 Bacteria 1229
393 Ga0207705_10163160 3300025909 Bacteria 1675
394 Ga0207705_10363213 3300025909 Bacteria 1117
395 Ga0207684_10083165 3300025910 Unclassified 2726
396 Ga0207684_10090601 3300025910 Unclassified 2605
397 Ga0207654_10142390 3300025911 Bacteria 1530
398 Ga0207654_10409186 3300025911 Bacteria 945
399 Ga0207707_10003484 3300025912 Bacteria 13920
400 Ga0207707_10012153 3300025912 Bacteria 7483
401 Ga0207707_10094903 3300025912 Bacteria 2607
402 Ga0207707_10109988 3300025912 Bacteria 2408
403 Ga0207695_10070550 3300025913 Bacteria 3571
404 Ga0207695_10229168 3300025913 Bacteria 1763
405 Ga0207695_10239287 3300025913 Bacteria 1717
406 Ga0207695_10367685 3300025913 Bacteria 1324
407 Ga0207695_10440173 3300025913 Bacteria 1187
408 Ga0207695_10570324 3300025913 Bacteria 1013
409 Ga0207671_10056314 3300025914 Bacteria 2913
410 Ga0207671_10190361 3300025914 Bacteria 1600
411 Ga0207671_10295728 3300025914 Bacteria 1279
412 Ga0207693_10666123 3300025915 Bacteria 808
413 Ga0207660_10028263 3300025917 Bacteria 3835
414 Ga0207660_10081504 3300025917 Bacteria 2378
415 Ga0207660_10187752 3300025917 Bacteria 1608
416 Ga0207662_10104871 3300025918 Bacteria 1756
417 Ga0207657_10131553 3300025919 Bacteria 2050
418 Ga0207649_10014953 3300025920 Bacteria 4355
419 Ga0207652_10020700 3300025921 Bacteria 5421
420 Ga0207652_10036127 3300025921 Bacteria 4176
421 Ga0207652_10740390 3300025921 Bacteria 875
422 Ga0207652_10759573 3300025921 Bacteria 862
423 Ga0207646_10062772 3300025922 Unclassified 3317
424 Ga0207646_10137134 3300025922 Bacteria 2203
425 Ga0207681_10077137 3300025923 Bacteria 2342
426 Ga0207681_10352556 3300025923 Bacteria 1178
427 Ga0207681_10495887 3300025923 Bacteria 999
428 Ga0207694_10046482 3300025924 Bacteria 3355
429 Ga0207694_10279479 3300025924 Bacteria 1371
430 Ga0207694_10285487 3300025924 Bacteria 1356
431 Ga0207694_10409220 3300025924 Bacteria 1129
432 Ga0207694_10854811 3300025924 Bacteria 769
433 Ga0207650_10177191 3300025925 Bacteria 1697
434 Ga0207659_10076907 3300025926 Bacteria 2455
435 Ga0207687_10024425 3300025927 Bacteria 4039
436 Ga0207687_10436076 3300025927 Bacteria 1084
437 Ga0207700_10662882 3300025928 Bacteria 930
438 Ga0207644_10016877 3300025931 Bacteria 4919
439 Ga0207644_10193955 3300025931 Bacteria 1598
440 Ga0207644_10273995 3300025931 Bacteria 1353
441 Ga0207690_10205609 3300025932 Bacteria 1498
442 Ga0207706_10205979 3300025933 Bacteria 1725
443 Ga0207706_10312952 3300025933 Bacteria 1367
444 Ga0207706_10518528 3300025933 Bacteria 1028
445 Ga0207706_10552565 3300025933 Bacteria 991
446 Ga0207686_10367153 3300025934 Bacteria 1088
447 Ga0207709_10119033 3300025935 Bacteria 1780
448 Ga0207709_10145177 3300025935 Bacteria 1636
449 Ga0207709_10341498 3300025935 Bacteria 1127
450 Ga0207670_10088217 3300025936 Bacteria 2187
451 Ga0207704_10016841 3300025938 Bacteria 3769
452 Ga0207665_10411969 3300025939 Bacteria 1031
453 Ga0207691_10075742 3300025940 Bacteria 3033
454 Ga0207691_10389425 3300025940 Bacteria 1189
455 Ga0207711_10224504 3300025941 Bacteria 1719
456 Ga0207689_10031197 3300025942 Bacteria 4439
457 Ga0207689_10048889 3300025942 Bacteria 3489
458 Ga0207689_10204505 3300025942 Bacteria 1630
459 Ga0207661_10010365 3300025944 Bacteria 6707
460 Ga0207661_10032194 3300025944 Bacteria 4059
461 Ga0207679_10279869 3300025945 Bacteria 1430
462 Ga0207667_10051148 3300025949 Bacteria 4357
463 Ga0207667_10181197 3300025949 Bacteria 2163
464 Ga0207651_10357531 3300025960 Bacteria 1232
465 Ga0207712_10059409 3300025961 Bacteria 2706
466 Ga0207712_10235403 3300025961 Bacteria 1472
467 Ga0207712_10538069 3300025961 Bacteria 1003
468 Ga0207712_10745625 3300025961 Bacteria 858
469 Ga0207668_10141735 3300025972 Bacteria 1849
470 Ga0207668_10314864 3300025972 Bacteria 1296
471 Ga0207640_10033120 3300025981 Bacteria 3212
472 Ga0207640_10473452 3300025981 Bacteria 1037
473 Ga0207658_10086843 3300025986 Bacteria 2414
474 Ga0207658_10206354 3300025986 Bacteria 1644
475 Ga0207658_10458696 3300025986 Bacteria 1129
476 Ga0207677_10168303 3300026023 Bacteria 1711
477 Ga0207703_10066372 3300026035 Bacteria 2968
478 Ga0207703_10298759 3300026035 Bacteria 1468
479 Ga0207703_10643501 3300026035 Bacteria 1005
480 Ga0207639_10259738 3300026041 Bacteria 1518
481 Ga0207639_10408506 3300026041 Bacteria 1225
482 Ga0207678_10010764 3300026067 Bacteria 8037
483 Ga0207678_10058807 3300026067 Bacteria 3307
484 Ga0207678_10067429 3300026067 Bacteria 3072
485 Ga0207678_10093111 3300026067 Bacteria 2575
486 Ga0207678_10172642 3300026067 Bacteria 1846
487 Ga0207678_10193129 3300026067 Bacteria 1740
488 Ga0207678_10204311 3300026067 Bacteria 1690
489 Ga0207678_10324284 3300026067 Bacteria 1325
490 Ga0207708_10039623 3300026075 Bacteria 3591
491 Ga0207702_10529800 3300026078 Bacteria 1151
492 Ga0207702_10561540 3300026078 Bacteria 1117
493 Ga0207641_10202896 3300026088 Bacteria 1829
494 Ga0207641_10274207 3300026088 Bacteria 1584
495 Ga0207648_10019696 3300026089 Bacteria 6088
496 Ga0207648_10040396 3300026089 Bacteria 4099
497 Ga0207648_10307603 3300026089 Bacteria 1422
498 Ga0207676_10169565 3300026095 Bacteria 1900
499 Ga0207676_10364959 3300026095 Bacteria 1339
500 Ga0207674_10158192 3300026116 Bacteria 2221
501 Ga0207674_10306321 3300026116 Bacteria 1538
502 Ga0207675_100029182 3300026118 Bacteria 5141
503 Ga0207675_100175842 3300026118 Bacteria 2048
504 Ga0207675_100209540 3300026118 Bacteria 1874
505 Ga0207675_100697836 3300026118 Bacteria 1023
506 Ga0207675_100823015 3300026118 Bacteria 943
507 Ga0207683_10045593 3300026121 Bacteria 3834
508 Ga0207683_10093880 3300026121 Bacteria 2674
509 Ga0207683_10122247 3300026121 Bacteria 2338
510 Ga0207683_10176304 3300026121 Bacteria 1937
511 Ga0207683_10219002 3300026121 Bacteria 1734
512 Ga0207683_10562575 3300026121 Bacteria 1054
513 Ga0207683_10599312 3300026121 Bacteria 1020
514 Ga0207683_10746570 3300026121 Bacteria 908
515 Ga0207698_10001629 3300026142 Bacteria 13078
516 Ga0207698_10093367 3300026142 Bacteria 2470
517 Ga0207698_10127349 3300026142 Bacteria 2168
518 Ga0207698_10309172 3300026142 Bacteria 1475
519 Ga0207698_10815153 3300026142 Bacteria 936
520 Ga0209389_1000068 3300027296 Bacteria 98954
521 Ga0209389_1000092 3300027296 Bacteria 82555
522 Ga0209589_1000115 3300027357 Bacteria 82537
523 Ga0209489_100340 3300027361 Bacteria 82555
524 Ga0209489_115015 3300027361 Bacteria 5028
525 Ga0209700_100117 3300027363 Bacteria 115595
526 Ga0268266_10005735 3300028379 Bacteria 11501
527 Ga0268266_10014260 3300028379 Bacteria 6835
528 Ga0268266_10051241 3300028379 Bacteria 3543
529 Ga0268266_10093149 3300028379 Bacteria 2644
530 Ga0268266_10114937 3300028379 Bacteria 2388
531 Ga0268266_10170101 3300028379 Bacteria 1977
532 Ga0268266_10261743 3300028379 Bacteria 1603
533 Ga0268266_10358628 3300028379 Bacteria 1371
534 Ga0268265_10049404 3300028380 Bacteria 3163
535 Ga0268265_10190437 3300028380 Bacteria 1771
536 Ga0268265_10272498 3300028380 Bacteria 1510
537 Ga0268264_10023033 3300028381 Bacteria 5082
538 Ga0268264_10455651 3300028381 Bacteria 1240
539 Ga0268264_10740980 3300028381 Bacteria 978
540 Ga0307517_10000071 3300028786 Bacteria 138548
541 Ga0307517_10336441 3300028786 Bacteria 827
542 Ga0307515_10035411 3300028794 Bacteria 8123
543 Ga0307515_10225215 3300028794 Bacteria 1682
544 Ga0307515_10301631 3300028794 Bacteria 1286
545 Ga0265331_10010876 3300031250 Bacteria 5005
546 Ga0307513_10441231 3300031456 Bacteria 1028
547 Ga0307509_10103714 3300031507 Bacteria 2871
548 Ga0307508_10015804 3300031616 Bacteria 6878
549 Ga0307508_10182003 3300031616 Bacteria 1704
550 Ga0307508_10371132 3300031616 Bacteria 1022
551 Ga0307508_10560934 3300031616 Bacteria 741
552 Ga0265314_10071422 3300031711 Bacteria 2323
553 Ga0265314_10079398 3300031711 Bacteria 2169
554 Ga0265342_10014276 3300031712 Bacteria 5278
555 Ga0316578_10118059 3300031728 Bacteria 1594
556 Ga0307516_10130897 3300031730 Bacteria 2288
557 Ga0307516_10176600 3300031730 Bacteria 1872
558 Ga0307516_10292762 3300031730 Bacteria 1306
559 Ga0307516_10503868 3300031730 Bacteria 865
560 Ga0307516_10508305 3300031730 Bacteria 859
561 Ga0307413_10058019 3300031824 Bacteria 2370
562 Ga0307410_10512020 3300031852 Bacteria 989
563 Ga0307410_10548327 3300031852 Bacteria 958
564 Ga0307409_100122862 3300031995 Bacteria 2202
565 Ga0307409_100164695 3300031995 Bacteria 1944
566 Ga0307416_100148392 3300032002 Bacteria 2146
567 Ga0307416_100480374 3300032002 Bacteria 1302
568 Ga0307416_100985886 3300032002 Bacteria 945
569 Ga0307411_10052156 3300032005 Bacteria 2673
570 Ga0307411_10143569 3300032005 Bacteria 1763
571 Ga0307415_100129334 3300032126 Bacteria 1908
572 Ga0307507_10101429 3300033179 Bacteria 2407
573 Ga0307510_10005071 3300033180 Bacteria 15630
574 Ga0307510_10025489 3300033180 Bacteria 6817
575 Ga0307510_10054066 3300033180 Bacteria 4212
576 Ga0373930_0106668 3300034816 Bacteria 671
577 Ga0373926_0023353 3300035083 Bacteria 2147
578 Ga0373929_0001973 3300035085 Bacteria 3830
579 Ga0373949_0034709 3300035090 Bacteria 1217
580 Ga0373952_0025115 3300035092 Bacteria 1284
581 Ga0373923_0001429 3300035111 Bacteria 6837
582 Ga0373936_0060757 3300035113 Bacteria 1542
583 Ga0373936_0082108 3300035113 Bacteria 1343
584 Ga0373939_0020406 3300035114 Bacteria 1800
585 Ga0373941_0042528 3300035115 Bacteria 1411
586 Ga0373945_0105482 3300035116 Bacteria 1107
587 Ga0373954_0152795 3300035118 Bacteria 1128
588 Ga0373943_0177216 3300035170 Bacteria 1170
589 Ga0373955_0188902 3300035172 Bacteria 1224
590 Ga0373961_0090212 3300035241 Bacteria 978
591 Ga0316574_0498115 3300035398 Bacteria 760
592 Ga0373924_0027585 3300035410 Bacteria 2258
593 Ga0373931_0042267 3300035691 Bacteria 2396
594 Ga0373931_0274562 3300035691 Bacteria 1033
595 Ga0373935_0028891 3300035692 Bacteria 3428
596 Ga0373935_0164148 3300035692 Bacteria 1516
597 Ga0373927_0027565 3300035695 Bacteria 3708
598 Ga0373927_0037839 3300035695 Bacteria 3134
599 Ga0373927_0252127 3300035695 Bacteria 1160
600 Ga0373933_0207031 3300035724 Unclassified 1256
601 Ga0373947_0034898 3300035725 Bacteria 2976
602 Ga0316584_0180732 3300036712 Bacteria 1562
603 Ga0373925_0130287 3300037068 Bacteria 1960
604 Ga0373925_0457738 3300037068 Bacteria 1045
605 Ga0395900_0000601 3300037418 Bacteria 49219
606 Ga0395900_0084721 3300037418 Bacteria 3257
607 Ga0395900_0156434 3300037418 Bacteria 2328
608 Ga0395900_0384968 3300037418 Bacteria 1370
609 Ga0395898_0064519 3300037466 Bacteria 3552
610 Ga0395898_0557017 3300037466 Bacteria 1089
611 Ga0395905_0004099 3300037471 Bacteria 15269
612 Ga0395905_0028345 3300037471 Bacteria 5279
613 Ga0395905_0045576 3300037471 Bacteria 4113
614 Ga0395905_0179438 3300037471 Bacteria 1988
615 Ga0395905_0881125 3300037471 Bacteria 798
616 Ga0436364_1345727 3300037853 Bacteria 7069
617 Ga0395901_0084872 3300038443 Bacteria 3310
618 Ga0395901_0114991 3300038443 Bacteria 2826
619 Ga0395901_0190948 3300038443 Bacteria 2148
620 Ga0395901_0327622 3300038443 Bacteria 1584
621 Ga0395901_0383903 3300038443 Bacteria 1445
622 Ga0436365_0151405 3300039437 Bacteria 11975
623 Ga0436365_1756237 3300039437 Bacteria 4549
624 Ga0436360_0380292 3300039438 Bacteria 660
625 Ga0436361_0701096 3300039447 Bacteria 1431
626 Ga0436361_0877460 3300039447 Bacteria 1214
627 Ga0436363_1531694 3300039450 Bacteria 2797
628 Ga0436362_0238672 3300039453 Bacteria 6738
629 Ga0451789_0042347 3300041443 Bacteria 1783
630 Ga0451800_1635921 3300041459 Bacteria 1144
631 Ga0451802_0462708 3300041460 Bacteria 1149
632 Ga0451804_1129176 3300041463 Bacteria 1217
633 Ga0451833_1355453 3300041491 Bacteria 1153
634 Ga0466969_0100021 3300044656 Bacteria 1366
635 Ga0466972_0072759 3300044658 Bacteria 1639
636 Ga0466972_0258293 3300044658 Bacteria 814
637 Ga0466963_0037866 3300044694 Bacteria 3152
638 Ga0466964_0019616 3300044706 Bacteria 2601
639 Ga0466960_0013843 3300044901 Bacteria 3437
640 Ga0466960_0057079 3300044901 Bacteria 1903
641 Ga0466960_0068260 3300044901 Bacteria 1763
642 Ga0466959_0187516 3300045049 Bacteria 1444
643 Ga0466967_0122378 3300045976 Bacteria 2406
644 Ga0466967_0142386 3300045976 Bacteria 2234
645 Ga0495592_0161656 3300046454 Bacteria 1540
646 Ga0495592_0282725 3300046454 Bacteria 1085
647 Ga0495603_0034408 3300046455 Bacteria 3046
648 Ga0495590_0021555 3300046457 Bacteria 2283
649 Ga0495590_0062124 3300046457 Bacteria 1308
650 Ga0495629_0139772 3300046459 Bacteria 1685
651 Ga0495629_0159644 3300046459 Bacteria 1566
652 Ga0495638_0005428 3300046460 Bacteria 9486
653 Ga0495638_0113325 3300046460 Bacteria 1609
654 Ga0495641_0056529 3300046461 Bacteria 1778
655 Ga0495641_0131485 3300046461 Bacteria 1117
656 Ga0495651_0005518 3300046462 Bacteria 9647
657 Ga0495651_0007953 3300046462 Bacteria 8128
658 Ga0495651_0272547 3300046462 Bacteria 1147
659 Ga0495653_0223986 3300046463 Bacteria 1263
660 Ga0495580_0009497 3300046472 Bacteria 7646
661 Ga0495605_0135421 3300046474 Bacteria 1108
662 Ga0495639_0004008 3300046475 Bacteria 6313
663 Ga0495662_0172930 3300046476 Bacteria 1064
664 Ga0495664_0034909 3300046477 Bacteria 2959
665 Ga0495664_0040873 3300046477 Bacteria 2743
666 Ga0495664_0215422 3300046477 Bacteria 1163
667 Ga0495584_0267785 3300046491 Bacteria 868
668 Ga0495585_0110244 3300046492 Bacteria 1464
669 Ga0495596_0082976 3300046500 Bacteria 1244
670 Ga0495607_0102964 3300046501 Bacteria 1526
671 Ga0495607_0249128 3300046501 Bacteria 856
672 Ga0495608_0021931 3300046511 Bacteria 4380
673 Ga0495608_0133019 3300046511 Bacteria 1591
674 Ga0495608_0230027 3300046511 Bacteria 1161
675 Ga0495610_0085036 3300046512 Bacteria 1445
676 Ga0495610_0137742 3300046512 Bacteria 1053
677 Ga0495616_0091351 3300046513 Bacteria 1441
678 Ga0495616_0108748 3300046513 Bacteria 1290
679 Ga0495618_0022327 3300046514 Bacteria 3908
680 Ga0495620_0111337 3300046515 Bacteria 1085
681 Ga0495628_0136755 3300046516 Bacteria 1872
682 Ga0495630_0045229 3300046517 Bacteria 3289
683 Ga0495631_0118061 3300046518 Bacteria 1141
684 Ga0495631_0128667 3300046518 Bacteria 1088
685 Ga0495632_0156773 3300046519 Bacteria 1050
686 Ga0495632_0219770 3300046519 Bacteria 859
687 Ga0495644_0109982 3300046523 Bacteria 1045
688 Ga0495648_0040345 3300046524 Bacteria 2961
689 Ga0495648_0063509 3300046524 Bacteria 2180
690 Ga0495648_0120781 3300046524 Bacteria 1409
691 Ga0495648_0227933 3300046524 Bacteria 914
692 Ga0495652_0026970 3300046529 Bacteria 5067
693 Ga0495652_0170107 3300046529 Bacteria 1683
694 Ga0495652_0433823 3300046529 Bacteria 923
695 Ga0495587_0081675 3300046536 Bacteria 1873
696 Ga0495598_0152338 3300046537 Bacteria 808
697 Ga0495609_0099182 3300046538 Bacteria 1263
698 Ga0495609_0149992 3300046538 Bacteria 992
699 Ga0495609_0190328 3300046538 Bacteria 861
700 Ga0495621_0017558 3300046539 Bacteria 2315
701 Ga0495622_0088960 3300046557 Bacteria 1419
702 Ga0495622_0102868 3300046557 Bacteria 1309
703 Ga0495622_0186379 3300046557 Bacteria 929
704 Ga0495622_0278931 3300046557 Bacteria 731
705 Ga0495633_0031367 3300046558 Bacteria 2577
706 Ga0495633_0217666 3300046558 Bacteria 874
707 Ga0495656_0017547 3300046615 Bacteria 2733
708 Ga0495656_0227631 3300046615 Bacteria 934
709 Ga0495668_0051517 3300046616 Bacteria 2279
710 Ga0495668_0172125 3300046616 Bacteria 1186
711 Ga0495668_0475565 3300046616 Bacteria 688
712 Ga0495634_0013865 3300046642 Bacteria 5824
713 Ga0495634_0033410 3300046642 Bacteria 3536
714 Ga0495634_0281391 3300046642 Bacteria 1010
715 Ga0495611_0061653 3300046648 Bacteria 1705
716 Ga0495611_0191250 3300046648 Bacteria 955
717 Ga0495611_0243672 3300046648 Bacteria 834
718 Ga0495625_0286077 3300046660 Bacteria 1059
719 Ga0495625_0362396 3300046660 Bacteria 913
720 Ga0495635_0043662 3300046663 Bacteria 3093
721 Ga0495635_0049995 3300046663 Bacteria 2882
722 Ga0495659_0266048 3300046664 Bacteria 717
723 Ga0495661_0207557 3300046665 Bacteria 1022
724 Ga0495657_0002722 3300046675 Bacteria 14757
725 Ga0495623_0002730 3300046679 Bacteria 11661
726 Ga0495623_0287225 3300046679 Bacteria 913
727 Ga0495646_0088531 3300046680 Bacteria 1793
728 Ga0495646_0089695 3300046680 Bacteria 1779
729 Ga0495647_0233363 3300046681 Bacteria 815
730 Ga0495669_0084639 3300046684 Bacteria 1458
731 Ga0495624_0158055 3300046690 Bacteria 1385
732 Ga0495624_0162127 3300046690 Bacteria 1366
733 Ga0495624_0400437 3300046690 Bacteria 824
734 Ga0495670_0145113 3300046691 Bacteria 1243
735 Ga0495589_0221780 3300046794 Bacteria 888
736 Ga0495600_0019685 3300046809 Bacteria 4313
737 Ga0495600_0481224 3300046809 Bacteria 765
738 Ga0495581_0023440 3300047315 Bacteria 3576
739 Ga0495604_0020305 3300047317 Bacteria 5308
740 Ga0495604_0029080 3300047317 Bacteria 4397
741 Ga0495604_0173475 3300047317 Bacteria 1514
742 Ga0495636_0059948 3300047318 Bacteria 1607
743 Ga0495674_0037372 3300047319 Bacteria 4363
744 Ga0495674_0043669 3300047319 Bacteria 3988
745 Ga0495674_0769917 3300047319 Bacteria 751
746 Ga0495672_0028339 3300047320 Bacteria 3545
747 Ga0495672_0151839 3300047320 Bacteria 1201
748 Ga0495676_0126508 3300047321 Bacteria 1851
749 Ga0495680_0084540 3300047322 Bacteria 2391
750 Ga0495683_0013594 3300047323 Bacteria 4254
751 Ga0495683_0287932 3300047323 Bacteria 709
752 Ga0495687_056171 3300047443 Bacteria 1643
753 Ga0495675_0065231 3300047444 Bacteria 2303
754 Ga0495677_0005933 3300047445 Bacteria 4627
755 Ga0495679_097202 3300047446 Bacteria 821
756 Ga0495684_0012228 3300047471 Bacteria 6622
757 Ga0495686_0076268 3300047472 Bacteria 2054
758 Ga0495686_0080369 3300047472 Bacteria 1993
759 Ga0495593_0026986 3300047673 Bacteria 3165
760 Ga0495593_0322161 3300047673 Bacteria 773
761 Ga0495593_0363068 3300047673 Bacteria 724
762 Ga0495602_0214752 3300048088 Bacteria 1457
763 Ga0495615_0008583 3300048090 Bacteria 1982
764 Ga0495615_0060246 3300048090 Bacteria 1000
765 Ga0496100_0034333 3300048903 Bacteria 3182
766 Ga0496100_0099054 3300048903 Bacteria 2005
767 Ga0496100_0215752 3300048903 Bacteria 1406
768 Ga0496100_0353426 3300048903 Bacteria 1110
769 Ga0496101_0010035 3300048904 Bacteria 6239
770 Ga0496101_0251335 3300048904 Bacteria 1377
771 Ga0496101_0398983 3300048904 Bacteria 1083
772 Ga0496101_0429706 3300048904 Bacteria 1041
773 Ga0496102_0013449 3300048905 Bacteria 7089
774 Ga0496102_0062913 3300048905 Bacteria 3397
775 Ga0496102_0128269 3300048905 Bacteria 2372
776 Ga0496102_0162493 3300048905 Bacteria 2101
777 Ga0496102_0402287 3300048905 Bacteria 1287
778 Ga0496102_0494062 3300048905 Bacteria 1145
779 Ga0496103_0125217 3300048906 Bacteria 1639
780 Ga0496103_0378626 3300048906 Bacteria 909
781 Ga0496104_0034670 3300048907 Bacteria 4708
782 Ga0496104_0037615 3300048907 Bacteria 4525
783 Ga0496104_0095563 3300048907 Bacteria 2843
784 Ga0496104_0178001 3300048907 Bacteria 2037
785 Ga0496104_0438915 3300048907 Bacteria 1217
786 Ga0496105_0013759 3300048908 Bacteria 6424
787 Ga0496105_0031433 3300048908 Bacteria 4352
788 Ga0496105_0078016 3300048908 Bacteria 2735
789 Ga0496105_0316345 3300048908 Bacteria 1252
790 Ga0496105_0518923 3300048908 Bacteria 933
791 Ga0496106_0000790 3300048909 Bacteria 22889
792 Ga0496106_0034128 3300048909 Bacteria 3799
793 Ga0496106_0304489 3300048909 Bacteria 1278
794 Ga0496106_0329026 3300048909 Bacteria 1227
795 Ga0496106_0502338 3300048909 Bacteria 974
796 Ga0496107_0012206 3300048910 Bacteria 5994
797 Ga0496107_0041263 3300048910 Bacteria 3313
798 Ga0496107_0109232 3300048910 Bacteria 2032
799 Ga0496107_0310360 3300048910 Bacteria 1174
800 Ga0496108_0030269 3300048911 Bacteria 4486
801 Ga0496108_0194029 3300048911 Bacteria 1761
802 Ga0496108_0360749 3300048911 Bacteria 1268
803 Ga0496109_0110376 3300048912 Bacteria 2557
804 Ga0496109_0188961 3300048912 Bacteria 1935
805 Ga0496110_0017963 3300048913 Bacteria 5924
806 Ga0496110_0018229 3300048913 Bacteria 5883
807 Ga0496110_0153652 3300048913 Bacteria 2084
808 Ga0496110_0269092 3300048913 Bacteria 1551
809 Ga0496110_0320020 3300048913 Bacteria 1413
810 Ga0496111_0021492 3300048914 Bacteria 4508
811 Ga0496111_0072379 3300048914 Bacteria 2509
812 Ga0496112_0021451 3300048915 Bacteria 6143
813 Ga0496112_0040959 3300048915 Bacteria 4531
814 Ga0496112_0204579 3300048915 Bacteria 1932
815 Ga0496112_0208278 3300048915 Bacteria 1913
816 Ga0496112_0413839 3300048915 Bacteria 1287
817 Ga0496112_0770116 3300048915 Bacteria 888
818 Ga0496113_0025419 3300048916 Bacteria 4220
819 Ga0496113_0220446 3300048916 Bacteria 1511
820 Ga0496113_0309371 3300048916 Bacteria 1266
821 Ga0496113_0459930 3300048916 Bacteria 1022
822 Ga0496114_0009819 3300048917 Bacteria 7607
823 Ga0496114_0194523 3300048917 Bacteria 1775
824 Ga0496115_0106182 3300048918 Bacteria 2305
825 Ga0496115_0136097 3300048918 Bacteria 2026
826 Ga0496115_0166408 3300048918 Bacteria 1823
827 Ga0496115_0291782 3300048918 Bacteria 1338
828 Ga0496115_0352129 3300048918 Bacteria 1201
829 Ga0496115_0577737 3300048918 Bacteria 896
830 Ga0496115_0710117 3300048918 Bacteria 790
831 Ga0496116_0036199 3300048919 Bacteria 3458
832 Ga0496117_0023985 3300048920 Bacteria 4843
833 Ga0496117_0068751 3300048920 Bacteria 2389
834 Ga0496117_0117147 3300048920 Bacteria 1645
835 Ga0496117_0250327 3300048920 Bacteria 967
836 Ga0496119_0002261 3300048922 Bacteria 21403
837 Ga0496119_0047799 3300048922 Bacteria 2659
838 Ga0496119_0123825 3300048922 Bacteria 1417
839 Ga0496120_0020511 3300048923 Bacteria 4198
840 Ga0496121_0003198 3300048924 Bacteria 23590
841 Ga0496121_0004531 3300048924 Bacteria 18595
842 Ga0496121_0023313 3300048924 Bacteria 5966
843 Ga0496121_0033547 3300048924 Bacteria 4643
844 Ga0496121_0056653 3300048924 Bacteria 3253
845 Ga0496121_0087578 3300048924 Bacteria 2444
846 Ga0496121_0093417 3300048924 Bacteria 2342
847 Ga0496121_0095489 3300048924 Bacteria 2310
848 Ga0496121_0228402 3300048924 Bacteria 1305
849 Ga0496122_0221224 3300048925 Bacteria 1086
850 Ga0496124_0002423 3300048927 Bacteria 24474
851 Ga0496124_0055391 3300048927 Bacteria 3351
852 Ga0496124_0162000 3300048927 Bacteria 1742
853 Ga0496124_0226068 3300048927 Bacteria 1403
854 Ga0496124_0427866 3300048927 Bacteria 910
855 Ga0496125_0000252 3300048928 Bacteria 109988
856 Ga0496125_0000477 3300048928 Bacteria 70913
857 Ga0496125_0006104 3300048928 Bacteria 13147
858 Ga0496125_0014815 3300048928 Bacteria 7573
859 Ga0496125_0038225 3300048928 Bacteria 4159
860 Ga0496125_0057578 3300048928 Bacteria 3146
861 Ga0496125_0075024 3300048928 Bacteria 2619
862 Ga0496125_0078578 3300048928 Bacteria 2535
863 Ga0496125_0175324 3300048928 Bacteria 1435
864 Ga0496126_0003342 3300048929 Bacteria 20380
865 Ga0496126_0005092 3300048929 Bacteria 15243
866 Ga0496126_0008959 3300048929 Bacteria 10711
867 Ga0496126_0018165 3300048929 Bacteria 6977
868 Ga0496126_0024225 3300048929 Bacteria 5862
869 Ga0496126_0027002 3300048929 Bacteria 5494
870 Ga0496126_0046537 3300048929 Bacteria 3978
871 Ga0496126_0063150 3300048929 Bacteria 3320
872 Ga0496126_0087671 3300048929 Bacteria 2743
873 Ga0496126_0117917 3300048929 Bacteria 2305
874 Ga0496126_0145584 3300048929 Bacteria 2035
875 Ga0496126_0195956 3300048929 Bacteria 1708
876 Ga0496126_0197606 3300048929 Bacteria 1700
877 Ga0496126_0543982 3300048929 Bacteria 922
878 Ga0496126_0679466 3300048929 Bacteria 802
879 Ga0495682_0022934 3300049460 Bacteria 2332
880 Ga0495682_0174082 3300049460 Bacteria 765
881 Ga0501067_0035550 3300049583 Bacteria 2767
882 Ga0501067_0040139 3300049583 Bacteria 2600
883 Ga0501075_0443655 3300049591 Bacteria 990
884 nmdc:mga03683_110190_c1 3300050489 Bacteria 1216
885 nmdc:mga03683_261925_c1 3300050489 Bacteria 805
886 nmdc:mga03683_297427_c1 3300050489 Bacteria 756
887 nmdc:mga03n38_113295_c1 3300050490 Bacteria 1324
888 nmdc:mga03n38_191280_c1 3300050490 Bacteria 1054
889 nmdc:mga03n38_232557_c1 3300050490 Bacteria 967
890 nmdc:mga03n38_70192_c1 3300050490 Bacteria 1619
891 nmdc:mga00v17_149651_c1 3300050491 Bacteria 1499
892 nmdc:mga00v17_179927_c1 3300050491 Bacteria 1364
893 nmdc:mga00v17_313818_c1 3300050491 Bacteria 1019
894 nmdc:mga00v17_592228_c1 3300050491 Bacteria 715
895 nmdc:mga0yw44_210242_c1 3300050492 Bacteria 1287
896 nmdc:mga0yw44_308508_c1 3300050492 Bacteria 1061
897 nmdc:mga0yw44_333422_c1 3300050492 Bacteria 1020
898 nmdc:mga0yw44_60416_c1 3300050492 Bacteria 2322
899 nmdc:mga0k408_113047_c1 3300050493 Bacteria 1605
900 nmdc:mga06z11_27169_c1 3300050494 Bacteria 2734
901 nmdc:mga06z11_278886_c1 3300050494 Bacteria 990
902 nmdc:mga06z11_29474_c1 3300050494 Bacteria 2645
903 nmdc:mga06z11_434110_c1 3300050494 Bacteria 792
904 nmdc:mga06z11_47913_c1 3300050494 Bacteria 2172
905 nmdc:mga07m45_101344_c1 3300050496 Bacteria 1653
906 nmdc:mga07m45_141870_c1 3300050496 Bacteria 1391
907 nmdc:mga07m45_33802_c1 3300050496 Bacteria 2841
908 nmdc:mga07m45_40557_c1 3300050496 Bacteria 2605
909 nmdc:mga05p37_222833_c1 3300050507 Bacteria 2275
910 nmdc:mga05p37_254661_c1 3300050507 Bacteria 2104
911 nmdc:mga0qj67_382155_c1 3300050509 Bacteria 1137
912 nmdc:mga0qj67_63538_c1 3300050509 Bacteria 2935
913 nmdc:mga06r32_17887_c1 3300050510 Bacteria 6478
914 nmdc:mga0n895_255303_c1 3300050512 Bacteria 1779
915 nmdc:mga0n895_416634_c1 3300050512 Bacteria 1358
916 nmdc:mga0n895_871701_c1 3300050512 Bacteria 887
917 nmdc:mga0rr50_142842_c1 3300050513 Bacteria 1927
918 nmdc:mga0a205_21992_c1 3300050515 Bacteria 6034
919 nmdc:mga0sz30_30547_c1 3300050516 Bacteria 2226
920 nmdc:mga0sz30_99126_c1 3300050516 Bacteria 1272
921 Ga0495601_0559716 3300053077 Bacteria 735
922 Ga0500635_0017676 3300053080 Bacteria 2141
923 Ga0495619_0164315 3300053085 Bacteria 1534
924 Ga0500578_0022393 3300053086 Bacteria 4057
925 Ga0500643_000025 3300053087 Bacteria 259605
926 Ga0500583_0059313 3300053092 Bacteria 1802
927 Ga0500651_0006276 3300053093 Bacteria 6836
928 Ga0500651_0034629 3300053093 Bacteria 3184
929 Ga0500651_0158861 3300053093 Bacteria 1353
930 Ga0500566_0062550 3300053094 Bacteria 2104
931 Ga0500566_0090144 3300053094 Bacteria 1695
932 Ga0500566_0109291 3300053094 Bacteria 1505
933 Ga0500641_0008562 3300053096 Bacteria 3656
934 Ga0500641_0048832 3300053096 Bacteria 1734
935 Ga0500641_0139298 3300053096 Bacteria 1048
936 Ga0500554_026795 3300053102 Bacteria 1660
937 Ga0500555_022255 3300053103 Bacteria 1822
938 Ga0500555_071802 3300053103 Bacteria 913
939 Ga0500556_0071895 3300053104 Bacteria 1293
940 Ga0500557_000001 3300053105 Bacteria 241298
941 Ga0500562_012751 3300053108 Bacteria 2140
942 Ga0500569_010569 3300053109 Bacteria 2180
943 Ga0500572_013736 3300053111 Bacteria 2010
944 Ga0500595_000680 3300053119 Bacteria 20345
945 Ga0500595_001479 3300053119 Bacteria 12486
946 Ga0500595_003476 3300053119 Bacteria 7330
947 Ga0500595_062096 3300053119 Bacteria 1126
948 Ga0500642_0000221 3300053130 Bacteria 22633
949 Ga0500652_119435 3300053131 Bacteria 1102
950 Ga0500658_0021527 3300053134 Bacteria 2443
951 Ga0500658_0199659 3300053134 Bacteria 914
952 Ga0500559_0069414 3300053136 Bacteria 1584
953 Ga0500559_0090600 3300053136 Bacteria 1399
954 Ga0500568_0110097 3300053139 Bacteria 1030
955 Ga0500568_0119287 3300053139 Bacteria 983
956 Ga0500573_0073733 3300053140 Bacteria 1944
957 Ga0500573_0138523 3300053140 Bacteria 1342
958 Ga0500588_0013778 3300053146 Bacteria 2035
959 Ga0500588_0155099 3300053146 Bacteria 830
960 Ga0500590_057454 3300053148 Bacteria 1963
961 Ga0500604_0090367 3300053151 Bacteria 999
962 Ga0500622_0046562 3300053156 Bacteria 2241
963 Ga0500622_0099278 3300053156 Bacteria 1436
964 Ga0500627_0021488 3300053158 Bacteria 2605
965 Ga0500627_0162430 3300053158 Bacteria 1008
966 Ga0500633_0040266 3300053160 Bacteria 1567
967 Ga0500633_0067310 3300053160 Bacteria 1273
968 Ga0500634_0160967 3300053161 Bacteria 1036
969 Ga0500634_0191916 3300053161 Bacteria 907
970 Ga0500638_034071 3300053162 Bacteria 2463
971 Ga0500638_068136 3300053162 Bacteria 1704
972 Ga0500638_099711 3300053162 Bacteria 1356
973 Ga0500639_029815 3300053163 Bacteria 2883
974 Ga0500636_0002067 3300053177 Bacteria 11078
975 Ga0500636_0048980 3300053177 Bacteria 2486
976 Ga0500636_0067045 3300053177 Bacteria 2085
977 Ga0500636_0067386 3300053177 Unclassified 2080
978 Ga0500636_0083775 3300053177 Bacteria 1834
979 Ga0500637_0047630 3300053178 Bacteria 2435
980 Ga0500637_0136510 3300053178 Bacteria 1421
981 Ga0500637_0300745 3300053178 Bacteria 875
982 Ga0500609_001217 3300053731 Bacteria 3829
983 Ga0500609_018270 3300053731 Bacteria 954
984 Ga0500596_000723 3300053735 Bacteria 6467
985 Ga0530510_0160337 3300061734 Bacteria 1664

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_0380292 Ga0436360_0380292_100_621 169
2 3300034816 Ga0373930_0106668 Ga0373930_0106668_19_564 177
3 3300009545 Ga0105237_10114688 Ga0105237_101146883 189
4 3300053140 Ga0500573_0073733 Ga0500573_0073733_1011_1670 189
5 3300053177 Ga0500636_0067045 Ga0500636_0067045_692_1351 189
6 3300053735 Ga0500596_000723 Ga0500596_000723_723_1382 189
7 3300053136 Ga0500559_0069414 Ga0500559_0069414_419_1078 190
8 3300005535 Ga0070684_100115242 Ga0070684_1001152424 192
9 3300009093 Ga0105240_10008787 Ga0105240_1000878710 192
10 3300009551 Ga0105238_10008642 Ga0105238_100086424 192
11 3300013104 Ga0157370_10206147 Ga0157370_102061472 192
12 3300013105 Ga0157369_10124770 Ga0157369_101247704 192
13 3300013307 Ga0157372_10012959 Ga0157372_100129592 192
14 3300025913 Ga0207695_10070550 Ga0207695_100705501 192
15 3300025921 Ga0207652_10759573 Ga0207652_107595731 192
16 3300025924 Ga0207694_10046482 Ga0207694_100464823 192
17 3300026142 Ga0207698_10001629 Ga0207698_1000162914 192
18 3300005356 Ga0070674_100244574 Ga0070674_1002445742 195
19 3300006237 Ga0097621_100316706 Ga0097621_1003167062 195
20 3300006358 Ga0068871_100388701 Ga0068871_1003887011 195
21 3300046518 Ga0495631_0118061 Ga0495631_0118061_224_997 195
22 3300047673 Ga0495593_0322161 Ga0495593_0322161_20_715 195
23 3300003659 JGI25404J52841_10014306 JGI25404J52841_100143061 198
24 3300013306 Ga0163162_10028934 Ga0163162_100289342 203
25 3300046809 Ga0495600_0481224 Ga0495600_0481224_103_714 203
26 3300031728 Ga0316578_10118059 Ga0316578_101180591 205
27 3300035398 Ga0316574_0498115 Ga0316574_0498115_64_717 205
28 3300036712 Ga0316584_0180732 Ga0316584_0180732_817_1461 205
29 3300003320 rootH2_10283654 rootH2_102836542 206
30 3300005563 Ga0068855_100062456 Ga0068855_1000624563 206
31 3300021377 Ga0213874_10002013 Ga0213874_100020133 206
32 3300021384 Ga0213876_10017851 Ga0213876_100178516 206
33 3300039437 Ga0436365_0151405 Ga0436365_0151405_3591_4217 206
34 3300039450 Ga0436363_1531694 Ga0436363_1531694_1450_2097 206
35 iso_pu_bacteria 2824600985 2824608897 206
36 iso_pu_bacteria 2824609381 2824617372 206
37 iso_pu_bacteria 2824679649 2824682494 206
38 iso_pu_bacteria 2906626472 2906628097 206
39 iso_pu_bacteria 2922393267 2922395422 206
40 3300026142 Ga0207698_10093367 Ga0207698_100933672 207
41 iso_pu_bacteria 2507262055 2507509566 207
42 iso_pu_bacteria 2508501042 2508698601 207
43 iso_pu_bacteria 2508501128 2509151062 207
44 iso_pu_bacteria 2513237092 2513624616 207
45 iso_pu_bacteria 2513237094 2513638120 207
46 iso_pu_bacteria 2513237095 2513646419 207
47 iso_pu_bacteria 2513237098 2513673612 207
48 iso_pu_bacteria 2513237101 2513693199 207
49 iso_pu_bacteria 2513237102 2513700933 207
50 iso_pu_bacteria 2513237104 2513717656 207
51 iso_pu_bacteria 2513237139 2513879397 207
52 iso_pu_bacteria 2513237141 2513887331 207
53 iso_pu_bacteria 2513237161 2514016703 207
54 iso_pu_bacteria 2515154112 2515629039 207
55 iso_pu_bacteria 2517093001 2517108288 207
56 iso_pu_bacteria 2524023205 2524439676 207
57 iso_pu_bacteria 2524023210 2524467652 207
58 iso_pu_bacteria 2617270735 2617349073 207
59 iso_pu_bacteria 2617270741 2617376677 207
60 iso_pu_bacteria 2744054633 2745082131 207
61 iso_pu_bacteria 2791355196 2793060447 207
62 iso_pu_bacteria 2802429603 2805920295 207
63 iso_pu_bacteria 2816332527 2818240389 207
64 iso_pu_bacteria 2824617872 2824624573 207
65 iso_pu_bacteria 2824626560 2824630680 207
66 iso_pu_bacteria 2824635225 2824640384 207
67 iso_pu_bacteria 2824644064 2824647821 207
68 iso_pu_bacteria 2824661429 2824667280 207
69 iso_pu_bacteria 2824671348 2824676211 207
70 iso_pu_bacteria 2824687955 2824692331 207
71 iso_pu_bacteria 2824696289 2824700672 207
72 iso_pu_bacteria 2824704595 2824710537 207
73 iso_pu_bacteria 2824714736 2824719918 207
74 iso_pu_bacteria 2824723954 2824729516 207
75 iso_pu_bacteria 2824732956 2824735714 207
76 iso_pu_bacteria 2824746037 2824751710 207
77 iso_pu_bacteria 2824753945 2824756720 207
78 iso_pu_bacteria 2824763712 2824770903 207
79 iso_pu_bacteria 2824773399 2824779023 207
80 iso_pu_bacteria 2838122688 2838128716 207
81 iso_pu_bacteria 2841941048 2841948482 207
82 iso_pu_bacteria 2841949485 2841956403 207
83 iso_pu_bacteria 2841957949 2841962405 207
84 iso_pu_bacteria 2841966195 2841967176 207
85 iso_pu_bacteria 2841974524 2841979424 207
86 iso_pu_bacteria 2841983080 2841989903 207
87 iso_pu_bacteria 2842038055 2842039968 207
88 iso_pu_bacteria 2842045827 2842047087 207
89 iso_pu_bacteria 2844315083 2844318183 207
90 iso_pu_bacteria 2847930680 2847935053 207
91 iso_pu_bacteria 2847939898 2847945613 207
92 iso_pu_bacteria 2857509624 2857510408 207
93 iso_pu_bacteria 2874590934 2874595321 207
94 iso_pu_bacteria 2874612657 2874613281 207
95 iso_pu_bacteria 2874620515 2874626951 207
96 iso_pu_bacteria 2874628541 2874636475 207
97 iso_pu_bacteria 2874645413 2874651160 207
98 iso_pu_bacteria 2876761206 2876761234 207
99 iso_pu_bacteria 2876771140 2876775257 207
100 iso_pu_bacteria 2876818435 2876824072 207
101 iso_pu_bacteria 2879074833 2879080700 207
102 iso_pu_bacteria 2879083081 2879090782 207
103 iso_pu_bacteria 2879099564 2879109504 207
104 iso_pu_bacteria 2879127579 2879134717 207
105 iso_pu_bacteria 2879142872 2879144177 207
106 iso_pu_bacteria 2881665667 2881673056 207
107 iso_pu_bacteria 2885366525 2885373448 207
108 iso_pu_bacteria 2885383462 2885390910 207
109 iso_pu_bacteria 2885409591 2885410716 207
110 iso_pu_bacteria 2888378607 2888383029 207
111 iso_pu_bacteria 2888419890 2888423489 207
112 iso_pu_bacteria 2903727486 2903732967 207
113 iso_pu_bacteria 2903768456 2903775025 207
114 iso_pu_bacteria 2904666416 2904669652 207
115 iso_pu_bacteria 2904711408 2904716920 207
116 iso_pu_bacteria 2906602504 2906605076 207
117 iso_pu_bacteria 2906643746 2906650176 207
118 iso_pu_bacteria 2908775508 2908779218 207
119 iso_pu_bacteria 2922361189 2922361510 207
120 iso_pu_bacteria 2922368715 2922373214 207
121 iso_pu_bacteria 2929615660 2929615738 207
122 iso_pu_bacteria 2929624759 2929630352 207
123 iso_pu_bacteria 2932784394 2932791996 207
124 iso_pu_bacteria 2932801729 2932804404 207
125 iso_pu_bacteria 2932809354 2932814137 207
126 iso_pu_bacteria 2932818245 2932819375 207
127 iso_pu_bacteria 2932828146 2932833914 207
128 iso_pu_bacteria 2935608549 2935611560 207
129 iso_pu_bacteria 2935616580 2935624213 207
130 iso_pu_bacteria 2935638405 2935644603 207
131 iso_pu_bacteria 2935648319 2935648933 207
132 iso_pu_bacteria 2935656913 2935656985 207
133 iso_pu_bacteria 2935665750 2935673506 207
134 iso_pu_bacteria 2935675223 2935678393 207
135 iso_pu_bacteria 2935684952 2935688178 207
136 iso_pu_bacteria 2935694250 2935698844 207
137 iso_pu_bacteria 2935703347 2935708458 207
138 iso_pu_bacteria 2935713505 2935715197 207
139 iso_pu_bacteria 2935722832 2935726238 207
140 iso_pu_bacteria 2935732158 2935734016 207
141 iso_pu_bacteria 2935741537 2935743395 207
142 iso_pu_bacteria 2935750917 2935754567 207
143 iso_pu_bacteria 2935760218 2935765346 207
144 iso_pu_bacteria 2935769743 2935777010 207
145 iso_pu_bacteria 2935777560 2935785249 207
146 iso_pu_bacteria 2935785616 2935790383 207
147 iso_pu_bacteria 2935793552 2935798966 207
148 iso_pu_bacteria 2935801545 2935805297 207
149 iso_pu_bacteria 2935810662 2935816595 207
150 iso_pu_bacteria 2935819856 2935821037 207
151 iso_pu_bacteria 2935827899 2935833648 207
152 iso_pu_bacteria 2935837841 2935839666 207
153 iso_pu_bacteria 2935847175 2935850703 207
154 iso_pu_bacteria 2935855204 2935862753 207
155 iso_pu_bacteria 2935864058 2935871251 207
156 iso_pu_bacteria 2935873716 2935876244 207
157 iso_pu_bacteria 2935883170 2935888815 207
158 iso_pu_bacteria 2935908558 2935913928 207
159 iso_pu_bacteria 2935916978 2935920082 207
160 iso_pu_bacteria 2935926038 2935930421 207
161 iso_pu_bacteria 2935934488 2935939606 207
162 iso_pu_bacteria 2935942939 2935946555 207
163 iso_pu_bacteria 2935951376 2935955606 207
164 iso_pu_bacteria 2935959822 2935964532 207
165 iso_pu_bacteria 2935967501 2935972684 207
166 iso_pu_bacteria 2935975950 2935981494 207
167 iso_pu_bacteria 2935984226 2935989114 207
168 iso_pu_bacteria 2935992306 2936001582 207
169 iso_pu_bacteria 2936002035 2936007304 207
170 iso_pu_bacteria 2936011229 2936011843 207
171 iso_pu_bacteria 2936019824 2936020438 207
172 iso_pu_bacteria 2936028420 2936029132 207
173 iso_pu_bacteria 2936037263 2936043143 207
174 iso_pu_bacteria 2936046547 2936047161 207
175 iso_pu_bacteria 2936055302 2936061389 207
176 iso_pu_bacteria 2940556831 2940560056 207
177 iso_pu_bacteria 2941531003 2941533935 207
178 iso_pu_bacteria 2941538514 2941540355 207
179 iso_pu_bacteria 3005483717 3005490022 207
180 iso_pu_bacteria 3005506211 3005511677 207
181 iso_pu_bacteria 3005587118 3005590287 207
182 iso_pu_bacteria 3005594810 3005598236 207
183 iso_pu_bacteria 8006926726 8006932670 207
184 iso_pu_bacteria 8006964411 8006968960 207
185 iso_pu_bacteria 8016511872 8016514515 207
186 iso_pu_bacteria 8016583857 8016591520 207
187 iso_pu_bacteria 8016603502 8016611740 207
188 iso_pu_bacteria 8016613128 8016622062 207
189 iso_pu_bacteria 8016630954 8016632102 207
190 iso_pu_bacteria 8017057580 8017061911 207
191 iso_pu_bacteria 8019538911 8019543875 207
192 iso_pu_bacteria 8019586578 8019589074 207
193 iso_pu_bacteria 8019597564 8019602159 207
194 iso_pu_bacteria 8019608314 8019616400 207
195 iso_pu_bacteria 8019619141 8019627075 207
196 iso_pu_bacteria 8019629233 8019635473 207
197 iso_pu_bacteria 8019648815 8019657287 207
198 iso_pu_bacteria 8019668869 8019672900 207
199 iso_pu_bacteria 8019678201 8019683243 207
200 iso_pu_bacteria 8019687851 8019688950 207
201 iso_pu_bacteria 8056681323 8056684054 207
202 iso_pu_bacteria 8056967851 8056972542 207
203 3300005336 Ga0070680_100524730 Ga0070680_1005247302 208
204 3300005467 Ga0070706_100097360 Ga0070706_1000973603 208
205 3300005546 Ga0070696_100461411 Ga0070696_1004614111 208
206 3300006237 Ga0097621_100061776 Ga0097621_1000617762 208
207 3300006358 Ga0068871_100051768 Ga0068871_1000517683 208
208 3300006846 Ga0075430_100674765 Ga0075430_1006747652 208
209 3300006847 Ga0075431_100747870 Ga0075431_1007478702 208
210 3300006852 Ga0075433_10065291 Ga0075433_100652913 208
211 3300006871 Ga0075434_100227727 Ga0075434_1002277273 208
212 3300013104 Ga0157370_10031400 Ga0157370_100314003 208
213 3300025910 Ga0207684_10090601 Ga0207684_100906012 208
214 3300025913 Ga0207695_10367685 Ga0207695_103676852 208
215 3300025922 Ga0207646_10062772 Ga0207646_100627722 208
216 3300028381 Ga0268264_10740980 Ga0268264_107409801 208
217 3300039437 Ga0436365_1756237 Ga0436365_1756237_2076_2729 208
218 3300050512 nmdc:mga0n895_255303_c1 nmdc:mga0n895_255303_c1_1011_1664 208
219 3300050515 nmdc:mga0a205_21992_c1 nmdc:mga0a205_21992_c1_849_1502 208
220 iso_pu_bacteria 2791355199 2793078187 208
221 iso_pu_bacteria 2849076700 2849080227 208
222 iso_pu_bacteria 2874604998 2874607790 208
223 iso_pu_bacteria 2876808645 2876818136 208
224 iso_pu_bacteria 2879110137 2879110796 208
225 iso_pu_bacteria 2889033259 2889037383 208
226 iso_pu_bacteria 8006984368 8006985156 208
227 iso_pu_bacteria 8056673599 8056675993 208
228 3300003203 JGI25406J46586_10001420 JGI25406J46586_1000142012 209
229 3300005327 Ga0070658_10037739 Ga0070658_100377392 209
230 3300005327 Ga0070658_10676070 Ga0070658_106760702 209
231 3300005338 Ga0068868_100382848 Ga0068868_1003828481 209
232 3300005435 Ga0070714_101160800 Ga0070714_1011608001 209
233 3300005466 Ga0070685_10028473 Ga0070685_100284732 209
234 3300005985 Ga0081539_10000199 Ga0081539_100001994 209
235 3300006051 Ga0075364_10175971 Ga0075364_101759712 209
236 3300006177 Ga0075362_10151954 Ga0075362_101519541 209
237 3300006844 Ga0075428_100016072 Ga0075428_1000160723 209
238 3300006846 Ga0075430_100106259 Ga0075430_1001062592 209
239 3300009093 Ga0105240_10016654 Ga0105240_1001665413 209
240 3300009098 Ga0105245_10293884 Ga0105245_102938842 209
241 3300009176 Ga0105242_11377082 Ga0105242_113770821 209
242 3300014969 Ga0157376_10127559 Ga0157376_101275592 209
243 3300025909 Ga0207705_10163160 Ga0207705_101631602 209
244 3300025909 Ga0207705_10363213 Ga0207705_103632131 209
245 3300025913 Ga0207695_10229168 Ga0207695_102291682 209
246 3300025921 Ga0207652_10740390 Ga0207652_107403901 209
247 3300025949 Ga0207667_10181197 Ga0207667_101811972 209
248 3300028379 Ga0268266_10358628 Ga0268266_103586282 209
249 3300031852 Ga0307410_10548327 Ga0307410_105483271 209
250 3300032002 Ga0307416_100148392 Ga0307416_1001483922 209
251 3300032002 Ga0307416_100985886 Ga0307416_1009858862 209
252 3300035724 Ga0373933_0207031 Ga0373933_0207031_483_1157 209
253 3300037418 Ga0395900_0084721 Ga0395900_0084721_119_808 209
254 3300037471 Ga0395905_0028345 Ga0395905_0028345_1272_1961 209
255 3300038443 Ga0395901_0190948 Ga0395901_0190948_410_1099 209
256 3300050489 nmdc:mga03683_297427_c1 nmdc:mga03683_297427_c1_59_730 209
257 3300050491 nmdc:mga00v17_179927_c1 nmdc:mga00v17_179927_c1_94_753 209
258 3300050509 nmdc:mga0qj67_63538_c1 nmdc:mga0qj67_63538_c1_1156_1812 209
259 3300050510 nmdc:mga06r32_17887_c1 nmdc:mga06r32_17887_c1_1260_1916 209
260 3300053096 Ga0500641_0139298 Ga0500641_0139298_15_674 209
261 3300005331 Ga0070670_100243984 Ga0070670_1002439842 210
262 3300005354 Ga0070675_100143838 Ga0070675_1001438383 210
263 3300005548 Ga0070665_100522321 Ga0070665_1005223211 210
264 3300005617 Ga0068859_100474172 Ga0068859_1004741722 210
265 3300005937 Ga0081455_10033478 Ga0081455_100334782 210
266 3300005983 Ga0081540_1016563 Ga0081540_10165632 210
267 3300006038 Ga0075365_10146950 Ga0075365_101469503 210
268 3300006931 Ga0097620_100474217 Ga0097620_1004742172 210
269 3300009093 Ga0105240_10033152 Ga0105240_100331525 210
270 3300009093 Ga0105240_11020604 Ga0105240_110206041 210
271 3300009147 Ga0114129_10068162 Ga0114129_100681627 210
272 3300011119 Ga0105246_10581249 Ga0105246_105812491 210
273 3300013104 Ga0157370_10430444 Ga0157370_104304442 210
274 3300013105 Ga0157369_10007473 Ga0157369_100074735 210
275 3300013105 Ga0157369_10007917 Ga0157369_1000791713 210
276 3300013307 Ga0157372_10092414 Ga0157372_100924145 210
277 3300014745 Ga0157377_10130905 Ga0157377_101309052 210
278 3300025302 Ga0207426_1008616 Ga0207426_10086163 210
279 3300025913 Ga0207695_10570324 Ga0207695_105703242 210
280 3300025926 Ga0207659_10076907 Ga0207659_100769073 210
281 3300026121 Ga0207683_10045593 Ga0207683_100455933 210
282 3300026121 Ga0207683_10122247 Ga0207683_101222474 210
283 3300031730 Ga0307516_10176600 Ga0307516_101766002 210
284 3300033179 Ga0307507_10101429 Ga0307507_101014292 210
285 3300035695 Ga0373927_0027565 Ga0373927_0027565_1732_2391 210
286 3300038443 Ga0395901_0084872 Ga0395901_0084872_2239_2910 210
287 3300046557 Ga0495622_0186379 Ga0495622_0186379_38_697 210
288 3300048909 Ga0496106_0000790 Ga0496106_0000790_16055_16714 210
289 3300048920 Ga0496117_0068751 Ga0496117_0068751_1642_2301 210
290 3300048924 Ga0496121_0003198 Ga0496121_0003198_6241_6900 210
291 3300048927 Ga0496124_0002423 Ga0496124_0002423_6152_6811 210
292 3300048928 Ga0496125_0014815 Ga0496125_0014815_5245_5904 210
293 3300048929 Ga0496126_0018165 Ga0496126_0018165_3136_3795 210
294 3300048929 Ga0496126_0197606 Ga0496126_0197606_595_1230 210
295 3300049583 Ga0501067_0040139 Ga0501067_0040139_566_1210 210
296 3300050492 nmdc:mga0yw44_333422_c1 nmdc:mga0yw44_333422_c1_282_947 210
297 3300050507 nmdc:mga05p37_222833_c1 nmdc:mga05p37_222833_c1_1365_2096 210
298 3300053094 Ga0500566_0062550 Ga0500566_0062550_40_699 210
299 3300053119 Ga0500595_062096 Ga0500595_062096_11_670 210
300 3300053140 Ga0500573_0138523 Ga0500573_0138523_478_1146 210
301 3300053163 Ga0500639_029815 Ga0500639_029815_499_1158 210
302 3300053177 Ga0500636_0048980 Ga0500636_0048980_542_1210 210
303 iso_pu_bacteria 2524023228 2524534591 210
304 iso_pu_bacteria 2885374607 2885379776 210
305 iso_pu_bacteria 2903748898 2903753627 210
306 iso_pu_bacteria 2904690495 2904697814 210
307 iso_pu_bacteria 2908756301 2908762812 210
308 3300003215 JGI25153J46596_10000476 JGI25153J46596_1000047620 211
309 3300003215 JGI25153J46596_10001154 JGI25153J46596_1000115410 211
310 3300003215 JGI25153J46596_10003343 JGI25153J46596_100033432 211
311 3300003215 JGI25153J46596_10011871 JGI25153J46596_100118714 211
312 3300003320 rootH2_10017704 rootH2_100177041 211
313 3300003354 JGI25160J50197_1000874 JGI25160J50197_100087410 211
314 3300003354 JGI25160J50197_1002069 JGI25160J50197_10020694 211
315 3300003354 JGI25160J50197_1047014 JGI25160J50197_10470141 211
316 3300003771 Ga0055526_1018859 Ga0055526_10188594 211
317 3300003775 Ga0055524_1054952 Ga0055524_10549521 211
318 3300003794 Ga0055531_10004147 Ga0055531_100041475 211
319 3300004625 Ga0055543_1026444 Ga0055543_10264442 211
320 3300004625 Ga0055543_1039447 Ga0055543_10394471 211
321 3300005262 Ga0065165_1001382 Ga0065165_100138216 211
322 3300005262 Ga0065165_1005174 Ga0065165_10051743 211
323 3300005262 Ga0065165_1007497 Ga0065165_10074972 211
324 3300005327 Ga0070658_10068536 Ga0070658_100685362 211
325 3300005328 Ga0070676_10187764 Ga0070676_101877641 211
326 3300005329 Ga0070683_100003848 Ga0070683_1000038483 211
327 3300005335 Ga0070666_10056060 Ga0070666_100560602 211
328 3300005336 Ga0070680_100013845 Ga0070680_1000138454 211
329 3300005336 Ga0070680_100018157 Ga0070680_1000181577 211
330 3300005337 Ga0070682_100095905 Ga0070682_1000959053 211
331 3300005338 Ga0068868_100174197 Ga0068868_1001741972 211
332 3300005347 Ga0070668_100254287 Ga0070668_1002542872 211
333 3300005353 Ga0070669_100412469 Ga0070669_1004124691 211
334 3300005355 Ga0070671_100006368 Ga0070671_1000063683 211
335 3300005366 Ga0070659_100239995 Ga0070659_1002399952 211
336 3300005366 Ga0070659_100647809 Ga0070659_1006478091 211
337 3300005367 Ga0070667_100541259 Ga0070667_1005412592 211
338 3300005434 Ga0070709_10035930 Ga0070709_100359303 211
339 3300005434 Ga0070709_10193898 Ga0070709_101938982 211
340 3300005434 Ga0070709_10393134 Ga0070709_103931341 211
341 3300005436 Ga0070713_100450371 Ga0070713_1004503712 211
342 3300005437 Ga0070710_10472116 Ga0070710_104721161 211
343 3300005439 Ga0070711_100071519 Ga0070711_1000715192 211
344 3300005440 Ga0070705_100069562 Ga0070705_1000695622 211
345 3300005445 Ga0070708_100015641 Ga0070708_1000156413 211
346 3300005445 Ga0070708_100137566 Ga0070708_1001375663 211
347 3300005455 Ga0070663_100059790 Ga0070663_1000597903 211
348 3300005457 Ga0070662_100651254 Ga0070662_1006512541 211
349 3300005458 Ga0070681_10051259 Ga0070681_100512595 211
350 3300005458 Ga0070681_10132380 Ga0070681_101323804 211
351 3300005458 Ga0070681_10429181 Ga0070681_104291811 211
352 3300005466 Ga0070685_10223924 Ga0070685_102239241 211
353 3300005467 Ga0070706_100011186 Ga0070706_1000111867 211
354 3300005468 Ga0070707_100179371 Ga0070707_1001793712 211
355 3300005471 Ga0070698_100090792 Ga0070698_1000907925 211
356 3300005471 Ga0070698_100228557 Ga0070698_1002285572 211
357 3300005518 Ga0070699_100098649 Ga0070699_1000986493 211
358 3300005530 Ga0070679_100008868 Ga0070679_1000088686 211
359 3300005535 Ga0070684_100011240 Ga0070684_1000112408 211
360 3300005539 Ga0068853_100149354 Ga0068853_1001493542 211
361 3300005539 Ga0068853_100444314 Ga0068853_1004443141 211
362 3300005548 Ga0070665_100048108 Ga0070665_1000481084 211
363 3300005548 Ga0070665_100143997 Ga0070665_1001439973 211
364 3300005548 Ga0070665_100308663 Ga0070665_1003086632 211
365 3300005563 Ga0068855_100037453 Ga0068855_1000374535 211
366 3300005563 Ga0068855_100214780 Ga0068855_1002147802 211
367 3300005563 Ga0068855_101102957 Ga0068855_1011029571 211
368 3300005577 Ga0068857_100173468 Ga0068857_1001734683 211
369 3300005577 Ga0068857_100215252 Ga0068857_1002152522 211
370 3300005614 Ga0068856_100173953 Ga0068856_1001739534 211
371 3300005614 Ga0068856_100187899 Ga0068856_1001878993 211
372 3300005616 Ga0068852_100099808 Ga0068852_1000998082 211
373 3300005616 Ga0068852_100740399 Ga0068852_1007403991 211
374 3300005617 Ga0068859_100292377 Ga0068859_1002923772 211
375 3300005719 Ga0068861_100667086 Ga0068861_1006670861 211
376 3300005842 Ga0068858_100325974 Ga0068858_1003259742 211
377 3300005843 Ga0068860_100426867 Ga0068860_1004268672 211
378 3300005844 Ga0068862_100183997 Ga0068862_1001839974 211
379 3300005844 Ga0068862_100900856 Ga0068862_1009008561 211
380 3300005983 Ga0081540_1017555 Ga0081540_10175557 211
381 3300005983 Ga0081540_1031580 Ga0081540_10315802 211
382 3300006028 Ga0070717_10406377 Ga0070717_104063772 211
383 3300006038 Ga0075365_10057257 Ga0075365_100572573 211
384 3300006038 Ga0075365_10139884 Ga0075365_101398842 211
385 3300006042 Ga0075368_10038514 Ga0075368_100385142 211
386 3300006048 Ga0075363_100011602 Ga0075363_1000116024 211
387 3300006048 Ga0075363_100072184 Ga0075363_1000721842 211
388 3300006051 Ga0075364_10034925 Ga0075364_100349252 211
389 3300006051 Ga0075364_10201057 Ga0075364_102010572 211
390 3300006051 Ga0075364_10495069 Ga0075364_104950692 211
391 3300006175 Ga0070712_100255780 Ga0070712_1002557801 211
392 3300006177 Ga0075362_10117977 Ga0075362_101179771 211
393 3300006178 Ga0075367_10042081 Ga0075367_100420813 211
394 3300006178 Ga0075367_10509307 Ga0075367_105093071 211
395 3300006186 Ga0075369_10076970 Ga0075369_100769702 211
396 3300006186 Ga0075369_10091087 Ga0075369_100910872 211
397 3300006195 Ga0075366_10010538 Ga0075366_100105388 211
398 3300006353 Ga0075370_10034975 Ga0075370_100349753 211
399 3300006353 Ga0075370_10126665 Ga0075370_101266652 211
400 3300006353 Ga0075370_10246371 Ga0075370_102463712 211
401 3300006931 Ga0097620_100292378 Ga0097620_1002923783 211
402 3300006941 Ga0099825_1023676 Ga0099825_10236763 211
403 3300006942 Ga0099824_1009133 Ga0099824_10091334 211
404 3300006943 Ga0099822_1041193 Ga0099822_10411933 211
405 3300007788 Ga0099795_10028710 Ga0099795_100287103 211
406 3300009093 Ga0105240_10182042 Ga0105240_101820421 211
407 3300009093 Ga0105240_10194966 Ga0105240_101949662 211
408 3300009093 Ga0105240_10415158 Ga0105240_104151582 211
409 3300009098 Ga0105245_10455014 Ga0105245_104550143 211
410 3300009101 Ga0105247_10032849 Ga0105247_100328497 211
411 3300009147 Ga0114129_10362293 Ga0114129_103622933 211
412 3300009148 Ga0105243_10602031 Ga0105243_106020312 211
413 3300009174 Ga0105241_10223481 Ga0105241_102234813 211
414 3300009177 Ga0105248_10037450 Ga0105248_100374502 211
415 3300009177 Ga0105248_10476762 Ga0105248_104767622 211
416 3300009545 Ga0105237_10418915 Ga0105237_104189151 211
417 3300009545 Ga0105237_10467682 Ga0105237_104676821 211
418 3300009545 Ga0105237_10610184 Ga0105237_106101841 211
419 3300009551 Ga0105238_10029381 Ga0105238_100293813 211
420 3300009551 Ga0105238_10131091 Ga0105238_101310914 211
421 3300009551 Ga0105238_10228161 Ga0105238_102281612 211
422 3300009551 Ga0105238_10359464 Ga0105238_103594642 211
423 3300010375 Ga0105239_10047131 Ga0105239_100471316 211
424 3300010375 Ga0105239_10085044 Ga0105239_100850445 211
425 3300010375 Ga0105239_10200628 Ga0105239_102006282 211
426 3300010375 Ga0105239_10359743 Ga0105239_103597434 211
427 3300010375 Ga0105239_11596544 Ga0105239_115965441 211
428 3300011119 Ga0105246_10138536 Ga0105246_101385361 211
429 3300013105 Ga0157369_10122107 Ga0157369_101221074 211
430 3300013105 Ga0157369_10211938 Ga0157369_102119383 211
431 3300013105 Ga0157369_10631350 Ga0157369_106313501 211
432 3300013296 Ga0157374_10341546 Ga0157374_103415462 211
433 3300013296 Ga0157374_10489587 Ga0157374_104895872 211
434 3300013306 Ga0163162_10202167 Ga0163162_102021674 211
435 3300013307 Ga0157372_11178271 Ga0157372_111782711 211
436 3300013308 Ga0157375_10101448 Ga0157375_101014482 211
437 3300014325 Ga0163163_10058631 Ga0163163_100586315 211
438 3300014325 Ga0163163_10504256 Ga0163163_105042562 211
439 3300014745 Ga0157377_10469523 Ga0157377_104695232 211
440 3300014968 Ga0157379_10567827 Ga0157379_105678272 211
441 3300017792 Ga0163161_10288154 Ga0163161_102881542 211
442 3300021320 Ga0214544_1003958 Ga0214544_100395822 211
443 3300021321 Ga0214542_1000002 Ga0214542_1000002433 211
444 3300021324 Ga0214545_1000002 Ga0214545_1000002287 211
445 3300021327 Ga0214543_1000013 Ga0214543_100001335 211
446 3300025245 Ga0207425_1008878 Ga0207425_10088783 211
447 3300025254 Ga0209148_1000493 Ga0209148_10004934 211
448 3300025261 Ga0209233_1020253 Ga0209233_10202532 211
449 3300025272 Ga0209455_1004278 Ga0209455_10042784 211
450 3300025295 Ga0209564_1005921 Ga0209564_10059214 211
451 3300025295 Ga0209564_1007197 Ga0209564_10071973 211
452 3300025297 Ga0209758_1000100 Ga0209758_1000100194 211
453 3300025297 Ga0209758_1000138 Ga0209758_1000138158 211
454 3300025297 Ga0209758_1001321 Ga0209758_10013215 211
455 3300025297 Ga0209758_1012135 Ga0209758_10121352 211
456 3300025297 Ga0209758_1117037 Ga0209758_11170371 211
457 3300025299 Ga0209256_1003445 Ga0209256_10034459 211
458 3300025302 Ga0207426_1000382 Ga0207426_100038210 211
459 3300025302 Ga0207426_1001031 Ga0207426_100103116 211
460 3300025304 Ga0209257_1001637 Ga0209257_100163725 211
461 3300025304 Ga0209257_1009407 Ga0209257_10094076 211
462 3300025321 Ga0207656_10366467 Ga0207656_103664671 211
463 3300025901 Ga0207688_10074810 Ga0207688_100748102 211
464 3300025903 Ga0207680_10128093 Ga0207680_101280933 211
465 3300025904 Ga0207647_10001578 Ga0207647_1000157813 211
466 3300025905 Ga0207685_10175985 Ga0207685_101759852 211
467 3300025906 Ga0207699_10032852 Ga0207699_100328524 211
468 3300025906 Ga0207699_10134629 Ga0207699_101346293 211
469 3300025910 Ga0207684_10083165 Ga0207684_100831652 211
470 3300025912 Ga0207707_10003484 Ga0207707_1000348412 211
471 3300025912 Ga0207707_10012153 Ga0207707_100121533 211
472 3300025912 Ga0207707_10094903 Ga0207707_100949034 211
473 3300025912 Ga0207707_10109988 Ga0207707_101099883 211
474 3300025913 Ga0207695_10239287 Ga0207695_102392872 211
475 3300025913 Ga0207695_10440173 Ga0207695_104401731 211
476 3300025914 Ga0207671_10190361 Ga0207671_101903612 211
477 3300025914 Ga0207671_10295728 Ga0207671_102957282 211
478 3300025915 Ga0207693_10666123 Ga0207693_106661231 211
479 3300025917 Ga0207660_10028263 Ga0207660_100282634 211
480 3300025917 Ga0207660_10081504 Ga0207660_100815044 211
481 3300025917 Ga0207660_10187752 Ga0207660_101877522 211
482 3300025921 Ga0207652_10020700 Ga0207652_100207007 211
483 3300025921 Ga0207652_10036127 Ga0207652_100361274 211
484 3300025922 Ga0207646_10137134 Ga0207646_101371343 211
485 3300025923 Ga0207681_10077137 Ga0207681_100771371 211
486 3300025923 Ga0207681_10495887 Ga0207681_104958872 211
487 3300025924 Ga0207694_10285487 Ga0207694_102854871 211
488 3300025928 Ga0207700_10662882 Ga0207700_106628821 211
489 3300025931 Ga0207644_10193955 Ga0207644_101939554 211
490 3300025932 Ga0207690_10205609 Ga0207690_102056093 211
491 3300025933 Ga0207706_10205979 Ga0207706_102059794 211
492 3300025933 Ga0207706_10552565 Ga0207706_105525652 211
493 3300025935 Ga0207709_10341498 Ga0207709_103414982 211
494 3300025942 Ga0207689_10204505 Ga0207689_102045053 211
495 3300025944 Ga0207661_10010365 Ga0207661_100103659 211
496 3300025944 Ga0207661_10032194 Ga0207661_100321943 211
497 3300025949 Ga0207667_10051148 Ga0207667_100511487 211
498 3300025960 Ga0207651_10357531 Ga0207651_103575312 211
499 3300025961 Ga0207712_10745625 Ga0207712_107456252 211
500 3300025986 Ga0207658_10086843 Ga0207658_100868433 211
501 3300025986 Ga0207658_10458696 Ga0207658_104586962 211
502 3300026035 Ga0207703_10298759 Ga0207703_102987592 211
503 3300026041 Ga0207639_10259738 Ga0207639_102597383 211
504 3300026041 Ga0207639_10408506 Ga0207639_104085062 211
505 3300026067 Ga0207678_10010764 Ga0207678_100107642 211
506 3300026067 Ga0207678_10204311 Ga0207678_102043111 211
507 3300026067 Ga0207678_10324284 Ga0207678_103242842 211
508 3300026078 Ga0207702_10529800 Ga0207702_105298001 211
509 3300026078 Ga0207702_10561540 Ga0207702_105615401 211
510 3300026089 Ga0207648_10040396 Ga0207648_100403963 211
511 3300026116 Ga0207674_10158192 Ga0207674_101581923 211
512 3300026116 Ga0207674_10306321 Ga0207674_103063212 211
513 3300026118 Ga0207675_100175842 Ga0207675_1001758423 211
514 3300026118 Ga0207675_100823015 Ga0207675_1008230152 211
515 3300026121 Ga0207683_10599312 Ga0207683_105993122 211
516 3300026142 Ga0207698_10127349 Ga0207698_101273494 211
517 3300027296 Ga0209389_1000068 Ga0209389_10000688 211
518 3300027296 Ga0209389_1000092 Ga0209389_100009226 211
519 3300027357 Ga0209589_1000115 Ga0209589_100011526 211
520 3300027361 Ga0209489_100340 Ga0209489_10034026 211
521 3300027361 Ga0209489_115015 Ga0209489_1150157 211
522 3300027363 Ga0209700_100117 Ga0209700_10011795 211
523 3300028379 Ga0268266_10014260 Ga0268266_100142609 211
524 3300028379 Ga0268266_10051241 Ga0268266_100512415 211
525 3300028379 Ga0268266_10093149 Ga0268266_100931496 211
526 3300028379 Ga0268266_10170101 Ga0268266_101701013 211
527 3300028380 Ga0268265_10190437 Ga0268265_101904372 211
528 3300028381 Ga0268264_10455651 Ga0268264_104556511 211
529 3300028786 Ga0307517_10336441 Ga0307517_103364411 211
530 3300031250 Ga0265331_10010876 Ga0265331_100108766 211
531 3300031616 Ga0307508_10182003 Ga0307508_101820032 211
532 3300031711 Ga0265314_10071422 Ga0265314_100714222 211
533 3300031712 Ga0265342_10014276 Ga0265342_100142766 211
534 3300031730 Ga0307516_10292762 Ga0307516_102927622 211
535 3300031824 Ga0307413_10058019 Ga0307413_100580192 211
536 3300031852 Ga0307410_10512020 Ga0307410_105120202 211
537 3300031995 Ga0307409_100122862 Ga0307409_1001228623 211
538 3300032002 Ga0307416_100480374 Ga0307416_1004803742 211
539 3300032005 Ga0307411_10052156 Ga0307411_100521563 211
540 3300032005 Ga0307411_10143569 Ga0307411_101435692 211
541 3300032126 Ga0307415_100129334 Ga0307415_1001293341 211
542 3300033180 Ga0307510_10005071 Ga0307510_1000507116 211
543 3300033180 Ga0307510_10054066 Ga0307510_100540662 211
544 3300035083 Ga0373926_0023353 Ga0373926_0023353_414_1097 211
545 3300035111 Ga0373923_0001429 Ga0373923_0001429_4094_4777 211
546 3300035113 Ga0373936_0060757 Ga0373936_0060757_763_1446 211
547 3300035113 Ga0373936_0082108 Ga0373936_0082108_292_927 211
548 3300035114 Ga0373939_0020406 Ga0373939_0020406_1084_1719 211
549 3300035116 Ga0373945_0105482 Ga0373945_0105482_414_1097 211
550 3300035118 Ga0373954_0152795 Ga0373954_0152795_111_794 211
551 3300035170 Ga0373943_0177216 Ga0373943_0177216_85_768 211
552 3300035172 Ga0373955_0188902 Ga0373955_0188902_204_887 211
553 3300035410 Ga0373924_0027585 Ga0373924_0027585_1130_1813 211
554 3300035691 Ga0373931_0274562 Ga0373931_0274562_173_808 211
555 3300035692 Ga0373935_0028891 Ga0373935_0028891_269_952 211
556 3300035695 Ga0373927_0037839 Ga0373927_0037839_1345_2028 211
557 3300035725 Ga0373947_0034898 Ga0373947_0034898_12_695 211
558 3300037068 Ga0373925_0130287 Ga0373925_0130287_100_783 211
559 3300037418 Ga0395900_0000601 Ga0395900_0000601_6238_6885 211
560 3300037418 Ga0395900_0156434 Ga0395900_0156434_1181_1828 211
561 3300037418 Ga0395900_0384968 Ga0395900_0384968_459_1097 211
562 3300037466 Ga0395898_0064519 Ga0395898_0064519_738_1385 211
563 3300037466 Ga0395898_0557017 Ga0395898_0557017_155_793 211
564 3300037471 Ga0395905_0004099 Ga0395905_0004099_11627_12265 211
565 3300037471 Ga0395905_0179438 Ga0395905_0179438_246_893 211
566 3300037471 Ga0395905_0881125 Ga0395905_0881125_74_712 211
567 3300037853 Ga0436364_1345727 Ga0436364_1345727_3635_4330 211
568 3300038443 Ga0395901_0114991 Ga0395901_0114991_254_892 211
569 3300038443 Ga0395901_0383903 Ga0395901_0383903_72_719 211
570 3300039447 Ga0436361_0701096 Ga0436361_0701096_427_1071 211
571 3300039447 Ga0436361_0877460 Ga0436361_0877460_352_996 211
572 3300039453 Ga0436362_0238672 Ga0436362_0238672_2364_3008 211
573 3300041443 Ga0451789_0042347 Ga0451789_0042347_976_1614 211
574 3300041459 Ga0451800_1635921 Ga0451800_1635921_302_937 211
575 3300041460 Ga0451802_0462708 Ga0451802_0462708_195_833 211
576 3300041463 Ga0451804_1129176 Ga0451804_1129176_225_863 211
577 3300041491 Ga0451833_1355453 Ga0451833_1355453_105_743 211
578 3300044656 Ga0466969_0100021 Ga0466969_0100021_359_1003 211
579 3300044658 Ga0466972_0072759 Ga0466972_0072759_898_1536 211
580 3300044658 Ga0466972_0258293 Ga0466972_0258293_41_679 211
581 3300044694 Ga0466963_0037866 Ga0466963_0037866_532_1170 211
582 3300044706 Ga0466964_0019616 Ga0466964_0019616_1804_2442 211
583 3300044901 Ga0466960_0013843 Ga0466960_0013843_1345_1983 211
584 3300044901 Ga0466960_0057079 Ga0466960_0057079_1073_1711 211
585 3300044901 Ga0466960_0068260 Ga0466960_0068260_140_787 211
586 3300045049 Ga0466959_0187516 Ga0466959_0187516_582_1286 211
587 3300045976 Ga0466967_0122378 Ga0466967_0122378_927_1574 211
588 3300045976 Ga0466967_0142386 Ga0466967_0142386_671_1309 211
589 3300046454 Ga0495592_0161656 Ga0495592_0161656_215_886 211
590 3300046457 Ga0495590_0021555 Ga0495590_0021555_1002_1643 211
591 3300046457 Ga0495590_0062124 Ga0495590_0062124_62_700 211
592 3300046459 Ga0495629_0139772 Ga0495629_0139772_901_1539 211
593 3300046459 Ga0495629_0159644 Ga0495629_0159644_574_1209 211
594 3300046460 Ga0495638_0005428 Ga0495638_0005428_184_822 211
595 3300046462 Ga0495651_0005518 Ga0495651_0005518_1473_2111 211
596 3300046462 Ga0495651_0007953 Ga0495651_0007953_611_1249 211
597 3300046462 Ga0495651_0272547 Ga0495651_0272547_379_1014 211
598 3300046463 Ga0495653_0223986 Ga0495653_0223986_348_986 211
599 3300046472 Ga0495580_0009497 Ga0495580_0009497_979_1662 211
600 3300046475 Ga0495639_0004008 Ga0495639_0004008_5225_5908 211
601 3300046476 Ga0495662_0172930 Ga0495662_0172930_90_773 211
602 3300046477 Ga0495664_0034909 Ga0495664_0034909_1685_2368 211
603 3300046500 Ga0495596_0082976 Ga0495596_0082976_407_1042 211
604 3300046501 Ga0495607_0102964 Ga0495607_0102964_766_1404 211
605 3300046511 Ga0495608_0021931 Ga0495608_0021931_3695_4333 211
606 3300046511 Ga0495608_0133019 Ga0495608_0133019_75_719 211
607 3300046511 Ga0495608_0230027 Ga0495608_0230027_16_651 211
608 3300046512 Ga0495610_0085036 Ga0495610_0085036_598_1236 211
609 3300046513 Ga0495616_0108748 Ga0495616_0108748_142_780 211
610 3300046514 Ga0495618_0022327 Ga0495618_0022327_1605_2288 211
611 3300046515 Ga0495620_0111337 Ga0495620_0111337_50_688 211
612 3300046516 Ga0495628_0136755 Ga0495628_0136755_1029_1667 211
613 3300046517 Ga0495630_0045229 Ga0495630_0045229_88_771 211
614 3300046524 Ga0495648_0040345 Ga0495648_0040345_226_864 211
615 3300046524 Ga0495648_0063509 Ga0495648_0063509_954_1778 211
616 3300046524 Ga0495648_0227933 Ga0495648_0227933_133_771 211
617 3300046529 Ga0495652_0026970 Ga0495652_0026970_2141_2779 211
618 3300046529 Ga0495652_0170107 Ga0495652_0170107_648_1283 211
619 3300046536 Ga0495587_0081675 Ga0495587_0081675_146_784 211
620 3300046538 Ga0495609_0099182 Ga0495609_0099182_132_770 211
621 3300046557 Ga0495622_0278931 Ga0495622_0278931_58_696 211
622 3300046615 Ga0495656_0017547 Ga0495656_0017547_246_881 211
623 3300046616 Ga0495668_0051517 Ga0495668_0051517_832_1470 211
624 3300046616 Ga0495668_0475565 Ga0495668_0475565_29_664 211
625 3300046642 Ga0495634_0013865 Ga0495634_0013865_2529_3212 211
626 3300046642 Ga0495634_0033410 Ga0495634_0033410_1639_2277 211
627 3300046642 Ga0495634_0281391 Ga0495634_0281391_348_986 211
628 3300046648 Ga0495611_0243672 Ga0495611_0243672_111_749 211
629 3300046660 Ga0495625_0286077 Ga0495625_0286077_207_845 211
630 3300046663 Ga0495635_0043662 Ga0495635_0043662_586_1224 211
631 3300046663 Ga0495635_0049995 Ga0495635_0049995_1395_2078 211
632 3300046675 Ga0495657_0002722 Ga0495657_0002722_8499_9137 211
633 3300046679 Ga0495623_0002730 Ga0495623_0002730_9006_9644 211
634 3300046679 Ga0495623_0287225 Ga0495623_0287225_56_694 211
635 3300046680 Ga0495646_0088531 Ga0495646_0088531_976_1659 211
636 3300046680 Ga0495646_0089695 Ga0495646_0089695_102_740 211
637 3300046681 Ga0495647_0233363 Ga0495647_0233363_62_745 211
638 3300046684 Ga0495669_0084639 Ga0495669_0084639_583_1221 211
639 3300046690 Ga0495624_0158055 Ga0495624_0158055_257_940 211
640 3300046690 Ga0495624_0162127 Ga0495624_0162127_341_976 211
641 3300046794 Ga0495589_0221780 Ga0495589_0221780_57_695 211
642 3300046809 Ga0495600_0019685 Ga0495600_0019685_275_913 211
643 3300047315 Ga0495581_0023440 Ga0495581_0023440_2607_3290 211
644 3300047317 Ga0495604_0020305 Ga0495604_0020305_388_1026 211
645 3300047317 Ga0495604_0029080 Ga0495604_0029080_1910_2548 211
646 3300047319 Ga0495674_0037372 Ga0495674_0037372_221_859 211
647 3300047319 Ga0495674_0043669 Ga0495674_0043669_2971_3654 211
648 3300047319 Ga0495674_0769917 Ga0495674_0769917_31_735 211
649 3300047321 Ga0495676_0126508 Ga0495676_0126508_795_1433 211
650 3300047322 Ga0495680_0084540 Ga0495680_0084540_958_1596 211
651 3300047323 Ga0495683_0013594 Ga0495683_0013594_2931_3569 211
652 3300047443 Ga0495687_056171 Ga0495687_056171_554_1192 211
653 3300047444 Ga0495675_0065231 Ga0495675_0065231_710_1381 211
654 3300047471 Ga0495684_0012228 Ga0495684_0012228_170_853 211
655 3300047472 Ga0495686_0076268 Ga0495686_0076268_930_1565 211
656 3300047472 Ga0495686_0080369 Ga0495686_0080369_355_1002 211
657 3300047673 Ga0495593_0026986 Ga0495593_0026986_2075_2758 211
658 3300047673 Ga0495593_0363068 Ga0495593_0363068_21_659 211
659 3300048088 Ga0495602_0214752 Ga0495602_0214752_324_962 211
660 3300048090 Ga0495615_0008583 Ga0495615_0008583_1262_1897 211
661 3300048903 Ga0496100_0099054 Ga0496100_0099054_746_1384 211
662 3300048904 Ga0496101_0429706 Ga0496101_0429706_334_972 211
663 3300048905 Ga0496102_0062913 Ga0496102_0062913_2720_3358 211
664 3300048906 Ga0496103_0125217 Ga0496103_0125217_699_1334 211
665 3300048907 Ga0496104_0095563 Ga0496104_0095563_721_1359 211
666 3300048907 Ga0496104_0438915 Ga0496104_0438915_151_789 211
667 3300048908 Ga0496105_0078016 Ga0496105_0078016_1765_2403 211
668 3300048910 Ga0496107_0310360 Ga0496107_0310360_132_770 211
669 3300048911 Ga0496108_0194029 Ga0496108_0194029_1053_1691 211
670 3300048913 Ga0496110_0153652 Ga0496110_0153652_264_902 211
671 3300048913 Ga0496110_0269092 Ga0496110_0269092_382_1020 211
672 3300048915 Ga0496112_0040959 Ga0496112_0040959_3373_4020 211
673 3300048915 Ga0496112_0208278 Ga0496112_0208278_900_1538 211
674 3300048915 Ga0496112_0770116 Ga0496112_0770116_180_818 211
675 3300048916 Ga0496113_0309371 Ga0496113_0309371_129_767 211
676 3300048916 Ga0496113_0459930 Ga0496113_0459930_76_714 211
677 3300048918 Ga0496115_0136097 Ga0496115_0136097_954_1589 211
678 3300048918 Ga0496115_0166408 Ga0496115_0166408_279_926 211
679 3300048918 Ga0496115_0291782 Ga0496115_0291782_363_1001 211
680 3300048918 Ga0496115_0352129 Ga0496115_0352129_89_727 211
681 3300048919 Ga0496116_0036199 Ga0496116_0036199_648_1286 211
682 3300048920 Ga0496117_0023985 Ga0496117_0023985_1138_1776 211
683 3300048920 Ga0496117_0250327 Ga0496117_0250327_266_901 211
684 3300048922 Ga0496119_0002261 Ga0496119_0002261_17609_18247 211
685 3300048922 Ga0496119_0123825 Ga0496119_0123825_561_1199 211
686 3300048923 Ga0496120_0020511 Ga0496120_0020511_2689_3327 211
687 3300048924 Ga0496121_0004531 Ga0496121_0004531_1356_2030 211
688 3300048924 Ga0496121_0023313 Ga0496121_0023313_500_1138 211
689 3300048924 Ga0496121_0093417 Ga0496121_0093417_379_1014 211
690 3300048924 Ga0496121_0095489 Ga0496121_0095489_525_1163 211
691 3300048924 Ga0496121_0228402 Ga0496121_0228402_472_1113 211
692 3300048925 Ga0496122_0221224 Ga0496122_0221224_279_947 211
693 3300048927 Ga0496124_0055391 Ga0496124_0055391_1321_1962 211
694 3300048927 Ga0496124_0226068 Ga0496124_0226068_676_1314 211
695 3300048927 Ga0496124_0427866 Ga0496124_0427866_58_720 211
696 3300048928 Ga0496125_0000252 Ga0496125_0000252_15181_15849 211
697 3300048928 Ga0496125_0000477 Ga0496125_0000477_19294_19956 211
698 3300048928 Ga0496125_0006104 Ga0496125_0006104_11709_12371 211
699 3300048928 Ga0496125_0038225 Ga0496125_0038225_1436_2074 211
700 3300048928 Ga0496125_0075024 Ga0496125_0075024_962_1600 211
701 3300048928 Ga0496125_0078578 Ga0496125_0078578_721_1359 211
702 3300048929 Ga0496126_0003342 Ga0496126_0003342_11108_11755 211
703 3300048929 Ga0496126_0008959 Ga0496126_0008959_5083_5730 211
704 3300048929 Ga0496126_0027002 Ga0496126_0027002_4497_5135 211
705 3300048929 Ga0496126_0117917 Ga0496126_0117917_295_933 211
706 3300048929 Ga0496126_0145584 Ga0496126_0145584_115_753 211
707 3300048929 Ga0496126_0195956 Ga0496126_0195956_842_1489 211
708 3300048929 Ga0496126_0679466 Ga0496126_0679466_87_728 211
709 3300049460 Ga0495682_0022934 Ga0495682_0022934_561_1199 211
710 3300050489 nmdc:mga03683_110190_c1 nmdc:mga03683_110190_c1_411_1049 211
711 3300050490 nmdc:mga03n38_70192_c1 nmdc:mga03n38_70192_c1_142_777 211
712 3300050491 nmdc:mga00v17_149651_c1 nmdc:mga00v17_149651_c1_776_1414 211
713 3300050491 nmdc:mga00v17_313818_c1 nmdc:mga00v17_313818_c1_20_658 211
714 3300050491 nmdc:mga00v17_592228_c1 nmdc:mga00v17_592228_c1_61_699 211
715 3300050492 nmdc:mga0yw44_308508_c1 nmdc:mga0yw44_308508_c1_14_649 211
716 3300050492 nmdc:mga0yw44_60416_c1 nmdc:mga0yw44_60416_c1_750_1388 211
717 3300050493 nmdc:mga0k408_113047_c1 nmdc:mga0k408_113047_c1_452_1105 211
718 3300050494 nmdc:mga06z11_278886_c1 nmdc:mga06z11_278886_c1_93_734 211
719 3300050494 nmdc:mga06z11_29474_c1 nmdc:mga06z11_29474_c1_1332_1970 211
720 3300050494 nmdc:mga06z11_434110_c1 nmdc:mga06z11_434110_c1_86_727 211
721 3300050496 nmdc:mga07m45_101344_c1 nmdc:mga07m45_101344_c1_777_1430 211
722 3300050496 nmdc:mga07m45_141870_c1 nmdc:mga07m45_141870_c1_101_739 211
723 3300050496 nmdc:mga07m45_33802_c1 nmdc:mga07m45_33802_c1_1016_1654 211
724 3300050507 nmdc:mga05p37_254661_c1 nmdc:mga05p37_254661_c1_1447_2082 211
725 3300050512 nmdc:mga0n895_871701_c1 nmdc:mga0n895_871701_c1_102_785 211
726 3300050516 nmdc:mga0sz30_30547_c1 nmdc:mga0sz30_30547_c1_1284_1922 211
727 3300050516 nmdc:mga0sz30_99126_c1 nmdc:mga0sz30_99126_c1_614_1249 211
728 3300053080 Ga0500635_0017676 Ga0500635_0017676_1166_1837 211
729 3300053086 Ga0500578_0022393 Ga0500578_0022393_434_1072 211
730 3300053087 Ga0500643_000025 Ga0500643_000025_25167_25805 211
731 3300053092 Ga0500583_0059313 Ga0500583_0059313_1081_1719 211
732 3300053093 Ga0500651_0034629 Ga0500651_0034629_448_1086 211
733 3300053093 Ga0500651_0158861 Ga0500651_0158861_456_1094 211
734 3300053094 Ga0500566_0109291 Ga0500566_0109291_511_1182 211
735 3300053096 Ga0500641_0008562 Ga0500641_0008562_560_1222 211
736 3300053096 Ga0500641_0048832 Ga0500641_0048832_626_1261 211
737 3300053103 Ga0500555_022255 Ga0500555_022255_549_1187 211
738 3300053104 Ga0500556_0071895 Ga0500556_0071895_536_1174 211
739 3300053105 Ga0500557_000001 Ga0500557_000001_159041_159679 211
740 3300053108 Ga0500562_012751 Ga0500562_012751_1469_2107 211
741 3300053109 Ga0500569_010569 Ga0500569_010569_914_1552 211
742 3300053111 Ga0500572_013736 Ga0500572_013736_58_729 211
743 3300053119 Ga0500595_003476 Ga0500595_003476_4378_5025 211
744 3300053130 Ga0500642_0000221 Ga0500642_0000221_7768_8406 211
745 3300053131 Ga0500652_119435 Ga0500652_119435_350_988 211
746 3300053136 Ga0500559_0090600 Ga0500559_0090600_705_1376 211
747 3300053139 Ga0500568_0110097 Ga0500568_0110097_65_703 211
748 3300053139 Ga0500568_0119287 Ga0500568_0119287_164_802 211
749 3300053146 Ga0500588_0155099 Ga0500588_0155099_180_818 211
750 3300053148 Ga0500590_057454 Ga0500590_057454_1314_1949 211
751 3300053151 Ga0500604_0090367 Ga0500604_0090367_287_949 211
752 3300053156 Ga0500622_0046562 Ga0500622_0046562_1459_2097 211
753 3300053158 Ga0500627_0021488 Ga0500627_0021488_847_1485 211
754 3300053160 Ga0500633_0067310 Ga0500633_0067310_561_1199 211
755 3300053162 Ga0500638_068136 Ga0500638_068136_276_914 211
756 3300053162 Ga0500638_099711 Ga0500638_099711_623_1294 211
757 3300053177 Ga0500636_0002067 Ga0500636_0002067_7356_8027 211
758 3300053177 Ga0500636_0067386 Ga0500636_0067386_1390_2025 211
759 3300053177 Ga0500636_0083775 Ga0500636_0083775_1015_1650 211
760 3300053178 Ga0500637_0136510 Ga0500637_0136510_445_1116 211
761 3300053178 Ga0500637_0300745 Ga0500637_0300745_217_852 211
762 3300053731 Ga0500609_001217 Ga0500609_001217_2052_2690 211
763 iso_pu_bacteria 2721755755 2723848107 211
764 iso_pu_bacteria 2933577622 2933578975 211
765 iso_pu_bacteria 3005710791 3005713956 211
766 iso_pu_bacteria 8055742211 8055747386 211
767 3300002070 JGI24750J21931_1010209 JGI24750J21931_10102092 212
768 3300002244 JGI24742J22300_10009328 JGI24742J22300_100093282 212
769 3300003215 JGI25153J46596_10004553 JGI25153J46596_100045532 212
770 3300003215 JGI25153J46596_10013642 JGI25153J46596_100136422 212
771 3300003320 rootH2_10132730 rootH2_101327302 212
772 3300003322 rootL2_10131868 rootL2_101318683 212
773 3300005293 Ga0065715_10177401 Ga0065715_101774012 212
774 3300005328 Ga0070676_10222772 Ga0070676_102227722 212
775 3300005331 Ga0070670_100443514 Ga0070670_1004435142 212
776 3300005334 Ga0068869_100042626 Ga0068869_1000426262 212
777 3300005334 Ga0068869_100046137 Ga0068869_1000461375 212
778 3300005334 Ga0068869_100623999 Ga0068869_1006239991 212
779 3300005338 Ga0068868_100147989 Ga0068868_1001479892 212
780 3300005338 Ga0068868_100455915 Ga0068868_1004559151 212
781 3300005340 Ga0070689_100148809 Ga0070689_1001488093 212
782 3300005340 Ga0070689_100193978 Ga0070689_1001939782 212
783 3300005344 Ga0070661_100072219 Ga0070661_1000722193 212
784 3300005344 Ga0070661_100213456 Ga0070661_1002134562 212
785 3300005344 Ga0070661_100943411 Ga0070661_1009434111 212
786 3300005347 Ga0070668_100029460 Ga0070668_1000294607 212
787 3300005347 Ga0070668_100093136 Ga0070668_1000931363 212
788 3300005347 Ga0070668_100201866 Ga0070668_1002018662 212
789 3300005347 Ga0070668_100245523 Ga0070668_1002455232 212
790 3300005353 Ga0070669_100073703 Ga0070669_1000737033 212
791 3300005353 Ga0070669_100308564 Ga0070669_1003085641 212
792 3300005355 Ga0070671_100398834 Ga0070671_1003988341 212
793 3300005356 Ga0070674_100076493 Ga0070674_1000764931 212
794 3300005365 Ga0070688_100452898 Ga0070688_1004528981 212
795 3300005366 Ga0070659_100537331 Ga0070659_1005373312 212
796 3300005367 Ga0070667_100133687 Ga0070667_1001336873 212
797 3300005438 Ga0070701_10272194 Ga0070701_102721942 212
798 3300005440 Ga0070705_100255437 Ga0070705_1002554372 212
799 3300005455 Ga0070663_100061793 Ga0070663_1000617933 212
800 3300005455 Ga0070663_100075935 Ga0070663_1000759353 212
801 3300005455 Ga0070663_100147104 Ga0070663_1001471042 212
802 3300005455 Ga0070663_100164837 Ga0070663_1001648373 212
803 3300005455 Ga0070663_100222098 Ga0070663_1002220982 212
804 3300005455 Ga0070663_100813719 Ga0070663_1008137191 212
805 3300005456 Ga0070678_100123878 Ga0070678_1001238783 212
806 3300005456 Ga0070678_100181178 Ga0070678_1001811783 212
807 3300005457 Ga0070662_100021115 Ga0070662_1000211155 212
808 3300005457 Ga0070662_100080814 Ga0070662_1000808144 212
809 3300005459 Ga0068867_100044046 Ga0068867_1000440462 212
810 3300005459 Ga0068867_100324494 Ga0068867_1003244942 212
811 3300005459 Ga0068867_100703553 Ga0068867_1007035531 212
812 3300005535 Ga0070684_100179997 Ga0070684_1001799971 212
813 3300005535 Ga0070684_100269786 Ga0070684_1002697861 212
814 3300005539 Ga0068853_100129622 Ga0068853_1001296222 212
815 3300005539 Ga0068853_100135576 Ga0068853_1001355763 212
816 3300005539 Ga0068853_100571092 Ga0068853_1005710922 212
817 3300005543 Ga0070672_100017103 Ga0070672_1000171033 212
818 3300005543 Ga0070672_100213424 Ga0070672_1002134243 212
819 3300005545 Ga0070695_100193314 Ga0070695_1001933142 212
820 3300005547 Ga0070693_100023629 Ga0070693_1000236295 212
821 3300005547 Ga0070693_100266035 Ga0070693_1002660352 212
822 3300005548 Ga0070665_100063529 Ga0070665_1000635292 212
823 3300005548 Ga0070665_100297744 Ga0070665_1002977442 212
824 3300005548 Ga0070665_100654714 Ga0070665_1006547142 212
825 3300005563 Ga0068855_100223280 Ga0068855_1002232802 212
826 3300005564 Ga0070664_100253929 Ga0070664_1002539292 212
827 3300005564 Ga0070664_100334465 Ga0070664_1003344652 212
828 3300005578 Ga0068854_100104017 Ga0068854_1001040173 212
829 3300005578 Ga0068854_100511366 Ga0068854_1005113662 212
830 3300005614 Ga0068856_100048216 Ga0068856_1000482165 212
831 3300005615 Ga0070702_100082084 Ga0070702_1000820843 212
832 3300005616 Ga0068852_100142897 Ga0068852_1001428974 212
833 3300005616 Ga0068852_100320270 Ga0068852_1003202702 212
834 3300005616 Ga0068852_100462691 Ga0068852_1004626911 212
835 3300005617 Ga0068859_100131914 Ga0068859_1001319142 212
836 3300005617 Ga0068859_100353023 Ga0068859_1003530232 212
837 3300005618 Ga0068864_100391349 Ga0068864_1003913492 212
838 3300005718 Ga0068866_10054663 Ga0068866_100546633 212
839 3300005718 Ga0068866_10153029 Ga0068866_101530292 212
840 3300005719 Ga0068861_100020526 Ga0068861_1000205264 212
841 3300005719 Ga0068861_100063438 Ga0068861_1000634383 212
842 3300005719 Ga0068861_100419044 Ga0068861_1004190442 212
843 3300005841 Ga0068863_100516105 Ga0068863_1005161051 212
844 3300005842 Ga0068858_100091500 Ga0068858_1000915004 212
845 3300005842 Ga0068858_100142639 Ga0068858_1001426392 212
846 3300005843 Ga0068860_100161081 Ga0068860_1001610812 212
847 3300005843 Ga0068860_100250233 Ga0068860_1002502331 212
848 3300005843 Ga0068860_100501595 Ga0068860_1005015952 212
849 3300005844 Ga0068862_100045914 Ga0068862_1000459144 212
850 3300005844 Ga0068862_100062334 Ga0068862_1000623341 212
851 3300005844 Ga0068862_100117710 Ga0068862_1001177104 212
852 3300005844 Ga0068862_100227586 Ga0068862_1002275863 212
853 3300005937 Ga0081455_10015336 Ga0081455_100153365 212
854 3300005937 Ga0081455_10181824 Ga0081455_101818242 212
855 3300005981 Ga0081538_10103094 Ga0081538_101030942 212
856 3300005983 Ga0081540_1004140 Ga0081540_100414014 212
857 3300005983 Ga0081540_1005687 Ga0081540_100568710 212
858 3300005983 Ga0081540_1010925 Ga0081540_10109257 212
859 3300005983 Ga0081540_1079967 Ga0081540_10799672 212
860 3300005985 Ga0081539_10019345 Ga0081539_100193452 212
861 3300006038 Ga0075365_10190875 Ga0075365_101908751 212
862 3300006048 Ga0075363_100018491 Ga0075363_1000184914 212
863 3300006048 Ga0075363_100108190 Ga0075363_1001081902 212
864 3300006178 Ga0075367_10002456 Ga0075367_100024565 212
865 3300006178 Ga0075367_10012875 Ga0075367_100128753 212
866 3300006178 Ga0075367_10020273 Ga0075367_100202735 212
867 3300006186 Ga0075369_10157575 Ga0075369_101575753 212
868 3300006237 Ga0097621_100423091 Ga0097621_1004230911 212
869 3300006353 Ga0075370_10053723 Ga0075370_100537233 212
870 3300006358 Ga0068871_100295356 Ga0068871_1002953563 212
871 3300006358 Ga0068871_100614222 Ga0068871_1006142222 212
872 3300006358 Ga0068871_100674142 Ga0068871_1006741422 212
873 3300006881 Ga0068865_100064851 Ga0068865_1000648513 212
874 3300006931 Ga0097620_100131926 Ga0097620_1001319262 212
875 3300006931 Ga0097620_100353012 Ga0097620_1003530122 212
876 3300007076 Ga0075435_100137799 Ga0075435_1001377993 212
877 3300009093 Ga0105240_11106718 Ga0105240_111067181 212
878 3300009098 Ga0105245_10108637 Ga0105245_101086371 212
879 3300009098 Ga0105245_10201630 Ga0105245_102016303 212
880 3300009098 Ga0105245_10364213 Ga0105245_103642131 212
881 3300009098 Ga0105245_11706360 Ga0105245_117063601 212
882 3300009101 Ga0105247_10096820 Ga0105247_100968204 212
883 3300009101 Ga0105247_10150998 Ga0105247_101509982 212
884 3300009101 Ga0105247_10189651 Ga0105247_101896512 212
885 3300009101 Ga0105247_10473920 Ga0105247_104739202 212
886 3300009148 Ga0105243_10255677 Ga0105243_102556772 212
887 3300009148 Ga0105243_10328799 Ga0105243_103287992 212
888 3300009148 Ga0105243_10329267 Ga0105243_103292671 212
889 3300009174 Ga0105241_10020802 Ga0105241_100208022 212
890 3300009174 Ga0105241_10752413 Ga0105241_107524131 212
891 3300009176 Ga0105242_10137338 Ga0105242_101373383 212
892 3300009176 Ga0105242_10743671 Ga0105242_107436712 212
893 3300009176 Ga0105242_10754450 Ga0105242_107544501 212
894 3300009177 Ga0105248_10144983 Ga0105248_101449832 212
895 3300009177 Ga0105248_10658129 Ga0105248_106581291 212
896 3300009545 Ga0105237_10218378 Ga0105237_102183783 212
897 3300009545 Ga0105237_10443511 Ga0105237_104435112 212
898 3300009551 Ga0105238_10225419 Ga0105238_102254191 212
899 3300009551 Ga0105238_10895422 Ga0105238_108954221 212
900 3300009553 Ga0105249_10145325 Ga0105249_101453253 212
901 3300009553 Ga0105249_10226941 Ga0105249_102269413 212
902 3300009553 Ga0105249_10768991 Ga0105249_107689912 212
903 3300009553 Ga0105249_11091964 Ga0105249_110919641 212
904 3300010375 Ga0105239_10099657 Ga0105239_100996575 212
905 3300010375 Ga0105239_10435494 Ga0105239_104354942 212
906 3300010375 Ga0105239_10661858 Ga0105239_106618581 212
907 3300011119 Ga0105246_10172292 Ga0105246_101722923 212
908 3300011119 Ga0105246_10186368 Ga0105246_101863683 212
909 3300011119 Ga0105246_10410177 Ga0105246_104101772 212
910 3300013296 Ga0157374_10062596 Ga0157374_100625964 212
911 3300013296 Ga0157374_10175385 Ga0157374_101753853 212
912 3300013297 Ga0157378_10104317 Ga0157378_101043173 212
913 3300013297 Ga0157378_10115924 Ga0157378_101159242 212
914 3300013306 Ga0163162_10077525 Ga0163162_100775253 212
915 3300013306 Ga0163162_10290394 Ga0163162_102903942 212
916 3300013306 Ga0163162_10383251 Ga0163162_103832513 212
917 3300013306 Ga0163162_10517807 Ga0163162_105178072 212
918 3300013308 Ga0157375_10017613 Ga0157375_100176134 212
919 3300014325 Ga0163163_10033417 Ga0163163_100334174 212
920 3300014325 Ga0163163_10218554 Ga0163163_102185543 212
921 3300014325 Ga0163163_10280029 Ga0163163_102800293 212
922 3300014325 Ga0163163_10292201 Ga0163163_102922012 212
923 3300014326 Ga0157380_10149717 Ga0157380_101497172 212
924 3300014326 Ga0157380_10896436 Ga0157380_108964361 212
925 3300014745 Ga0157377_10151352 Ga0157377_101513522 212
926 3300014745 Ga0157377_10248961 Ga0157377_102489612 212
927 3300014968 Ga0157379_10240107 Ga0157379_102401071 212
928 3300014968 Ga0157379_10268995 Ga0157379_102689953 212
929 3300014968 Ga0157379_10745659 Ga0157379_107456591 212
930 3300014969 Ga0157376_10005581 Ga0157376_100055818 212
931 3300014969 Ga0157376_10274276 Ga0157376_102742763 212
932 3300017792 Ga0163161_10340276 Ga0163161_103402762 212
933 3300017792 Ga0163161_10399603 Ga0163161_103996031 212
934 3300025297 Ga0209758_1034945 Ga0209758_10349453 212
935 3300025901 Ga0207688_10278094 Ga0207688_102780942 212
936 3300025903 Ga0207680_10360301 Ga0207680_103603012 212
937 3300025907 Ga0207645_10072377 Ga0207645_100723773 212
938 3300025907 Ga0207645_10228146 Ga0207645_102281462 212
939 3300025911 Ga0207654_10142390 Ga0207654_101423902 212
940 3300025911 Ga0207654_10409186 Ga0207654_104091862 212
941 3300025914 Ga0207671_10056314 Ga0207671_100563142 212
942 3300025918 Ga0207662_10104871 Ga0207662_101048711 212
943 3300025919 Ga0207657_10131553 Ga0207657_101315531 212
944 3300025920 Ga0207649_10014953 Ga0207649_100149533 212
945 3300025923 Ga0207681_10352556 Ga0207681_103525562 212
946 3300025924 Ga0207694_10279479 Ga0207694_102794792 212
947 3300025924 Ga0207694_10409220 Ga0207694_104092201 212
948 3300025924 Ga0207694_10854811 Ga0207694_108548111 212
949 3300025925 Ga0207650_10177191 Ga0207650_101771911 212
950 3300025927 Ga0207687_10024425 Ga0207687_100244255 212
951 3300025927 Ga0207687_10436076 Ga0207687_104360762 212
952 3300025931 Ga0207644_10016877 Ga0207644_100168773 212
953 3300025931 Ga0207644_10273995 Ga0207644_102739951 212
954 3300025933 Ga0207706_10312952 Ga0207706_103129522 212
955 3300025933 Ga0207706_10518528 Ga0207706_105185281 212
956 3300025934 Ga0207686_10367153 Ga0207686_103671532 212
957 3300025935 Ga0207709_10119033 Ga0207709_101190333 212
958 3300025935 Ga0207709_10145177 Ga0207709_101451773 212
959 3300025936 Ga0207670_10088217 Ga0207670_100882174 212
960 3300025938 Ga0207704_10016841 Ga0207704_100168416 212
961 3300025939 Ga0207665_10411969 Ga0207665_104119691 212
962 3300025940 Ga0207691_10075742 Ga0207691_100757424 212
963 3300025940 Ga0207691_10389425 Ga0207691_103894252 212
964 3300025941 Ga0207711_10224504 Ga0207711_102245042 212
965 3300025942 Ga0207689_10031197 Ga0207689_100311972 212
966 3300025942 Ga0207689_10048889 Ga0207689_100488894 212
967 3300025945 Ga0207679_10279869 Ga0207679_102798692 212
968 3300025961 Ga0207712_10059409 Ga0207712_100594092 212
969 3300025961 Ga0207712_10235403 Ga0207712_102354032 212
970 3300025961 Ga0207712_10538069 Ga0207712_105380692 212
971 3300025972 Ga0207668_10141735 Ga0207668_101417353 212
972 3300025972 Ga0207668_10314864 Ga0207668_103148642 212
973 3300025981 Ga0207640_10033120 Ga0207640_100331204 212
974 3300025981 Ga0207640_10473452 Ga0207640_104734522 212
975 3300025986 Ga0207658_10206354 Ga0207658_102063542 212
976 3300026023 Ga0207677_10168303 Ga0207677_101683032 212
977 3300026035 Ga0207703_10066372 Ga0207703_100663722 212
978 3300026035 Ga0207703_10643501 Ga0207703_106435012 212
979 3300026067 Ga0207678_10058807 Ga0207678_100588072 212
980 3300026067 Ga0207678_10067429 Ga0207678_100674292 212
981 3300026067 Ga0207678_10093111 Ga0207678_100931113 212
982 3300026067 Ga0207678_10172642 Ga0207678_101726422 212
983 3300026067 Ga0207678_10193129 Ga0207678_101931293 212
984 3300026075 Ga0207708_10039623 Ga0207708_100396235 212
985 3300026088 Ga0207641_10202896 Ga0207641_102028963 212
986 3300026088 Ga0207641_10274207 Ga0207641_102742071 212
987 3300026089 Ga0207648_10019696 Ga0207648_100196963 212
988 3300026089 Ga0207648_10307603 Ga0207648_103076031 212
989 3300026095 Ga0207676_10169565 Ga0207676_101695652 212
990 3300026095 Ga0207676_10364959 Ga0207676_103649592 212
991 3300026118 Ga0207675_100029182 Ga0207675_1000291823 212
992 3300026118 Ga0207675_100209540 Ga0207675_1002095402 212
993 3300026118 Ga0207675_100697836 Ga0207675_1006978362 212
994 3300026121 Ga0207683_10093880 Ga0207683_100938803 212
995 3300026121 Ga0207683_10176304 Ga0207683_101763042 212
996 3300026121 Ga0207683_10219002 Ga0207683_102190023 212
997 3300026121 Ga0207683_10562575 Ga0207683_105625752 212
998 3300026121 Ga0207683_10746570 Ga0207683_107465702 212
999 3300026142 Ga0207698_10309172 Ga0207698_103091721 212
1000 3300026142 Ga0207698_10815153 Ga0207698_108151531 212
1001 3300028379 Ga0268266_10005735 Ga0268266_100057354 212
1002 3300028379 Ga0268266_10114937 Ga0268266_101149374 212
1003 3300028379 Ga0268266_10261743 Ga0268266_102617433 212
1004 3300028380 Ga0268265_10049404 Ga0268265_100494044 212
1005 3300028380 Ga0268265_10272498 Ga0268265_102724982 212
1006 3300028381 Ga0268264_10023033 Ga0268264_100230332 212
1007 3300028786 Ga0307517_10000071 Ga0307517_1000007168 212
1008 3300028794 Ga0307515_10035411 Ga0307515_100354119 212
1009 3300028794 Ga0307515_10225215 Ga0307515_102252152 212
1010 3300028794 Ga0307515_10301631 Ga0307515_103016312 212
1011 3300031456 Ga0307513_10441231 Ga0307513_104412312 212
1012 3300031507 Ga0307509_10103714 Ga0307509_101037142 212
1013 3300031616 Ga0307508_10015804 Ga0307508_100158049 212
1014 3300031616 Ga0307508_10371132 Ga0307508_103711322 212
1015 3300031616 Ga0307508_10560934 Ga0307508_105609341 212
1016 3300031711 Ga0265314_10079398 Ga0265314_100793983 212
1017 3300031730 Ga0307516_10130897 Ga0307516_101308973 212
1018 3300031730 Ga0307516_10503868 Ga0307516_105038681 212
1019 3300031730 Ga0307516_10508305 Ga0307516_105083051 212
1020 3300031995 Ga0307409_100164695 Ga0307409_1001646953 212
1021 3300033180 Ga0307510_10025489 Ga0307510_100254898 212
1022 3300035085 Ga0373929_0001973 Ga0373929_0001973_1224_1862 212
1023 3300035090 Ga0373949_0034709 Ga0373949_0034709_463_1107 212
1024 3300035092 Ga0373952_0025115 Ga0373952_0025115_580_1224 212
1025 3300035115 Ga0373941_0042528 Ga0373941_0042528_371_1015 212
1026 3300035241 Ga0373961_0090212 Ga0373961_0090212_192_830 212
1027 3300035691 Ga0373931_0042267 Ga0373931_0042267_669_1313 212
1028 3300035692 Ga0373935_0164148 Ga0373935_0164148_760_1404 212
1029 3300035695 Ga0373927_0252127 Ga0373927_0252127_402_1046 212
1030 3300037068 Ga0373925_0457738 Ga0373925_0457738_215_853 212
1031 3300037471 Ga0395905_0045576 Ga0395905_0045576_1875_2513 212
1032 3300038443 Ga0395901_0327622 Ga0395901_0327622_447_1085 212
1033 3300046454 Ga0495592_0282725 Ga0495592_0282725_384_1022 212
1034 3300046455 Ga0495603_0034408 Ga0495603_0034408_198_836 212
1035 3300046460 Ga0495638_0113325 Ga0495638_0113325_621_1316 212
1036 3300046461 Ga0495641_0056529 Ga0495641_0056529_369_1007 212
1037 3300046461 Ga0495641_0131485 Ga0495641_0131485_172_810 212
1038 3300046474 Ga0495605_0135421 Ga0495605_0135421_99_737 212
1039 3300046477 Ga0495664_0040873 Ga0495664_0040873_1660_2298 212
1040 3300046477 Ga0495664_0215422 Ga0495664_0215422_371_1015 212
1041 3300046491 Ga0495584_0267785 Ga0495584_0267785_156_794 212
1042 3300046492 Ga0495585_0110244 Ga0495585_0110244_78_716 212
1043 3300046501 Ga0495607_0249128 Ga0495607_0249128_175_813 212
1044 3300046512 Ga0495610_0137742 Ga0495610_0137742_55_693 212
1045 3300046513 Ga0495616_0091351 Ga0495616_0091351_507_1145 212
1046 3300046518 Ga0495631_0128667 Ga0495631_0128667_26_664 212
1047 3300046519 Ga0495632_0156773 Ga0495632_0156773_239_883 212
1048 3300046519 Ga0495632_0219770 Ga0495632_0219770_66_704 212
1049 3300046523 Ga0495644_0109982 Ga0495644_0109982_10_648 212
1050 3300046524 Ga0495648_0120781 Ga0495648_0120781_450_1088 212
1051 3300046529 Ga0495652_0433823 Ga0495652_0433823_142_780 212
1052 3300046537 Ga0495598_0152338 Ga0495598_0152338_98_736 212
1053 3300046538 Ga0495609_0149992 Ga0495609_0149992_284_922 212
1054 3300046538 Ga0495609_0190328 Ga0495609_0190328_155_793 212
1055 3300046539 Ga0495621_0017558 Ga0495621_0017558_1015_1653 212
1056 3300046557 Ga0495622_0088960 Ga0495622_0088960_319_957 212
1057 3300046557 Ga0495622_0102868 Ga0495622_0102868_152_796 212
1058 3300046558 Ga0495633_0031367 Ga0495633_0031367_1527_2165 212
1059 3300046558 Ga0495633_0217666 Ga0495633_0217666_58_696 212
1060 3300046615 Ga0495656_0227631 Ga0495656_0227631_220_858 212
1061 3300046616 Ga0495668_0172125 Ga0495668_0172125_163_801 212
1062 3300046648 Ga0495611_0061653 Ga0495611_0061653_646_1341 212
1063 3300046648 Ga0495611_0191250 Ga0495611_0191250_133_771 212
1064 3300046660 Ga0495625_0362396 Ga0495625_0362396_36_674 212
1065 3300046664 Ga0495659_0266048 Ga0495659_0266048_15_653 212
1066 3300046665 Ga0495661_0207557 Ga0495661_0207557_82_720 212
1067 3300046690 Ga0495624_0400437 Ga0495624_0400437_10_648 212
1068 3300046691 Ga0495670_0145113 Ga0495670_0145113_169_807 212
1069 3300047317 Ga0495604_0173475 Ga0495604_0173475_272_910 212
1070 3300047318 Ga0495636_0059948 Ga0495636_0059948_564_1202 212
1071 3300047320 Ga0495672_0028339 Ga0495672_0028339_2232_2876 212
1072 3300047320 Ga0495672_0151839 Ga0495672_0151839_473_1111 212
1073 3300047323 Ga0495683_0287932 Ga0495683_0287932_15_653 212
1074 3300047445 Ga0495677_0005933 Ga0495677_0005933_3734_4372 212
1075 3300047446 Ga0495679_097202 Ga0495679_097202_167_805 212
1076 3300048090 Ga0495615_0060246 Ga0495615_0060246_208_846 212
1077 3300048903 Ga0496100_0034333 Ga0496100_0034333_604_1245 212
1078 3300048903 Ga0496100_0215752 Ga0496100_0215752_225_869 212
1079 3300048903 Ga0496100_0353426 Ga0496100_0353426_129_767 212
1080 3300048904 Ga0496101_0010035 Ga0496101_0010035_3935_4576 212
1081 3300048904 Ga0496101_0251335 Ga0496101_0251335_511_1149 212
1082 3300048904 Ga0496101_0398983 Ga0496101_0398983_347_985 212
1083 3300048905 Ga0496102_0013449 Ga0496102_0013449_3714_4358 212
1084 3300048905 Ga0496102_0128269 Ga0496102_0128269_800_1441 212
1085 3300048905 Ga0496102_0162493 Ga0496102_0162493_116_760 212
1086 3300048905 Ga0496102_0402287 Ga0496102_0402287_289_927 212
1087 3300048905 Ga0496102_0494062 Ga0496102_0494062_329_967 212
1088 3300048906 Ga0496103_0378626 Ga0496103_0378626_125_763 212
1089 3300048907 Ga0496104_0034670 Ga0496104_0034670_1472_2113 212
1090 3300048907 Ga0496104_0037615 Ga0496104_0037615_2815_3453 212
1091 3300048907 Ga0496104_0178001 Ga0496104_0178001_188_826 212
1092 3300048908 Ga0496105_0013759 Ga0496105_0013759_669_1313 212
1093 3300048908 Ga0496105_0031433 Ga0496105_0031433_351_992 212
1094 3300048908 Ga0496105_0316345 Ga0496105_0316345_293_931 212
1095 3300048908 Ga0496105_0518923 Ga0496105_0518923_149_793 212
1096 3300048909 Ga0496106_0034128 Ga0496106_0034128_1541_2185 212
1097 3300048909 Ga0496106_0304489 Ga0496106_0304489_192_830 212
1098 3300048909 Ga0496106_0329026 Ga0496106_0329026_62_700 212
1099 3300048909 Ga0496106_0502338 Ga0496106_0502338_288_926 212
1100 3300048910 Ga0496107_0012206 Ga0496107_0012206_2728_3372 212
1101 3300048910 Ga0496107_0041263 Ga0496107_0041263_2458_3099 212
1102 3300048910 Ga0496107_0109232 Ga0496107_0109232_1285_1923 212
1103 3300048911 Ga0496108_0030269 Ga0496108_0030269_761_1402 212
1104 3300048911 Ga0496108_0360749 Ga0496108_0360749_537_1181 212
1105 3300048912 Ga0496109_0110376 Ga0496109_0110376_23_667 212
1106 3300048912 Ga0496109_0188961 Ga0496109_0188961_936_1580 212
1107 3300048913 Ga0496110_0017963 Ga0496110_0017963_2790_3428 212
1108 3300048913 Ga0496110_0018229 Ga0496110_0018229_1805_2449 212
1109 3300048913 Ga0496110_0320020 Ga0496110_0320020_132_770 212
1110 3300048914 Ga0496111_0021492 Ga0496111_0021492_3121_3765 212
1111 3300048914 Ga0496111_0072379 Ga0496111_0072379_889_1530 212
1112 3300048915 Ga0496112_0021451 Ga0496112_0021451_3564_4205 212
1113 3300048915 Ga0496112_0204579 Ga0496112_0204579_934_1578 212
1114 3300048915 Ga0496112_0413839 Ga0496112_0413839_528_1172 212
1115 3300048916 Ga0496113_0025419 Ga0496113_0025419_539_1183 212
1116 3300048916 Ga0496113_0220446 Ga0496113_0220446_656_1297 212
1117 3300048917 Ga0496114_0009819 Ga0496114_0009819_6716_7357 212
1118 3300048917 Ga0496114_0194523 Ga0496114_0194523_646_1284 212
1119 3300048918 Ga0496115_0106182 Ga0496115_0106182_1159_1803 212
1120 3300048918 Ga0496115_0577737 Ga0496115_0577737_227_865 212
1121 3300048918 Ga0496115_0710117 Ga0496115_0710117_140_778 212
1122 3300048920 Ga0496117_0117147 Ga0496117_0117147_952_1590 212
1123 3300048922 Ga0496119_0047799 Ga0496119_0047799_1871_2509 212
1124 3300048924 Ga0496121_0033547 Ga0496121_0033547_3452_4090 212
1125 3300048924 Ga0496121_0056653 Ga0496121_0056653_753_1391 212
1126 3300048924 Ga0496121_0087578 Ga0496121_0087578_797_1441 212
1127 3300048927 Ga0496124_0162000 Ga0496124_0162000_889_1527 212
1128 3300048928 Ga0496125_0057578 Ga0496125_0057578_1218_1856 212
1129 3300048928 Ga0496125_0175324 Ga0496125_0175324_597_1241 212
1130 3300048929 Ga0496126_0005092 Ga0496126_0005092_6246_6884 212
1131 3300048929 Ga0496126_0024225 Ga0496126_0024225_2820_3458 212
1132 3300048929 Ga0496126_0046537 Ga0496126_0046537_75_713 212
1133 3300048929 Ga0496126_0063150 Ga0496126_0063150_2107_2745 212
1134 3300048929 Ga0496126_0087671 Ga0496126_0087671_291_929 212
1135 3300048929 Ga0496126_0543982 Ga0496126_0543982_181_819 212
1136 3300049460 Ga0495682_0174082 Ga0495682_0174082_33_671 212
1137 3300049583 Ga0501067_0035550 Ga0501067_0035550_1169_1807 212
1138 3300049591 Ga0501075_0443655 Ga0501075_0443655_195_833 212
1139 3300050489 nmdc:mga03683_261925_c1 nmdc:mga03683_261925_c1_44_688 212
1140 3300050490 nmdc:mga03n38_113295_c1 nmdc:mga03n38_113295_c1_364_1002 212
1141 3300050490 nmdc:mga03n38_191280_c1 nmdc:mga03n38_191280_c1_306_956 212
1142 3300050490 nmdc:mga03n38_232557_c1 nmdc:mga03n38_232557_c1_99_743 212
1143 3300050492 nmdc:mga0yw44_210242_c1 nmdc:mga0yw44_210242_c1_431_1075 212
1144 3300050494 nmdc:mga06z11_27169_c1 nmdc:mga06z11_27169_c1_1496_2134 212
1145 3300050494 nmdc:mga06z11_47913_c1 nmdc:mga06z11_47913_c1_697_1335 212
1146 3300050496 nmdc:mga07m45_40557_c1 nmdc:mga07m45_40557_c1_1207_1845 212
1147 3300050509 nmdc:mga0qj67_382155_c1 nmdc:mga0qj67_382155_c1_129_767 212
1148 3300050512 nmdc:mga0n895_416634_c1 nmdc:mga0n895_416634_c1_164_808 212
1149 3300050513 nmdc:mga0rr50_142842_c1 nmdc:mga0rr50_142842_c1_469_1113 212
1150 3300053077 Ga0495601_0559716 Ga0495601_0559716_65_703 212
1151 3300053085 Ga0495619_0164315 Ga0495619_0164315_852_1490 212
1152 3300053093 Ga0500651_0006276 Ga0500651_0006276_6010_6696 212
1153 3300053094 Ga0500566_0090144 Ga0500566_0090144_298_936 212
1154 3300053102 Ga0500554_026795 Ga0500554_026795_34_672 212
1155 3300053103 Ga0500555_071802 Ga0500555_071802_252_890 212
1156 3300053119 Ga0500595_000680 Ga0500595_000680_11154_11792 212
1157 3300053119 Ga0500595_001479 Ga0500595_001479_3650_4288 212
1158 3300053134 Ga0500658_0021527 Ga0500658_0021527_1294_1932 212
1159 3300053134 Ga0500658_0199659 Ga0500658_0199659_76_714 212
1160 3300053146 Ga0500588_0013778 Ga0500588_0013778_1302_1940 212
1161 3300053156 Ga0500622_0099278 Ga0500622_0099278_765_1403 212
1162 3300053158 Ga0500627_0162430 Ga0500627_0162430_241_936 212
1163 3300053160 Ga0500633_0040266 Ga0500633_0040266_178_816 212
1164 3300053161 Ga0500634_0160967 Ga0500634_0160967_184_822 212
1165 3300053161 Ga0500634_0191916 Ga0500634_0191916_125_820 212
1166 3300053162 Ga0500638_034071 Ga0500638_034071_1616_2254 212
1167 3300053178 Ga0500637_0047630 Ga0500637_0047630_552_1190 212
1168 3300053731 Ga0500609_018270 Ga0500609_018270_178_825 212
1169 3300061734 Ga0530510_0160337 Ga0530510_0160337_184_822 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

40

218

0.93

PF13242

Hydrolase_like

HAD-hyrolase-like

176

239

0.91

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

37

212

0.84

PF12710

HAD

haloacid dehalogenase-like hydrolase

40

209

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sd7-assembly1.cif.gz_A 1.7 angstrom resolution crystal structure of putative phosphatase from clostridium difficile 0.9163 1 212
3sd7-assembly1.cif.gz_A 1.7 angstrom resolution crystal structure of putative phosphatase from clostridium difficile 0.9122 1 212
2ah5-assembly1.cif.gz_A hydrolase, haloacid dehalogenase-like family protein sp0104 from streptococcus pneumoniae 0.8744 1 212
2ah5-assembly1.cif.gz_A hydrolase, haloacid dehalogenase-like family protein sp0104 from streptococcus pneumoniae 0.8592 1 212
8i8b-assembly1.cif.gz_J outer shell and inner layer structures of autographa californica multiple nucleopolyhedrovirus (acmnpv) 0.8518 2 131
ID Description Score Start End Superfamily
2ah5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9346 1 212 3.40.50.1000
3mc1B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9204 1 210 3.40.50.1000
2ah5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9155 1 212 3.40.50.1000
3mc1B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9081 1 210 3.40.50.1000
af_Q60DU2_197_332_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9067 85 206 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A3S0GB45-F1-model_v4 HAD family hydrolase 0.9577 2 211 GO:0004713
GO:0005829
GO:0016787
AF-A0A524F6N1-F1-model_v4 HAD family hydrolase 0.9562 2 210 GO:0004713
GO:0005829
GO:0016787
AF-A0A7V8BJ90-F1-model_v4 HAD hydrolase-like protein 0.9509 2 211 GO:0004713
GO:0005829
GO:0016787
AF-A0A2D4UK66-F1-model_v4 HAD family hydrolase 0.9421 63 211 GO:0004713
GO:0005829
AF-A0A256WN98-F1-model_v4 Phosphoglycolate phosphatase 0.9416 1 212 GO:0004713
GO:0005829

Feature Viewer

pLDDT pTM Quality
96.41 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map