F491127
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1169 | 604 | 985 | 214 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10661858|Ga0105239_106618581 |
| Length | 248 |
| Sequence | MMTADNVSAFPRRVASEYFGLRFANPPHNVTRTDMTMDAIFFDLDGTLTDPKPGITRSIQYALQKLGHHTIPTEDELTWCIGPPLRASLARILGAEEHADRALALYRERFSDIGLYENAVYDGIGEVLTTLGESGCRLFVATSKPHVFATRIVAHFALRHHFEHVFGSELDGRRVDKSDLLAYALKQAGVDPAKTLMIGDRSHDMAGAANNGMKGIGVLYGYGSREELIGAGALHVCATPQAILGCIS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 4 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 5 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 8 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 15 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 16 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 17 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 18 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 19 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 20 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 21 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 22 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 23 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 24 | 2791355199 | |||
| 25 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 26 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 27 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 28 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 29 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 30 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 31 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 32 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 33 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 34 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 35 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 36 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 37 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 38 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 39 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 40 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 41 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 42 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 43 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 44 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 45 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 46 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 47 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 48 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 49 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 50 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 51 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 52 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 53 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 54 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 55 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 56 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 57 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 58 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 59 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 60 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 61 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 62 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 63 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 64 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 65 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 66 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 67 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 68 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 69 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 70 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 71 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 72 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 73 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 74 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 75 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 76 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 77 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 78 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 79 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 80 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 81 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 82 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 83 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 84 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 85 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 86 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 87 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 88 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 89 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 90 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 91 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 92 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 93 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 94 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 95 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 96 | 2922368715 | |||
| 97 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 98 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 99 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 100 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 101 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 102 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 103 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 104 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 105 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 106 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 107 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 108 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 109 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 110 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 111 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 112 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 113 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 114 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 115 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 116 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 117 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 118 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 119 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 120 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 121 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 122 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 123 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 124 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 125 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 126 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 127 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 128 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 129 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 130 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 131 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 132 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 133 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 134 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 135 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 136 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 137 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 138 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 139 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 140 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 141 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 142 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 143 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 144 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 145 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 146 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 147 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 148 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 149 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 150 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 151 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 152 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 153 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 154 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 155 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 156 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 157 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 158 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 159 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 160 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 161 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 162 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 163 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 164 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 165 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 166 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 167 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 168 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 169 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 170 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 171 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 172 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 173 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 174 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 175 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 176 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 179 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 181 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 183 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 184 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 185 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 186 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 193 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 196 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 198 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 199 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 200 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 207 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 208 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 209 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 210 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 211 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 212 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 214 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 215 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 216 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 218 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 222 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 224 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 225 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 226 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 228 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 229 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 230 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 231 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 232 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 233 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 234 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 235 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 236 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 237 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 238 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 239 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 240 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 242 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 243 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 244 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 245 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 246 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 247 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 248 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 249 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 250 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 252 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 253 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 254 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 255 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 256 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 257 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 258 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 259 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 261 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 262 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 263 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 264 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 265 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 266 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 271 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 272 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 273 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 274 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 275 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 276 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 277 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 278 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 279 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 281 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 282 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 284 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 286 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 287 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 288 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 289 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 290 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 291 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 292 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 293 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 294 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 295 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 296 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 297 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 298 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 299 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 300 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 301 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 302 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 303 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 304 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 305 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 306 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 365 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 366 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 367 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 368 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 372 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 373 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 374 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 375 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 376 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 377 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 378 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 379 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 380 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 381 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 382 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 383 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 384 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 385 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 386 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 387 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 388 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 389 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 390 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 391 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 392 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 393 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 394 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 395 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 396 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 397 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 398 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 399 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 400 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 401 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 402 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 403 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 404 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 405 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 406 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 407 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 408 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 409 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 410 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 411 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 412 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 413 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 414 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 415 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 416 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 417 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 418 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 419 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 420 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 421 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 422 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 423 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 424 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 425 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 426 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 427 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 428 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 429 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 430 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 431 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 432 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 433 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 434 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 504 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 505 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 506 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 507 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 508 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 509 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 510 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 511 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 512 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 513 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 514 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 515 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 516 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 517 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 518 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 519 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 520 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 521 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 522 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 523 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 524 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 525 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 526 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 527 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 528 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 530 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 531 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 532 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 533 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 534 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 535 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 536 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 537 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 538 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 539 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 540 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 541 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 542 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 543 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 544 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 545 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 547 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 549 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 550 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 551 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 552 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 553 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 554 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 555 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 556 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 557 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 558 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 559 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 560 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 561 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 562 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 563 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 564 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 565 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 566 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 567 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 568 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 569 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 570 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 571 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 572 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 573 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 574 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 575 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 576 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 577 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 578 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 579 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 580 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 581 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 582 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 583 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 584 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 585 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 586 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 587 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 588 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 589 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 590 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 591 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 592 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 593 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 594 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 595 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 596 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 597 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 598 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 599 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 600 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 601 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 602 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 603 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 604 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.4 |
| Metatranscriptomes | 0 |
| Isolates | 15.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13 |
| Nodule | 12.4 |
| Rhizoplane | 5.99 |
| Rhizosphere | 57.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1010209 | 3300002070 | Bacteria | 1221 |
| 2 | JGI24742J22300_10009328 | 3300002244 | Bacteria | 1619 |
| 3 | JGI25406J46586_10001420 | 3300003203 | Bacteria | 11290 |
| 4 | JGI25153J46596_10000476 | 3300003215 | Bacteria | 25668 |
| 5 | JGI25153J46596_10001154 | 3300003215 | Bacteria | 15990 |
| 6 | JGI25153J46596_10003343 | 3300003215 | Bacteria | 9004 |
| 7 | JGI25153J46596_10004553 | 3300003215 | Bacteria | 7444 |
| 8 | JGI25153J46596_10011871 | 3300003215 | Bacteria | 3816 |
| 9 | JGI25153J46596_10013642 | 3300003215 | Bacteria | 3422 |
| 10 | rootH2_10017704 | 3300003320 | Bacteria | 1046 |
| 11 | rootH2_10132730 | 3300003320 | Bacteria | 1046 |
| 12 | rootH2_10283654 | 3300003320 | Bacteria | 1059 |
| 13 | rootL2_10131868 | 3300003322 | Bacteria | 3866 |
| 14 | JGI25160J50197_1000874 | 3300003354 | Bacteria | 15930 |
| 15 | JGI25160J50197_1002069 | 3300003354 | Bacteria | 9546 |
| 16 | JGI25160J50197_1047014 | 3300003354 | Bacteria | 942 |
| 17 | JGI25404J52841_10014306 | 3300003659 | Bacteria | 1721 |
| 18 | Ga0055526_1018859 | 3300003771 | Bacteria | 2547 |
| 19 | Ga0055524_1054952 | 3300003775 | Bacteria | 868 |
| 20 | Ga0055531_10004147 | 3300003794 | Bacteria | 8950 |
| 21 | Ga0055543_1026444 | 3300004625 | Bacteria | 1032 |
| 22 | Ga0055543_1039447 | 3300004625 | Bacteria | 801 |
| 23 | Ga0065165_1001382 | 3300005262 | Bacteria | 26647 |
| 24 | Ga0065165_1005174 | 3300005262 | Bacteria | 7533 |
| 25 | Ga0065165_1007497 | 3300005262 | Bacteria | 5345 |
| 26 | Ga0065715_10177401 | 3300005293 | Bacteria | 1501 |
| 27 | Ga0070658_10037739 | 3300005327 | Bacteria | 3895 |
| 28 | Ga0070658_10068536 | 3300005327 | Bacteria | 2900 |
| 29 | Ga0070658_10676070 | 3300005327 | Bacteria | 896 |
| 30 | Ga0070676_10187764 | 3300005328 | Bacteria | 1347 |
| 31 | Ga0070676_10222772 | 3300005328 | Bacteria | 1247 |
| 32 | Ga0070683_100003848 | 3300005329 | Bacteria | 12266 |
| 33 | Ga0070670_100243984 | 3300005331 | Bacteria | 1564 |
| 34 | Ga0070670_100443514 | 3300005331 | Bacteria | 1150 |
| 35 | Ga0068869_100042626 | 3300005334 | Bacteria | 3254 |
| 36 | Ga0068869_100046137 | 3300005334 | Bacteria | 3141 |
| 37 | Ga0068869_100623999 | 3300005334 | Bacteria | 913 |
| 38 | Ga0070666_10056060 | 3300005335 | Bacteria | 2661 |
| 39 | Ga0070680_100013845 | 3300005336 | Bacteria | 6292 |
| 40 | Ga0070680_100018157 | 3300005336 | Bacteria | 5556 |
| 41 | Ga0070680_100524730 | 3300005336 | Bacteria | 1014 |
| 42 | Ga0070682_100095905 | 3300005337 | Bacteria | 1948 |
| 43 | Ga0068868_100147989 | 3300005338 | Bacteria | 1932 |
| 44 | Ga0068868_100174197 | 3300005338 | Bacteria | 1782 |
| 45 | Ga0068868_100382848 | 3300005338 | Bacteria | 1211 |
| 46 | Ga0068868_100455915 | 3300005338 | Bacteria | 1113 |
| 47 | Ga0070689_100148809 | 3300005340 | Bacteria | 1887 |
| 48 | Ga0070689_100193978 | 3300005340 | Bacteria | 1655 |
| 49 | Ga0070661_100072219 | 3300005344 | Bacteria | 2539 |
| 50 | Ga0070661_100213456 | 3300005344 | Bacteria | 1478 |
| 51 | Ga0070661_100943411 | 3300005344 | Bacteria | 714 |
| 52 | Ga0070668_100029460 | 3300005347 | Bacteria | 4170 |
| 53 | Ga0070668_100093136 | 3300005347 | Bacteria | 2377 |
| 54 | Ga0070668_100201866 | 3300005347 | Bacteria | 1632 |
| 55 | Ga0070668_100245523 | 3300005347 | Bacteria | 1484 |
| 56 | Ga0070668_100254287 | 3300005347 | Bacteria | 1459 |
| 57 | Ga0070669_100073703 | 3300005353 | Bacteria | 2530 |
| 58 | Ga0070669_100308564 | 3300005353 | Bacteria | 1274 |
| 59 | Ga0070669_100412469 | 3300005353 | Bacteria | 1107 |
| 60 | Ga0070675_100143838 | 3300005354 | Bacteria | 2040 |
| 61 | Ga0070671_100006368 | 3300005355 | Bacteria | 9425 |
| 62 | Ga0070671_100398834 | 3300005355 | Bacteria | 1177 |
| 63 | Ga0070674_100076493 | 3300005356 | Bacteria | 2380 |
| 64 | Ga0070674_100244574 | 3300005356 | Bacteria | 1406 |
| 65 | Ga0070688_100452898 | 3300005365 | Bacteria | 960 |
| 66 | Ga0070659_100239995 | 3300005366 | Bacteria | 1499 |
| 67 | Ga0070659_100537331 | 3300005366 | Bacteria | 1000 |
| 68 | Ga0070659_100647809 | 3300005366 | Bacteria | 911 |
| 69 | Ga0070667_100133687 | 3300005367 | Bacteria | 2167 |
| 70 | Ga0070667_100541259 | 3300005367 | Bacteria | 1070 |
| 71 | Ga0070709_10035930 | 3300005434 | Bacteria | 3014 |
| 72 | Ga0070709_10193898 | 3300005434 | Bacteria | 1435 |
| 73 | Ga0070709_10393134 | 3300005434 | Bacteria | 1034 |
| 74 | Ga0070714_101160800 | 3300005435 | Bacteria | 753 |
| 75 | Ga0070713_100450371 | 3300005436 | Bacteria | 1209 |
| 76 | Ga0070710_10472116 | 3300005437 | Bacteria | 854 |
| 77 | Ga0070701_10272194 | 3300005438 | Bacteria | 1031 |
| 78 | Ga0070711_100071519 | 3300005439 | Bacteria | 2445 |
| 79 | Ga0070705_100069562 | 3300005440 | Bacteria | 2123 |
| 80 | Ga0070705_100255437 | 3300005440 | Bacteria | 1233 |
| 81 | Ga0070708_100015641 | 3300005445 | Bacteria | 6271 |
| 82 | Ga0070708_100137566 | 3300005445 | Bacteria | 2264 |
| 83 | Ga0070663_100059790 | 3300005455 | Bacteria | 2739 |
| 84 | Ga0070663_100061793 | 3300005455 | Bacteria | 2698 |
| 85 | Ga0070663_100075935 | 3300005455 | Bacteria | 2456 |
| 86 | Ga0070663_100147104 | 3300005455 | Bacteria | 1803 |
| 87 | Ga0070663_100164837 | 3300005455 | Bacteria | 1708 |
| 88 | Ga0070663_100222098 | 3300005455 | Bacteria | 1484 |
| 89 | Ga0070663_100813719 | 3300005455 | Bacteria | 802 |
| 90 | Ga0070678_100123878 | 3300005456 | Bacteria | 2043 |
| 91 | Ga0070678_100181178 | 3300005456 | Bacteria | 1724 |
| 92 | Ga0070662_100021115 | 3300005457 | Bacteria | 4443 |
| 93 | Ga0070662_100080814 | 3300005457 | Bacteria | 2420 |
| 94 | Ga0070662_100651254 | 3300005457 | Bacteria | 889 |
| 95 | Ga0070681_10051259 | 3300005458 | Bacteria | 4117 |
| 96 | Ga0070681_10132380 | 3300005458 | Bacteria | 2426 |
| 97 | Ga0070681_10429181 | 3300005458 | Bacteria | 1234 |
| 98 | Ga0068867_100044046 | 3300005459 | Bacteria | 3268 |
| 99 | Ga0068867_100324494 | 3300005459 | Bacteria | 1276 |
| 100 | Ga0068867_100703553 | 3300005459 | Bacteria | 892 |
| 101 | Ga0070685_10028473 | 3300005466 | Bacteria | 3095 |
| 102 | Ga0070685_10223924 | 3300005466 | Bacteria | 1234 |
| 103 | Ga0070706_100011186 | 3300005467 | Bacteria | 8332 |
| 104 | Ga0070706_100097360 | 3300005467 | Unclassified | 2733 |
| 105 | Ga0070707_100179371 | 3300005468 | Bacteria | 2065 |
| 106 | Ga0070698_100090792 | 3300005471 | Bacteria | 3037 |
| 107 | Ga0070698_100228557 | 3300005471 | Bacteria | 1794 |
| 108 | Ga0070699_100098649 | 3300005518 | Bacteria | 2560 |
| 109 | Ga0070679_100008868 | 3300005530 | Bacteria | 9492 |
| 110 | Ga0070684_100011240 | 3300005535 | Bacteria | 7127 |
| 111 | Ga0070684_100115242 | 3300005535 | Bacteria | 2413 |
| 112 | Ga0070684_100179997 | 3300005535 | Bacteria | 1922 |
| 113 | Ga0070684_100269786 | 3300005535 | Bacteria | 1557 |
| 114 | Ga0068853_100129622 | 3300005539 | Bacteria | 2257 |
| 115 | Ga0068853_100135576 | 3300005539 | Bacteria | 2206 |
| 116 | Ga0068853_100149354 | 3300005539 | Bacteria | 2102 |
| 117 | Ga0068853_100444314 | 3300005539 | Bacteria | 1219 |
| 118 | Ga0068853_100571092 | 3300005539 | Bacteria | 1072 |
| 119 | Ga0070672_100017103 | 3300005543 | Bacteria | 5212 |
| 120 | Ga0070672_100213424 | 3300005543 | Bacteria | 1617 |
| 121 | Ga0070695_100193314 | 3300005545 | Bacteria | 1450 |
| 122 | Ga0070696_100461411 | 3300005546 | Bacteria | 1004 |
| 123 | Ga0070693_100023629 | 3300005547 | Bacteria | 3288 |
| 124 | Ga0070693_100266035 | 3300005547 | Bacteria | 1142 |
| 125 | Ga0070665_100048108 | 3300005548 | Bacteria | 4282 |
| 126 | Ga0070665_100063529 | 3300005548 | Bacteria | 3702 |
| 127 | Ga0070665_100143997 | 3300005548 | Bacteria | 2387 |
| 128 | Ga0070665_100297744 | 3300005548 | Bacteria | 1616 |
| 129 | Ga0070665_100308663 | 3300005548 | Bacteria | 1585 |
| 130 | Ga0070665_100522321 | 3300005548 | Bacteria | 1199 |
| 131 | Ga0070665_100654714 | 3300005548 | Bacteria | 1063 |
| 132 | Ga0068855_100037453 | 3300005563 | Bacteria | 5766 |
| 133 | Ga0068855_100062456 | 3300005563 | Bacteria | 4348 |
| 134 | Ga0068855_100214780 | 3300005563 | Bacteria | 2160 |
| 135 | Ga0068855_100223280 | 3300005563 | Bacteria | 2111 |
| 136 | Ga0068855_101102957 | 3300005563 | Bacteria | 829 |
| 137 | Ga0070664_100253929 | 3300005564 | Bacteria | 1581 |
| 138 | Ga0070664_100334465 | 3300005564 | Bacteria | 1374 |
| 139 | Ga0068857_100173468 | 3300005577 | Bacteria | 1961 |
| 140 | Ga0068857_100215252 | 3300005577 | Bacteria | 1754 |
| 141 | Ga0068854_100104017 | 3300005578 | Bacteria | 2132 |
| 142 | Ga0068854_100511366 | 3300005578 | Bacteria | 1013 |
| 143 | Ga0068856_100048216 | 3300005614 | Bacteria | 4196 |
| 144 | Ga0068856_100173953 | 3300005614 | Bacteria | 2166 |
| 145 | Ga0068856_100187899 | 3300005614 | Bacteria | 2080 |
| 146 | Ga0070702_100082084 | 3300005615 | Bacteria | 1933 |
| 147 | Ga0068852_100099808 | 3300005616 | Bacteria | 2618 |
| 148 | Ga0068852_100142897 | 3300005616 | Bacteria | 2217 |
| 149 | Ga0068852_100320270 | 3300005616 | Bacteria | 1506 |
| 150 | Ga0068852_100462691 | 3300005616 | Bacteria | 1258 |
| 151 | Ga0068852_100740399 | 3300005616 | Bacteria | 995 |
| 152 | Ga0068859_100131914 | 3300005617 | Bacteria | 2570 |
| 153 | Ga0068859_100292377 | 3300005617 | Bacteria | 1722 |
| 154 | Ga0068859_100353023 | 3300005617 | Bacteria | 1565 |
| 155 | Ga0068859_100474172 | 3300005617 | Bacteria | 1347 |
| 156 | Ga0068864_100391349 | 3300005618 | Bacteria | 1319 |
| 157 | Ga0068866_10054663 | 3300005718 | Bacteria | 2047 |
| 158 | Ga0068866_10153029 | 3300005718 | Bacteria | 1338 |
| 159 | Ga0068861_100020526 | 3300005719 | Bacteria | 4735 |
| 160 | Ga0068861_100063438 | 3300005719 | Bacteria | 2840 |
| 161 | Ga0068861_100419044 | 3300005719 | Bacteria | 1193 |
| 162 | Ga0068861_100667086 | 3300005719 | Bacteria | 962 |
| 163 | Ga0068863_100516105 | 3300005841 | Bacteria | 1178 |
| 164 | Ga0068858_100091500 | 3300005842 | Bacteria | 2831 |
| 165 | Ga0068858_100142639 | 3300005842 | Bacteria | 2249 |
| 166 | Ga0068858_100325974 | 3300005842 | Bacteria | 1468 |
| 167 | Ga0068860_100161081 | 3300005843 | Bacteria | 2163 |
| 168 | Ga0068860_100250233 | 3300005843 | Bacteria | 1726 |
| 169 | Ga0068860_100426867 | 3300005843 | Bacteria | 1315 |
| 170 | Ga0068860_100501595 | 3300005843 | Bacteria | 1212 |
| 171 | Ga0068862_100045914 | 3300005844 | Bacteria | 3728 |
| 172 | Ga0068862_100062334 | 3300005844 | Bacteria | 3206 |
| 173 | Ga0068862_100117710 | 3300005844 | Bacteria | 2338 |
| 174 | Ga0068862_100183997 | 3300005844 | Bacteria | 1877 |
| 175 | Ga0068862_100227586 | 3300005844 | Bacteria | 1690 |
| 176 | Ga0068862_100900856 | 3300005844 | Bacteria | 869 |
| 177 | Ga0081455_10015336 | 3300005937 | Bacteria | 7451 |
| 178 | Ga0081455_10033478 | 3300005937 | Bacteria | 4618 |
| 179 | Ga0081455_10181824 | 3300005937 | Bacteria | 1591 |
| 180 | Ga0081538_10103094 | 3300005981 | Bacteria | 1429 |
| 181 | Ga0081540_1004140 | 3300005983 | Bacteria | 11188 |
| 182 | Ga0081540_1005687 | 3300005983 | Bacteria | 9252 |
| 183 | Ga0081540_1010925 | 3300005983 | Bacteria | 6098 |
| 184 | Ga0081540_1016563 | 3300005983 | Bacteria | 4604 |
| 185 | Ga0081540_1017555 | 3300005983 | Bacteria | 4426 |
| 186 | Ga0081540_1031580 | 3300005983 | Bacteria | 2909 |
| 187 | Ga0081540_1079967 | 3300005983 | Bacteria | 1475 |
| 188 | Ga0081539_10000199 | 3300005985 | Bacteria | 139305 |
| 189 | Ga0081539_10019345 | 3300005985 | Bacteria | 4667 |
| 190 | Ga0070717_10406377 | 3300006028 | Bacteria | 1224 |
| 191 | Ga0075365_10057257 | 3300006038 | Bacteria | 2593 |
| 192 | Ga0075365_10139884 | 3300006038 | Bacteria | 1680 |
| 193 | Ga0075365_10146950 | 3300006038 | Bacteria | 1639 |
| 194 | Ga0075365_10190875 | 3300006038 | Bacteria | 1434 |
| 195 | Ga0075368_10038514 | 3300006042 | Bacteria | 1872 |
| 196 | Ga0075363_100011602 | 3300006048 | Bacteria | 4225 |
| 197 | Ga0075363_100018491 | 3300006048 | Bacteria | 3473 |
| 198 | Ga0075363_100072184 | 3300006048 | Bacteria | 1877 |
| 199 | Ga0075363_100108190 | 3300006048 | Bacteria | 1543 |
| 200 | Ga0075364_10034925 | 3300006051 | Bacteria | 3247 |
| 201 | Ga0075364_10175971 | 3300006051 | Bacteria | 1447 |
| 202 | Ga0075364_10201057 | 3300006051 | Bacteria | 1350 |
| 203 | Ga0075364_10495069 | 3300006051 | Bacteria | 836 |
| 204 | Ga0070712_100255780 | 3300006175 | Bacteria | 1401 |
| 205 | Ga0075362_10117977 | 3300006177 | Bacteria | 1254 |
| 206 | Ga0075362_10151954 | 3300006177 | Bacteria | 1111 |
| 207 | Ga0075367_10002456 | 3300006178 | Bacteria | 8481 |
| 208 | Ga0075367_10012875 | 3300006178 | Bacteria | 4479 |
| 209 | Ga0075367_10020273 | 3300006178 | Bacteria | 3699 |
| 210 | Ga0075367_10042081 | 3300006178 | Bacteria | 2672 |
| 211 | Ga0075367_10509307 | 3300006178 | Bacteria | 764 |
| 212 | Ga0075369_10076970 | 3300006186 | Bacteria | 1475 |
| 213 | Ga0075369_10091087 | 3300006186 | Bacteria | 1361 |
| 214 | Ga0075369_10157575 | 3300006186 | Bacteria | 1040 |
| 215 | Ga0075366_10010538 | 3300006195 | Bacteria | 5190 |
| 216 | Ga0097621_100061776 | 3300006237 | Bacteria | 3073 |
| 217 | Ga0097621_100316706 | 3300006237 | Bacteria | 1381 |
| 218 | Ga0097621_100423091 | 3300006237 | Bacteria | 1196 |
| 219 | Ga0075370_10034975 | 3300006353 | Bacteria | 2818 |
| 220 | Ga0075370_10053723 | 3300006353 | Bacteria | 2286 |
| 221 | Ga0075370_10126665 | 3300006353 | Bacteria | 1489 |
| 222 | Ga0075370_10246371 | 3300006353 | Bacteria | 1058 |
| 223 | Ga0068871_100051768 | 3300006358 | Bacteria | 3324 |
| 224 | Ga0068871_100295356 | 3300006358 | Bacteria | 1421 |
| 225 | Ga0068871_100388701 | 3300006358 | Bacteria | 1240 |
| 226 | Ga0068871_100614222 | 3300006358 | Bacteria | 990 |
| 227 | Ga0068871_100674142 | 3300006358 | Bacteria | 945 |
| 228 | Ga0075428_100016072 | 3300006844 | Bacteria | 8275 |
| 229 | Ga0075430_100106259 | 3300006846 | Bacteria | 2342 |
| 230 | Ga0075430_100674765 | 3300006846 | Bacteria | 852 |
| 231 | Ga0075431_100747870 | 3300006847 | Bacteria | 953 |
| 232 | Ga0075433_10065291 | 3300006852 | Bacteria | 3192 |
| 233 | Ga0075434_100227727 | 3300006871 | Bacteria | 1883 |
| 234 | Ga0068865_100064851 | 3300006881 | Bacteria | 2571 |
| 235 | Ga0097620_100131926 | 3300006931 | Bacteria | 2570 |
| 236 | Ga0097620_100292378 | 3300006931 | Bacteria | 1722 |
| 237 | Ga0097620_100353012 | 3300006931 | Bacteria | 1565 |
| 238 | Ga0097620_100474217 | 3300006931 | Bacteria | 1347 |
| 239 | Ga0099825_1023676 | 3300006941 | Bacteria | 3718 |
| 240 | Ga0099824_1009133 | 3300006942 | Bacteria | 12334 |
| 241 | Ga0099822_1041193 | 3300006943 | Bacteria | 2507 |
| 242 | Ga0075435_100137799 | 3300007076 | Bacteria | 2045 |
| 243 | Ga0099795_10028710 | 3300007788 | Bacteria | 1895 |
| 244 | Ga0105240_10008787 | 3300009093 | Bacteria | 14390 |
| 245 | Ga0105240_10016654 | 3300009093 | Bacteria | 9942 |
| 246 | Ga0105240_10033152 | 3300009093 | Bacteria | 6675 |
| 247 | Ga0105240_10182042 | 3300009093 | Bacteria | 2479 |
| 248 | Ga0105240_10194966 | 3300009093 | Bacteria | 2379 |
| 249 | Ga0105240_10415158 | 3300009093 | Bacteria | 1513 |
| 250 | Ga0105240_11020604 | 3300009093 | Bacteria | 884 |
| 251 | Ga0105240_11106718 | 3300009093 | Bacteria | 843 |
| 252 | Ga0105245_10108637 | 3300009098 | Bacteria | 2576 |
| 253 | Ga0105245_10201630 | 3300009098 | Bacteria | 1911 |
| 254 | Ga0105245_10293884 | 3300009098 | Bacteria | 1592 |
| 255 | Ga0105245_10364213 | 3300009098 | Bacteria | 1436 |
| 256 | Ga0105245_10455014 | 3300009098 | Bacteria | 1289 |
| 257 | Ga0105245_11706360 | 3300009098 | Bacteria | 682 |
| 258 | Ga0105247_10032849 | 3300009101 | Bacteria | 3153 |
| 259 | Ga0105247_10096820 | 3300009101 | Bacteria | 1881 |
| 260 | Ga0105247_10150998 | 3300009101 | Bacteria | 1531 |
| 261 | Ga0105247_10189651 | 3300009101 | Bacteria | 1376 |
| 262 | Ga0105247_10473920 | 3300009101 | Bacteria | 907 |
| 263 | Ga0114129_10068162 | 3300009147 | Bacteria | 4961 |
| 264 | Ga0114129_10362293 | 3300009147 | Bacteria | 1918 |
| 265 | Ga0105243_10255677 | 3300009148 | Bacteria | 1566 |
| 266 | Ga0105243_10328799 | 3300009148 | Bacteria | 1395 |
| 267 | Ga0105243_10329267 | 3300009148 | Bacteria | 1395 |
| 268 | Ga0105243_10602031 | 3300009148 | Bacteria | 1058 |
| 269 | Ga0105241_10020802 | 3300009174 | Bacteria | 4850 |
| 270 | Ga0105241_10223481 | 3300009174 | Bacteria | 1584 |
| 271 | Ga0105241_10752413 | 3300009174 | Bacteria | 894 |
| 272 | Ga0105242_10137338 | 3300009176 | Bacteria | 2117 |
| 273 | Ga0105242_10743671 | 3300009176 | Bacteria | 964 |
| 274 | Ga0105242_10754450 | 3300009176 | Bacteria | 958 |
| 275 | Ga0105242_11377082 | 3300009176 | Bacteria | 732 |
| 276 | Ga0105248_10037450 | 3300009177 | Bacteria | 5426 |
| 277 | Ga0105248_10144983 | 3300009177 | Bacteria | 2679 |
| 278 | Ga0105248_10476762 | 3300009177 | Bacteria | 1406 |
| 279 | Ga0105248_10658129 | 3300009177 | Bacteria | 1182 |
| 280 | Ga0105237_10114688 | 3300009545 | Bacteria | 2687 |
| 281 | Ga0105237_10218378 | 3300009545 | Bacteria | 1907 |
| 282 | Ga0105237_10418915 | 3300009545 | Bacteria | 1345 |
| 283 | Ga0105237_10443511 | 3300009545 | Bacteria | 1304 |
| 284 | Ga0105237_10467682 | 3300009545 | Bacteria | 1267 |
| 285 | Ga0105237_10610184 | 3300009545 | Bacteria | 1098 |
| 286 | Ga0105238_10008642 | 3300009551 | Bacteria | 10191 |
| 287 | Ga0105238_10029381 | 3300009551 | Bacteria | 5600 |
| 288 | Ga0105238_10131091 | 3300009551 | Bacteria | 2485 |
| 289 | Ga0105238_10225419 | 3300009551 | Bacteria | 1851 |
| 290 | Ga0105238_10228161 | 3300009551 | Bacteria | 1839 |
| 291 | Ga0105238_10359464 | 3300009551 | Bacteria | 1445 |
| 292 | Ga0105238_10895422 | 3300009551 | Bacteria | 906 |
| 293 | Ga0105249_10145325 | 3300009553 | Bacteria | 2278 |
| 294 | Ga0105249_10226941 | 3300009553 | Bacteria | 1841 |
| 295 | Ga0105249_10768991 | 3300009553 | Bacteria | 1026 |
| 296 | Ga0105249_11091964 | 3300009553 | Bacteria | 868 |
| 297 | Ga0105239_10047131 | 3300010375 | Bacteria | 4723 |
| 298 | Ga0105239_10085044 | 3300010375 | Bacteria | 3485 |
| 299 | Ga0105239_10099657 | 3300010375 | Bacteria | 3212 |
| 300 | Ga0105239_10200628 | 3300010375 | Bacteria | 2235 |
| 301 | Ga0105239_10359743 | 3300010375 | Bacteria | 1644 |
| 302 | Ga0105239_10435494 | 3300010375 | Bacteria | 1486 |
| 303 | Ga0105239_10661858 | 3300010375 | Bacteria | 1193 |
| 304 | Ga0105239_11596544 | 3300010375 | Bacteria | 754 |
| 305 | Ga0105246_10138536 | 3300011119 | Bacteria | 1827 |
| 306 | Ga0105246_10172292 | 3300011119 | Bacteria | 1659 |
| 307 | Ga0105246_10186368 | 3300011119 | Bacteria | 1602 |
| 308 | Ga0105246_10410177 | 3300011119 | Bacteria | 1127 |
| 309 | Ga0105246_10581249 | 3300011119 | Bacteria | 965 |
| 310 | Ga0157370_10031400 | 3300013104 | Bacteria | 5196 |
| 311 | Ga0157370_10206147 | 3300013104 | Bacteria | 1823 |
| 312 | Ga0157370_10430444 | 3300013104 | Bacteria | 1213 |
| 313 | Ga0157369_10007473 | 3300013105 | Bacteria | 12579 |
| 314 | Ga0157369_10007917 | 3300013105 | Bacteria | 12218 |
| 315 | Ga0157369_10122107 | 3300013105 | Bacteria | 2763 |
| 316 | Ga0157369_10124770 | 3300013105 | Bacteria | 2731 |
| 317 | Ga0157369_10211938 | 3300013105 | Bacteria | 2030 |
| 318 | Ga0157369_10631350 | 3300013105 | Bacteria | 1105 |
| 319 | Ga0157374_10062596 | 3300013296 | Bacteria | 3488 |
| 320 | Ga0157374_10175385 | 3300013296 | Bacteria | 2092 |
| 321 | Ga0157374_10341546 | 3300013296 | Bacteria | 1486 |
| 322 | Ga0157374_10489587 | 3300013296 | Bacteria | 1233 |
| 323 | Ga0157378_10104317 | 3300013297 | Bacteria | 2591 |
| 324 | Ga0157378_10115924 | 3300013297 | Bacteria | 2463 |
| 325 | Ga0163162_10028934 | 3300013306 | Bacteria | 5484 |
| 326 | Ga0163162_10077525 | 3300013306 | Bacteria | 3387 |
| 327 | Ga0163162_10202167 | 3300013306 | Bacteria | 2115 |
| 328 | Ga0163162_10290394 | 3300013306 | Bacteria | 1767 |
| 329 | Ga0163162_10383251 | 3300013306 | Bacteria | 1539 |
| 330 | Ga0163162_10517807 | 3300013306 | Bacteria | 1322 |
| 331 | Ga0157372_10012959 | 3300013307 | Bacteria | 8891 |
| 332 | Ga0157372_10092414 | 3300013307 | Bacteria | 3442 |
| 333 | Ga0157372_11178271 | 3300013307 | Bacteria | 886 |
| 334 | Ga0157375_10017613 | 3300013308 | Bacteria | 6451 |
| 335 | Ga0157375_10101448 | 3300013308 | Bacteria | 2961 |
| 336 | Ga0163163_10033417 | 3300014325 | Bacteria | 4976 |
| 337 | Ga0163163_10058631 | 3300014325 | Bacteria | 3807 |
| 338 | Ga0163163_10218554 | 3300014325 | Bacteria | 1954 |
| 339 | Ga0163163_10280029 | 3300014325 | Bacteria | 1719 |
| 340 | Ga0163163_10292201 | 3300014325 | Bacteria | 1682 |
| 341 | Ga0163163_10504256 | 3300014325 | Bacteria | 1272 |
| 342 | Ga0157380_10149717 | 3300014326 | Bacteria | 2016 |
| 343 | Ga0157380_10896436 | 3300014326 | Bacteria | 912 |
| 344 | Ga0157377_10130905 | 3300014745 | Bacteria | 1532 |
| 345 | Ga0157377_10151352 | 3300014745 | Bacteria | 1435 |
| 346 | Ga0157377_10248961 | 3300014745 | Bacteria | 1151 |
| 347 | Ga0157377_10469523 | 3300014745 | Bacteria | 873 |
| 348 | Ga0157379_10240107 | 3300014968 | Bacteria | 1643 |
| 349 | Ga0157379_10268995 | 3300014968 | Bacteria | 1550 |
| 350 | Ga0157379_10567827 | 3300014968 | Bacteria | 1057 |
| 351 | Ga0157379_10745659 | 3300014968 | Bacteria | 922 |
| 352 | Ga0157376_10005581 | 3300014969 | Bacteria | 8802 |
| 353 | Ga0157376_10127559 | 3300014969 | Bacteria | 2265 |
| 354 | Ga0157376_10274276 | 3300014969 | Bacteria | 1586 |
| 355 | Ga0163161_10288154 | 3300017792 | Bacteria | 1290 |
| 356 | Ga0163161_10340276 | 3300017792 | Bacteria | 1190 |
| 357 | Ga0163161_10399603 | 3300017792 | Bacteria | 1102 |
| 358 | Ga0214544_1003958 | 3300021320 | Bacteria | 30115 |
| 359 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 360 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 361 | Ga0214543_1000013 | 3300021327 | Bacteria | 329117 |
| 362 | Ga0213874_10002013 | 3300021377 | Bacteria | 4292 |
| 363 | Ga0213876_10017851 | 3300021384 | Bacteria | 3743 |
| 364 | Ga0207425_1008878 | 3300025245 | Bacteria | 2537 |
| 365 | Ga0209148_1000493 | 3300025254 | Bacteria | 40546 |
| 366 | Ga0209233_1020253 | 3300025261 | Bacteria | 1748 |
| 367 | Ga0209455_1004278 | 3300025272 | Bacteria | 4733 |
| 368 | Ga0209564_1005921 | 3300025295 | Bacteria | 6772 |
| 369 | Ga0209564_1007197 | 3300025295 | Bacteria | 5797 |
| 370 | Ga0209758_1000100 | 3300025297 | Bacteria | 227948 |
| 371 | Ga0209758_1000138 | 3300025297 | Bacteria | 175187 |
| 372 | Ga0209758_1001321 | 3300025297 | Bacteria | 30110 |
| 373 | Ga0209758_1012135 | 3300025297 | Bacteria | 4865 |
| 374 | Ga0209758_1034945 | 3300025297 | Bacteria | 1989 |
| 375 | Ga0209758_1117037 | 3300025297 | Bacteria | 726 |
| 376 | Ga0209256_1003445 | 3300025299 | Bacteria | 11092 |
| 377 | Ga0207426_1000382 | 3300025302 | Bacteria | 76034 |
| 378 | Ga0207426_1001031 | 3300025302 | Bacteria | 26635 |
| 379 | Ga0207426_1008616 | 3300025302 | Bacteria | 4096 |
| 380 | Ga0209257_1001637 | 3300025304 | Bacteria | 25658 |
| 381 | Ga0209257_1009407 | 3300025304 | Bacteria | 5247 |
| 382 | Ga0207656_10366467 | 3300025321 | Bacteria | 721 |
| 383 | Ga0207688_10074810 | 3300025901 | Bacteria | 1927 |
| 384 | Ga0207688_10278094 | 3300025901 | Bacteria | 1019 |
| 385 | Ga0207680_10128093 | 3300025903 | Bacteria | 1669 |
| 386 | Ga0207680_10360301 | 3300025903 | Bacteria | 1023 |
| 387 | Ga0207647_10001578 | 3300025904 | Bacteria | 17487 |
| 388 | Ga0207685_10175985 | 3300025905 | Bacteria | 988 |
| 389 | Ga0207699_10032852 | 3300025906 | Bacteria | 2927 |
| 390 | Ga0207699_10134629 | 3300025906 | Bacteria | 1617 |
| 391 | Ga0207645_10072377 | 3300025907 | Bacteria | 2206 |
| 392 | Ga0207645_10228146 | 3300025907 | Bacteria | 1229 |
| 393 | Ga0207705_10163160 | 3300025909 | Bacteria | 1675 |
| 394 | Ga0207705_10363213 | 3300025909 | Bacteria | 1117 |
| 395 | Ga0207684_10083165 | 3300025910 | Unclassified | 2726 |
| 396 | Ga0207684_10090601 | 3300025910 | Unclassified | 2605 |
| 397 | Ga0207654_10142390 | 3300025911 | Bacteria | 1530 |
| 398 | Ga0207654_10409186 | 3300025911 | Bacteria | 945 |
| 399 | Ga0207707_10003484 | 3300025912 | Bacteria | 13920 |
| 400 | Ga0207707_10012153 | 3300025912 | Bacteria | 7483 |
| 401 | Ga0207707_10094903 | 3300025912 | Bacteria | 2607 |
| 402 | Ga0207707_10109988 | 3300025912 | Bacteria | 2408 |
| 403 | Ga0207695_10070550 | 3300025913 | Bacteria | 3571 |
| 404 | Ga0207695_10229168 | 3300025913 | Bacteria | 1763 |
| 405 | Ga0207695_10239287 | 3300025913 | Bacteria | 1717 |
| 406 | Ga0207695_10367685 | 3300025913 | Bacteria | 1324 |
| 407 | Ga0207695_10440173 | 3300025913 | Bacteria | 1187 |
| 408 | Ga0207695_10570324 | 3300025913 | Bacteria | 1013 |
| 409 | Ga0207671_10056314 | 3300025914 | Bacteria | 2913 |
| 410 | Ga0207671_10190361 | 3300025914 | Bacteria | 1600 |
| 411 | Ga0207671_10295728 | 3300025914 | Bacteria | 1279 |
| 412 | Ga0207693_10666123 | 3300025915 | Bacteria | 808 |
| 413 | Ga0207660_10028263 | 3300025917 | Bacteria | 3835 |
| 414 | Ga0207660_10081504 | 3300025917 | Bacteria | 2378 |
| 415 | Ga0207660_10187752 | 3300025917 | Bacteria | 1608 |
| 416 | Ga0207662_10104871 | 3300025918 | Bacteria | 1756 |
| 417 | Ga0207657_10131553 | 3300025919 | Bacteria | 2050 |
| 418 | Ga0207649_10014953 | 3300025920 | Bacteria | 4355 |
| 419 | Ga0207652_10020700 | 3300025921 | Bacteria | 5421 |
| 420 | Ga0207652_10036127 | 3300025921 | Bacteria | 4176 |
| 421 | Ga0207652_10740390 | 3300025921 | Bacteria | 875 |
| 422 | Ga0207652_10759573 | 3300025921 | Bacteria | 862 |
| 423 | Ga0207646_10062772 | 3300025922 | Unclassified | 3317 |
| 424 | Ga0207646_10137134 | 3300025922 | Bacteria | 2203 |
| 425 | Ga0207681_10077137 | 3300025923 | Bacteria | 2342 |
| 426 | Ga0207681_10352556 | 3300025923 | Bacteria | 1178 |
| 427 | Ga0207681_10495887 | 3300025923 | Bacteria | 999 |
| 428 | Ga0207694_10046482 | 3300025924 | Bacteria | 3355 |
| 429 | Ga0207694_10279479 | 3300025924 | Bacteria | 1371 |
| 430 | Ga0207694_10285487 | 3300025924 | Bacteria | 1356 |
| 431 | Ga0207694_10409220 | 3300025924 | Bacteria | 1129 |
| 432 | Ga0207694_10854811 | 3300025924 | Bacteria | 769 |
| 433 | Ga0207650_10177191 | 3300025925 | Bacteria | 1697 |
| 434 | Ga0207659_10076907 | 3300025926 | Bacteria | 2455 |
| 435 | Ga0207687_10024425 | 3300025927 | Bacteria | 4039 |
| 436 | Ga0207687_10436076 | 3300025927 | Bacteria | 1084 |
| 437 | Ga0207700_10662882 | 3300025928 | Bacteria | 930 |
| 438 | Ga0207644_10016877 | 3300025931 | Bacteria | 4919 |
| 439 | Ga0207644_10193955 | 3300025931 | Bacteria | 1598 |
| 440 | Ga0207644_10273995 | 3300025931 | Bacteria | 1353 |
| 441 | Ga0207690_10205609 | 3300025932 | Bacteria | 1498 |
| 442 | Ga0207706_10205979 | 3300025933 | Bacteria | 1725 |
| 443 | Ga0207706_10312952 | 3300025933 | Bacteria | 1367 |
| 444 | Ga0207706_10518528 | 3300025933 | Bacteria | 1028 |
| 445 | Ga0207706_10552565 | 3300025933 | Bacteria | 991 |
| 446 | Ga0207686_10367153 | 3300025934 | Bacteria | 1088 |
| 447 | Ga0207709_10119033 | 3300025935 | Bacteria | 1780 |
| 448 | Ga0207709_10145177 | 3300025935 | Bacteria | 1636 |
| 449 | Ga0207709_10341498 | 3300025935 | Bacteria | 1127 |
| 450 | Ga0207670_10088217 | 3300025936 | Bacteria | 2187 |
| 451 | Ga0207704_10016841 | 3300025938 | Bacteria | 3769 |
| 452 | Ga0207665_10411969 | 3300025939 | Bacteria | 1031 |
| 453 | Ga0207691_10075742 | 3300025940 | Bacteria | 3033 |
| 454 | Ga0207691_10389425 | 3300025940 | Bacteria | 1189 |
| 455 | Ga0207711_10224504 | 3300025941 | Bacteria | 1719 |
| 456 | Ga0207689_10031197 | 3300025942 | Bacteria | 4439 |
| 457 | Ga0207689_10048889 | 3300025942 | Bacteria | 3489 |
| 458 | Ga0207689_10204505 | 3300025942 | Bacteria | 1630 |
| 459 | Ga0207661_10010365 | 3300025944 | Bacteria | 6707 |
| 460 | Ga0207661_10032194 | 3300025944 | Bacteria | 4059 |
| 461 | Ga0207679_10279869 | 3300025945 | Bacteria | 1430 |
| 462 | Ga0207667_10051148 | 3300025949 | Bacteria | 4357 |
| 463 | Ga0207667_10181197 | 3300025949 | Bacteria | 2163 |
| 464 | Ga0207651_10357531 | 3300025960 | Bacteria | 1232 |
| 465 | Ga0207712_10059409 | 3300025961 | Bacteria | 2706 |
| 466 | Ga0207712_10235403 | 3300025961 | Bacteria | 1472 |
| 467 | Ga0207712_10538069 | 3300025961 | Bacteria | 1003 |
| 468 | Ga0207712_10745625 | 3300025961 | Bacteria | 858 |
| 469 | Ga0207668_10141735 | 3300025972 | Bacteria | 1849 |
| 470 | Ga0207668_10314864 | 3300025972 | Bacteria | 1296 |
| 471 | Ga0207640_10033120 | 3300025981 | Bacteria | 3212 |
| 472 | Ga0207640_10473452 | 3300025981 | Bacteria | 1037 |
| 473 | Ga0207658_10086843 | 3300025986 | Bacteria | 2414 |
| 474 | Ga0207658_10206354 | 3300025986 | Bacteria | 1644 |
| 475 | Ga0207658_10458696 | 3300025986 | Bacteria | 1129 |
| 476 | Ga0207677_10168303 | 3300026023 | Bacteria | 1711 |
| 477 | Ga0207703_10066372 | 3300026035 | Bacteria | 2968 |
| 478 | Ga0207703_10298759 | 3300026035 | Bacteria | 1468 |
| 479 | Ga0207703_10643501 | 3300026035 | Bacteria | 1005 |
| 480 | Ga0207639_10259738 | 3300026041 | Bacteria | 1518 |
| 481 | Ga0207639_10408506 | 3300026041 | Bacteria | 1225 |
| 482 | Ga0207678_10010764 | 3300026067 | Bacteria | 8037 |
| 483 | Ga0207678_10058807 | 3300026067 | Bacteria | 3307 |
| 484 | Ga0207678_10067429 | 3300026067 | Bacteria | 3072 |
| 485 | Ga0207678_10093111 | 3300026067 | Bacteria | 2575 |
| 486 | Ga0207678_10172642 | 3300026067 | Bacteria | 1846 |
| 487 | Ga0207678_10193129 | 3300026067 | Bacteria | 1740 |
| 488 | Ga0207678_10204311 | 3300026067 | Bacteria | 1690 |
| 489 | Ga0207678_10324284 | 3300026067 | Bacteria | 1325 |
| 490 | Ga0207708_10039623 | 3300026075 | Bacteria | 3591 |
| 491 | Ga0207702_10529800 | 3300026078 | Bacteria | 1151 |
| 492 | Ga0207702_10561540 | 3300026078 | Bacteria | 1117 |
| 493 | Ga0207641_10202896 | 3300026088 | Bacteria | 1829 |
| 494 | Ga0207641_10274207 | 3300026088 | Bacteria | 1584 |
| 495 | Ga0207648_10019696 | 3300026089 | Bacteria | 6088 |
| 496 | Ga0207648_10040396 | 3300026089 | Bacteria | 4099 |
| 497 | Ga0207648_10307603 | 3300026089 | Bacteria | 1422 |
| 498 | Ga0207676_10169565 | 3300026095 | Bacteria | 1900 |
| 499 | Ga0207676_10364959 | 3300026095 | Bacteria | 1339 |
| 500 | Ga0207674_10158192 | 3300026116 | Bacteria | 2221 |
| 501 | Ga0207674_10306321 | 3300026116 | Bacteria | 1538 |
| 502 | Ga0207675_100029182 | 3300026118 | Bacteria | 5141 |
| 503 | Ga0207675_100175842 | 3300026118 | Bacteria | 2048 |
| 504 | Ga0207675_100209540 | 3300026118 | Bacteria | 1874 |
| 505 | Ga0207675_100697836 | 3300026118 | Bacteria | 1023 |
| 506 | Ga0207675_100823015 | 3300026118 | Bacteria | 943 |
| 507 | Ga0207683_10045593 | 3300026121 | Bacteria | 3834 |
| 508 | Ga0207683_10093880 | 3300026121 | Bacteria | 2674 |
| 509 | Ga0207683_10122247 | 3300026121 | Bacteria | 2338 |
| 510 | Ga0207683_10176304 | 3300026121 | Bacteria | 1937 |
| 511 | Ga0207683_10219002 | 3300026121 | Bacteria | 1734 |
| 512 | Ga0207683_10562575 | 3300026121 | Bacteria | 1054 |
| 513 | Ga0207683_10599312 | 3300026121 | Bacteria | 1020 |
| 514 | Ga0207683_10746570 | 3300026121 | Bacteria | 908 |
| 515 | Ga0207698_10001629 | 3300026142 | Bacteria | 13078 |
| 516 | Ga0207698_10093367 | 3300026142 | Bacteria | 2470 |
| 517 | Ga0207698_10127349 | 3300026142 | Bacteria | 2168 |
| 518 | Ga0207698_10309172 | 3300026142 | Bacteria | 1475 |
| 519 | Ga0207698_10815153 | 3300026142 | Bacteria | 936 |
| 520 | Ga0209389_1000068 | 3300027296 | Bacteria | 98954 |
| 521 | Ga0209389_1000092 | 3300027296 | Bacteria | 82555 |
| 522 | Ga0209589_1000115 | 3300027357 | Bacteria | 82537 |
| 523 | Ga0209489_100340 | 3300027361 | Bacteria | 82555 |
| 524 | Ga0209489_115015 | 3300027361 | Bacteria | 5028 |
| 525 | Ga0209700_100117 | 3300027363 | Bacteria | 115595 |
| 526 | Ga0268266_10005735 | 3300028379 | Bacteria | 11501 |
| 527 | Ga0268266_10014260 | 3300028379 | Bacteria | 6835 |
| 528 | Ga0268266_10051241 | 3300028379 | Bacteria | 3543 |
| 529 | Ga0268266_10093149 | 3300028379 | Bacteria | 2644 |
| 530 | Ga0268266_10114937 | 3300028379 | Bacteria | 2388 |
| 531 | Ga0268266_10170101 | 3300028379 | Bacteria | 1977 |
| 532 | Ga0268266_10261743 | 3300028379 | Bacteria | 1603 |
| 533 | Ga0268266_10358628 | 3300028379 | Bacteria | 1371 |
| 534 | Ga0268265_10049404 | 3300028380 | Bacteria | 3163 |
| 535 | Ga0268265_10190437 | 3300028380 | Bacteria | 1771 |
| 536 | Ga0268265_10272498 | 3300028380 | Bacteria | 1510 |
| 537 | Ga0268264_10023033 | 3300028381 | Bacteria | 5082 |
| 538 | Ga0268264_10455651 | 3300028381 | Bacteria | 1240 |
| 539 | Ga0268264_10740980 | 3300028381 | Bacteria | 978 |
| 540 | Ga0307517_10000071 | 3300028786 | Bacteria | 138548 |
| 541 | Ga0307517_10336441 | 3300028786 | Bacteria | 827 |
| 542 | Ga0307515_10035411 | 3300028794 | Bacteria | 8123 |
| 543 | Ga0307515_10225215 | 3300028794 | Bacteria | 1682 |
| 544 | Ga0307515_10301631 | 3300028794 | Bacteria | 1286 |
| 545 | Ga0265331_10010876 | 3300031250 | Bacteria | 5005 |
| 546 | Ga0307513_10441231 | 3300031456 | Bacteria | 1028 |
| 547 | Ga0307509_10103714 | 3300031507 | Bacteria | 2871 |
| 548 | Ga0307508_10015804 | 3300031616 | Bacteria | 6878 |
| 549 | Ga0307508_10182003 | 3300031616 | Bacteria | 1704 |
| 550 | Ga0307508_10371132 | 3300031616 | Bacteria | 1022 |
| 551 | Ga0307508_10560934 | 3300031616 | Bacteria | 741 |
| 552 | Ga0265314_10071422 | 3300031711 | Bacteria | 2323 |
| 553 | Ga0265314_10079398 | 3300031711 | Bacteria | 2169 |
| 554 | Ga0265342_10014276 | 3300031712 | Bacteria | 5278 |
| 555 | Ga0316578_10118059 | 3300031728 | Bacteria | 1594 |
| 556 | Ga0307516_10130897 | 3300031730 | Bacteria | 2288 |
| 557 | Ga0307516_10176600 | 3300031730 | Bacteria | 1872 |
| 558 | Ga0307516_10292762 | 3300031730 | Bacteria | 1306 |
| 559 | Ga0307516_10503868 | 3300031730 | Bacteria | 865 |
| 560 | Ga0307516_10508305 | 3300031730 | Bacteria | 859 |
| 561 | Ga0307413_10058019 | 3300031824 | Bacteria | 2370 |
| 562 | Ga0307410_10512020 | 3300031852 | Bacteria | 989 |
| 563 | Ga0307410_10548327 | 3300031852 | Bacteria | 958 |
| 564 | Ga0307409_100122862 | 3300031995 | Bacteria | 2202 |
| 565 | Ga0307409_100164695 | 3300031995 | Bacteria | 1944 |
| 566 | Ga0307416_100148392 | 3300032002 | Bacteria | 2146 |
| 567 | Ga0307416_100480374 | 3300032002 | Bacteria | 1302 |
| 568 | Ga0307416_100985886 | 3300032002 | Bacteria | 945 |
| 569 | Ga0307411_10052156 | 3300032005 | Bacteria | 2673 |
| 570 | Ga0307411_10143569 | 3300032005 | Bacteria | 1763 |
| 571 | Ga0307415_100129334 | 3300032126 | Bacteria | 1908 |
| 572 | Ga0307507_10101429 | 3300033179 | Bacteria | 2407 |
| 573 | Ga0307510_10005071 | 3300033180 | Bacteria | 15630 |
| 574 | Ga0307510_10025489 | 3300033180 | Bacteria | 6817 |
| 575 | Ga0307510_10054066 | 3300033180 | Bacteria | 4212 |
| 576 | Ga0373930_0106668 | 3300034816 | Bacteria | 671 |
| 577 | Ga0373926_0023353 | 3300035083 | Bacteria | 2147 |
| 578 | Ga0373929_0001973 | 3300035085 | Bacteria | 3830 |
| 579 | Ga0373949_0034709 | 3300035090 | Bacteria | 1217 |
| 580 | Ga0373952_0025115 | 3300035092 | Bacteria | 1284 |
| 581 | Ga0373923_0001429 | 3300035111 | Bacteria | 6837 |
| 582 | Ga0373936_0060757 | 3300035113 | Bacteria | 1542 |
| 583 | Ga0373936_0082108 | 3300035113 | Bacteria | 1343 |
| 584 | Ga0373939_0020406 | 3300035114 | Bacteria | 1800 |
| 585 | Ga0373941_0042528 | 3300035115 | Bacteria | 1411 |
| 586 | Ga0373945_0105482 | 3300035116 | Bacteria | 1107 |
| 587 | Ga0373954_0152795 | 3300035118 | Bacteria | 1128 |
| 588 | Ga0373943_0177216 | 3300035170 | Bacteria | 1170 |
| 589 | Ga0373955_0188902 | 3300035172 | Bacteria | 1224 |
| 590 | Ga0373961_0090212 | 3300035241 | Bacteria | 978 |
| 591 | Ga0316574_0498115 | 3300035398 | Bacteria | 760 |
| 592 | Ga0373924_0027585 | 3300035410 | Bacteria | 2258 |
| 593 | Ga0373931_0042267 | 3300035691 | Bacteria | 2396 |
| 594 | Ga0373931_0274562 | 3300035691 | Bacteria | 1033 |
| 595 | Ga0373935_0028891 | 3300035692 | Bacteria | 3428 |
| 596 | Ga0373935_0164148 | 3300035692 | Bacteria | 1516 |
| 597 | Ga0373927_0027565 | 3300035695 | Bacteria | 3708 |
| 598 | Ga0373927_0037839 | 3300035695 | Bacteria | 3134 |
| 599 | Ga0373927_0252127 | 3300035695 | Bacteria | 1160 |
| 600 | Ga0373933_0207031 | 3300035724 | Unclassified | 1256 |
| 601 | Ga0373947_0034898 | 3300035725 | Bacteria | 2976 |
| 602 | Ga0316584_0180732 | 3300036712 | Bacteria | 1562 |
| 603 | Ga0373925_0130287 | 3300037068 | Bacteria | 1960 |
| 604 | Ga0373925_0457738 | 3300037068 | Bacteria | 1045 |
| 605 | Ga0395900_0000601 | 3300037418 | Bacteria | 49219 |
| 606 | Ga0395900_0084721 | 3300037418 | Bacteria | 3257 |
| 607 | Ga0395900_0156434 | 3300037418 | Bacteria | 2328 |
| 608 | Ga0395900_0384968 | 3300037418 | Bacteria | 1370 |
| 609 | Ga0395898_0064519 | 3300037466 | Bacteria | 3552 |
| 610 | Ga0395898_0557017 | 3300037466 | Bacteria | 1089 |
| 611 | Ga0395905_0004099 | 3300037471 | Bacteria | 15269 |
| 612 | Ga0395905_0028345 | 3300037471 | Bacteria | 5279 |
| 613 | Ga0395905_0045576 | 3300037471 | Bacteria | 4113 |
| 614 | Ga0395905_0179438 | 3300037471 | Bacteria | 1988 |
| 615 | Ga0395905_0881125 | 3300037471 | Bacteria | 798 |
| 616 | Ga0436364_1345727 | 3300037853 | Bacteria | 7069 |
| 617 | Ga0395901_0084872 | 3300038443 | Bacteria | 3310 |
| 618 | Ga0395901_0114991 | 3300038443 | Bacteria | 2826 |
| 619 | Ga0395901_0190948 | 3300038443 | Bacteria | 2148 |
| 620 | Ga0395901_0327622 | 3300038443 | Bacteria | 1584 |
| 621 | Ga0395901_0383903 | 3300038443 | Bacteria | 1445 |
| 622 | Ga0436365_0151405 | 3300039437 | Bacteria | 11975 |
| 623 | Ga0436365_1756237 | 3300039437 | Bacteria | 4549 |
| 624 | Ga0436360_0380292 | 3300039438 | Bacteria | 660 |
| 625 | Ga0436361_0701096 | 3300039447 | Bacteria | 1431 |
| 626 | Ga0436361_0877460 | 3300039447 | Bacteria | 1214 |
| 627 | Ga0436363_1531694 | 3300039450 | Bacteria | 2797 |
| 628 | Ga0436362_0238672 | 3300039453 | Bacteria | 6738 |
| 629 | Ga0451789_0042347 | 3300041443 | Bacteria | 1783 |
| 630 | Ga0451800_1635921 | 3300041459 | Bacteria | 1144 |
| 631 | Ga0451802_0462708 | 3300041460 | Bacteria | 1149 |
| 632 | Ga0451804_1129176 | 3300041463 | Bacteria | 1217 |
| 633 | Ga0451833_1355453 | 3300041491 | Bacteria | 1153 |
| 634 | Ga0466969_0100021 | 3300044656 | Bacteria | 1366 |
| 635 | Ga0466972_0072759 | 3300044658 | Bacteria | 1639 |
| 636 | Ga0466972_0258293 | 3300044658 | Bacteria | 814 |
| 637 | Ga0466963_0037866 | 3300044694 | Bacteria | 3152 |
| 638 | Ga0466964_0019616 | 3300044706 | Bacteria | 2601 |
| 639 | Ga0466960_0013843 | 3300044901 | Bacteria | 3437 |
| 640 | Ga0466960_0057079 | 3300044901 | Bacteria | 1903 |
| 641 | Ga0466960_0068260 | 3300044901 | Bacteria | 1763 |
| 642 | Ga0466959_0187516 | 3300045049 | Bacteria | 1444 |
| 643 | Ga0466967_0122378 | 3300045976 | Bacteria | 2406 |
| 644 | Ga0466967_0142386 | 3300045976 | Bacteria | 2234 |
| 645 | Ga0495592_0161656 | 3300046454 | Bacteria | 1540 |
| 646 | Ga0495592_0282725 | 3300046454 | Bacteria | 1085 |
| 647 | Ga0495603_0034408 | 3300046455 | Bacteria | 3046 |
| 648 | Ga0495590_0021555 | 3300046457 | Bacteria | 2283 |
| 649 | Ga0495590_0062124 | 3300046457 | Bacteria | 1308 |
| 650 | Ga0495629_0139772 | 3300046459 | Bacteria | 1685 |
| 651 | Ga0495629_0159644 | 3300046459 | Bacteria | 1566 |
| 652 | Ga0495638_0005428 | 3300046460 | Bacteria | 9486 |
| 653 | Ga0495638_0113325 | 3300046460 | Bacteria | 1609 |
| 654 | Ga0495641_0056529 | 3300046461 | Bacteria | 1778 |
| 655 | Ga0495641_0131485 | 3300046461 | Bacteria | 1117 |
| 656 | Ga0495651_0005518 | 3300046462 | Bacteria | 9647 |
| 657 | Ga0495651_0007953 | 3300046462 | Bacteria | 8128 |
| 658 | Ga0495651_0272547 | 3300046462 | Bacteria | 1147 |
| 659 | Ga0495653_0223986 | 3300046463 | Bacteria | 1263 |
| 660 | Ga0495580_0009497 | 3300046472 | Bacteria | 7646 |
| 661 | Ga0495605_0135421 | 3300046474 | Bacteria | 1108 |
| 662 | Ga0495639_0004008 | 3300046475 | Bacteria | 6313 |
| 663 | Ga0495662_0172930 | 3300046476 | Bacteria | 1064 |
| 664 | Ga0495664_0034909 | 3300046477 | Bacteria | 2959 |
| 665 | Ga0495664_0040873 | 3300046477 | Bacteria | 2743 |
| 666 | Ga0495664_0215422 | 3300046477 | Bacteria | 1163 |
| 667 | Ga0495584_0267785 | 3300046491 | Bacteria | 868 |
| 668 | Ga0495585_0110244 | 3300046492 | Bacteria | 1464 |
| 669 | Ga0495596_0082976 | 3300046500 | Bacteria | 1244 |
| 670 | Ga0495607_0102964 | 3300046501 | Bacteria | 1526 |
| 671 | Ga0495607_0249128 | 3300046501 | Bacteria | 856 |
| 672 | Ga0495608_0021931 | 3300046511 | Bacteria | 4380 |
| 673 | Ga0495608_0133019 | 3300046511 | Bacteria | 1591 |
| 674 | Ga0495608_0230027 | 3300046511 | Bacteria | 1161 |
| 675 | Ga0495610_0085036 | 3300046512 | Bacteria | 1445 |
| 676 | Ga0495610_0137742 | 3300046512 | Bacteria | 1053 |
| 677 | Ga0495616_0091351 | 3300046513 | Bacteria | 1441 |
| 678 | Ga0495616_0108748 | 3300046513 | Bacteria | 1290 |
| 679 | Ga0495618_0022327 | 3300046514 | Bacteria | 3908 |
| 680 | Ga0495620_0111337 | 3300046515 | Bacteria | 1085 |
| 681 | Ga0495628_0136755 | 3300046516 | Bacteria | 1872 |
| 682 | Ga0495630_0045229 | 3300046517 | Bacteria | 3289 |
| 683 | Ga0495631_0118061 | 3300046518 | Bacteria | 1141 |
| 684 | Ga0495631_0128667 | 3300046518 | Bacteria | 1088 |
| 685 | Ga0495632_0156773 | 3300046519 | Bacteria | 1050 |
| 686 | Ga0495632_0219770 | 3300046519 | Bacteria | 859 |
| 687 | Ga0495644_0109982 | 3300046523 | Bacteria | 1045 |
| 688 | Ga0495648_0040345 | 3300046524 | Bacteria | 2961 |
| 689 | Ga0495648_0063509 | 3300046524 | Bacteria | 2180 |
| 690 | Ga0495648_0120781 | 3300046524 | Bacteria | 1409 |
| 691 | Ga0495648_0227933 | 3300046524 | Bacteria | 914 |
| 692 | Ga0495652_0026970 | 3300046529 | Bacteria | 5067 |
| 693 | Ga0495652_0170107 | 3300046529 | Bacteria | 1683 |
| 694 | Ga0495652_0433823 | 3300046529 | Bacteria | 923 |
| 695 | Ga0495587_0081675 | 3300046536 | Bacteria | 1873 |
| 696 | Ga0495598_0152338 | 3300046537 | Bacteria | 808 |
| 697 | Ga0495609_0099182 | 3300046538 | Bacteria | 1263 |
| 698 | Ga0495609_0149992 | 3300046538 | Bacteria | 992 |
| 699 | Ga0495609_0190328 | 3300046538 | Bacteria | 861 |
| 700 | Ga0495621_0017558 | 3300046539 | Bacteria | 2315 |
| 701 | Ga0495622_0088960 | 3300046557 | Bacteria | 1419 |
| 702 | Ga0495622_0102868 | 3300046557 | Bacteria | 1309 |
| 703 | Ga0495622_0186379 | 3300046557 | Bacteria | 929 |
| 704 | Ga0495622_0278931 | 3300046557 | Bacteria | 731 |
| 705 | Ga0495633_0031367 | 3300046558 | Bacteria | 2577 |
| 706 | Ga0495633_0217666 | 3300046558 | Bacteria | 874 |
| 707 | Ga0495656_0017547 | 3300046615 | Bacteria | 2733 |
| 708 | Ga0495656_0227631 | 3300046615 | Bacteria | 934 |
| 709 | Ga0495668_0051517 | 3300046616 | Bacteria | 2279 |
| 710 | Ga0495668_0172125 | 3300046616 | Bacteria | 1186 |
| 711 | Ga0495668_0475565 | 3300046616 | Bacteria | 688 |
| 712 | Ga0495634_0013865 | 3300046642 | Bacteria | 5824 |
| 713 | Ga0495634_0033410 | 3300046642 | Bacteria | 3536 |
| 714 | Ga0495634_0281391 | 3300046642 | Bacteria | 1010 |
| 715 | Ga0495611_0061653 | 3300046648 | Bacteria | 1705 |
| 716 | Ga0495611_0191250 | 3300046648 | Bacteria | 955 |
| 717 | Ga0495611_0243672 | 3300046648 | Bacteria | 834 |
| 718 | Ga0495625_0286077 | 3300046660 | Bacteria | 1059 |
| 719 | Ga0495625_0362396 | 3300046660 | Bacteria | 913 |
| 720 | Ga0495635_0043662 | 3300046663 | Bacteria | 3093 |
| 721 | Ga0495635_0049995 | 3300046663 | Bacteria | 2882 |
| 722 | Ga0495659_0266048 | 3300046664 | Bacteria | 717 |
| 723 | Ga0495661_0207557 | 3300046665 | Bacteria | 1022 |
| 724 | Ga0495657_0002722 | 3300046675 | Bacteria | 14757 |
| 725 | Ga0495623_0002730 | 3300046679 | Bacteria | 11661 |
| 726 | Ga0495623_0287225 | 3300046679 | Bacteria | 913 |
| 727 | Ga0495646_0088531 | 3300046680 | Bacteria | 1793 |
| 728 | Ga0495646_0089695 | 3300046680 | Bacteria | 1779 |
| 729 | Ga0495647_0233363 | 3300046681 | Bacteria | 815 |
| 730 | Ga0495669_0084639 | 3300046684 | Bacteria | 1458 |
| 731 | Ga0495624_0158055 | 3300046690 | Bacteria | 1385 |
| 732 | Ga0495624_0162127 | 3300046690 | Bacteria | 1366 |
| 733 | Ga0495624_0400437 | 3300046690 | Bacteria | 824 |
| 734 | Ga0495670_0145113 | 3300046691 | Bacteria | 1243 |
| 735 | Ga0495589_0221780 | 3300046794 | Bacteria | 888 |
| 736 | Ga0495600_0019685 | 3300046809 | Bacteria | 4313 |
| 737 | Ga0495600_0481224 | 3300046809 | Bacteria | 765 |
| 738 | Ga0495581_0023440 | 3300047315 | Bacteria | 3576 |
| 739 | Ga0495604_0020305 | 3300047317 | Bacteria | 5308 |
| 740 | Ga0495604_0029080 | 3300047317 | Bacteria | 4397 |
| 741 | Ga0495604_0173475 | 3300047317 | Bacteria | 1514 |
| 742 | Ga0495636_0059948 | 3300047318 | Bacteria | 1607 |
| 743 | Ga0495674_0037372 | 3300047319 | Bacteria | 4363 |
| 744 | Ga0495674_0043669 | 3300047319 | Bacteria | 3988 |
| 745 | Ga0495674_0769917 | 3300047319 | Bacteria | 751 |
| 746 | Ga0495672_0028339 | 3300047320 | Bacteria | 3545 |
| 747 | Ga0495672_0151839 | 3300047320 | Bacteria | 1201 |
| 748 | Ga0495676_0126508 | 3300047321 | Bacteria | 1851 |
| 749 | Ga0495680_0084540 | 3300047322 | Bacteria | 2391 |
| 750 | Ga0495683_0013594 | 3300047323 | Bacteria | 4254 |
| 751 | Ga0495683_0287932 | 3300047323 | Bacteria | 709 |
| 752 | Ga0495687_056171 | 3300047443 | Bacteria | 1643 |
| 753 | Ga0495675_0065231 | 3300047444 | Bacteria | 2303 |
| 754 | Ga0495677_0005933 | 3300047445 | Bacteria | 4627 |
| 755 | Ga0495679_097202 | 3300047446 | Bacteria | 821 |
| 756 | Ga0495684_0012228 | 3300047471 | Bacteria | 6622 |
| 757 | Ga0495686_0076268 | 3300047472 | Bacteria | 2054 |
| 758 | Ga0495686_0080369 | 3300047472 | Bacteria | 1993 |
| 759 | Ga0495593_0026986 | 3300047673 | Bacteria | 3165 |
| 760 | Ga0495593_0322161 | 3300047673 | Bacteria | 773 |
| 761 | Ga0495593_0363068 | 3300047673 | Bacteria | 724 |
| 762 | Ga0495602_0214752 | 3300048088 | Bacteria | 1457 |
| 763 | Ga0495615_0008583 | 3300048090 | Bacteria | 1982 |
| 764 | Ga0495615_0060246 | 3300048090 | Bacteria | 1000 |
| 765 | Ga0496100_0034333 | 3300048903 | Bacteria | 3182 |
| 766 | Ga0496100_0099054 | 3300048903 | Bacteria | 2005 |
| 767 | Ga0496100_0215752 | 3300048903 | Bacteria | 1406 |
| 768 | Ga0496100_0353426 | 3300048903 | Bacteria | 1110 |
| 769 | Ga0496101_0010035 | 3300048904 | Bacteria | 6239 |
| 770 | Ga0496101_0251335 | 3300048904 | Bacteria | 1377 |
| 771 | Ga0496101_0398983 | 3300048904 | Bacteria | 1083 |
| 772 | Ga0496101_0429706 | 3300048904 | Bacteria | 1041 |
| 773 | Ga0496102_0013449 | 3300048905 | Bacteria | 7089 |
| 774 | Ga0496102_0062913 | 3300048905 | Bacteria | 3397 |
| 775 | Ga0496102_0128269 | 3300048905 | Bacteria | 2372 |
| 776 | Ga0496102_0162493 | 3300048905 | Bacteria | 2101 |
| 777 | Ga0496102_0402287 | 3300048905 | Bacteria | 1287 |
| 778 | Ga0496102_0494062 | 3300048905 | Bacteria | 1145 |
| 779 | Ga0496103_0125217 | 3300048906 | Bacteria | 1639 |
| 780 | Ga0496103_0378626 | 3300048906 | Bacteria | 909 |
| 781 | Ga0496104_0034670 | 3300048907 | Bacteria | 4708 |
| 782 | Ga0496104_0037615 | 3300048907 | Bacteria | 4525 |
| 783 | Ga0496104_0095563 | 3300048907 | Bacteria | 2843 |
| 784 | Ga0496104_0178001 | 3300048907 | Bacteria | 2037 |
| 785 | Ga0496104_0438915 | 3300048907 | Bacteria | 1217 |
| 786 | Ga0496105_0013759 | 3300048908 | Bacteria | 6424 |
| 787 | Ga0496105_0031433 | 3300048908 | Bacteria | 4352 |
| 788 | Ga0496105_0078016 | 3300048908 | Bacteria | 2735 |
| 789 | Ga0496105_0316345 | 3300048908 | Bacteria | 1252 |
| 790 | Ga0496105_0518923 | 3300048908 | Bacteria | 933 |
| 791 | Ga0496106_0000790 | 3300048909 | Bacteria | 22889 |
| 792 | Ga0496106_0034128 | 3300048909 | Bacteria | 3799 |
| 793 | Ga0496106_0304489 | 3300048909 | Bacteria | 1278 |
| 794 | Ga0496106_0329026 | 3300048909 | Bacteria | 1227 |
| 795 | Ga0496106_0502338 | 3300048909 | Bacteria | 974 |
| 796 | Ga0496107_0012206 | 3300048910 | Bacteria | 5994 |
| 797 | Ga0496107_0041263 | 3300048910 | Bacteria | 3313 |
| 798 | Ga0496107_0109232 | 3300048910 | Bacteria | 2032 |
| 799 | Ga0496107_0310360 | 3300048910 | Bacteria | 1174 |
| 800 | Ga0496108_0030269 | 3300048911 | Bacteria | 4486 |
| 801 | Ga0496108_0194029 | 3300048911 | Bacteria | 1761 |
| 802 | Ga0496108_0360749 | 3300048911 | Bacteria | 1268 |
| 803 | Ga0496109_0110376 | 3300048912 | Bacteria | 2557 |
| 804 | Ga0496109_0188961 | 3300048912 | Bacteria | 1935 |
| 805 | Ga0496110_0017963 | 3300048913 | Bacteria | 5924 |
| 806 | Ga0496110_0018229 | 3300048913 | Bacteria | 5883 |
| 807 | Ga0496110_0153652 | 3300048913 | Bacteria | 2084 |
| 808 | Ga0496110_0269092 | 3300048913 | Bacteria | 1551 |
| 809 | Ga0496110_0320020 | 3300048913 | Bacteria | 1413 |
| 810 | Ga0496111_0021492 | 3300048914 | Bacteria | 4508 |
| 811 | Ga0496111_0072379 | 3300048914 | Bacteria | 2509 |
| 812 | Ga0496112_0021451 | 3300048915 | Bacteria | 6143 |
| 813 | Ga0496112_0040959 | 3300048915 | Bacteria | 4531 |
| 814 | Ga0496112_0204579 | 3300048915 | Bacteria | 1932 |
| 815 | Ga0496112_0208278 | 3300048915 | Bacteria | 1913 |
| 816 | Ga0496112_0413839 | 3300048915 | Bacteria | 1287 |
| 817 | Ga0496112_0770116 | 3300048915 | Bacteria | 888 |
| 818 | Ga0496113_0025419 | 3300048916 | Bacteria | 4220 |
| 819 | Ga0496113_0220446 | 3300048916 | Bacteria | 1511 |
| 820 | Ga0496113_0309371 | 3300048916 | Bacteria | 1266 |
| 821 | Ga0496113_0459930 | 3300048916 | Bacteria | 1022 |
| 822 | Ga0496114_0009819 | 3300048917 | Bacteria | 7607 |
| 823 | Ga0496114_0194523 | 3300048917 | Bacteria | 1775 |
| 824 | Ga0496115_0106182 | 3300048918 | Bacteria | 2305 |
| 825 | Ga0496115_0136097 | 3300048918 | Bacteria | 2026 |
| 826 | Ga0496115_0166408 | 3300048918 | Bacteria | 1823 |
| 827 | Ga0496115_0291782 | 3300048918 | Bacteria | 1338 |
| 828 | Ga0496115_0352129 | 3300048918 | Bacteria | 1201 |
| 829 | Ga0496115_0577737 | 3300048918 | Bacteria | 896 |
| 830 | Ga0496115_0710117 | 3300048918 | Bacteria | 790 |
| 831 | Ga0496116_0036199 | 3300048919 | Bacteria | 3458 |
| 832 | Ga0496117_0023985 | 3300048920 | Bacteria | 4843 |
| 833 | Ga0496117_0068751 | 3300048920 | Bacteria | 2389 |
| 834 | Ga0496117_0117147 | 3300048920 | Bacteria | 1645 |
| 835 | Ga0496117_0250327 | 3300048920 | Bacteria | 967 |
| 836 | Ga0496119_0002261 | 3300048922 | Bacteria | 21403 |
| 837 | Ga0496119_0047799 | 3300048922 | Bacteria | 2659 |
| 838 | Ga0496119_0123825 | 3300048922 | Bacteria | 1417 |
| 839 | Ga0496120_0020511 | 3300048923 | Bacteria | 4198 |
| 840 | Ga0496121_0003198 | 3300048924 | Bacteria | 23590 |
| 841 | Ga0496121_0004531 | 3300048924 | Bacteria | 18595 |
| 842 | Ga0496121_0023313 | 3300048924 | Bacteria | 5966 |
| 843 | Ga0496121_0033547 | 3300048924 | Bacteria | 4643 |
| 844 | Ga0496121_0056653 | 3300048924 | Bacteria | 3253 |
| 845 | Ga0496121_0087578 | 3300048924 | Bacteria | 2444 |
| 846 | Ga0496121_0093417 | 3300048924 | Bacteria | 2342 |
| 847 | Ga0496121_0095489 | 3300048924 | Bacteria | 2310 |
| 848 | Ga0496121_0228402 | 3300048924 | Bacteria | 1305 |
| 849 | Ga0496122_0221224 | 3300048925 | Bacteria | 1086 |
| 850 | Ga0496124_0002423 | 3300048927 | Bacteria | 24474 |
| 851 | Ga0496124_0055391 | 3300048927 | Bacteria | 3351 |
| 852 | Ga0496124_0162000 | 3300048927 | Bacteria | 1742 |
| 853 | Ga0496124_0226068 | 3300048927 | Bacteria | 1403 |
| 854 | Ga0496124_0427866 | 3300048927 | Bacteria | 910 |
| 855 | Ga0496125_0000252 | 3300048928 | Bacteria | 109988 |
| 856 | Ga0496125_0000477 | 3300048928 | Bacteria | 70913 |
| 857 | Ga0496125_0006104 | 3300048928 | Bacteria | 13147 |
| 858 | Ga0496125_0014815 | 3300048928 | Bacteria | 7573 |
| 859 | Ga0496125_0038225 | 3300048928 | Bacteria | 4159 |
| 860 | Ga0496125_0057578 | 3300048928 | Bacteria | 3146 |
| 861 | Ga0496125_0075024 | 3300048928 | Bacteria | 2619 |
| 862 | Ga0496125_0078578 | 3300048928 | Bacteria | 2535 |
| 863 | Ga0496125_0175324 | 3300048928 | Bacteria | 1435 |
| 864 | Ga0496126_0003342 | 3300048929 | Bacteria | 20380 |
| 865 | Ga0496126_0005092 | 3300048929 | Bacteria | 15243 |
| 866 | Ga0496126_0008959 | 3300048929 | Bacteria | 10711 |
| 867 | Ga0496126_0018165 | 3300048929 | Bacteria | 6977 |
| 868 | Ga0496126_0024225 | 3300048929 | Bacteria | 5862 |
| 869 | Ga0496126_0027002 | 3300048929 | Bacteria | 5494 |
| 870 | Ga0496126_0046537 | 3300048929 | Bacteria | 3978 |
| 871 | Ga0496126_0063150 | 3300048929 | Bacteria | 3320 |
| 872 | Ga0496126_0087671 | 3300048929 | Bacteria | 2743 |
| 873 | Ga0496126_0117917 | 3300048929 | Bacteria | 2305 |
| 874 | Ga0496126_0145584 | 3300048929 | Bacteria | 2035 |
| 875 | Ga0496126_0195956 | 3300048929 | Bacteria | 1708 |
| 876 | Ga0496126_0197606 | 3300048929 | Bacteria | 1700 |
| 877 | Ga0496126_0543982 | 3300048929 | Bacteria | 922 |
| 878 | Ga0496126_0679466 | 3300048929 | Bacteria | 802 |
| 879 | Ga0495682_0022934 | 3300049460 | Bacteria | 2332 |
| 880 | Ga0495682_0174082 | 3300049460 | Bacteria | 765 |
| 881 | Ga0501067_0035550 | 3300049583 | Bacteria | 2767 |
| 882 | Ga0501067_0040139 | 3300049583 | Bacteria | 2600 |
| 883 | Ga0501075_0443655 | 3300049591 | Bacteria | 990 |
| 884 | nmdc:mga03683_110190_c1 | 3300050489 | Bacteria | 1216 |
| 885 | nmdc:mga03683_261925_c1 | 3300050489 | Bacteria | 805 |
| 886 | nmdc:mga03683_297427_c1 | 3300050489 | Bacteria | 756 |
| 887 | nmdc:mga03n38_113295_c1 | 3300050490 | Bacteria | 1324 |
| 888 | nmdc:mga03n38_191280_c1 | 3300050490 | Bacteria | 1054 |
| 889 | nmdc:mga03n38_232557_c1 | 3300050490 | Bacteria | 967 |
| 890 | nmdc:mga03n38_70192_c1 | 3300050490 | Bacteria | 1619 |
| 891 | nmdc:mga00v17_149651_c1 | 3300050491 | Bacteria | 1499 |
| 892 | nmdc:mga00v17_179927_c1 | 3300050491 | Bacteria | 1364 |
| 893 | nmdc:mga00v17_313818_c1 | 3300050491 | Bacteria | 1019 |
| 894 | nmdc:mga00v17_592228_c1 | 3300050491 | Bacteria | 715 |
| 895 | nmdc:mga0yw44_210242_c1 | 3300050492 | Bacteria | 1287 |
| 896 | nmdc:mga0yw44_308508_c1 | 3300050492 | Bacteria | 1061 |
| 897 | nmdc:mga0yw44_333422_c1 | 3300050492 | Bacteria | 1020 |
| 898 | nmdc:mga0yw44_60416_c1 | 3300050492 | Bacteria | 2322 |
| 899 | nmdc:mga0k408_113047_c1 | 3300050493 | Bacteria | 1605 |
| 900 | nmdc:mga06z11_27169_c1 | 3300050494 | Bacteria | 2734 |
| 901 | nmdc:mga06z11_278886_c1 | 3300050494 | Bacteria | 990 |
| 902 | nmdc:mga06z11_29474_c1 | 3300050494 | Bacteria | 2645 |
| 903 | nmdc:mga06z11_434110_c1 | 3300050494 | Bacteria | 792 |
| 904 | nmdc:mga06z11_47913_c1 | 3300050494 | Bacteria | 2172 |
| 905 | nmdc:mga07m45_101344_c1 | 3300050496 | Bacteria | 1653 |
| 906 | nmdc:mga07m45_141870_c1 | 3300050496 | Bacteria | 1391 |
| 907 | nmdc:mga07m45_33802_c1 | 3300050496 | Bacteria | 2841 |
| 908 | nmdc:mga07m45_40557_c1 | 3300050496 | Bacteria | 2605 |
| 909 | nmdc:mga05p37_222833_c1 | 3300050507 | Bacteria | 2275 |
| 910 | nmdc:mga05p37_254661_c1 | 3300050507 | Bacteria | 2104 |
| 911 | nmdc:mga0qj67_382155_c1 | 3300050509 | Bacteria | 1137 |
| 912 | nmdc:mga0qj67_63538_c1 | 3300050509 | Bacteria | 2935 |
| 913 | nmdc:mga06r32_17887_c1 | 3300050510 | Bacteria | 6478 |
| 914 | nmdc:mga0n895_255303_c1 | 3300050512 | Bacteria | 1779 |
| 915 | nmdc:mga0n895_416634_c1 | 3300050512 | Bacteria | 1358 |
| 916 | nmdc:mga0n895_871701_c1 | 3300050512 | Bacteria | 887 |
| 917 | nmdc:mga0rr50_142842_c1 | 3300050513 | Bacteria | 1927 |
| 918 | nmdc:mga0a205_21992_c1 | 3300050515 | Bacteria | 6034 |
| 919 | nmdc:mga0sz30_30547_c1 | 3300050516 | Bacteria | 2226 |
| 920 | nmdc:mga0sz30_99126_c1 | 3300050516 | Bacteria | 1272 |
| 921 | Ga0495601_0559716 | 3300053077 | Bacteria | 735 |
| 922 | Ga0500635_0017676 | 3300053080 | Bacteria | 2141 |
| 923 | Ga0495619_0164315 | 3300053085 | Bacteria | 1534 |
| 924 | Ga0500578_0022393 | 3300053086 | Bacteria | 4057 |
| 925 | Ga0500643_000025 | 3300053087 | Bacteria | 259605 |
| 926 | Ga0500583_0059313 | 3300053092 | Bacteria | 1802 |
| 927 | Ga0500651_0006276 | 3300053093 | Bacteria | 6836 |
| 928 | Ga0500651_0034629 | 3300053093 | Bacteria | 3184 |
| 929 | Ga0500651_0158861 | 3300053093 | Bacteria | 1353 |
| 930 | Ga0500566_0062550 | 3300053094 | Bacteria | 2104 |
| 931 | Ga0500566_0090144 | 3300053094 | Bacteria | 1695 |
| 932 | Ga0500566_0109291 | 3300053094 | Bacteria | 1505 |
| 933 | Ga0500641_0008562 | 3300053096 | Bacteria | 3656 |
| 934 | Ga0500641_0048832 | 3300053096 | Bacteria | 1734 |
| 935 | Ga0500641_0139298 | 3300053096 | Bacteria | 1048 |
| 936 | Ga0500554_026795 | 3300053102 | Bacteria | 1660 |
| 937 | Ga0500555_022255 | 3300053103 | Bacteria | 1822 |
| 938 | Ga0500555_071802 | 3300053103 | Bacteria | 913 |
| 939 | Ga0500556_0071895 | 3300053104 | Bacteria | 1293 |
| 940 | Ga0500557_000001 | 3300053105 | Bacteria | 241298 |
| 941 | Ga0500562_012751 | 3300053108 | Bacteria | 2140 |
| 942 | Ga0500569_010569 | 3300053109 | Bacteria | 2180 |
| 943 | Ga0500572_013736 | 3300053111 | Bacteria | 2010 |
| 944 | Ga0500595_000680 | 3300053119 | Bacteria | 20345 |
| 945 | Ga0500595_001479 | 3300053119 | Bacteria | 12486 |
| 946 | Ga0500595_003476 | 3300053119 | Bacteria | 7330 |
| 947 | Ga0500595_062096 | 3300053119 | Bacteria | 1126 |
| 948 | Ga0500642_0000221 | 3300053130 | Bacteria | 22633 |
| 949 | Ga0500652_119435 | 3300053131 | Bacteria | 1102 |
| 950 | Ga0500658_0021527 | 3300053134 | Bacteria | 2443 |
| 951 | Ga0500658_0199659 | 3300053134 | Bacteria | 914 |
| 952 | Ga0500559_0069414 | 3300053136 | Bacteria | 1584 |
| 953 | Ga0500559_0090600 | 3300053136 | Bacteria | 1399 |
| 954 | Ga0500568_0110097 | 3300053139 | Bacteria | 1030 |
| 955 | Ga0500568_0119287 | 3300053139 | Bacteria | 983 |
| 956 | Ga0500573_0073733 | 3300053140 | Bacteria | 1944 |
| 957 | Ga0500573_0138523 | 3300053140 | Bacteria | 1342 |
| 958 | Ga0500588_0013778 | 3300053146 | Bacteria | 2035 |
| 959 | Ga0500588_0155099 | 3300053146 | Bacteria | 830 |
| 960 | Ga0500590_057454 | 3300053148 | Bacteria | 1963 |
| 961 | Ga0500604_0090367 | 3300053151 | Bacteria | 999 |
| 962 | Ga0500622_0046562 | 3300053156 | Bacteria | 2241 |
| 963 | Ga0500622_0099278 | 3300053156 | Bacteria | 1436 |
| 964 | Ga0500627_0021488 | 3300053158 | Bacteria | 2605 |
| 965 | Ga0500627_0162430 | 3300053158 | Bacteria | 1008 |
| 966 | Ga0500633_0040266 | 3300053160 | Bacteria | 1567 |
| 967 | Ga0500633_0067310 | 3300053160 | Bacteria | 1273 |
| 968 | Ga0500634_0160967 | 3300053161 | Bacteria | 1036 |
| 969 | Ga0500634_0191916 | 3300053161 | Bacteria | 907 |
| 970 | Ga0500638_034071 | 3300053162 | Bacteria | 2463 |
| 971 | Ga0500638_068136 | 3300053162 | Bacteria | 1704 |
| 972 | Ga0500638_099711 | 3300053162 | Bacteria | 1356 |
| 973 | Ga0500639_029815 | 3300053163 | Bacteria | 2883 |
| 974 | Ga0500636_0002067 | 3300053177 | Bacteria | 11078 |
| 975 | Ga0500636_0048980 | 3300053177 | Bacteria | 2486 |
| 976 | Ga0500636_0067045 | 3300053177 | Bacteria | 2085 |
| 977 | Ga0500636_0067386 | 3300053177 | Unclassified | 2080 |
| 978 | Ga0500636_0083775 | 3300053177 | Bacteria | 1834 |
| 979 | Ga0500637_0047630 | 3300053178 | Bacteria | 2435 |
| 980 | Ga0500637_0136510 | 3300053178 | Bacteria | 1421 |
| 981 | Ga0500637_0300745 | 3300053178 | Bacteria | 875 |
| 982 | Ga0500609_001217 | 3300053731 | Bacteria | 3829 |
| 983 | Ga0500609_018270 | 3300053731 | Bacteria | 954 |
| 984 | Ga0500596_000723 | 3300053735 | Bacteria | 6467 |
| 985 | Ga0530510_0160337 | 3300061734 | Bacteria | 1664 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039438 | Ga0436360_0380292 | Ga0436360_0380292_100_621 | 169 |
| 2 | 3300034816 | Ga0373930_0106668 | Ga0373930_0106668_19_564 | 177 |
| 3 | 3300009545 | Ga0105237_10114688 | Ga0105237_101146883 | 189 |
| 4 | 3300053140 | Ga0500573_0073733 | Ga0500573_0073733_1011_1670 | 189 |
| 5 | 3300053177 | Ga0500636_0067045 | Ga0500636_0067045_692_1351 | 189 |
| 6 | 3300053735 | Ga0500596_000723 | Ga0500596_000723_723_1382 | 189 |
| 7 | 3300053136 | Ga0500559_0069414 | Ga0500559_0069414_419_1078 | 190 |
| 8 | 3300005535 | Ga0070684_100115242 | Ga0070684_1001152424 | 192 |
| 9 | 3300009093 | Ga0105240_10008787 | Ga0105240_1000878710 | 192 |
| 10 | 3300009551 | Ga0105238_10008642 | Ga0105238_100086424 | 192 |
| 11 | 3300013104 | Ga0157370_10206147 | Ga0157370_102061472 | 192 |
| 12 | 3300013105 | Ga0157369_10124770 | Ga0157369_101247704 | 192 |
| 13 | 3300013307 | Ga0157372_10012959 | Ga0157372_100129592 | 192 |
| 14 | 3300025913 | Ga0207695_10070550 | Ga0207695_100705501 | 192 |
| 15 | 3300025921 | Ga0207652_10759573 | Ga0207652_107595731 | 192 |
| 16 | 3300025924 | Ga0207694_10046482 | Ga0207694_100464823 | 192 |
| 17 | 3300026142 | Ga0207698_10001629 | Ga0207698_1000162914 | 192 |
| 18 | 3300005356 | Ga0070674_100244574 | Ga0070674_1002445742 | 195 |
| 19 | 3300006237 | Ga0097621_100316706 | Ga0097621_1003167062 | 195 |
| 20 | 3300006358 | Ga0068871_100388701 | Ga0068871_1003887011 | 195 |
| 21 | 3300046518 | Ga0495631_0118061 | Ga0495631_0118061_224_997 | 195 |
| 22 | 3300047673 | Ga0495593_0322161 | Ga0495593_0322161_20_715 | 195 |
| 23 | 3300003659 | JGI25404J52841_10014306 | JGI25404J52841_100143061 | 198 |
| 24 | 3300013306 | Ga0163162_10028934 | Ga0163162_100289342 | 203 |
| 25 | 3300046809 | Ga0495600_0481224 | Ga0495600_0481224_103_714 | 203 |
| 26 | 3300031728 | Ga0316578_10118059 | Ga0316578_101180591 | 205 |
| 27 | 3300035398 | Ga0316574_0498115 | Ga0316574_0498115_64_717 | 205 |
| 28 | 3300036712 | Ga0316584_0180732 | Ga0316584_0180732_817_1461 | 205 |
| 29 | 3300003320 | rootH2_10283654 | rootH2_102836542 | 206 |
| 30 | 3300005563 | Ga0068855_100062456 | Ga0068855_1000624563 | 206 |
| 31 | 3300021377 | Ga0213874_10002013 | Ga0213874_100020133 | 206 |
| 32 | 3300021384 | Ga0213876_10017851 | Ga0213876_100178516 | 206 |
| 33 | 3300039437 | Ga0436365_0151405 | Ga0436365_0151405_3591_4217 | 206 |
| 34 | 3300039450 | Ga0436363_1531694 | Ga0436363_1531694_1450_2097 | 206 |
| 35 | iso_pu_bacteria | 2824600985 | 2824608897 | 206 |
| 36 | iso_pu_bacteria | 2824609381 | 2824617372 | 206 |
| 37 | iso_pu_bacteria | 2824679649 | 2824682494 | 206 |
| 38 | iso_pu_bacteria | 2906626472 | 2906628097 | 206 |
| 39 | iso_pu_bacteria | 2922393267 | 2922395422 | 206 |
| 40 | 3300026142 | Ga0207698_10093367 | Ga0207698_100933672 | 207 |
| 41 | iso_pu_bacteria | 2507262055 | 2507509566 | 207 |
| 42 | iso_pu_bacteria | 2508501042 | 2508698601 | 207 |
| 43 | iso_pu_bacteria | 2508501128 | 2509151062 | 207 |
| 44 | iso_pu_bacteria | 2513237092 | 2513624616 | 207 |
| 45 | iso_pu_bacteria | 2513237094 | 2513638120 | 207 |
| 46 | iso_pu_bacteria | 2513237095 | 2513646419 | 207 |
| 47 | iso_pu_bacteria | 2513237098 | 2513673612 | 207 |
| 48 | iso_pu_bacteria | 2513237101 | 2513693199 | 207 |
| 49 | iso_pu_bacteria | 2513237102 | 2513700933 | 207 |
| 50 | iso_pu_bacteria | 2513237104 | 2513717656 | 207 |
| 51 | iso_pu_bacteria | 2513237139 | 2513879397 | 207 |
| 52 | iso_pu_bacteria | 2513237141 | 2513887331 | 207 |
| 53 | iso_pu_bacteria | 2513237161 | 2514016703 | 207 |
| 54 | iso_pu_bacteria | 2515154112 | 2515629039 | 207 |
| 55 | iso_pu_bacteria | 2517093001 | 2517108288 | 207 |
| 56 | iso_pu_bacteria | 2524023205 | 2524439676 | 207 |
| 57 | iso_pu_bacteria | 2524023210 | 2524467652 | 207 |
| 58 | iso_pu_bacteria | 2617270735 | 2617349073 | 207 |
| 59 | iso_pu_bacteria | 2617270741 | 2617376677 | 207 |
| 60 | iso_pu_bacteria | 2744054633 | 2745082131 | 207 |
| 61 | iso_pu_bacteria | 2791355196 | 2793060447 | 207 |
| 62 | iso_pu_bacteria | 2802429603 | 2805920295 | 207 |
| 63 | iso_pu_bacteria | 2816332527 | 2818240389 | 207 |
| 64 | iso_pu_bacteria | 2824617872 | 2824624573 | 207 |
| 65 | iso_pu_bacteria | 2824626560 | 2824630680 | 207 |
| 66 | iso_pu_bacteria | 2824635225 | 2824640384 | 207 |
| 67 | iso_pu_bacteria | 2824644064 | 2824647821 | 207 |
| 68 | iso_pu_bacteria | 2824661429 | 2824667280 | 207 |
| 69 | iso_pu_bacteria | 2824671348 | 2824676211 | 207 |
| 70 | iso_pu_bacteria | 2824687955 | 2824692331 | 207 |
| 71 | iso_pu_bacteria | 2824696289 | 2824700672 | 207 |
| 72 | iso_pu_bacteria | 2824704595 | 2824710537 | 207 |
| 73 | iso_pu_bacteria | 2824714736 | 2824719918 | 207 |
| 74 | iso_pu_bacteria | 2824723954 | 2824729516 | 207 |
| 75 | iso_pu_bacteria | 2824732956 | 2824735714 | 207 |
| 76 | iso_pu_bacteria | 2824746037 | 2824751710 | 207 |
| 77 | iso_pu_bacteria | 2824753945 | 2824756720 | 207 |
| 78 | iso_pu_bacteria | 2824763712 | 2824770903 | 207 |
| 79 | iso_pu_bacteria | 2824773399 | 2824779023 | 207 |
| 80 | iso_pu_bacteria | 2838122688 | 2838128716 | 207 |
| 81 | iso_pu_bacteria | 2841941048 | 2841948482 | 207 |
| 82 | iso_pu_bacteria | 2841949485 | 2841956403 | 207 |
| 83 | iso_pu_bacteria | 2841957949 | 2841962405 | 207 |
| 84 | iso_pu_bacteria | 2841966195 | 2841967176 | 207 |
| 85 | iso_pu_bacteria | 2841974524 | 2841979424 | 207 |
| 86 | iso_pu_bacteria | 2841983080 | 2841989903 | 207 |
| 87 | iso_pu_bacteria | 2842038055 | 2842039968 | 207 |
| 88 | iso_pu_bacteria | 2842045827 | 2842047087 | 207 |
| 89 | iso_pu_bacteria | 2844315083 | 2844318183 | 207 |
| 90 | iso_pu_bacteria | 2847930680 | 2847935053 | 207 |
| 91 | iso_pu_bacteria | 2847939898 | 2847945613 | 207 |
| 92 | iso_pu_bacteria | 2857509624 | 2857510408 | 207 |
| 93 | iso_pu_bacteria | 2874590934 | 2874595321 | 207 |
| 94 | iso_pu_bacteria | 2874612657 | 2874613281 | 207 |
| 95 | iso_pu_bacteria | 2874620515 | 2874626951 | 207 |
| 96 | iso_pu_bacteria | 2874628541 | 2874636475 | 207 |
| 97 | iso_pu_bacteria | 2874645413 | 2874651160 | 207 |
| 98 | iso_pu_bacteria | 2876761206 | 2876761234 | 207 |
| 99 | iso_pu_bacteria | 2876771140 | 2876775257 | 207 |
| 100 | iso_pu_bacteria | 2876818435 | 2876824072 | 207 |
| 101 | iso_pu_bacteria | 2879074833 | 2879080700 | 207 |
| 102 | iso_pu_bacteria | 2879083081 | 2879090782 | 207 |
| 103 | iso_pu_bacteria | 2879099564 | 2879109504 | 207 |
| 104 | iso_pu_bacteria | 2879127579 | 2879134717 | 207 |
| 105 | iso_pu_bacteria | 2879142872 | 2879144177 | 207 |
| 106 | iso_pu_bacteria | 2881665667 | 2881673056 | 207 |
| 107 | iso_pu_bacteria | 2885366525 | 2885373448 | 207 |
| 108 | iso_pu_bacteria | 2885383462 | 2885390910 | 207 |
| 109 | iso_pu_bacteria | 2885409591 | 2885410716 | 207 |
| 110 | iso_pu_bacteria | 2888378607 | 2888383029 | 207 |
| 111 | iso_pu_bacteria | 2888419890 | 2888423489 | 207 |
| 112 | iso_pu_bacteria | 2903727486 | 2903732967 | 207 |
| 113 | iso_pu_bacteria | 2903768456 | 2903775025 | 207 |
| 114 | iso_pu_bacteria | 2904666416 | 2904669652 | 207 |
| 115 | iso_pu_bacteria | 2904711408 | 2904716920 | 207 |
| 116 | iso_pu_bacteria | 2906602504 | 2906605076 | 207 |
| 117 | iso_pu_bacteria | 2906643746 | 2906650176 | 207 |
| 118 | iso_pu_bacteria | 2908775508 | 2908779218 | 207 |
| 119 | iso_pu_bacteria | 2922361189 | 2922361510 | 207 |
| 120 | iso_pu_bacteria | 2922368715 | 2922373214 | 207 |
| 121 | iso_pu_bacteria | 2929615660 | 2929615738 | 207 |
| 122 | iso_pu_bacteria | 2929624759 | 2929630352 | 207 |
| 123 | iso_pu_bacteria | 2932784394 | 2932791996 | 207 |
| 124 | iso_pu_bacteria | 2932801729 | 2932804404 | 207 |
| 125 | iso_pu_bacteria | 2932809354 | 2932814137 | 207 |
| 126 | iso_pu_bacteria | 2932818245 | 2932819375 | 207 |
| 127 | iso_pu_bacteria | 2932828146 | 2932833914 | 207 |
| 128 | iso_pu_bacteria | 2935608549 | 2935611560 | 207 |
| 129 | iso_pu_bacteria | 2935616580 | 2935624213 | 207 |
| 130 | iso_pu_bacteria | 2935638405 | 2935644603 | 207 |
| 131 | iso_pu_bacteria | 2935648319 | 2935648933 | 207 |
| 132 | iso_pu_bacteria | 2935656913 | 2935656985 | 207 |
| 133 | iso_pu_bacteria | 2935665750 | 2935673506 | 207 |
| 134 | iso_pu_bacteria | 2935675223 | 2935678393 | 207 |
| 135 | iso_pu_bacteria | 2935684952 | 2935688178 | 207 |
| 136 | iso_pu_bacteria | 2935694250 | 2935698844 | 207 |
| 137 | iso_pu_bacteria | 2935703347 | 2935708458 | 207 |
| 138 | iso_pu_bacteria | 2935713505 | 2935715197 | 207 |
| 139 | iso_pu_bacteria | 2935722832 | 2935726238 | 207 |
| 140 | iso_pu_bacteria | 2935732158 | 2935734016 | 207 |
| 141 | iso_pu_bacteria | 2935741537 | 2935743395 | 207 |
| 142 | iso_pu_bacteria | 2935750917 | 2935754567 | 207 |
| 143 | iso_pu_bacteria | 2935760218 | 2935765346 | 207 |
| 144 | iso_pu_bacteria | 2935769743 | 2935777010 | 207 |
| 145 | iso_pu_bacteria | 2935777560 | 2935785249 | 207 |
| 146 | iso_pu_bacteria | 2935785616 | 2935790383 | 207 |
| 147 | iso_pu_bacteria | 2935793552 | 2935798966 | 207 |
| 148 | iso_pu_bacteria | 2935801545 | 2935805297 | 207 |
| 149 | iso_pu_bacteria | 2935810662 | 2935816595 | 207 |
| 150 | iso_pu_bacteria | 2935819856 | 2935821037 | 207 |
| 151 | iso_pu_bacteria | 2935827899 | 2935833648 | 207 |
| 152 | iso_pu_bacteria | 2935837841 | 2935839666 | 207 |
| 153 | iso_pu_bacteria | 2935847175 | 2935850703 | 207 |
| 154 | iso_pu_bacteria | 2935855204 | 2935862753 | 207 |
| 155 | iso_pu_bacteria | 2935864058 | 2935871251 | 207 |
| 156 | iso_pu_bacteria | 2935873716 | 2935876244 | 207 |
| 157 | iso_pu_bacteria | 2935883170 | 2935888815 | 207 |
| 158 | iso_pu_bacteria | 2935908558 | 2935913928 | 207 |
| 159 | iso_pu_bacteria | 2935916978 | 2935920082 | 207 |
| 160 | iso_pu_bacteria | 2935926038 | 2935930421 | 207 |
| 161 | iso_pu_bacteria | 2935934488 | 2935939606 | 207 |
| 162 | iso_pu_bacteria | 2935942939 | 2935946555 | 207 |
| 163 | iso_pu_bacteria | 2935951376 | 2935955606 | 207 |
| 164 | iso_pu_bacteria | 2935959822 | 2935964532 | 207 |
| 165 | iso_pu_bacteria | 2935967501 | 2935972684 | 207 |
| 166 | iso_pu_bacteria | 2935975950 | 2935981494 | 207 |
| 167 | iso_pu_bacteria | 2935984226 | 2935989114 | 207 |
| 168 | iso_pu_bacteria | 2935992306 | 2936001582 | 207 |
| 169 | iso_pu_bacteria | 2936002035 | 2936007304 | 207 |
| 170 | iso_pu_bacteria | 2936011229 | 2936011843 | 207 |
| 171 | iso_pu_bacteria | 2936019824 | 2936020438 | 207 |
| 172 | iso_pu_bacteria | 2936028420 | 2936029132 | 207 |
| 173 | iso_pu_bacteria | 2936037263 | 2936043143 | 207 |
| 174 | iso_pu_bacteria | 2936046547 | 2936047161 | 207 |
| 175 | iso_pu_bacteria | 2936055302 | 2936061389 | 207 |
| 176 | iso_pu_bacteria | 2940556831 | 2940560056 | 207 |
| 177 | iso_pu_bacteria | 2941531003 | 2941533935 | 207 |
| 178 | iso_pu_bacteria | 2941538514 | 2941540355 | 207 |
| 179 | iso_pu_bacteria | 3005483717 | 3005490022 | 207 |
| 180 | iso_pu_bacteria | 3005506211 | 3005511677 | 207 |
| 181 | iso_pu_bacteria | 3005587118 | 3005590287 | 207 |
| 182 | iso_pu_bacteria | 3005594810 | 3005598236 | 207 |
| 183 | iso_pu_bacteria | 8006926726 | 8006932670 | 207 |
| 184 | iso_pu_bacteria | 8006964411 | 8006968960 | 207 |
| 185 | iso_pu_bacteria | 8016511872 | 8016514515 | 207 |
| 186 | iso_pu_bacteria | 8016583857 | 8016591520 | 207 |
| 187 | iso_pu_bacteria | 8016603502 | 8016611740 | 207 |
| 188 | iso_pu_bacteria | 8016613128 | 8016622062 | 207 |
| 189 | iso_pu_bacteria | 8016630954 | 8016632102 | 207 |
| 190 | iso_pu_bacteria | 8017057580 | 8017061911 | 207 |
| 191 | iso_pu_bacteria | 8019538911 | 8019543875 | 207 |
| 192 | iso_pu_bacteria | 8019586578 | 8019589074 | 207 |
| 193 | iso_pu_bacteria | 8019597564 | 8019602159 | 207 |
| 194 | iso_pu_bacteria | 8019608314 | 8019616400 | 207 |
| 195 | iso_pu_bacteria | 8019619141 | 8019627075 | 207 |
| 196 | iso_pu_bacteria | 8019629233 | 8019635473 | 207 |
| 197 | iso_pu_bacteria | 8019648815 | 8019657287 | 207 |
| 198 | iso_pu_bacteria | 8019668869 | 8019672900 | 207 |
| 199 | iso_pu_bacteria | 8019678201 | 8019683243 | 207 |
| 200 | iso_pu_bacteria | 8019687851 | 8019688950 | 207 |
| 201 | iso_pu_bacteria | 8056681323 | 8056684054 | 207 |
| 202 | iso_pu_bacteria | 8056967851 | 8056972542 | 207 |
| 203 | 3300005336 | Ga0070680_100524730 | Ga0070680_1005247302 | 208 |
| 204 | 3300005467 | Ga0070706_100097360 | Ga0070706_1000973603 | 208 |
| 205 | 3300005546 | Ga0070696_100461411 | Ga0070696_1004614111 | 208 |
| 206 | 3300006237 | Ga0097621_100061776 | Ga0097621_1000617762 | 208 |
| 207 | 3300006358 | Ga0068871_100051768 | Ga0068871_1000517683 | 208 |
| 208 | 3300006846 | Ga0075430_100674765 | Ga0075430_1006747652 | 208 |
| 209 | 3300006847 | Ga0075431_100747870 | Ga0075431_1007478702 | 208 |
| 210 | 3300006852 | Ga0075433_10065291 | Ga0075433_100652913 | 208 |
| 211 | 3300006871 | Ga0075434_100227727 | Ga0075434_1002277273 | 208 |
| 212 | 3300013104 | Ga0157370_10031400 | Ga0157370_100314003 | 208 |
| 213 | 3300025910 | Ga0207684_10090601 | Ga0207684_100906012 | 208 |
| 214 | 3300025913 | Ga0207695_10367685 | Ga0207695_103676852 | 208 |
| 215 | 3300025922 | Ga0207646_10062772 | Ga0207646_100627722 | 208 |
| 216 | 3300028381 | Ga0268264_10740980 | Ga0268264_107409801 | 208 |
| 217 | 3300039437 | Ga0436365_1756237 | Ga0436365_1756237_2076_2729 | 208 |
| 218 | 3300050512 | nmdc:mga0n895_255303_c1 | nmdc:mga0n895_255303_c1_1011_1664 | 208 |
| 219 | 3300050515 | nmdc:mga0a205_21992_c1 | nmdc:mga0a205_21992_c1_849_1502 | 208 |
| 220 | iso_pu_bacteria | 2791355199 | 2793078187 | 208 |
| 221 | iso_pu_bacteria | 2849076700 | 2849080227 | 208 |
| 222 | iso_pu_bacteria | 2874604998 | 2874607790 | 208 |
| 223 | iso_pu_bacteria | 2876808645 | 2876818136 | 208 |
| 224 | iso_pu_bacteria | 2879110137 | 2879110796 | 208 |
| 225 | iso_pu_bacteria | 2889033259 | 2889037383 | 208 |
| 226 | iso_pu_bacteria | 8006984368 | 8006985156 | 208 |
| 227 | iso_pu_bacteria | 8056673599 | 8056675993 | 208 |
| 228 | 3300003203 | JGI25406J46586_10001420 | JGI25406J46586_1000142012 | 209 |
| 229 | 3300005327 | Ga0070658_10037739 | Ga0070658_100377392 | 209 |
| 230 | 3300005327 | Ga0070658_10676070 | Ga0070658_106760702 | 209 |
| 231 | 3300005338 | Ga0068868_100382848 | Ga0068868_1003828481 | 209 |
| 232 | 3300005435 | Ga0070714_101160800 | Ga0070714_1011608001 | 209 |
| 233 | 3300005466 | Ga0070685_10028473 | Ga0070685_100284732 | 209 |
| 234 | 3300005985 | Ga0081539_10000199 | Ga0081539_100001994 | 209 |
| 235 | 3300006051 | Ga0075364_10175971 | Ga0075364_101759712 | 209 |
| 236 | 3300006177 | Ga0075362_10151954 | Ga0075362_101519541 | 209 |
| 237 | 3300006844 | Ga0075428_100016072 | Ga0075428_1000160723 | 209 |
| 238 | 3300006846 | Ga0075430_100106259 | Ga0075430_1001062592 | 209 |
| 239 | 3300009093 | Ga0105240_10016654 | Ga0105240_1001665413 | 209 |
| 240 | 3300009098 | Ga0105245_10293884 | Ga0105245_102938842 | 209 |
| 241 | 3300009176 | Ga0105242_11377082 | Ga0105242_113770821 | 209 |
| 242 | 3300014969 | Ga0157376_10127559 | Ga0157376_101275592 | 209 |
| 243 | 3300025909 | Ga0207705_10163160 | Ga0207705_101631602 | 209 |
| 244 | 3300025909 | Ga0207705_10363213 | Ga0207705_103632131 | 209 |
| 245 | 3300025913 | Ga0207695_10229168 | Ga0207695_102291682 | 209 |
| 246 | 3300025921 | Ga0207652_10740390 | Ga0207652_107403901 | 209 |
| 247 | 3300025949 | Ga0207667_10181197 | Ga0207667_101811972 | 209 |
| 248 | 3300028379 | Ga0268266_10358628 | Ga0268266_103586282 | 209 |
| 249 | 3300031852 | Ga0307410_10548327 | Ga0307410_105483271 | 209 |
| 250 | 3300032002 | Ga0307416_100148392 | Ga0307416_1001483922 | 209 |
| 251 | 3300032002 | Ga0307416_100985886 | Ga0307416_1009858862 | 209 |
| 252 | 3300035724 | Ga0373933_0207031 | Ga0373933_0207031_483_1157 | 209 |
| 253 | 3300037418 | Ga0395900_0084721 | Ga0395900_0084721_119_808 | 209 |
| 254 | 3300037471 | Ga0395905_0028345 | Ga0395905_0028345_1272_1961 | 209 |
| 255 | 3300038443 | Ga0395901_0190948 | Ga0395901_0190948_410_1099 | 209 |
| 256 | 3300050489 | nmdc:mga03683_297427_c1 | nmdc:mga03683_297427_c1_59_730 | 209 |
| 257 | 3300050491 | nmdc:mga00v17_179927_c1 | nmdc:mga00v17_179927_c1_94_753 | 209 |
| 258 | 3300050509 | nmdc:mga0qj67_63538_c1 | nmdc:mga0qj67_63538_c1_1156_1812 | 209 |
| 259 | 3300050510 | nmdc:mga06r32_17887_c1 | nmdc:mga06r32_17887_c1_1260_1916 | 209 |
| 260 | 3300053096 | Ga0500641_0139298 | Ga0500641_0139298_15_674 | 209 |
| 261 | 3300005331 | Ga0070670_100243984 | Ga0070670_1002439842 | 210 |
| 262 | 3300005354 | Ga0070675_100143838 | Ga0070675_1001438383 | 210 |
| 263 | 3300005548 | Ga0070665_100522321 | Ga0070665_1005223211 | 210 |
| 264 | 3300005617 | Ga0068859_100474172 | Ga0068859_1004741722 | 210 |
| 265 | 3300005937 | Ga0081455_10033478 | Ga0081455_100334782 | 210 |
| 266 | 3300005983 | Ga0081540_1016563 | Ga0081540_10165632 | 210 |
| 267 | 3300006038 | Ga0075365_10146950 | Ga0075365_101469503 | 210 |
| 268 | 3300006931 | Ga0097620_100474217 | Ga0097620_1004742172 | 210 |
| 269 | 3300009093 | Ga0105240_10033152 | Ga0105240_100331525 | 210 |
| 270 | 3300009093 | Ga0105240_11020604 | Ga0105240_110206041 | 210 |
| 271 | 3300009147 | Ga0114129_10068162 | Ga0114129_100681627 | 210 |
| 272 | 3300011119 | Ga0105246_10581249 | Ga0105246_105812491 | 210 |
| 273 | 3300013104 | Ga0157370_10430444 | Ga0157370_104304442 | 210 |
| 274 | 3300013105 | Ga0157369_10007473 | Ga0157369_100074735 | 210 |
| 275 | 3300013105 | Ga0157369_10007917 | Ga0157369_1000791713 | 210 |
| 276 | 3300013307 | Ga0157372_10092414 | Ga0157372_100924145 | 210 |
| 277 | 3300014745 | Ga0157377_10130905 | Ga0157377_101309052 | 210 |
| 278 | 3300025302 | Ga0207426_1008616 | Ga0207426_10086163 | 210 |
| 279 | 3300025913 | Ga0207695_10570324 | Ga0207695_105703242 | 210 |
| 280 | 3300025926 | Ga0207659_10076907 | Ga0207659_100769073 | 210 |
| 281 | 3300026121 | Ga0207683_10045593 | Ga0207683_100455933 | 210 |
| 282 | 3300026121 | Ga0207683_10122247 | Ga0207683_101222474 | 210 |
| 283 | 3300031730 | Ga0307516_10176600 | Ga0307516_101766002 | 210 |
| 284 | 3300033179 | Ga0307507_10101429 | Ga0307507_101014292 | 210 |
| 285 | 3300035695 | Ga0373927_0027565 | Ga0373927_0027565_1732_2391 | 210 |
| 286 | 3300038443 | Ga0395901_0084872 | Ga0395901_0084872_2239_2910 | 210 |
| 287 | 3300046557 | Ga0495622_0186379 | Ga0495622_0186379_38_697 | 210 |
| 288 | 3300048909 | Ga0496106_0000790 | Ga0496106_0000790_16055_16714 | 210 |
| 289 | 3300048920 | Ga0496117_0068751 | Ga0496117_0068751_1642_2301 | 210 |
| 290 | 3300048924 | Ga0496121_0003198 | Ga0496121_0003198_6241_6900 | 210 |
| 291 | 3300048927 | Ga0496124_0002423 | Ga0496124_0002423_6152_6811 | 210 |
| 292 | 3300048928 | Ga0496125_0014815 | Ga0496125_0014815_5245_5904 | 210 |
| 293 | 3300048929 | Ga0496126_0018165 | Ga0496126_0018165_3136_3795 | 210 |
| 294 | 3300048929 | Ga0496126_0197606 | Ga0496126_0197606_595_1230 | 210 |
| 295 | 3300049583 | Ga0501067_0040139 | Ga0501067_0040139_566_1210 | 210 |
| 296 | 3300050492 | nmdc:mga0yw44_333422_c1 | nmdc:mga0yw44_333422_c1_282_947 | 210 |
| 297 | 3300050507 | nmdc:mga05p37_222833_c1 | nmdc:mga05p37_222833_c1_1365_2096 | 210 |
| 298 | 3300053094 | Ga0500566_0062550 | Ga0500566_0062550_40_699 | 210 |
| 299 | 3300053119 | Ga0500595_062096 | Ga0500595_062096_11_670 | 210 |
| 300 | 3300053140 | Ga0500573_0138523 | Ga0500573_0138523_478_1146 | 210 |
| 301 | 3300053163 | Ga0500639_029815 | Ga0500639_029815_499_1158 | 210 |
| 302 | 3300053177 | Ga0500636_0048980 | Ga0500636_0048980_542_1210 | 210 |
| 303 | iso_pu_bacteria | 2524023228 | 2524534591 | 210 |
| 304 | iso_pu_bacteria | 2885374607 | 2885379776 | 210 |
| 305 | iso_pu_bacteria | 2903748898 | 2903753627 | 210 |
| 306 | iso_pu_bacteria | 2904690495 | 2904697814 | 210 |
| 307 | iso_pu_bacteria | 2908756301 | 2908762812 | 210 |
| 308 | 3300003215 | JGI25153J46596_10000476 | JGI25153J46596_1000047620 | 211 |
| 309 | 3300003215 | JGI25153J46596_10001154 | JGI25153J46596_1000115410 | 211 |
| 310 | 3300003215 | JGI25153J46596_10003343 | JGI25153J46596_100033432 | 211 |
| 311 | 3300003215 | JGI25153J46596_10011871 | JGI25153J46596_100118714 | 211 |
| 312 | 3300003320 | rootH2_10017704 | rootH2_100177041 | 211 |
| 313 | 3300003354 | JGI25160J50197_1000874 | JGI25160J50197_100087410 | 211 |
| 314 | 3300003354 | JGI25160J50197_1002069 | JGI25160J50197_10020694 | 211 |
| 315 | 3300003354 | JGI25160J50197_1047014 | JGI25160J50197_10470141 | 211 |
| 316 | 3300003771 | Ga0055526_1018859 | Ga0055526_10188594 | 211 |
| 317 | 3300003775 | Ga0055524_1054952 | Ga0055524_10549521 | 211 |
| 318 | 3300003794 | Ga0055531_10004147 | Ga0055531_100041475 | 211 |
| 319 | 3300004625 | Ga0055543_1026444 | Ga0055543_10264442 | 211 |
| 320 | 3300004625 | Ga0055543_1039447 | Ga0055543_10394471 | 211 |
| 321 | 3300005262 | Ga0065165_1001382 | Ga0065165_100138216 | 211 |
| 322 | 3300005262 | Ga0065165_1005174 | Ga0065165_10051743 | 211 |
| 323 | 3300005262 | Ga0065165_1007497 | Ga0065165_10074972 | 211 |
| 324 | 3300005327 | Ga0070658_10068536 | Ga0070658_100685362 | 211 |
| 325 | 3300005328 | Ga0070676_10187764 | Ga0070676_101877641 | 211 |
| 326 | 3300005329 | Ga0070683_100003848 | Ga0070683_1000038483 | 211 |
| 327 | 3300005335 | Ga0070666_10056060 | Ga0070666_100560602 | 211 |
| 328 | 3300005336 | Ga0070680_100013845 | Ga0070680_1000138454 | 211 |
| 329 | 3300005336 | Ga0070680_100018157 | Ga0070680_1000181577 | 211 |
| 330 | 3300005337 | Ga0070682_100095905 | Ga0070682_1000959053 | 211 |
| 331 | 3300005338 | Ga0068868_100174197 | Ga0068868_1001741972 | 211 |
| 332 | 3300005347 | Ga0070668_100254287 | Ga0070668_1002542872 | 211 |
| 333 | 3300005353 | Ga0070669_100412469 | Ga0070669_1004124691 | 211 |
| 334 | 3300005355 | Ga0070671_100006368 | Ga0070671_1000063683 | 211 |
| 335 | 3300005366 | Ga0070659_100239995 | Ga0070659_1002399952 | 211 |
| 336 | 3300005366 | Ga0070659_100647809 | Ga0070659_1006478091 | 211 |
| 337 | 3300005367 | Ga0070667_100541259 | Ga0070667_1005412592 | 211 |
| 338 | 3300005434 | Ga0070709_10035930 | Ga0070709_100359303 | 211 |
| 339 | 3300005434 | Ga0070709_10193898 | Ga0070709_101938982 | 211 |
| 340 | 3300005434 | Ga0070709_10393134 | Ga0070709_103931341 | 211 |
| 341 | 3300005436 | Ga0070713_100450371 | Ga0070713_1004503712 | 211 |
| 342 | 3300005437 | Ga0070710_10472116 | Ga0070710_104721161 | 211 |
| 343 | 3300005439 | Ga0070711_100071519 | Ga0070711_1000715192 | 211 |
| 344 | 3300005440 | Ga0070705_100069562 | Ga0070705_1000695622 | 211 |
| 345 | 3300005445 | Ga0070708_100015641 | Ga0070708_1000156413 | 211 |
| 346 | 3300005445 | Ga0070708_100137566 | Ga0070708_1001375663 | 211 |
| 347 | 3300005455 | Ga0070663_100059790 | Ga0070663_1000597903 | 211 |
| 348 | 3300005457 | Ga0070662_100651254 | Ga0070662_1006512541 | 211 |
| 349 | 3300005458 | Ga0070681_10051259 | Ga0070681_100512595 | 211 |
| 350 | 3300005458 | Ga0070681_10132380 | Ga0070681_101323804 | 211 |
| 351 | 3300005458 | Ga0070681_10429181 | Ga0070681_104291811 | 211 |
| 352 | 3300005466 | Ga0070685_10223924 | Ga0070685_102239241 | 211 |
| 353 | 3300005467 | Ga0070706_100011186 | Ga0070706_1000111867 | 211 |
| 354 | 3300005468 | Ga0070707_100179371 | Ga0070707_1001793712 | 211 |
| 355 | 3300005471 | Ga0070698_100090792 | Ga0070698_1000907925 | 211 |
| 356 | 3300005471 | Ga0070698_100228557 | Ga0070698_1002285572 | 211 |
| 357 | 3300005518 | Ga0070699_100098649 | Ga0070699_1000986493 | 211 |
| 358 | 3300005530 | Ga0070679_100008868 | Ga0070679_1000088686 | 211 |
| 359 | 3300005535 | Ga0070684_100011240 | Ga0070684_1000112408 | 211 |
| 360 | 3300005539 | Ga0068853_100149354 | Ga0068853_1001493542 | 211 |
| 361 | 3300005539 | Ga0068853_100444314 | Ga0068853_1004443141 | 211 |
| 362 | 3300005548 | Ga0070665_100048108 | Ga0070665_1000481084 | 211 |
| 363 | 3300005548 | Ga0070665_100143997 | Ga0070665_1001439973 | 211 |
| 364 | 3300005548 | Ga0070665_100308663 | Ga0070665_1003086632 | 211 |
| 365 | 3300005563 | Ga0068855_100037453 | Ga0068855_1000374535 | 211 |
| 366 | 3300005563 | Ga0068855_100214780 | Ga0068855_1002147802 | 211 |
| 367 | 3300005563 | Ga0068855_101102957 | Ga0068855_1011029571 | 211 |
| 368 | 3300005577 | Ga0068857_100173468 | Ga0068857_1001734683 | 211 |
| 369 | 3300005577 | Ga0068857_100215252 | Ga0068857_1002152522 | 211 |
| 370 | 3300005614 | Ga0068856_100173953 | Ga0068856_1001739534 | 211 |
| 371 | 3300005614 | Ga0068856_100187899 | Ga0068856_1001878993 | 211 |
| 372 | 3300005616 | Ga0068852_100099808 | Ga0068852_1000998082 | 211 |
| 373 | 3300005616 | Ga0068852_100740399 | Ga0068852_1007403991 | 211 |
| 374 | 3300005617 | Ga0068859_100292377 | Ga0068859_1002923772 | 211 |
| 375 | 3300005719 | Ga0068861_100667086 | Ga0068861_1006670861 | 211 |
| 376 | 3300005842 | Ga0068858_100325974 | Ga0068858_1003259742 | 211 |
| 377 | 3300005843 | Ga0068860_100426867 | Ga0068860_1004268672 | 211 |
| 378 | 3300005844 | Ga0068862_100183997 | Ga0068862_1001839974 | 211 |
| 379 | 3300005844 | Ga0068862_100900856 | Ga0068862_1009008561 | 211 |
| 380 | 3300005983 | Ga0081540_1017555 | Ga0081540_10175557 | 211 |
| 381 | 3300005983 | Ga0081540_1031580 | Ga0081540_10315802 | 211 |
| 382 | 3300006028 | Ga0070717_10406377 | Ga0070717_104063772 | 211 |
| 383 | 3300006038 | Ga0075365_10057257 | Ga0075365_100572573 | 211 |
| 384 | 3300006038 | Ga0075365_10139884 | Ga0075365_101398842 | 211 |
| 385 | 3300006042 | Ga0075368_10038514 | Ga0075368_100385142 | 211 |
| 386 | 3300006048 | Ga0075363_100011602 | Ga0075363_1000116024 | 211 |
| 387 | 3300006048 | Ga0075363_100072184 | Ga0075363_1000721842 | 211 |
| 388 | 3300006051 | Ga0075364_10034925 | Ga0075364_100349252 | 211 |
| 389 | 3300006051 | Ga0075364_10201057 | Ga0075364_102010572 | 211 |
| 390 | 3300006051 | Ga0075364_10495069 | Ga0075364_104950692 | 211 |
| 391 | 3300006175 | Ga0070712_100255780 | Ga0070712_1002557801 | 211 |
| 392 | 3300006177 | Ga0075362_10117977 | Ga0075362_101179771 | 211 |
| 393 | 3300006178 | Ga0075367_10042081 | Ga0075367_100420813 | 211 |
| 394 | 3300006178 | Ga0075367_10509307 | Ga0075367_105093071 | 211 |
| 395 | 3300006186 | Ga0075369_10076970 | Ga0075369_100769702 | 211 |
| 396 | 3300006186 | Ga0075369_10091087 | Ga0075369_100910872 | 211 |
| 397 | 3300006195 | Ga0075366_10010538 | Ga0075366_100105388 | 211 |
| 398 | 3300006353 | Ga0075370_10034975 | Ga0075370_100349753 | 211 |
| 399 | 3300006353 | Ga0075370_10126665 | Ga0075370_101266652 | 211 |
| 400 | 3300006353 | Ga0075370_10246371 | Ga0075370_102463712 | 211 |
| 401 | 3300006931 | Ga0097620_100292378 | Ga0097620_1002923783 | 211 |
| 402 | 3300006941 | Ga0099825_1023676 | Ga0099825_10236763 | 211 |
| 403 | 3300006942 | Ga0099824_1009133 | Ga0099824_10091334 | 211 |
| 404 | 3300006943 | Ga0099822_1041193 | Ga0099822_10411933 | 211 |
| 405 | 3300007788 | Ga0099795_10028710 | Ga0099795_100287103 | 211 |
| 406 | 3300009093 | Ga0105240_10182042 | Ga0105240_101820421 | 211 |
| 407 | 3300009093 | Ga0105240_10194966 | Ga0105240_101949662 | 211 |
| 408 | 3300009093 | Ga0105240_10415158 | Ga0105240_104151582 | 211 |
| 409 | 3300009098 | Ga0105245_10455014 | Ga0105245_104550143 | 211 |
| 410 | 3300009101 | Ga0105247_10032849 | Ga0105247_100328497 | 211 |
| 411 | 3300009147 | Ga0114129_10362293 | Ga0114129_103622933 | 211 |
| 412 | 3300009148 | Ga0105243_10602031 | Ga0105243_106020312 | 211 |
| 413 | 3300009174 | Ga0105241_10223481 | Ga0105241_102234813 | 211 |
| 414 | 3300009177 | Ga0105248_10037450 | Ga0105248_100374502 | 211 |
| 415 | 3300009177 | Ga0105248_10476762 | Ga0105248_104767622 | 211 |
| 416 | 3300009545 | Ga0105237_10418915 | Ga0105237_104189151 | 211 |
| 417 | 3300009545 | Ga0105237_10467682 | Ga0105237_104676821 | 211 |
| 418 | 3300009545 | Ga0105237_10610184 | Ga0105237_106101841 | 211 |
| 419 | 3300009551 | Ga0105238_10029381 | Ga0105238_100293813 | 211 |
| 420 | 3300009551 | Ga0105238_10131091 | Ga0105238_101310914 | 211 |
| 421 | 3300009551 | Ga0105238_10228161 | Ga0105238_102281612 | 211 |
| 422 | 3300009551 | Ga0105238_10359464 | Ga0105238_103594642 | 211 |
| 423 | 3300010375 | Ga0105239_10047131 | Ga0105239_100471316 | 211 |
| 424 | 3300010375 | Ga0105239_10085044 | Ga0105239_100850445 | 211 |
| 425 | 3300010375 | Ga0105239_10200628 | Ga0105239_102006282 | 211 |
| 426 | 3300010375 | Ga0105239_10359743 | Ga0105239_103597434 | 211 |
| 427 | 3300010375 | Ga0105239_11596544 | Ga0105239_115965441 | 211 |
| 428 | 3300011119 | Ga0105246_10138536 | Ga0105246_101385361 | 211 |
| 429 | 3300013105 | Ga0157369_10122107 | Ga0157369_101221074 | 211 |
| 430 | 3300013105 | Ga0157369_10211938 | Ga0157369_102119383 | 211 |
| 431 | 3300013105 | Ga0157369_10631350 | Ga0157369_106313501 | 211 |
| 432 | 3300013296 | Ga0157374_10341546 | Ga0157374_103415462 | 211 |
| 433 | 3300013296 | Ga0157374_10489587 | Ga0157374_104895872 | 211 |
| 434 | 3300013306 | Ga0163162_10202167 | Ga0163162_102021674 | 211 |
| 435 | 3300013307 | Ga0157372_11178271 | Ga0157372_111782711 | 211 |
| 436 | 3300013308 | Ga0157375_10101448 | Ga0157375_101014482 | 211 |
| 437 | 3300014325 | Ga0163163_10058631 | Ga0163163_100586315 | 211 |
| 438 | 3300014325 | Ga0163163_10504256 | Ga0163163_105042562 | 211 |
| 439 | 3300014745 | Ga0157377_10469523 | Ga0157377_104695232 | 211 |
| 440 | 3300014968 | Ga0157379_10567827 | Ga0157379_105678272 | 211 |
| 441 | 3300017792 | Ga0163161_10288154 | Ga0163161_102881542 | 211 |
| 442 | 3300021320 | Ga0214544_1003958 | Ga0214544_100395822 | 211 |
| 443 | 3300021321 | Ga0214542_1000002 | Ga0214542_1000002433 | 211 |
| 444 | 3300021324 | Ga0214545_1000002 | Ga0214545_1000002287 | 211 |
| 445 | 3300021327 | Ga0214543_1000013 | Ga0214543_100001335 | 211 |
| 446 | 3300025245 | Ga0207425_1008878 | Ga0207425_10088783 | 211 |
| 447 | 3300025254 | Ga0209148_1000493 | Ga0209148_10004934 | 211 |
| 448 | 3300025261 | Ga0209233_1020253 | Ga0209233_10202532 | 211 |
| 449 | 3300025272 | Ga0209455_1004278 | Ga0209455_10042784 | 211 |
| 450 | 3300025295 | Ga0209564_1005921 | Ga0209564_10059214 | 211 |
| 451 | 3300025295 | Ga0209564_1007197 | Ga0209564_10071973 | 211 |
| 452 | 3300025297 | Ga0209758_1000100 | Ga0209758_1000100194 | 211 |
| 453 | 3300025297 | Ga0209758_1000138 | Ga0209758_1000138158 | 211 |
| 454 | 3300025297 | Ga0209758_1001321 | Ga0209758_10013215 | 211 |
| 455 | 3300025297 | Ga0209758_1012135 | Ga0209758_10121352 | 211 |
| 456 | 3300025297 | Ga0209758_1117037 | Ga0209758_11170371 | 211 |
| 457 | 3300025299 | Ga0209256_1003445 | Ga0209256_10034459 | 211 |
| 458 | 3300025302 | Ga0207426_1000382 | Ga0207426_100038210 | 211 |
| 459 | 3300025302 | Ga0207426_1001031 | Ga0207426_100103116 | 211 |
| 460 | 3300025304 | Ga0209257_1001637 | Ga0209257_100163725 | 211 |
| 461 | 3300025304 | Ga0209257_1009407 | Ga0209257_10094076 | 211 |
| 462 | 3300025321 | Ga0207656_10366467 | Ga0207656_103664671 | 211 |
| 463 | 3300025901 | Ga0207688_10074810 | Ga0207688_100748102 | 211 |
| 464 | 3300025903 | Ga0207680_10128093 | Ga0207680_101280933 | 211 |
| 465 | 3300025904 | Ga0207647_10001578 | Ga0207647_1000157813 | 211 |
| 466 | 3300025905 | Ga0207685_10175985 | Ga0207685_101759852 | 211 |
| 467 | 3300025906 | Ga0207699_10032852 | Ga0207699_100328524 | 211 |
| 468 | 3300025906 | Ga0207699_10134629 | Ga0207699_101346293 | 211 |
| 469 | 3300025910 | Ga0207684_10083165 | Ga0207684_100831652 | 211 |
| 470 | 3300025912 | Ga0207707_10003484 | Ga0207707_1000348412 | 211 |
| 471 | 3300025912 | Ga0207707_10012153 | Ga0207707_100121533 | 211 |
| 472 | 3300025912 | Ga0207707_10094903 | Ga0207707_100949034 | 211 |
| 473 | 3300025912 | Ga0207707_10109988 | Ga0207707_101099883 | 211 |
| 474 | 3300025913 | Ga0207695_10239287 | Ga0207695_102392872 | 211 |
| 475 | 3300025913 | Ga0207695_10440173 | Ga0207695_104401731 | 211 |
| 476 | 3300025914 | Ga0207671_10190361 | Ga0207671_101903612 | 211 |
| 477 | 3300025914 | Ga0207671_10295728 | Ga0207671_102957282 | 211 |
| 478 | 3300025915 | Ga0207693_10666123 | Ga0207693_106661231 | 211 |
| 479 | 3300025917 | Ga0207660_10028263 | Ga0207660_100282634 | 211 |
| 480 | 3300025917 | Ga0207660_10081504 | Ga0207660_100815044 | 211 |
| 481 | 3300025917 | Ga0207660_10187752 | Ga0207660_101877522 | 211 |
| 482 | 3300025921 | Ga0207652_10020700 | Ga0207652_100207007 | 211 |
| 483 | 3300025921 | Ga0207652_10036127 | Ga0207652_100361274 | 211 |
| 484 | 3300025922 | Ga0207646_10137134 | Ga0207646_101371343 | 211 |
| 485 | 3300025923 | Ga0207681_10077137 | Ga0207681_100771371 | 211 |
| 486 | 3300025923 | Ga0207681_10495887 | Ga0207681_104958872 | 211 |
| 487 | 3300025924 | Ga0207694_10285487 | Ga0207694_102854871 | 211 |
| 488 | 3300025928 | Ga0207700_10662882 | Ga0207700_106628821 | 211 |
| 489 | 3300025931 | Ga0207644_10193955 | Ga0207644_101939554 | 211 |
| 490 | 3300025932 | Ga0207690_10205609 | Ga0207690_102056093 | 211 |
| 491 | 3300025933 | Ga0207706_10205979 | Ga0207706_102059794 | 211 |
| 492 | 3300025933 | Ga0207706_10552565 | Ga0207706_105525652 | 211 |
| 493 | 3300025935 | Ga0207709_10341498 | Ga0207709_103414982 | 211 |
| 494 | 3300025942 | Ga0207689_10204505 | Ga0207689_102045053 | 211 |
| 495 | 3300025944 | Ga0207661_10010365 | Ga0207661_100103659 | 211 |
| 496 | 3300025944 | Ga0207661_10032194 | Ga0207661_100321943 | 211 |
| 497 | 3300025949 | Ga0207667_10051148 | Ga0207667_100511487 | 211 |
| 498 | 3300025960 | Ga0207651_10357531 | Ga0207651_103575312 | 211 |
| 499 | 3300025961 | Ga0207712_10745625 | Ga0207712_107456252 | 211 |
| 500 | 3300025986 | Ga0207658_10086843 | Ga0207658_100868433 | 211 |
| 501 | 3300025986 | Ga0207658_10458696 | Ga0207658_104586962 | 211 |
| 502 | 3300026035 | Ga0207703_10298759 | Ga0207703_102987592 | 211 |
| 503 | 3300026041 | Ga0207639_10259738 | Ga0207639_102597383 | 211 |
| 504 | 3300026041 | Ga0207639_10408506 | Ga0207639_104085062 | 211 |
| 505 | 3300026067 | Ga0207678_10010764 | Ga0207678_100107642 | 211 |
| 506 | 3300026067 | Ga0207678_10204311 | Ga0207678_102043111 | 211 |
| 507 | 3300026067 | Ga0207678_10324284 | Ga0207678_103242842 | 211 |
| 508 | 3300026078 | Ga0207702_10529800 | Ga0207702_105298001 | 211 |
| 509 | 3300026078 | Ga0207702_10561540 | Ga0207702_105615401 | 211 |
| 510 | 3300026089 | Ga0207648_10040396 | Ga0207648_100403963 | 211 |
| 511 | 3300026116 | Ga0207674_10158192 | Ga0207674_101581923 | 211 |
| 512 | 3300026116 | Ga0207674_10306321 | Ga0207674_103063212 | 211 |
| 513 | 3300026118 | Ga0207675_100175842 | Ga0207675_1001758423 | 211 |
| 514 | 3300026118 | Ga0207675_100823015 | Ga0207675_1008230152 | 211 |
| 515 | 3300026121 | Ga0207683_10599312 | Ga0207683_105993122 | 211 |
| 516 | 3300026142 | Ga0207698_10127349 | Ga0207698_101273494 | 211 |
| 517 | 3300027296 | Ga0209389_1000068 | Ga0209389_10000688 | 211 |
| 518 | 3300027296 | Ga0209389_1000092 | Ga0209389_100009226 | 211 |
| 519 | 3300027357 | Ga0209589_1000115 | Ga0209589_100011526 | 211 |
| 520 | 3300027361 | Ga0209489_100340 | Ga0209489_10034026 | 211 |
| 521 | 3300027361 | Ga0209489_115015 | Ga0209489_1150157 | 211 |
| 522 | 3300027363 | Ga0209700_100117 | Ga0209700_10011795 | 211 |
| 523 | 3300028379 | Ga0268266_10014260 | Ga0268266_100142609 | 211 |
| 524 | 3300028379 | Ga0268266_10051241 | Ga0268266_100512415 | 211 |
| 525 | 3300028379 | Ga0268266_10093149 | Ga0268266_100931496 | 211 |
| 526 | 3300028379 | Ga0268266_10170101 | Ga0268266_101701013 | 211 |
| 527 | 3300028380 | Ga0268265_10190437 | Ga0268265_101904372 | 211 |
| 528 | 3300028381 | Ga0268264_10455651 | Ga0268264_104556511 | 211 |
| 529 | 3300028786 | Ga0307517_10336441 | Ga0307517_103364411 | 211 |
| 530 | 3300031250 | Ga0265331_10010876 | Ga0265331_100108766 | 211 |
| 531 | 3300031616 | Ga0307508_10182003 | Ga0307508_101820032 | 211 |
| 532 | 3300031711 | Ga0265314_10071422 | Ga0265314_100714222 | 211 |
| 533 | 3300031712 | Ga0265342_10014276 | Ga0265342_100142766 | 211 |
| 534 | 3300031730 | Ga0307516_10292762 | Ga0307516_102927622 | 211 |
| 535 | 3300031824 | Ga0307413_10058019 | Ga0307413_100580192 | 211 |
| 536 | 3300031852 | Ga0307410_10512020 | Ga0307410_105120202 | 211 |
| 537 | 3300031995 | Ga0307409_100122862 | Ga0307409_1001228623 | 211 |
| 538 | 3300032002 | Ga0307416_100480374 | Ga0307416_1004803742 | 211 |
| 539 | 3300032005 | Ga0307411_10052156 | Ga0307411_100521563 | 211 |
| 540 | 3300032005 | Ga0307411_10143569 | Ga0307411_101435692 | 211 |
| 541 | 3300032126 | Ga0307415_100129334 | Ga0307415_1001293341 | 211 |
| 542 | 3300033180 | Ga0307510_10005071 | Ga0307510_1000507116 | 211 |
| 543 | 3300033180 | Ga0307510_10054066 | Ga0307510_100540662 | 211 |
| 544 | 3300035083 | Ga0373926_0023353 | Ga0373926_0023353_414_1097 | 211 |
| 545 | 3300035111 | Ga0373923_0001429 | Ga0373923_0001429_4094_4777 | 211 |
| 546 | 3300035113 | Ga0373936_0060757 | Ga0373936_0060757_763_1446 | 211 |
| 547 | 3300035113 | Ga0373936_0082108 | Ga0373936_0082108_292_927 | 211 |
| 548 | 3300035114 | Ga0373939_0020406 | Ga0373939_0020406_1084_1719 | 211 |
| 549 | 3300035116 | Ga0373945_0105482 | Ga0373945_0105482_414_1097 | 211 |
| 550 | 3300035118 | Ga0373954_0152795 | Ga0373954_0152795_111_794 | 211 |
| 551 | 3300035170 | Ga0373943_0177216 | Ga0373943_0177216_85_768 | 211 |
| 552 | 3300035172 | Ga0373955_0188902 | Ga0373955_0188902_204_887 | 211 |
| 553 | 3300035410 | Ga0373924_0027585 | Ga0373924_0027585_1130_1813 | 211 |
| 554 | 3300035691 | Ga0373931_0274562 | Ga0373931_0274562_173_808 | 211 |
| 555 | 3300035692 | Ga0373935_0028891 | Ga0373935_0028891_269_952 | 211 |
| 556 | 3300035695 | Ga0373927_0037839 | Ga0373927_0037839_1345_2028 | 211 |
| 557 | 3300035725 | Ga0373947_0034898 | Ga0373947_0034898_12_695 | 211 |
| 558 | 3300037068 | Ga0373925_0130287 | Ga0373925_0130287_100_783 | 211 |
| 559 | 3300037418 | Ga0395900_0000601 | Ga0395900_0000601_6238_6885 | 211 |
| 560 | 3300037418 | Ga0395900_0156434 | Ga0395900_0156434_1181_1828 | 211 |
| 561 | 3300037418 | Ga0395900_0384968 | Ga0395900_0384968_459_1097 | 211 |
| 562 | 3300037466 | Ga0395898_0064519 | Ga0395898_0064519_738_1385 | 211 |
| 563 | 3300037466 | Ga0395898_0557017 | Ga0395898_0557017_155_793 | 211 |
| 564 | 3300037471 | Ga0395905_0004099 | Ga0395905_0004099_11627_12265 | 211 |
| 565 | 3300037471 | Ga0395905_0179438 | Ga0395905_0179438_246_893 | 211 |
| 566 | 3300037471 | Ga0395905_0881125 | Ga0395905_0881125_74_712 | 211 |
| 567 | 3300037853 | Ga0436364_1345727 | Ga0436364_1345727_3635_4330 | 211 |
| 568 | 3300038443 | Ga0395901_0114991 | Ga0395901_0114991_254_892 | 211 |
| 569 | 3300038443 | Ga0395901_0383903 | Ga0395901_0383903_72_719 | 211 |
| 570 | 3300039447 | Ga0436361_0701096 | Ga0436361_0701096_427_1071 | 211 |
| 571 | 3300039447 | Ga0436361_0877460 | Ga0436361_0877460_352_996 | 211 |
| 572 | 3300039453 | Ga0436362_0238672 | Ga0436362_0238672_2364_3008 | 211 |
| 573 | 3300041443 | Ga0451789_0042347 | Ga0451789_0042347_976_1614 | 211 |
| 574 | 3300041459 | Ga0451800_1635921 | Ga0451800_1635921_302_937 | 211 |
| 575 | 3300041460 | Ga0451802_0462708 | Ga0451802_0462708_195_833 | 211 |
| 576 | 3300041463 | Ga0451804_1129176 | Ga0451804_1129176_225_863 | 211 |
| 577 | 3300041491 | Ga0451833_1355453 | Ga0451833_1355453_105_743 | 211 |
| 578 | 3300044656 | Ga0466969_0100021 | Ga0466969_0100021_359_1003 | 211 |
| 579 | 3300044658 | Ga0466972_0072759 | Ga0466972_0072759_898_1536 | 211 |
| 580 | 3300044658 | Ga0466972_0258293 | Ga0466972_0258293_41_679 | 211 |
| 581 | 3300044694 | Ga0466963_0037866 | Ga0466963_0037866_532_1170 | 211 |
| 582 | 3300044706 | Ga0466964_0019616 | Ga0466964_0019616_1804_2442 | 211 |
| 583 | 3300044901 | Ga0466960_0013843 | Ga0466960_0013843_1345_1983 | 211 |
| 584 | 3300044901 | Ga0466960_0057079 | Ga0466960_0057079_1073_1711 | 211 |
| 585 | 3300044901 | Ga0466960_0068260 | Ga0466960_0068260_140_787 | 211 |
| 586 | 3300045049 | Ga0466959_0187516 | Ga0466959_0187516_582_1286 | 211 |
| 587 | 3300045976 | Ga0466967_0122378 | Ga0466967_0122378_927_1574 | 211 |
| 588 | 3300045976 | Ga0466967_0142386 | Ga0466967_0142386_671_1309 | 211 |
| 589 | 3300046454 | Ga0495592_0161656 | Ga0495592_0161656_215_886 | 211 |
| 590 | 3300046457 | Ga0495590_0021555 | Ga0495590_0021555_1002_1643 | 211 |
| 591 | 3300046457 | Ga0495590_0062124 | Ga0495590_0062124_62_700 | 211 |
| 592 | 3300046459 | Ga0495629_0139772 | Ga0495629_0139772_901_1539 | 211 |
| 593 | 3300046459 | Ga0495629_0159644 | Ga0495629_0159644_574_1209 | 211 |
| 594 | 3300046460 | Ga0495638_0005428 | Ga0495638_0005428_184_822 | 211 |
| 595 | 3300046462 | Ga0495651_0005518 | Ga0495651_0005518_1473_2111 | 211 |
| 596 | 3300046462 | Ga0495651_0007953 | Ga0495651_0007953_611_1249 | 211 |
| 597 | 3300046462 | Ga0495651_0272547 | Ga0495651_0272547_379_1014 | 211 |
| 598 | 3300046463 | Ga0495653_0223986 | Ga0495653_0223986_348_986 | 211 |
| 599 | 3300046472 | Ga0495580_0009497 | Ga0495580_0009497_979_1662 | 211 |
| 600 | 3300046475 | Ga0495639_0004008 | Ga0495639_0004008_5225_5908 | 211 |
| 601 | 3300046476 | Ga0495662_0172930 | Ga0495662_0172930_90_773 | 211 |
| 602 | 3300046477 | Ga0495664_0034909 | Ga0495664_0034909_1685_2368 | 211 |
| 603 | 3300046500 | Ga0495596_0082976 | Ga0495596_0082976_407_1042 | 211 |
| 604 | 3300046501 | Ga0495607_0102964 | Ga0495607_0102964_766_1404 | 211 |
| 605 | 3300046511 | Ga0495608_0021931 | Ga0495608_0021931_3695_4333 | 211 |
| 606 | 3300046511 | Ga0495608_0133019 | Ga0495608_0133019_75_719 | 211 |
| 607 | 3300046511 | Ga0495608_0230027 | Ga0495608_0230027_16_651 | 211 |
| 608 | 3300046512 | Ga0495610_0085036 | Ga0495610_0085036_598_1236 | 211 |
| 609 | 3300046513 | Ga0495616_0108748 | Ga0495616_0108748_142_780 | 211 |
| 610 | 3300046514 | Ga0495618_0022327 | Ga0495618_0022327_1605_2288 | 211 |
| 611 | 3300046515 | Ga0495620_0111337 | Ga0495620_0111337_50_688 | 211 |
| 612 | 3300046516 | Ga0495628_0136755 | Ga0495628_0136755_1029_1667 | 211 |
| 613 | 3300046517 | Ga0495630_0045229 | Ga0495630_0045229_88_771 | 211 |
| 614 | 3300046524 | Ga0495648_0040345 | Ga0495648_0040345_226_864 | 211 |
| 615 | 3300046524 | Ga0495648_0063509 | Ga0495648_0063509_954_1778 | 211 |
| 616 | 3300046524 | Ga0495648_0227933 | Ga0495648_0227933_133_771 | 211 |
| 617 | 3300046529 | Ga0495652_0026970 | Ga0495652_0026970_2141_2779 | 211 |
| 618 | 3300046529 | Ga0495652_0170107 | Ga0495652_0170107_648_1283 | 211 |
| 619 | 3300046536 | Ga0495587_0081675 | Ga0495587_0081675_146_784 | 211 |
| 620 | 3300046538 | Ga0495609_0099182 | Ga0495609_0099182_132_770 | 211 |
| 621 | 3300046557 | Ga0495622_0278931 | Ga0495622_0278931_58_696 | 211 |
| 622 | 3300046615 | Ga0495656_0017547 | Ga0495656_0017547_246_881 | 211 |
| 623 | 3300046616 | Ga0495668_0051517 | Ga0495668_0051517_832_1470 | 211 |
| 624 | 3300046616 | Ga0495668_0475565 | Ga0495668_0475565_29_664 | 211 |
| 625 | 3300046642 | Ga0495634_0013865 | Ga0495634_0013865_2529_3212 | 211 |
| 626 | 3300046642 | Ga0495634_0033410 | Ga0495634_0033410_1639_2277 | 211 |
| 627 | 3300046642 | Ga0495634_0281391 | Ga0495634_0281391_348_986 | 211 |
| 628 | 3300046648 | Ga0495611_0243672 | Ga0495611_0243672_111_749 | 211 |
| 629 | 3300046660 | Ga0495625_0286077 | Ga0495625_0286077_207_845 | 211 |
| 630 | 3300046663 | Ga0495635_0043662 | Ga0495635_0043662_586_1224 | 211 |
| 631 | 3300046663 | Ga0495635_0049995 | Ga0495635_0049995_1395_2078 | 211 |
| 632 | 3300046675 | Ga0495657_0002722 | Ga0495657_0002722_8499_9137 | 211 |
| 633 | 3300046679 | Ga0495623_0002730 | Ga0495623_0002730_9006_9644 | 211 |
| 634 | 3300046679 | Ga0495623_0287225 | Ga0495623_0287225_56_694 | 211 |
| 635 | 3300046680 | Ga0495646_0088531 | Ga0495646_0088531_976_1659 | 211 |
| 636 | 3300046680 | Ga0495646_0089695 | Ga0495646_0089695_102_740 | 211 |
| 637 | 3300046681 | Ga0495647_0233363 | Ga0495647_0233363_62_745 | 211 |
| 638 | 3300046684 | Ga0495669_0084639 | Ga0495669_0084639_583_1221 | 211 |
| 639 | 3300046690 | Ga0495624_0158055 | Ga0495624_0158055_257_940 | 211 |
| 640 | 3300046690 | Ga0495624_0162127 | Ga0495624_0162127_341_976 | 211 |
| 641 | 3300046794 | Ga0495589_0221780 | Ga0495589_0221780_57_695 | 211 |
| 642 | 3300046809 | Ga0495600_0019685 | Ga0495600_0019685_275_913 | 211 |
| 643 | 3300047315 | Ga0495581_0023440 | Ga0495581_0023440_2607_3290 | 211 |
| 644 | 3300047317 | Ga0495604_0020305 | Ga0495604_0020305_388_1026 | 211 |
| 645 | 3300047317 | Ga0495604_0029080 | Ga0495604_0029080_1910_2548 | 211 |
| 646 | 3300047319 | Ga0495674_0037372 | Ga0495674_0037372_221_859 | 211 |
| 647 | 3300047319 | Ga0495674_0043669 | Ga0495674_0043669_2971_3654 | 211 |
| 648 | 3300047319 | Ga0495674_0769917 | Ga0495674_0769917_31_735 | 211 |
| 649 | 3300047321 | Ga0495676_0126508 | Ga0495676_0126508_795_1433 | 211 |
| 650 | 3300047322 | Ga0495680_0084540 | Ga0495680_0084540_958_1596 | 211 |
| 651 | 3300047323 | Ga0495683_0013594 | Ga0495683_0013594_2931_3569 | 211 |
| 652 | 3300047443 | Ga0495687_056171 | Ga0495687_056171_554_1192 | 211 |
| 653 | 3300047444 | Ga0495675_0065231 | Ga0495675_0065231_710_1381 | 211 |
| 654 | 3300047471 | Ga0495684_0012228 | Ga0495684_0012228_170_853 | 211 |
| 655 | 3300047472 | Ga0495686_0076268 | Ga0495686_0076268_930_1565 | 211 |
| 656 | 3300047472 | Ga0495686_0080369 | Ga0495686_0080369_355_1002 | 211 |
| 657 | 3300047673 | Ga0495593_0026986 | Ga0495593_0026986_2075_2758 | 211 |
| 658 | 3300047673 | Ga0495593_0363068 | Ga0495593_0363068_21_659 | 211 |
| 659 | 3300048088 | Ga0495602_0214752 | Ga0495602_0214752_324_962 | 211 |
| 660 | 3300048090 | Ga0495615_0008583 | Ga0495615_0008583_1262_1897 | 211 |
| 661 | 3300048903 | Ga0496100_0099054 | Ga0496100_0099054_746_1384 | 211 |
| 662 | 3300048904 | Ga0496101_0429706 | Ga0496101_0429706_334_972 | 211 |
| 663 | 3300048905 | Ga0496102_0062913 | Ga0496102_0062913_2720_3358 | 211 |
| 664 | 3300048906 | Ga0496103_0125217 | Ga0496103_0125217_699_1334 | 211 |
| 665 | 3300048907 | Ga0496104_0095563 | Ga0496104_0095563_721_1359 | 211 |
| 666 | 3300048907 | Ga0496104_0438915 | Ga0496104_0438915_151_789 | 211 |
| 667 | 3300048908 | Ga0496105_0078016 | Ga0496105_0078016_1765_2403 | 211 |
| 668 | 3300048910 | Ga0496107_0310360 | Ga0496107_0310360_132_770 | 211 |
| 669 | 3300048911 | Ga0496108_0194029 | Ga0496108_0194029_1053_1691 | 211 |
| 670 | 3300048913 | Ga0496110_0153652 | Ga0496110_0153652_264_902 | 211 |
| 671 | 3300048913 | Ga0496110_0269092 | Ga0496110_0269092_382_1020 | 211 |
| 672 | 3300048915 | Ga0496112_0040959 | Ga0496112_0040959_3373_4020 | 211 |
| 673 | 3300048915 | Ga0496112_0208278 | Ga0496112_0208278_900_1538 | 211 |
| 674 | 3300048915 | Ga0496112_0770116 | Ga0496112_0770116_180_818 | 211 |
| 675 | 3300048916 | Ga0496113_0309371 | Ga0496113_0309371_129_767 | 211 |
| 676 | 3300048916 | Ga0496113_0459930 | Ga0496113_0459930_76_714 | 211 |
| 677 | 3300048918 | Ga0496115_0136097 | Ga0496115_0136097_954_1589 | 211 |
| 678 | 3300048918 | Ga0496115_0166408 | Ga0496115_0166408_279_926 | 211 |
| 679 | 3300048918 | Ga0496115_0291782 | Ga0496115_0291782_363_1001 | 211 |
| 680 | 3300048918 | Ga0496115_0352129 | Ga0496115_0352129_89_727 | 211 |
| 681 | 3300048919 | Ga0496116_0036199 | Ga0496116_0036199_648_1286 | 211 |
| 682 | 3300048920 | Ga0496117_0023985 | Ga0496117_0023985_1138_1776 | 211 |
| 683 | 3300048920 | Ga0496117_0250327 | Ga0496117_0250327_266_901 | 211 |
| 684 | 3300048922 | Ga0496119_0002261 | Ga0496119_0002261_17609_18247 | 211 |
| 685 | 3300048922 | Ga0496119_0123825 | Ga0496119_0123825_561_1199 | 211 |
| 686 | 3300048923 | Ga0496120_0020511 | Ga0496120_0020511_2689_3327 | 211 |
| 687 | 3300048924 | Ga0496121_0004531 | Ga0496121_0004531_1356_2030 | 211 |
| 688 | 3300048924 | Ga0496121_0023313 | Ga0496121_0023313_500_1138 | 211 |
| 689 | 3300048924 | Ga0496121_0093417 | Ga0496121_0093417_379_1014 | 211 |
| 690 | 3300048924 | Ga0496121_0095489 | Ga0496121_0095489_525_1163 | 211 |
| 691 | 3300048924 | Ga0496121_0228402 | Ga0496121_0228402_472_1113 | 211 |
| 692 | 3300048925 | Ga0496122_0221224 | Ga0496122_0221224_279_947 | 211 |
| 693 | 3300048927 | Ga0496124_0055391 | Ga0496124_0055391_1321_1962 | 211 |
| 694 | 3300048927 | Ga0496124_0226068 | Ga0496124_0226068_676_1314 | 211 |
| 695 | 3300048927 | Ga0496124_0427866 | Ga0496124_0427866_58_720 | 211 |
| 696 | 3300048928 | Ga0496125_0000252 | Ga0496125_0000252_15181_15849 | 211 |
| 697 | 3300048928 | Ga0496125_0000477 | Ga0496125_0000477_19294_19956 | 211 |
| 698 | 3300048928 | Ga0496125_0006104 | Ga0496125_0006104_11709_12371 | 211 |
| 699 | 3300048928 | Ga0496125_0038225 | Ga0496125_0038225_1436_2074 | 211 |
| 700 | 3300048928 | Ga0496125_0075024 | Ga0496125_0075024_962_1600 | 211 |
| 701 | 3300048928 | Ga0496125_0078578 | Ga0496125_0078578_721_1359 | 211 |
| 702 | 3300048929 | Ga0496126_0003342 | Ga0496126_0003342_11108_11755 | 211 |
| 703 | 3300048929 | Ga0496126_0008959 | Ga0496126_0008959_5083_5730 | 211 |
| 704 | 3300048929 | Ga0496126_0027002 | Ga0496126_0027002_4497_5135 | 211 |
| 705 | 3300048929 | Ga0496126_0117917 | Ga0496126_0117917_295_933 | 211 |
| 706 | 3300048929 | Ga0496126_0145584 | Ga0496126_0145584_115_753 | 211 |
| 707 | 3300048929 | Ga0496126_0195956 | Ga0496126_0195956_842_1489 | 211 |
| 708 | 3300048929 | Ga0496126_0679466 | Ga0496126_0679466_87_728 | 211 |
| 709 | 3300049460 | Ga0495682_0022934 | Ga0495682_0022934_561_1199 | 211 |
| 710 | 3300050489 | nmdc:mga03683_110190_c1 | nmdc:mga03683_110190_c1_411_1049 | 211 |
| 711 | 3300050490 | nmdc:mga03n38_70192_c1 | nmdc:mga03n38_70192_c1_142_777 | 211 |
| 712 | 3300050491 | nmdc:mga00v17_149651_c1 | nmdc:mga00v17_149651_c1_776_1414 | 211 |
| 713 | 3300050491 | nmdc:mga00v17_313818_c1 | nmdc:mga00v17_313818_c1_20_658 | 211 |
| 714 | 3300050491 | nmdc:mga00v17_592228_c1 | nmdc:mga00v17_592228_c1_61_699 | 211 |
| 715 | 3300050492 | nmdc:mga0yw44_308508_c1 | nmdc:mga0yw44_308508_c1_14_649 | 211 |
| 716 | 3300050492 | nmdc:mga0yw44_60416_c1 | nmdc:mga0yw44_60416_c1_750_1388 | 211 |
| 717 | 3300050493 | nmdc:mga0k408_113047_c1 | nmdc:mga0k408_113047_c1_452_1105 | 211 |
| 718 | 3300050494 | nmdc:mga06z11_278886_c1 | nmdc:mga06z11_278886_c1_93_734 | 211 |
| 719 | 3300050494 | nmdc:mga06z11_29474_c1 | nmdc:mga06z11_29474_c1_1332_1970 | 211 |
| 720 | 3300050494 | nmdc:mga06z11_434110_c1 | nmdc:mga06z11_434110_c1_86_727 | 211 |
| 721 | 3300050496 | nmdc:mga07m45_101344_c1 | nmdc:mga07m45_101344_c1_777_1430 | 211 |
| 722 | 3300050496 | nmdc:mga07m45_141870_c1 | nmdc:mga07m45_141870_c1_101_739 | 211 |
| 723 | 3300050496 | nmdc:mga07m45_33802_c1 | nmdc:mga07m45_33802_c1_1016_1654 | 211 |
| 724 | 3300050507 | nmdc:mga05p37_254661_c1 | nmdc:mga05p37_254661_c1_1447_2082 | 211 |
| 725 | 3300050512 | nmdc:mga0n895_871701_c1 | nmdc:mga0n895_871701_c1_102_785 | 211 |
| 726 | 3300050516 | nmdc:mga0sz30_30547_c1 | nmdc:mga0sz30_30547_c1_1284_1922 | 211 |
| 727 | 3300050516 | nmdc:mga0sz30_99126_c1 | nmdc:mga0sz30_99126_c1_614_1249 | 211 |
| 728 | 3300053080 | Ga0500635_0017676 | Ga0500635_0017676_1166_1837 | 211 |
| 729 | 3300053086 | Ga0500578_0022393 | Ga0500578_0022393_434_1072 | 211 |
| 730 | 3300053087 | Ga0500643_000025 | Ga0500643_000025_25167_25805 | 211 |
| 731 | 3300053092 | Ga0500583_0059313 | Ga0500583_0059313_1081_1719 | 211 |
| 732 | 3300053093 | Ga0500651_0034629 | Ga0500651_0034629_448_1086 | 211 |
| 733 | 3300053093 | Ga0500651_0158861 | Ga0500651_0158861_456_1094 | 211 |
| 734 | 3300053094 | Ga0500566_0109291 | Ga0500566_0109291_511_1182 | 211 |
| 735 | 3300053096 | Ga0500641_0008562 | Ga0500641_0008562_560_1222 | 211 |
| 736 | 3300053096 | Ga0500641_0048832 | Ga0500641_0048832_626_1261 | 211 |
| 737 | 3300053103 | Ga0500555_022255 | Ga0500555_022255_549_1187 | 211 |
| 738 | 3300053104 | Ga0500556_0071895 | Ga0500556_0071895_536_1174 | 211 |
| 739 | 3300053105 | Ga0500557_000001 | Ga0500557_000001_159041_159679 | 211 |
| 740 | 3300053108 | Ga0500562_012751 | Ga0500562_012751_1469_2107 | 211 |
| 741 | 3300053109 | Ga0500569_010569 | Ga0500569_010569_914_1552 | 211 |
| 742 | 3300053111 | Ga0500572_013736 | Ga0500572_013736_58_729 | 211 |
| 743 | 3300053119 | Ga0500595_003476 | Ga0500595_003476_4378_5025 | 211 |
| 744 | 3300053130 | Ga0500642_0000221 | Ga0500642_0000221_7768_8406 | 211 |
| 745 | 3300053131 | Ga0500652_119435 | Ga0500652_119435_350_988 | 211 |
| 746 | 3300053136 | Ga0500559_0090600 | Ga0500559_0090600_705_1376 | 211 |
| 747 | 3300053139 | Ga0500568_0110097 | Ga0500568_0110097_65_703 | 211 |
| 748 | 3300053139 | Ga0500568_0119287 | Ga0500568_0119287_164_802 | 211 |
| 749 | 3300053146 | Ga0500588_0155099 | Ga0500588_0155099_180_818 | 211 |
| 750 | 3300053148 | Ga0500590_057454 | Ga0500590_057454_1314_1949 | 211 |
| 751 | 3300053151 | Ga0500604_0090367 | Ga0500604_0090367_287_949 | 211 |
| 752 | 3300053156 | Ga0500622_0046562 | Ga0500622_0046562_1459_2097 | 211 |
| 753 | 3300053158 | Ga0500627_0021488 | Ga0500627_0021488_847_1485 | 211 |
| 754 | 3300053160 | Ga0500633_0067310 | Ga0500633_0067310_561_1199 | 211 |
| 755 | 3300053162 | Ga0500638_068136 | Ga0500638_068136_276_914 | 211 |
| 756 | 3300053162 | Ga0500638_099711 | Ga0500638_099711_623_1294 | 211 |
| 757 | 3300053177 | Ga0500636_0002067 | Ga0500636_0002067_7356_8027 | 211 |
| 758 | 3300053177 | Ga0500636_0067386 | Ga0500636_0067386_1390_2025 | 211 |
| 759 | 3300053177 | Ga0500636_0083775 | Ga0500636_0083775_1015_1650 | 211 |
| 760 | 3300053178 | Ga0500637_0136510 | Ga0500637_0136510_445_1116 | 211 |
| 761 | 3300053178 | Ga0500637_0300745 | Ga0500637_0300745_217_852 | 211 |
| 762 | 3300053731 | Ga0500609_001217 | Ga0500609_001217_2052_2690 | 211 |
| 763 | iso_pu_bacteria | 2721755755 | 2723848107 | 211 |
| 764 | iso_pu_bacteria | 2933577622 | 2933578975 | 211 |
| 765 | iso_pu_bacteria | 3005710791 | 3005713956 | 211 |
| 766 | iso_pu_bacteria | 8055742211 | 8055747386 | 211 |
| 767 | 3300002070 | JGI24750J21931_1010209 | JGI24750J21931_10102092 | 212 |
| 768 | 3300002244 | JGI24742J22300_10009328 | JGI24742J22300_100093282 | 212 |
| 769 | 3300003215 | JGI25153J46596_10004553 | JGI25153J46596_100045532 | 212 |
| 770 | 3300003215 | JGI25153J46596_10013642 | JGI25153J46596_100136422 | 212 |
| 771 | 3300003320 | rootH2_10132730 | rootH2_101327302 | 212 |
| 772 | 3300003322 | rootL2_10131868 | rootL2_101318683 | 212 |
| 773 | 3300005293 | Ga0065715_10177401 | Ga0065715_101774012 | 212 |
| 774 | 3300005328 | Ga0070676_10222772 | Ga0070676_102227722 | 212 |
| 775 | 3300005331 | Ga0070670_100443514 | Ga0070670_1004435142 | 212 |
| 776 | 3300005334 | Ga0068869_100042626 | Ga0068869_1000426262 | 212 |
| 777 | 3300005334 | Ga0068869_100046137 | Ga0068869_1000461375 | 212 |
| 778 | 3300005334 | Ga0068869_100623999 | Ga0068869_1006239991 | 212 |
| 779 | 3300005338 | Ga0068868_100147989 | Ga0068868_1001479892 | 212 |
| 780 | 3300005338 | Ga0068868_100455915 | Ga0068868_1004559151 | 212 |
| 781 | 3300005340 | Ga0070689_100148809 | Ga0070689_1001488093 | 212 |
| 782 | 3300005340 | Ga0070689_100193978 | Ga0070689_1001939782 | 212 |
| 783 | 3300005344 | Ga0070661_100072219 | Ga0070661_1000722193 | 212 |
| 784 | 3300005344 | Ga0070661_100213456 | Ga0070661_1002134562 | 212 |
| 785 | 3300005344 | Ga0070661_100943411 | Ga0070661_1009434111 | 212 |
| 786 | 3300005347 | Ga0070668_100029460 | Ga0070668_1000294607 | 212 |
| 787 | 3300005347 | Ga0070668_100093136 | Ga0070668_1000931363 | 212 |
| 788 | 3300005347 | Ga0070668_100201866 | Ga0070668_1002018662 | 212 |
| 789 | 3300005347 | Ga0070668_100245523 | Ga0070668_1002455232 | 212 |
| 790 | 3300005353 | Ga0070669_100073703 | Ga0070669_1000737033 | 212 |
| 791 | 3300005353 | Ga0070669_100308564 | Ga0070669_1003085641 | 212 |
| 792 | 3300005355 | Ga0070671_100398834 | Ga0070671_1003988341 | 212 |
| 793 | 3300005356 | Ga0070674_100076493 | Ga0070674_1000764931 | 212 |
| 794 | 3300005365 | Ga0070688_100452898 | Ga0070688_1004528981 | 212 |
| 795 | 3300005366 | Ga0070659_100537331 | Ga0070659_1005373312 | 212 |
| 796 | 3300005367 | Ga0070667_100133687 | Ga0070667_1001336873 | 212 |
| 797 | 3300005438 | Ga0070701_10272194 | Ga0070701_102721942 | 212 |
| 798 | 3300005440 | Ga0070705_100255437 | Ga0070705_1002554372 | 212 |
| 799 | 3300005455 | Ga0070663_100061793 | Ga0070663_1000617933 | 212 |
| 800 | 3300005455 | Ga0070663_100075935 | Ga0070663_1000759353 | 212 |
| 801 | 3300005455 | Ga0070663_100147104 | Ga0070663_1001471042 | 212 |
| 802 | 3300005455 | Ga0070663_100164837 | Ga0070663_1001648373 | 212 |
| 803 | 3300005455 | Ga0070663_100222098 | Ga0070663_1002220982 | 212 |
| 804 | 3300005455 | Ga0070663_100813719 | Ga0070663_1008137191 | 212 |
| 805 | 3300005456 | Ga0070678_100123878 | Ga0070678_1001238783 | 212 |
| 806 | 3300005456 | Ga0070678_100181178 | Ga0070678_1001811783 | 212 |
| 807 | 3300005457 | Ga0070662_100021115 | Ga0070662_1000211155 | 212 |
| 808 | 3300005457 | Ga0070662_100080814 | Ga0070662_1000808144 | 212 |
| 809 | 3300005459 | Ga0068867_100044046 | Ga0068867_1000440462 | 212 |
| 810 | 3300005459 | Ga0068867_100324494 | Ga0068867_1003244942 | 212 |
| 811 | 3300005459 | Ga0068867_100703553 | Ga0068867_1007035531 | 212 |
| 812 | 3300005535 | Ga0070684_100179997 | Ga0070684_1001799971 | 212 |
| 813 | 3300005535 | Ga0070684_100269786 | Ga0070684_1002697861 | 212 |
| 814 | 3300005539 | Ga0068853_100129622 | Ga0068853_1001296222 | 212 |
| 815 | 3300005539 | Ga0068853_100135576 | Ga0068853_1001355763 | 212 |
| 816 | 3300005539 | Ga0068853_100571092 | Ga0068853_1005710922 | 212 |
| 817 | 3300005543 | Ga0070672_100017103 | Ga0070672_1000171033 | 212 |
| 818 | 3300005543 | Ga0070672_100213424 | Ga0070672_1002134243 | 212 |
| 819 | 3300005545 | Ga0070695_100193314 | Ga0070695_1001933142 | 212 |
| 820 | 3300005547 | Ga0070693_100023629 | Ga0070693_1000236295 | 212 |
| 821 | 3300005547 | Ga0070693_100266035 | Ga0070693_1002660352 | 212 |
| 822 | 3300005548 | Ga0070665_100063529 | Ga0070665_1000635292 | 212 |
| 823 | 3300005548 | Ga0070665_100297744 | Ga0070665_1002977442 | 212 |
| 824 | 3300005548 | Ga0070665_100654714 | Ga0070665_1006547142 | 212 |
| 825 | 3300005563 | Ga0068855_100223280 | Ga0068855_1002232802 | 212 |
| 826 | 3300005564 | Ga0070664_100253929 | Ga0070664_1002539292 | 212 |
| 827 | 3300005564 | Ga0070664_100334465 | Ga0070664_1003344652 | 212 |
| 828 | 3300005578 | Ga0068854_100104017 | Ga0068854_1001040173 | 212 |
| 829 | 3300005578 | Ga0068854_100511366 | Ga0068854_1005113662 | 212 |
| 830 | 3300005614 | Ga0068856_100048216 | Ga0068856_1000482165 | 212 |
| 831 | 3300005615 | Ga0070702_100082084 | Ga0070702_1000820843 | 212 |
| 832 | 3300005616 | Ga0068852_100142897 | Ga0068852_1001428974 | 212 |
| 833 | 3300005616 | Ga0068852_100320270 | Ga0068852_1003202702 | 212 |
| 834 | 3300005616 | Ga0068852_100462691 | Ga0068852_1004626911 | 212 |
| 835 | 3300005617 | Ga0068859_100131914 | Ga0068859_1001319142 | 212 |
| 836 | 3300005617 | Ga0068859_100353023 | Ga0068859_1003530232 | 212 |
| 837 | 3300005618 | Ga0068864_100391349 | Ga0068864_1003913492 | 212 |
| 838 | 3300005718 | Ga0068866_10054663 | Ga0068866_100546633 | 212 |
| 839 | 3300005718 | Ga0068866_10153029 | Ga0068866_101530292 | 212 |
| 840 | 3300005719 | Ga0068861_100020526 | Ga0068861_1000205264 | 212 |
| 841 | 3300005719 | Ga0068861_100063438 | Ga0068861_1000634383 | 212 |
| 842 | 3300005719 | Ga0068861_100419044 | Ga0068861_1004190442 | 212 |
| 843 | 3300005841 | Ga0068863_100516105 | Ga0068863_1005161051 | 212 |
| 844 | 3300005842 | Ga0068858_100091500 | Ga0068858_1000915004 | 212 |
| 845 | 3300005842 | Ga0068858_100142639 | Ga0068858_1001426392 | 212 |
| 846 | 3300005843 | Ga0068860_100161081 | Ga0068860_1001610812 | 212 |
| 847 | 3300005843 | Ga0068860_100250233 | Ga0068860_1002502331 | 212 |
| 848 | 3300005843 | Ga0068860_100501595 | Ga0068860_1005015952 | 212 |
| 849 | 3300005844 | Ga0068862_100045914 | Ga0068862_1000459144 | 212 |
| 850 | 3300005844 | Ga0068862_100062334 | Ga0068862_1000623341 | 212 |
| 851 | 3300005844 | Ga0068862_100117710 | Ga0068862_1001177104 | 212 |
| 852 | 3300005844 | Ga0068862_100227586 | Ga0068862_1002275863 | 212 |
| 853 | 3300005937 | Ga0081455_10015336 | Ga0081455_100153365 | 212 |
| 854 | 3300005937 | Ga0081455_10181824 | Ga0081455_101818242 | 212 |
| 855 | 3300005981 | Ga0081538_10103094 | Ga0081538_101030942 | 212 |
| 856 | 3300005983 | Ga0081540_1004140 | Ga0081540_100414014 | 212 |
| 857 | 3300005983 | Ga0081540_1005687 | Ga0081540_100568710 | 212 |
| 858 | 3300005983 | Ga0081540_1010925 | Ga0081540_10109257 | 212 |
| 859 | 3300005983 | Ga0081540_1079967 | Ga0081540_10799672 | 212 |
| 860 | 3300005985 | Ga0081539_10019345 | Ga0081539_100193452 | 212 |
| 861 | 3300006038 | Ga0075365_10190875 | Ga0075365_101908751 | 212 |
| 862 | 3300006048 | Ga0075363_100018491 | Ga0075363_1000184914 | 212 |
| 863 | 3300006048 | Ga0075363_100108190 | Ga0075363_1001081902 | 212 |
| 864 | 3300006178 | Ga0075367_10002456 | Ga0075367_100024565 | 212 |
| 865 | 3300006178 | Ga0075367_10012875 | Ga0075367_100128753 | 212 |
| 866 | 3300006178 | Ga0075367_10020273 | Ga0075367_100202735 | 212 |
| 867 | 3300006186 | Ga0075369_10157575 | Ga0075369_101575753 | 212 |
| 868 | 3300006237 | Ga0097621_100423091 | Ga0097621_1004230911 | 212 |
| 869 | 3300006353 | Ga0075370_10053723 | Ga0075370_100537233 | 212 |
| 870 | 3300006358 | Ga0068871_100295356 | Ga0068871_1002953563 | 212 |
| 871 | 3300006358 | Ga0068871_100614222 | Ga0068871_1006142222 | 212 |
| 872 | 3300006358 | Ga0068871_100674142 | Ga0068871_1006741422 | 212 |
| 873 | 3300006881 | Ga0068865_100064851 | Ga0068865_1000648513 | 212 |
| 874 | 3300006931 | Ga0097620_100131926 | Ga0097620_1001319262 | 212 |
| 875 | 3300006931 | Ga0097620_100353012 | Ga0097620_1003530122 | 212 |
| 876 | 3300007076 | Ga0075435_100137799 | Ga0075435_1001377993 | 212 |
| 877 | 3300009093 | Ga0105240_11106718 | Ga0105240_111067181 | 212 |
| 878 | 3300009098 | Ga0105245_10108637 | Ga0105245_101086371 | 212 |
| 879 | 3300009098 | Ga0105245_10201630 | Ga0105245_102016303 | 212 |
| 880 | 3300009098 | Ga0105245_10364213 | Ga0105245_103642131 | 212 |
| 881 | 3300009098 | Ga0105245_11706360 | Ga0105245_117063601 | 212 |
| 882 | 3300009101 | Ga0105247_10096820 | Ga0105247_100968204 | 212 |
| 883 | 3300009101 | Ga0105247_10150998 | Ga0105247_101509982 | 212 |
| 884 | 3300009101 | Ga0105247_10189651 | Ga0105247_101896512 | 212 |
| 885 | 3300009101 | Ga0105247_10473920 | Ga0105247_104739202 | 212 |
| 886 | 3300009148 | Ga0105243_10255677 | Ga0105243_102556772 | 212 |
| 887 | 3300009148 | Ga0105243_10328799 | Ga0105243_103287992 | 212 |
| 888 | 3300009148 | Ga0105243_10329267 | Ga0105243_103292671 | 212 |
| 889 | 3300009174 | Ga0105241_10020802 | Ga0105241_100208022 | 212 |
| 890 | 3300009174 | Ga0105241_10752413 | Ga0105241_107524131 | 212 |
| 891 | 3300009176 | Ga0105242_10137338 | Ga0105242_101373383 | 212 |
| 892 | 3300009176 | Ga0105242_10743671 | Ga0105242_107436712 | 212 |
| 893 | 3300009176 | Ga0105242_10754450 | Ga0105242_107544501 | 212 |
| 894 | 3300009177 | Ga0105248_10144983 | Ga0105248_101449832 | 212 |
| 895 | 3300009177 | Ga0105248_10658129 | Ga0105248_106581291 | 212 |
| 896 | 3300009545 | Ga0105237_10218378 | Ga0105237_102183783 | 212 |
| 897 | 3300009545 | Ga0105237_10443511 | Ga0105237_104435112 | 212 |
| 898 | 3300009551 | Ga0105238_10225419 | Ga0105238_102254191 | 212 |
| 899 | 3300009551 | Ga0105238_10895422 | Ga0105238_108954221 | 212 |
| 900 | 3300009553 | Ga0105249_10145325 | Ga0105249_101453253 | 212 |
| 901 | 3300009553 | Ga0105249_10226941 | Ga0105249_102269413 | 212 |
| 902 | 3300009553 | Ga0105249_10768991 | Ga0105249_107689912 | 212 |
| 903 | 3300009553 | Ga0105249_11091964 | Ga0105249_110919641 | 212 |
| 904 | 3300010375 | Ga0105239_10099657 | Ga0105239_100996575 | 212 |
| 905 | 3300010375 | Ga0105239_10435494 | Ga0105239_104354942 | 212 |
| 906 | 3300010375 | Ga0105239_10661858 | Ga0105239_106618581 | 212 |
| 907 | 3300011119 | Ga0105246_10172292 | Ga0105246_101722923 | 212 |
| 908 | 3300011119 | Ga0105246_10186368 | Ga0105246_101863683 | 212 |
| 909 | 3300011119 | Ga0105246_10410177 | Ga0105246_104101772 | 212 |
| 910 | 3300013296 | Ga0157374_10062596 | Ga0157374_100625964 | 212 |
| 911 | 3300013296 | Ga0157374_10175385 | Ga0157374_101753853 | 212 |
| 912 | 3300013297 | Ga0157378_10104317 | Ga0157378_101043173 | 212 |
| 913 | 3300013297 | Ga0157378_10115924 | Ga0157378_101159242 | 212 |
| 914 | 3300013306 | Ga0163162_10077525 | Ga0163162_100775253 | 212 |
| 915 | 3300013306 | Ga0163162_10290394 | Ga0163162_102903942 | 212 |
| 916 | 3300013306 | Ga0163162_10383251 | Ga0163162_103832513 | 212 |
| 917 | 3300013306 | Ga0163162_10517807 | Ga0163162_105178072 | 212 |
| 918 | 3300013308 | Ga0157375_10017613 | Ga0157375_100176134 | 212 |
| 919 | 3300014325 | Ga0163163_10033417 | Ga0163163_100334174 | 212 |
| 920 | 3300014325 | Ga0163163_10218554 | Ga0163163_102185543 | 212 |
| 921 | 3300014325 | Ga0163163_10280029 | Ga0163163_102800293 | 212 |
| 922 | 3300014325 | Ga0163163_10292201 | Ga0163163_102922012 | 212 |
| 923 | 3300014326 | Ga0157380_10149717 | Ga0157380_101497172 | 212 |
| 924 | 3300014326 | Ga0157380_10896436 | Ga0157380_108964361 | 212 |
| 925 | 3300014745 | Ga0157377_10151352 | Ga0157377_101513522 | 212 |
| 926 | 3300014745 | Ga0157377_10248961 | Ga0157377_102489612 | 212 |
| 927 | 3300014968 | Ga0157379_10240107 | Ga0157379_102401071 | 212 |
| 928 | 3300014968 | Ga0157379_10268995 | Ga0157379_102689953 | 212 |
| 929 | 3300014968 | Ga0157379_10745659 | Ga0157379_107456591 | 212 |
| 930 | 3300014969 | Ga0157376_10005581 | Ga0157376_100055818 | 212 |
| 931 | 3300014969 | Ga0157376_10274276 | Ga0157376_102742763 | 212 |
| 932 | 3300017792 | Ga0163161_10340276 | Ga0163161_103402762 | 212 |
| 933 | 3300017792 | Ga0163161_10399603 | Ga0163161_103996031 | 212 |
| 934 | 3300025297 | Ga0209758_1034945 | Ga0209758_10349453 | 212 |
| 935 | 3300025901 | Ga0207688_10278094 | Ga0207688_102780942 | 212 |
| 936 | 3300025903 | Ga0207680_10360301 | Ga0207680_103603012 | 212 |
| 937 | 3300025907 | Ga0207645_10072377 | Ga0207645_100723773 | 212 |
| 938 | 3300025907 | Ga0207645_10228146 | Ga0207645_102281462 | 212 |
| 939 | 3300025911 | Ga0207654_10142390 | Ga0207654_101423902 | 212 |
| 940 | 3300025911 | Ga0207654_10409186 | Ga0207654_104091862 | 212 |
| 941 | 3300025914 | Ga0207671_10056314 | Ga0207671_100563142 | 212 |
| 942 | 3300025918 | Ga0207662_10104871 | Ga0207662_101048711 | 212 |
| 943 | 3300025919 | Ga0207657_10131553 | Ga0207657_101315531 | 212 |
| 944 | 3300025920 | Ga0207649_10014953 | Ga0207649_100149533 | 212 |
| 945 | 3300025923 | Ga0207681_10352556 | Ga0207681_103525562 | 212 |
| 946 | 3300025924 | Ga0207694_10279479 | Ga0207694_102794792 | 212 |
| 947 | 3300025924 | Ga0207694_10409220 | Ga0207694_104092201 | 212 |
| 948 | 3300025924 | Ga0207694_10854811 | Ga0207694_108548111 | 212 |
| 949 | 3300025925 | Ga0207650_10177191 | Ga0207650_101771911 | 212 |
| 950 | 3300025927 | Ga0207687_10024425 | Ga0207687_100244255 | 212 |
| 951 | 3300025927 | Ga0207687_10436076 | Ga0207687_104360762 | 212 |
| 952 | 3300025931 | Ga0207644_10016877 | Ga0207644_100168773 | 212 |
| 953 | 3300025931 | Ga0207644_10273995 | Ga0207644_102739951 | 212 |
| 954 | 3300025933 | Ga0207706_10312952 | Ga0207706_103129522 | 212 |
| 955 | 3300025933 | Ga0207706_10518528 | Ga0207706_105185281 | 212 |
| 956 | 3300025934 | Ga0207686_10367153 | Ga0207686_103671532 | 212 |
| 957 | 3300025935 | Ga0207709_10119033 | Ga0207709_101190333 | 212 |
| 958 | 3300025935 | Ga0207709_10145177 | Ga0207709_101451773 | 212 |
| 959 | 3300025936 | Ga0207670_10088217 | Ga0207670_100882174 | 212 |
| 960 | 3300025938 | Ga0207704_10016841 | Ga0207704_100168416 | 212 |
| 961 | 3300025939 | Ga0207665_10411969 | Ga0207665_104119691 | 212 |
| 962 | 3300025940 | Ga0207691_10075742 | Ga0207691_100757424 | 212 |
| 963 | 3300025940 | Ga0207691_10389425 | Ga0207691_103894252 | 212 |
| 964 | 3300025941 | Ga0207711_10224504 | Ga0207711_102245042 | 212 |
| 965 | 3300025942 | Ga0207689_10031197 | Ga0207689_100311972 | 212 |
| 966 | 3300025942 | Ga0207689_10048889 | Ga0207689_100488894 | 212 |
| 967 | 3300025945 | Ga0207679_10279869 | Ga0207679_102798692 | 212 |
| 968 | 3300025961 | Ga0207712_10059409 | Ga0207712_100594092 | 212 |
| 969 | 3300025961 | Ga0207712_10235403 | Ga0207712_102354032 | 212 |
| 970 | 3300025961 | Ga0207712_10538069 | Ga0207712_105380692 | 212 |
| 971 | 3300025972 | Ga0207668_10141735 | Ga0207668_101417353 | 212 |
| 972 | 3300025972 | Ga0207668_10314864 | Ga0207668_103148642 | 212 |
| 973 | 3300025981 | Ga0207640_10033120 | Ga0207640_100331204 | 212 |
| 974 | 3300025981 | Ga0207640_10473452 | Ga0207640_104734522 | 212 |
| 975 | 3300025986 | Ga0207658_10206354 | Ga0207658_102063542 | 212 |
| 976 | 3300026023 | Ga0207677_10168303 | Ga0207677_101683032 | 212 |
| 977 | 3300026035 | Ga0207703_10066372 | Ga0207703_100663722 | 212 |
| 978 | 3300026035 | Ga0207703_10643501 | Ga0207703_106435012 | 212 |
| 979 | 3300026067 | Ga0207678_10058807 | Ga0207678_100588072 | 212 |
| 980 | 3300026067 | Ga0207678_10067429 | Ga0207678_100674292 | 212 |
| 981 | 3300026067 | Ga0207678_10093111 | Ga0207678_100931113 | 212 |
| 982 | 3300026067 | Ga0207678_10172642 | Ga0207678_101726422 | 212 |
| 983 | 3300026067 | Ga0207678_10193129 | Ga0207678_101931293 | 212 |
| 984 | 3300026075 | Ga0207708_10039623 | Ga0207708_100396235 | 212 |
| 985 | 3300026088 | Ga0207641_10202896 | Ga0207641_102028963 | 212 |
| 986 | 3300026088 | Ga0207641_10274207 | Ga0207641_102742071 | 212 |
| 987 | 3300026089 | Ga0207648_10019696 | Ga0207648_100196963 | 212 |
| 988 | 3300026089 | Ga0207648_10307603 | Ga0207648_103076031 | 212 |
| 989 | 3300026095 | Ga0207676_10169565 | Ga0207676_101695652 | 212 |
| 990 | 3300026095 | Ga0207676_10364959 | Ga0207676_103649592 | 212 |
| 991 | 3300026118 | Ga0207675_100029182 | Ga0207675_1000291823 | 212 |
| 992 | 3300026118 | Ga0207675_100209540 | Ga0207675_1002095402 | 212 |
| 993 | 3300026118 | Ga0207675_100697836 | Ga0207675_1006978362 | 212 |
| 994 | 3300026121 | Ga0207683_10093880 | Ga0207683_100938803 | 212 |
| 995 | 3300026121 | Ga0207683_10176304 | Ga0207683_101763042 | 212 |
| 996 | 3300026121 | Ga0207683_10219002 | Ga0207683_102190023 | 212 |
| 997 | 3300026121 | Ga0207683_10562575 | Ga0207683_105625752 | 212 |
| 998 | 3300026121 | Ga0207683_10746570 | Ga0207683_107465702 | 212 |
| 999 | 3300026142 | Ga0207698_10309172 | Ga0207698_103091721 | 212 |
| 1000 | 3300026142 | Ga0207698_10815153 | Ga0207698_108151531 | 212 |
| 1001 | 3300028379 | Ga0268266_10005735 | Ga0268266_100057354 | 212 |
| 1002 | 3300028379 | Ga0268266_10114937 | Ga0268266_101149374 | 212 |
| 1003 | 3300028379 | Ga0268266_10261743 | Ga0268266_102617433 | 212 |
| 1004 | 3300028380 | Ga0268265_10049404 | Ga0268265_100494044 | 212 |
| 1005 | 3300028380 | Ga0268265_10272498 | Ga0268265_102724982 | 212 |
| 1006 | 3300028381 | Ga0268264_10023033 | Ga0268264_100230332 | 212 |
| 1007 | 3300028786 | Ga0307517_10000071 | Ga0307517_1000007168 | 212 |
| 1008 | 3300028794 | Ga0307515_10035411 | Ga0307515_100354119 | 212 |
| 1009 | 3300028794 | Ga0307515_10225215 | Ga0307515_102252152 | 212 |
| 1010 | 3300028794 | Ga0307515_10301631 | Ga0307515_103016312 | 212 |
| 1011 | 3300031456 | Ga0307513_10441231 | Ga0307513_104412312 | 212 |
| 1012 | 3300031507 | Ga0307509_10103714 | Ga0307509_101037142 | 212 |
| 1013 | 3300031616 | Ga0307508_10015804 | Ga0307508_100158049 | 212 |
| 1014 | 3300031616 | Ga0307508_10371132 | Ga0307508_103711322 | 212 |
| 1015 | 3300031616 | Ga0307508_10560934 | Ga0307508_105609341 | 212 |
| 1016 | 3300031711 | Ga0265314_10079398 | Ga0265314_100793983 | 212 |
| 1017 | 3300031730 | Ga0307516_10130897 | Ga0307516_101308973 | 212 |
| 1018 | 3300031730 | Ga0307516_10503868 | Ga0307516_105038681 | 212 |
| 1019 | 3300031730 | Ga0307516_10508305 | Ga0307516_105083051 | 212 |
| 1020 | 3300031995 | Ga0307409_100164695 | Ga0307409_1001646953 | 212 |
| 1021 | 3300033180 | Ga0307510_10025489 | Ga0307510_100254898 | 212 |
| 1022 | 3300035085 | Ga0373929_0001973 | Ga0373929_0001973_1224_1862 | 212 |
| 1023 | 3300035090 | Ga0373949_0034709 | Ga0373949_0034709_463_1107 | 212 |
| 1024 | 3300035092 | Ga0373952_0025115 | Ga0373952_0025115_580_1224 | 212 |
| 1025 | 3300035115 | Ga0373941_0042528 | Ga0373941_0042528_371_1015 | 212 |
| 1026 | 3300035241 | Ga0373961_0090212 | Ga0373961_0090212_192_830 | 212 |
| 1027 | 3300035691 | Ga0373931_0042267 | Ga0373931_0042267_669_1313 | 212 |
| 1028 | 3300035692 | Ga0373935_0164148 | Ga0373935_0164148_760_1404 | 212 |
| 1029 | 3300035695 | Ga0373927_0252127 | Ga0373927_0252127_402_1046 | 212 |
| 1030 | 3300037068 | Ga0373925_0457738 | Ga0373925_0457738_215_853 | 212 |
| 1031 | 3300037471 | Ga0395905_0045576 | Ga0395905_0045576_1875_2513 | 212 |
| 1032 | 3300038443 | Ga0395901_0327622 | Ga0395901_0327622_447_1085 | 212 |
| 1033 | 3300046454 | Ga0495592_0282725 | Ga0495592_0282725_384_1022 | 212 |
| 1034 | 3300046455 | Ga0495603_0034408 | Ga0495603_0034408_198_836 | 212 |
| 1035 | 3300046460 | Ga0495638_0113325 | Ga0495638_0113325_621_1316 | 212 |
| 1036 | 3300046461 | Ga0495641_0056529 | Ga0495641_0056529_369_1007 | 212 |
| 1037 | 3300046461 | Ga0495641_0131485 | Ga0495641_0131485_172_810 | 212 |
| 1038 | 3300046474 | Ga0495605_0135421 | Ga0495605_0135421_99_737 | 212 |
| 1039 | 3300046477 | Ga0495664_0040873 | Ga0495664_0040873_1660_2298 | 212 |
| 1040 | 3300046477 | Ga0495664_0215422 | Ga0495664_0215422_371_1015 | 212 |
| 1041 | 3300046491 | Ga0495584_0267785 | Ga0495584_0267785_156_794 | 212 |
| 1042 | 3300046492 | Ga0495585_0110244 | Ga0495585_0110244_78_716 | 212 |
| 1043 | 3300046501 | Ga0495607_0249128 | Ga0495607_0249128_175_813 | 212 |
| 1044 | 3300046512 | Ga0495610_0137742 | Ga0495610_0137742_55_693 | 212 |
| 1045 | 3300046513 | Ga0495616_0091351 | Ga0495616_0091351_507_1145 | 212 |
| 1046 | 3300046518 | Ga0495631_0128667 | Ga0495631_0128667_26_664 | 212 |
| 1047 | 3300046519 | Ga0495632_0156773 | Ga0495632_0156773_239_883 | 212 |
| 1048 | 3300046519 | Ga0495632_0219770 | Ga0495632_0219770_66_704 | 212 |
| 1049 | 3300046523 | Ga0495644_0109982 | Ga0495644_0109982_10_648 | 212 |
| 1050 | 3300046524 | Ga0495648_0120781 | Ga0495648_0120781_450_1088 | 212 |
| 1051 | 3300046529 | Ga0495652_0433823 | Ga0495652_0433823_142_780 | 212 |
| 1052 | 3300046537 | Ga0495598_0152338 | Ga0495598_0152338_98_736 | 212 |
| 1053 | 3300046538 | Ga0495609_0149992 | Ga0495609_0149992_284_922 | 212 |
| 1054 | 3300046538 | Ga0495609_0190328 | Ga0495609_0190328_155_793 | 212 |
| 1055 | 3300046539 | Ga0495621_0017558 | Ga0495621_0017558_1015_1653 | 212 |
| 1056 | 3300046557 | Ga0495622_0088960 | Ga0495622_0088960_319_957 | 212 |
| 1057 | 3300046557 | Ga0495622_0102868 | Ga0495622_0102868_152_796 | 212 |
| 1058 | 3300046558 | Ga0495633_0031367 | Ga0495633_0031367_1527_2165 | 212 |
| 1059 | 3300046558 | Ga0495633_0217666 | Ga0495633_0217666_58_696 | 212 |
| 1060 | 3300046615 | Ga0495656_0227631 | Ga0495656_0227631_220_858 | 212 |
| 1061 | 3300046616 | Ga0495668_0172125 | Ga0495668_0172125_163_801 | 212 |
| 1062 | 3300046648 | Ga0495611_0061653 | Ga0495611_0061653_646_1341 | 212 |
| 1063 | 3300046648 | Ga0495611_0191250 | Ga0495611_0191250_133_771 | 212 |
| 1064 | 3300046660 | Ga0495625_0362396 | Ga0495625_0362396_36_674 | 212 |
| 1065 | 3300046664 | Ga0495659_0266048 | Ga0495659_0266048_15_653 | 212 |
| 1066 | 3300046665 | Ga0495661_0207557 | Ga0495661_0207557_82_720 | 212 |
| 1067 | 3300046690 | Ga0495624_0400437 | Ga0495624_0400437_10_648 | 212 |
| 1068 | 3300046691 | Ga0495670_0145113 | Ga0495670_0145113_169_807 | 212 |
| 1069 | 3300047317 | Ga0495604_0173475 | Ga0495604_0173475_272_910 | 212 |
| 1070 | 3300047318 | Ga0495636_0059948 | Ga0495636_0059948_564_1202 | 212 |
| 1071 | 3300047320 | Ga0495672_0028339 | Ga0495672_0028339_2232_2876 | 212 |
| 1072 | 3300047320 | Ga0495672_0151839 | Ga0495672_0151839_473_1111 | 212 |
| 1073 | 3300047323 | Ga0495683_0287932 | Ga0495683_0287932_15_653 | 212 |
| 1074 | 3300047445 | Ga0495677_0005933 | Ga0495677_0005933_3734_4372 | 212 |
| 1075 | 3300047446 | Ga0495679_097202 | Ga0495679_097202_167_805 | 212 |
| 1076 | 3300048090 | Ga0495615_0060246 | Ga0495615_0060246_208_846 | 212 |
| 1077 | 3300048903 | Ga0496100_0034333 | Ga0496100_0034333_604_1245 | 212 |
| 1078 | 3300048903 | Ga0496100_0215752 | Ga0496100_0215752_225_869 | 212 |
| 1079 | 3300048903 | Ga0496100_0353426 | Ga0496100_0353426_129_767 | 212 |
| 1080 | 3300048904 | Ga0496101_0010035 | Ga0496101_0010035_3935_4576 | 212 |
| 1081 | 3300048904 | Ga0496101_0251335 | Ga0496101_0251335_511_1149 | 212 |
| 1082 | 3300048904 | Ga0496101_0398983 | Ga0496101_0398983_347_985 | 212 |
| 1083 | 3300048905 | Ga0496102_0013449 | Ga0496102_0013449_3714_4358 | 212 |
| 1084 | 3300048905 | Ga0496102_0128269 | Ga0496102_0128269_800_1441 | 212 |
| 1085 | 3300048905 | Ga0496102_0162493 | Ga0496102_0162493_116_760 | 212 |
| 1086 | 3300048905 | Ga0496102_0402287 | Ga0496102_0402287_289_927 | 212 |
| 1087 | 3300048905 | Ga0496102_0494062 | Ga0496102_0494062_329_967 | 212 |
| 1088 | 3300048906 | Ga0496103_0378626 | Ga0496103_0378626_125_763 | 212 |
| 1089 | 3300048907 | Ga0496104_0034670 | Ga0496104_0034670_1472_2113 | 212 |
| 1090 | 3300048907 | Ga0496104_0037615 | Ga0496104_0037615_2815_3453 | 212 |
| 1091 | 3300048907 | Ga0496104_0178001 | Ga0496104_0178001_188_826 | 212 |
| 1092 | 3300048908 | Ga0496105_0013759 | Ga0496105_0013759_669_1313 | 212 |
| 1093 | 3300048908 | Ga0496105_0031433 | Ga0496105_0031433_351_992 | 212 |
| 1094 | 3300048908 | Ga0496105_0316345 | Ga0496105_0316345_293_931 | 212 |
| 1095 | 3300048908 | Ga0496105_0518923 | Ga0496105_0518923_149_793 | 212 |
| 1096 | 3300048909 | Ga0496106_0034128 | Ga0496106_0034128_1541_2185 | 212 |
| 1097 | 3300048909 | Ga0496106_0304489 | Ga0496106_0304489_192_830 | 212 |
| 1098 | 3300048909 | Ga0496106_0329026 | Ga0496106_0329026_62_700 | 212 |
| 1099 | 3300048909 | Ga0496106_0502338 | Ga0496106_0502338_288_926 | 212 |
| 1100 | 3300048910 | Ga0496107_0012206 | Ga0496107_0012206_2728_3372 | 212 |
| 1101 | 3300048910 | Ga0496107_0041263 | Ga0496107_0041263_2458_3099 | 212 |
| 1102 | 3300048910 | Ga0496107_0109232 | Ga0496107_0109232_1285_1923 | 212 |
| 1103 | 3300048911 | Ga0496108_0030269 | Ga0496108_0030269_761_1402 | 212 |
| 1104 | 3300048911 | Ga0496108_0360749 | Ga0496108_0360749_537_1181 | 212 |
| 1105 | 3300048912 | Ga0496109_0110376 | Ga0496109_0110376_23_667 | 212 |
| 1106 | 3300048912 | Ga0496109_0188961 | Ga0496109_0188961_936_1580 | 212 |
| 1107 | 3300048913 | Ga0496110_0017963 | Ga0496110_0017963_2790_3428 | 212 |
| 1108 | 3300048913 | Ga0496110_0018229 | Ga0496110_0018229_1805_2449 | 212 |
| 1109 | 3300048913 | Ga0496110_0320020 | Ga0496110_0320020_132_770 | 212 |
| 1110 | 3300048914 | Ga0496111_0021492 | Ga0496111_0021492_3121_3765 | 212 |
| 1111 | 3300048914 | Ga0496111_0072379 | Ga0496111_0072379_889_1530 | 212 |
| 1112 | 3300048915 | Ga0496112_0021451 | Ga0496112_0021451_3564_4205 | 212 |
| 1113 | 3300048915 | Ga0496112_0204579 | Ga0496112_0204579_934_1578 | 212 |
| 1114 | 3300048915 | Ga0496112_0413839 | Ga0496112_0413839_528_1172 | 212 |
| 1115 | 3300048916 | Ga0496113_0025419 | Ga0496113_0025419_539_1183 | 212 |
| 1116 | 3300048916 | Ga0496113_0220446 | Ga0496113_0220446_656_1297 | 212 |
| 1117 | 3300048917 | Ga0496114_0009819 | Ga0496114_0009819_6716_7357 | 212 |
| 1118 | 3300048917 | Ga0496114_0194523 | Ga0496114_0194523_646_1284 | 212 |
| 1119 | 3300048918 | Ga0496115_0106182 | Ga0496115_0106182_1159_1803 | 212 |
| 1120 | 3300048918 | Ga0496115_0577737 | Ga0496115_0577737_227_865 | 212 |
| 1121 | 3300048918 | Ga0496115_0710117 | Ga0496115_0710117_140_778 | 212 |
| 1122 | 3300048920 | Ga0496117_0117147 | Ga0496117_0117147_952_1590 | 212 |
| 1123 | 3300048922 | Ga0496119_0047799 | Ga0496119_0047799_1871_2509 | 212 |
| 1124 | 3300048924 | Ga0496121_0033547 | Ga0496121_0033547_3452_4090 | 212 |
| 1125 | 3300048924 | Ga0496121_0056653 | Ga0496121_0056653_753_1391 | 212 |
| 1126 | 3300048924 | Ga0496121_0087578 | Ga0496121_0087578_797_1441 | 212 |
| 1127 | 3300048927 | Ga0496124_0162000 | Ga0496124_0162000_889_1527 | 212 |
| 1128 | 3300048928 | Ga0496125_0057578 | Ga0496125_0057578_1218_1856 | 212 |
| 1129 | 3300048928 | Ga0496125_0175324 | Ga0496125_0175324_597_1241 | 212 |
| 1130 | 3300048929 | Ga0496126_0005092 | Ga0496126_0005092_6246_6884 | 212 |
| 1131 | 3300048929 | Ga0496126_0024225 | Ga0496126_0024225_2820_3458 | 212 |
| 1132 | 3300048929 | Ga0496126_0046537 | Ga0496126_0046537_75_713 | 212 |
| 1133 | 3300048929 | Ga0496126_0063150 | Ga0496126_0063150_2107_2745 | 212 |
| 1134 | 3300048929 | Ga0496126_0087671 | Ga0496126_0087671_291_929 | 212 |
| 1135 | 3300048929 | Ga0496126_0543982 | Ga0496126_0543982_181_819 | 212 |
| 1136 | 3300049460 | Ga0495682_0174082 | Ga0495682_0174082_33_671 | 212 |
| 1137 | 3300049583 | Ga0501067_0035550 | Ga0501067_0035550_1169_1807 | 212 |
| 1138 | 3300049591 | Ga0501075_0443655 | Ga0501075_0443655_195_833 | 212 |
| 1139 | 3300050489 | nmdc:mga03683_261925_c1 | nmdc:mga03683_261925_c1_44_688 | 212 |
| 1140 | 3300050490 | nmdc:mga03n38_113295_c1 | nmdc:mga03n38_113295_c1_364_1002 | 212 |
| 1141 | 3300050490 | nmdc:mga03n38_191280_c1 | nmdc:mga03n38_191280_c1_306_956 | 212 |
| 1142 | 3300050490 | nmdc:mga03n38_232557_c1 | nmdc:mga03n38_232557_c1_99_743 | 212 |
| 1143 | 3300050492 | nmdc:mga0yw44_210242_c1 | nmdc:mga0yw44_210242_c1_431_1075 | 212 |
| 1144 | 3300050494 | nmdc:mga06z11_27169_c1 | nmdc:mga06z11_27169_c1_1496_2134 | 212 |
| 1145 | 3300050494 | nmdc:mga06z11_47913_c1 | nmdc:mga06z11_47913_c1_697_1335 | 212 |
| 1146 | 3300050496 | nmdc:mga07m45_40557_c1 | nmdc:mga07m45_40557_c1_1207_1845 | 212 |
| 1147 | 3300050509 | nmdc:mga0qj67_382155_c1 | nmdc:mga0qj67_382155_c1_129_767 | 212 |
| 1148 | 3300050512 | nmdc:mga0n895_416634_c1 | nmdc:mga0n895_416634_c1_164_808 | 212 |
| 1149 | 3300050513 | nmdc:mga0rr50_142842_c1 | nmdc:mga0rr50_142842_c1_469_1113 | 212 |
| 1150 | 3300053077 | Ga0495601_0559716 | Ga0495601_0559716_65_703 | 212 |
| 1151 | 3300053085 | Ga0495619_0164315 | Ga0495619_0164315_852_1490 | 212 |
| 1152 | 3300053093 | Ga0500651_0006276 | Ga0500651_0006276_6010_6696 | 212 |
| 1153 | 3300053094 | Ga0500566_0090144 | Ga0500566_0090144_298_936 | 212 |
| 1154 | 3300053102 | Ga0500554_026795 | Ga0500554_026795_34_672 | 212 |
| 1155 | 3300053103 | Ga0500555_071802 | Ga0500555_071802_252_890 | 212 |
| 1156 | 3300053119 | Ga0500595_000680 | Ga0500595_000680_11154_11792 | 212 |
| 1157 | 3300053119 | Ga0500595_001479 | Ga0500595_001479_3650_4288 | 212 |
| 1158 | 3300053134 | Ga0500658_0021527 | Ga0500658_0021527_1294_1932 | 212 |
| 1159 | 3300053134 | Ga0500658_0199659 | Ga0500658_0199659_76_714 | 212 |
| 1160 | 3300053146 | Ga0500588_0013778 | Ga0500588_0013778_1302_1940 | 212 |
| 1161 | 3300053156 | Ga0500622_0099278 | Ga0500622_0099278_765_1403 | 212 |
| 1162 | 3300053158 | Ga0500627_0162430 | Ga0500627_0162430_241_936 | 212 |
| 1163 | 3300053160 | Ga0500633_0040266 | Ga0500633_0040266_178_816 | 212 |
| 1164 | 3300053161 | Ga0500634_0160967 | Ga0500634_0160967_184_822 | 212 |
| 1165 | 3300053161 | Ga0500634_0191916 | Ga0500634_0191916_125_820 | 212 |
| 1166 | 3300053162 | Ga0500638_034071 | Ga0500638_034071_1616_2254 | 212 |
| 1167 | 3300053178 | Ga0500637_0047630 | Ga0500637_0047630_552_1190 | 212 |
| 1168 | 3300053731 | Ga0500609_018270 | Ga0500609_018270_178_825 | 212 |
| 1169 | 3300061734 | Ga0530510_0160337 | Ga0530510_0160337_184_822 | 212 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3sd7-assembly1.cif.gz_A | 1.7 angstrom resolution crystal structure of putative phosphatase from clostridium difficile | 0.9163 | 1 | 212 |
| 3sd7-assembly1.cif.gz_A | 1.7 angstrom resolution crystal structure of putative phosphatase from clostridium difficile | 0.9122 | 1 | 212 |
| 2ah5-assembly1.cif.gz_A | hydrolase, haloacid dehalogenase-like family protein sp0104 from streptococcus pneumoniae | 0.8744 | 1 | 212 |
| 2ah5-assembly1.cif.gz_A | hydrolase, haloacid dehalogenase-like family protein sp0104 from streptococcus pneumoniae | 0.8592 | 1 | 212 |
| 8i8b-assembly1.cif.gz_J | outer shell and inner layer structures of autographa californica multiple nucleopolyhedrovirus (acmnpv) | 0.8518 | 2 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ah5A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9346 | 1 | 212 | 3.40.50.1000 |
| 3mc1B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9204 | 1 | 210 | 3.40.50.1000 |
| 2ah5A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9155 | 1 | 212 | 3.40.50.1000 |
| 3mc1B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9081 | 1 | 210 | 3.40.50.1000 |
| af_Q60DU2_197_332_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9067 | 85 | 206 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S0GB45-F1-model_v4 | HAD family hydrolase | 0.9577 | 2 | 211 |
GO:0004713
GO:0005829 GO:0016787 |
| AF-A0A524F6N1-F1-model_v4 | HAD family hydrolase | 0.9562 | 2 | 210 |
GO:0004713
GO:0005829 GO:0016787 |
| AF-A0A7V8BJ90-F1-model_v4 | HAD hydrolase-like protein | 0.9509 | 2 | 211 |
GO:0004713
GO:0005829 GO:0016787 |
| AF-A0A2D4UK66-F1-model_v4 | HAD family hydrolase | 0.9421 | 63 | 211 |
GO:0004713
GO:0005829 |
| AF-A0A256WN98-F1-model_v4 | Phosphoglycolate phosphatase | 0.9416 | 1 | 212 |
GO:0004713
GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar