F491123

General Info

Members Datasets Scaffolds Average Seq Length
1169 513 1122 184

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100002929|Ga0070663_10000292913
Length 194
Sequence VSAQRIEGYVIVSADGMLADACNVMPDELKFGGDKAFFTAALDRADLIVHGRNSYEDQPNSPHRKRVILTQKIEAIAPDPSNPKATLWNPAGASFEAACAHAGVRSGTIAIIGGPGVFGMFMDRYDVFWLSVAPRVRLPDGEPCFPGVPACTPQEVLAANGLHAGEPQMLDPAEGVTVTPWRATPRLSLTYTSP

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
7 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
8 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
9 2643221651 Afipia sp. Root123D2 Isolate Unclassified
10 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
11 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
12 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
13 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
14 2791355199
15 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
16 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
17 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
18 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
19 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
20 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
21 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
22 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
23 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
24 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
25 2904699407
26 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
27 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
28 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
29 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
30 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
31 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
32 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
33 2922425934
34 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
35 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
36 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
37 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
38 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
39 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
40 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
41 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
43 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
74 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
75 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
78 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
82 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
96 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
102 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
103 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
104 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
105 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
106 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
109 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
110 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
111 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
112 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
113 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
118 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
122 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
123 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
124 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
136 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
148 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
149 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
150 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
151 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
154 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
155 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
157 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
159 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
221 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
222 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
223 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
229 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
230 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
231 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
232 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
233 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
234 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
235 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
236 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
237 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
238 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
239 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
240 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
241 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
242 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
243 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
244 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
245 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
246 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
247 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
248 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
249 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
250 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
251 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
252 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
253 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
254 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
255 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
256 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
257 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
258 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
259 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
260 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
261 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
262 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
263 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
264 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
265 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
266 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
268 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
269 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
270 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
271 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
272 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
273 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
274 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
275 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
276 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
277 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
278 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
279 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
280 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
281 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
282 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
283 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
285 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
286 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
287 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
288 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
289 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
290 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
291 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
292 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
293 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
294 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
295 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
296 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
297 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
298 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
299 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
300 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
301 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
302 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
303 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
304 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
305 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
306 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
307 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
308 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
309 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
310 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
311 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
312 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
313 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
314 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
315 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
316 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
317 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
318 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
319 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
320 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
321 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
322 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
323 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
324 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
325 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
326 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
327 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
328 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
329 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
330 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
331 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
332 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
333 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
334 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
335 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
336 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
337 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
338 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
339 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
340 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
341 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
342 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
343 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
344 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
345 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
346 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
347 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
348 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
349 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
350 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
351 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
352 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
353 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
354 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
355 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
356 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
357 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
358 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
359 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
360 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
361 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
362 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
363 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
364 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
365 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
366 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
367 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
368 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
369 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
370 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
371 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
372 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
373 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
374 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
375 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
376 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
377 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
378 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
379 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
380 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
381 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
382 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
383 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
384 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
385 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
386 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
387 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
388 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
389 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
390 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
391 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
392 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
393 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
394 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
395 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
396 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
397 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
398 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
399 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
400 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
401 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
402 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
403 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
404 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
405 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
406 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
407 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
408 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
409 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
410 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
411 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
412 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
413 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
414 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
415 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
416 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
417 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
418 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
419 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
420 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
421 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
422 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
423 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
424 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
425 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
426 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
427 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
442 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
443 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
444 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
445 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
446 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
447 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
448 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
449 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
450 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
451 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
452 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
453 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
455 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
456 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
457 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
458 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
459 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
460 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
461 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
462 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
463 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
464 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
465 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
466 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
467 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
468 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
469 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
470 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
471 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
472 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
473 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
474 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
475 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
476 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
477 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
478 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
479 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
480 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
481 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
482 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
483 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
484 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
485 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
486 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
487 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
488 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
489 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
490 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
491 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
492 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
493 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
494 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
495 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
496 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
497 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
498 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
499 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
500 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
501 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
502 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
503 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
504 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
505 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
506 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
507 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
508 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
509 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
510 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
511 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
512 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
513 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.88
Metatranscriptomes 0.34
Isolates 3.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.13
Nodule 3.08
Rhizoplane 7.44
Rhizosphere 71.94
Stem 0
Stem Tuber 0
Unclassified 9.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10044120 3300001990 Bacteria 1364
2 JGI24744J21845_10007871 3300002077 Bacteria 2201
3 JGI25406J46586_10000104 3300003203 Bacteria 37774
4 JGI25153J46596_10001106 3300003215 Bacteria 16363
5 rootH2_10125295 3300003320 Bacteria 1347
6 Ga0070676_10042094 3300005328 Bacteria 2651
7 Ga0070676_10680029 3300005328 Bacteria 750
8 Ga0070683_100390438 3300005329 Bacteria 1327
9 Ga0070690_100377428 3300005330 Bacteria 1036
10 Ga0070690_100414628 3300005330 Bacteria 992
11 Ga0070670_100217605 3300005331 Bacteria 1661
12 Ga0070670_100446574 3300005331 Bacteria 1145
13 Ga0068869_100086035 3300005334 Bacteria 2355
14 Ga0068869_100102861 3300005334 Bacteria 2163
15 Ga0068869_100974494 3300005334 Bacteria 737
16 Ga0070666_10539928 3300005335 Bacteria 847
17 Ga0070680_100081052 3300005336 Bacteria 2677
18 Ga0070682_100110843 3300005337 Bacteria 1829
19 Ga0070682_100163513 3300005337 Bacteria 1540
20 Ga0070682_100165434 3300005337 Bacteria 1532
21 Ga0070682_100182044 3300005337 Bacteria 1469
22 Ga0070682_100216401 3300005337 Bacteria 1361
23 Ga0068868_100007248 3300005338 Bacteria 7885
24 Ga0068868_100034333 3300005338 Bacteria 3915
25 Ga0068868_100663556 3300005338 Bacteria 930
26 Ga0068868_100671185 3300005338 Bacteria 925
27 Ga0068868_100701086 3300005338 Bacteria 906
28 Ga0070660_100075327 3300005339 Bacteria 2642
29 Ga0070660_100176267 3300005339 Bacteria 1729
30 Ga0070689_100627965 3300005340 Bacteria 933
31 Ga0070661_100064797 3300005344 Bacteria 2686
32 Ga0070661_100539269 3300005344 Bacteria 938
33 Ga0070668_100071521 3300005347 Bacteria 2702
34 Ga0070668_100169745 3300005347 Bacteria 1775
35 Ga0070668_100429114 3300005347 Bacteria 1133
36 Ga0070668_100524107 3300005347 Bacteria 1028
37 Ga0070669_100313835 3300005353 Bacteria 1264
38 Ga0070675_101132990 3300005354 Bacteria 720
39 Ga0070671_100141963 3300005355 Bacteria 2027
40 Ga0070671_100160036 3300005355 Bacteria 1903
41 Ga0070671_100249989 3300005355 Bacteria 1506
42 Ga0070659_100029963 3300005366 Bacteria 4208
43 Ga0070659_100120478 3300005366 Bacteria 2124
44 Ga0070659_100650705 3300005366 Bacteria 909
45 Ga0070659_100722896 3300005366 Bacteria 862
46 Ga0070659_101009091 3300005366 Bacteria 731
47 Ga0070667_100062286 3300005367 Bacteria 3159
48 Ga0070667_100257503 3300005367 Bacteria 1561
49 Ga0070709_10175697 3300005434 Bacteria 1500
50 Ga0070709_10471830 3300005434 Bacteria 949
51 Ga0070713_100359384 3300005436 Bacteria 1353
52 Ga0070710_10000842 3300005437 Bacteria 14763
53 Ga0070710_10099270 3300005437 Bacteria 1731
54 Ga0070710_10252981 3300005437 Bacteria 1133
55 Ga0070710_10462722 3300005437 Bacteria 862
56 Ga0070701_10051111 3300005438 Bacteria 2143
57 Ga0070711_100007982 3300005439 Bacteria 6460
58 Ga0070700_100029109 3300005441 Bacteria 3290
59 Ga0070700_100212205 3300005441 Bacteria 1367
60 Ga0070663_100002929 3300005455 Bacteria 9711
61 Ga0070663_100031336 3300005455 Bacteria 3654
62 Ga0070663_100039960 3300005455 Bacteria 3281
63 Ga0070663_100054728 3300005455 Bacteria 2853
64 Ga0070663_100078560 3300005455 Bacteria 2419
65 Ga0070663_100616613 3300005455 Bacteria 914
66 Ga0070663_100651462 3300005455 Bacteria 891
67 Ga0070663_101042183 3300005455 Bacteria 713
68 Ga0070678_100048839 3300005456 Bacteria 3050
69 Ga0070678_100169375 3300005456 Bacteria 1777
70 Ga0070678_100338181 3300005456 Bacteria 1291
71 Ga0070678_100378193 3300005456 Bacteria 1224
72 Ga0070678_100410784 3300005456 Bacteria 1178
73 Ga0070662_100028974 3300005457 Bacteria 3859
74 Ga0070662_100045363 3300005457 Bacteria 3153
75 Ga0070662_100217027 3300005457 Bacteria 1524
76 Ga0070662_100310416 3300005457 Bacteria 1284
77 Ga0070681_10036057 3300005458 Bacteria 4968
78 Ga0070681_10219486 3300005458 Bacteria 1816
79 Ga0070681_10491334 3300005458 Bacteria 1140
80 Ga0070681_10699284 3300005458 Bacteria 929
81 Ga0068867_100186194 3300005459 Bacteria 1654
82 Ga0070685_10074039 3300005466 Bacteria 2026
83 Ga0070706_100371768 3300005467 Bacteria 1332
84 Ga0070698_100080796 3300005471 Bacteria 3245
85 Ga0070698_100112992 3300005471 Bacteria 2681
86 Ga0070679_100020404 3300005530 Bacteria 6461
87 Ga0070679_100043395 3300005530 Bacteria 4479
88 Ga0070679_100066920 3300005530 Bacteria 3582
89 Ga0070684_100095276 3300005535 Bacteria 2652
90 Ga0070684_100221335 3300005535 Bacteria 1727
91 Ga0070697_100128010 3300005536 Bacteria 2128
92 Ga0070697_100261043 3300005536 Bacteria 1483
93 Ga0068853_100029364 3300005539 Bacteria 4634
94 Ga0068853_100084664 3300005539 Bacteria 2778
95 Ga0068853_100282325 3300005539 Bacteria 1531
96 Ga0070672_100048601 3300005543 Bacteria 3297
97 Ga0070686_100339296 3300005544 Bacteria 1126
98 Ga0070693_100022866 3300005547 Bacteria 3332
99 Ga0070693_100052550 3300005547 Bacteria 2336
100 Ga0070665_100042917 3300005548 Bacteria 4546
101 Ga0070665_100052300 3300005548 Bacteria 4097
102 Ga0070665_100079662 3300005548 Bacteria 3281
103 Ga0070665_100160319 3300005548 Bacteria 2251
104 Ga0070665_100312102 3300005548 Bacteria 1576
105 Ga0070665_100390460 3300005548 Bacteria 1399
106 Ga0070665_100619145 3300005548 Bacteria 1096
107 Ga0068855_100070167 3300005563 Bacteria 4077
108 Ga0068855_100669825 3300005563 Bacteria 1113
109 Ga0070664_100149315 3300005564 Bacteria 2063
110 Ga0070664_100545762 3300005564 Bacteria 1071
111 Ga0068857_100003351 3300005577 Bacteria 13343
112 Ga0068857_100228560 3300005577 Bacteria 1701
113 Ga0068857_100325994 3300005577 Bacteria 1419
114 Ga0068857_101000316 3300005577 Bacteria 805
115 Ga0068854_100117469 3300005578 Bacteria 2014
116 Ga0068854_100236089 3300005578 Bacteria 1454
117 Ga0068854_100334583 3300005578 Bacteria 1235
118 Ga0068854_100451257 3300005578 Bacteria 1074
119 Ga0068854_101067737 3300005578 Bacteria 718
120 Ga0068856_100000082 3300005614 Bacteria 88302
121 Ga0068856_100027659 3300005614 Bacteria 5533
122 Ga0068856_100044548 3300005614 Bacteria 4366
123 Ga0070702_100570022 3300005615 Bacteria 844
124 Ga0070702_100759358 3300005615 Bacteria 746
125 Ga0068852_100056294 3300005616 Bacteria 3398
126 Ga0068852_100096821 3300005616 Bacteria 2653
127 Ga0068852_100112587 3300005616 Bacteria 2477
128 Ga0068852_100755725 3300005616 Bacteria 985
129 Ga0068852_101353155 3300005616 Bacteria 734
130 Ga0068859_100102030 3300005617 Bacteria 2926
131 Ga0068859_100226342 3300005617 Bacteria 1958
132 Ga0068859_100285421 3300005617 Bacteria 1743
133 Ga0068864_100025302 3300005618 Bacteria 4998
134 Ga0068864_100080894 3300005618 Bacteria 2847
135 Ga0068866_10012084 3300005718 Bacteria 3756
136 Ga0068866_10137352 3300005718 Bacteria 1399
137 Ga0068866_10517967 3300005718 Bacteria 792
138 Ga0068861_100135031 3300005719 Bacteria 2006
139 Ga0068861_100495736 3300005719 Bacteria 1103
140 Ga0068851_10249285 3300005834 Bacteria 1007
141 Ga0068870_10059157 3300005840 Bacteria 2054
142 Ga0068870_10129406 3300005840 Bacteria 1465
143 Ga0068863_100450869 3300005841 Bacteria 1262
144 Ga0068863_100714978 3300005841 Bacteria 996
145 Ga0068863_100946924 3300005841 Bacteria 862
146 Ga0068858_100091420 3300005842 Bacteria 2833
147 Ga0068858_100121056 3300005842 Bacteria 2447
148 Ga0068858_100429826 3300005842 Bacteria 1270
149 Ga0068860_100173616 3300005843 Bacteria 2083
150 Ga0068860_100439021 3300005843 Bacteria 1296
151 Ga0068860_100643963 3300005843 Bacteria 1067
152 Ga0068862_100032642 3300005844 Bacteria 4399
153 Ga0068862_100053834 3300005844 Bacteria 3445
154 Ga0068862_100152717 3300005844 Bacteria 2056
155 Ga0068862_100502988 3300005844 Bacteria 1150
156 Ga0081455_10002419 3300005937 Bacteria 22263
157 Ga0081455_10220768 3300005937 Bacteria 1405
158 Ga0081455_10388858 3300005937 Bacteria 972
159 Ga0081540_1002092 3300005983 Bacteria 16629
160 Ga0081540_1004102 3300005983 Bacteria 11245
161 Ga0081540_1004519 3300005983 Bacteria 10561
162 Ga0081540_1016640 3300005983 Bacteria 4591
163 Ga0081540_1056399 3300005983 Bacteria 1907
164 Ga0081539_10000273 3300005985 Bacteria 117936
165 Ga0081539_10009974 3300005985 Bacteria 7826
166 Ga0081539_10084603 3300005985 Bacteria 1657
167 Ga0075365_10005918 3300006038 Bacteria 6658
168 Ga0075365_10032588 3300006038 Bacteria 3351
169 Ga0075365_10033942 3300006038 Bacteria 3292
170 Ga0075368_10022328 3300006042 Bacteria 2408
171 Ga0075363_100010147 3300006048 Bacteria 4455
172 Ga0075363_100039459 3300006048 Bacteria 2485
173 Ga0075363_100138720 3300006048 Bacteria 1368
174 Ga0075363_100245716 3300006048 Bacteria 1030
175 Ga0075364_10026565 3300006051 Bacteria 3694
176 Ga0075364_10064370 3300006051 Bacteria 2407
177 Ga0070715_10000599 3300006163 Bacteria 9516
178 Ga0070716_100001743 3300006173 Bacteria 9822
179 Ga0070712_100007030 3300006175 Bacteria 7016
180 Ga0070712_100013006 3300006175 Bacteria 5308
181 Ga0070712_100048117 3300006175 Bacteria 2955
182 Ga0075367_10033118 3300006178 Bacteria 2976
183 Ga0075367_10067366 3300006178 Bacteria 2146
184 Ga0075367_10070568 3300006178 Bacteria 2100
185 Ga0075369_10194898 3300006186 Unclassified 934
186 Ga0075366_10189891 3300006195 Bacteria 1248
187 Ga0097621_100083061 3300006237 Bacteria 2668
188 Ga0097621_100194605 3300006237 Bacteria 1757
189 Ga0097621_100431168 3300006237 Bacteria 1185
190 Ga0097621_100763182 3300006237 Bacteria 894
191 Ga0075370_10017192 3300006353 Bacteria 3904
192 Ga0075370_10047236 3300006353 Bacteria 2438
193 Ga0075370_10052063 3300006353 Bacteria 2322
194 Ga0075370_10409544 3300006353 Bacteria 814
195 Ga0068871_100304142 3300006358 Bacteria 1400
196 Ga0075428_100174800 3300006844 Bacteria 2326
197 Ga0075428_100263228 3300006844 Bacteria 1856
198 Ga0075434_100203577 3300006871 Bacteria 1999
199 Ga0068865_100507280 3300006881 Bacteria 1007
200 Ga0097620_100102032 3300006931 Bacteria 2926
201 Ga0097620_100226341 3300006931 Bacteria 1958
202 Ga0097620_100285417 3300006931 Bacteria 1743
203 Ga0097620_100438716 3300006931 Bacteria 1402
204 Ga0099824_1023248 3300006942 Bacteria 3886
205 Ga0099822_1000080 3300006943 Bacteria 54304
206 Ga0099794_10008554 3300007265 Bacteria 4258
207 Ga0099795_10009675 3300007788 Bacteria 2807
208 Ga0099795_10029828 3300007788 Bacteria 1867
209 Ga0099795_10029973 3300007788 Bacteria 1864
210 Ga0105240_10007507 3300009093 Bacteria 15822
211 Ga0105240_10050611 3300009093 Bacteria 5236
212 Ga0105240_10095181 3300009093 Bacteria 3631
213 Ga0111539_10136421 3300009094 Bacteria 2873
214 Ga0105247_10016251 3300009101 Bacteria 4458
215 Ga0105247_10064365 3300009101 Bacteria 2278
216 Ga0105247_10235465 3300009101 Bacteria 1245
217 Ga0105247_10367823 3300009101 Bacteria 1016
218 Ga0114129_10064849 3300009147 Bacteria 5098
219 Ga0105243_10027582 3300009148 Bacteria 4352
220 Ga0105243_10196369 3300009148 Bacteria 1766
221 Ga0105243_10324591 3300009148 Bacteria 1404
222 Ga0105243_10908670 3300009148 Bacteria 876
223 Ga0105243_10946454 3300009148 Bacteria 860
224 Ga0105243_11074339 3300009148 Bacteria 812
225 Ga0105241_10010606 3300009174 Bacteria 6758
226 Ga0105241_10032329 3300009174 Bacteria 3922
227 Ga0105241_10041152 3300009174 Bacteria 3490
228 Ga0105241_10219524 3300009174 Bacteria 1597
229 Ga0105242_10125087 3300009176 Bacteria 2212
230 Ga0105242_10398219 3300009176 Bacteria 1284
231 Ga0105248_10033538 3300009177 Bacteria 5736
232 Ga0105248_10223621 3300009177 Bacteria 2119
233 Ga0105248_10238890 3300009177 Bacteria 2045
234 Ga0105248_10478146 3300009177 Bacteria 1404
235 Ga0105248_10546523 3300009177 Bacteria 1307
236 Ga0105248_11203018 3300009177 Bacteria 857
237 Ga0105237_10052204 3300009545 Bacteria 4105
238 Ga0105237_10124318 3300009545 Bacteria 2574
239 Ga0105237_10250559 3300009545 Bacteria 1773
240 Ga0105237_10262981 3300009545 Bacteria 1728
241 Ga0105237_10475461 3300009545 Bacteria 1256
242 Ga0105238_10027110 3300009551 Bacteria 5840
243 Ga0105238_10205293 3300009551 Bacteria 1946
244 Ga0105249_10241385 3300009553 Bacteria 1786
245 Ga0099796_10002843 3300010159 Bacteria 3896
246 Ga0099796_10262689 3300010159 Bacteria 721
247 Ga0105239_10016782 3300010375 Bacteria 8094
248 Ga0105239_10043449 3300010375 Bacteria 4926
249 Ga0105239_10214770 3300010375 Bacteria 2156
250 Ga0105239_10272943 3300010375 Bacteria 1902
251 Ga0105239_10280590 3300010375 Bacteria 1875
252 Ga0105239_10528120 3300010375 Bacteria 1343
253 Ga0157371_10103344 3300013102 Bacteria 2022
254 Ga0157369_10003890 3300013105 Bacteria 17720
255 Ga0157369_10008785 3300013105 Bacteria 11576
256 Ga0157369_10160692 3300013105 Bacteria 2371
257 Ga0157369_10586469 3300013105 Bacteria 1151
258 Ga0157374_10595416 3300013296 Bacteria 1115
259 Ga0157374_10698894 3300013296 Bacteria 1027
260 Ga0157378_10043554 3300013297 Bacteria 3986
261 Ga0157378_10052830 3300013297 Bacteria 3615
262 Ga0157378_10493435 3300013297 Bacteria 1222
263 Ga0157378_10840866 3300013297 Bacteria 946
264 Ga0163162_10003676 3300013306 Bacteria 14707
265 Ga0163162_10100717 3300013306 Bacteria 2981
266 Ga0163162_10387927 3300013306 Bacteria 1530
267 Ga0163162_10529953 3300013306 Bacteria 1307
268 Ga0163162_10545219 3300013306 Bacteria 1288
269 Ga0163162_10635620 3300013306 Bacteria 1192
270 Ga0157372_10093100 3300013307 Bacteria 3429
271 Ga0157372_10221124 3300013307 Bacteria 2195
272 Ga0157375_10336630 3300013308 Bacteria 1674
273 Ga0157375_10752300 3300013308 Bacteria 1126
274 Ga0157375_11329358 3300013308 Bacteria 845
275 Ga0157375_11654959 3300013308 Bacteria 757
276 Ga0163163_10144284 3300014325 Bacteria 2424
277 Ga0157380_10204726 3300014326 Bacteria 1754
278 Ga0157380_10447494 3300014326 Bacteria 1239
279 Ga0157377_10144231 3300014745 Bacteria 1466
280 Ga0157379_10075745 3300014968 Bacteria 3013
281 Ga0157379_10085223 3300014968 Bacteria 2831
282 Ga0157376_10013748 3300014969 Bacteria 6052
283 Ga0163161_10382935 3300017792 Bacteria 1125
284 Ga0163161_10549107 3300017792 Bacteria 947
285 Ga0206354_10882167 3300020081 Bacteria 819
286 Ga0206353_10028130 3300020082 Bacteria 1740
287 Ga0206353_11059723 3300020082 Bacteria 951
288 Ga0213876_10183644 3300021384 Bacteria 1112
289 Ga0213875_10024351 3300021388 Bacteria 2888
290 Ga0224712_10009301 3300022467 Bacteria 2955
291 Ga0209233_1002573 3300025261 Bacteria 6599
292 Ga0209130_1025167 3300025284 Bacteria 1291
293 Ga0209758_1007614 3300025297 Bacteria 7304
294 Ga0209758_1036773 3300025297 Bacteria 1904
295 Ga0207697_10007446 3300025315 Bacteria 4883
296 Ga0207656_10016121 3300025321 Bacteria 2904
297 Ga0207656_10034050 3300025321 Bacteria 2125
298 Ga0207692_10092661 3300025898 Bacteria 1642
299 Ga0207692_10180757 3300025898 Bacteria 1229
300 Ga0207692_10332900 3300025898 Bacteria 932
301 Ga0207642_10415068 3300025899 Bacteria 808
302 Ga0207710_10012692 3300025900 Bacteria 3546
303 Ga0207710_10030090 3300025900 Bacteria 2366
304 Ga0207710_10166674 3300025900 Bacteria 1075
305 Ga0207688_10063847 3300025901 Bacteria 2077
306 Ga0207688_10088380 3300025901 Bacteria 1777
307 Ga0207680_10144957 3300025903 Bacteria 1578
308 Ga0207680_10389013 3300025903 Bacteria 984
309 Ga0207647_10073492 3300025904 Bacteria 2060
310 Ga0207685_10002037 3300025905 Bacteria 4504
311 Ga0207699_10065182 3300025906 Bacteria 2207
312 Ga0207645_10144718 3300025907 Bacteria 1549
313 Ga0207645_10212347 3300025907 Bacteria 1275
314 Ga0207643_10037354 3300025908 Bacteria 2725
315 Ga0207643_10168286 3300025908 Bacteria 1321
316 Ga0207705_10492075 3300025909 Bacteria 952
317 Ga0207684_10118590 3300025910 Bacteria 2268
318 Ga0207684_10517856 3300025910 Bacteria 1022
319 Ga0207684_10541520 3300025910 Bacteria 996
320 Ga0207654_10011369 3300025911 Bacteria 4542
321 Ga0207654_10012520 3300025911 Bacteria 4347
322 Ga0207707_10002249 3300025912 Bacteria 17455
323 Ga0207707_10135199 3300025912 Bacteria 2156
324 Ga0207707_10245836 3300025912 Bacteria 1554
325 Ga0207695_10139649 3300025913 Bacteria 2373
326 Ga0207695_10187481 3300025913 Bacteria 1987
327 Ga0207695_10193093 3300025913 Bacteria 1953
328 Ga0207671_10040002 3300025914 Bacteria 3471
329 Ga0207671_10078202 3300025914 Bacteria 2477
330 Ga0207671_10166173 3300025914 Bacteria 1711
331 Ga0207671_10320000 3300025914 Bacteria 1227
332 Ga0207693_10000095 3300025915 Bacteria 78764
333 Ga0207693_10022609 3300025915 Bacteria 4995
334 Ga0207693_10200987 3300025915 Bacteria 1567
335 Ga0207663_10099139 3300025916 Bacteria 1953
336 Ga0207660_10046822 3300025917 Bacteria 3054
337 Ga0207660_10107578 3300025917 Bacteria 2093
338 Ga0207657_10007732 3300025919 Bacteria 10976
339 Ga0207657_10069057 3300025919 Bacteria 3000
340 Ga0207657_10159573 3300025919 Bacteria 1832
341 Ga0207649_10071248 3300025920 Bacteria 2219
342 Ga0207652_10099410 3300025921 Bacteria 2567
343 Ga0207652_10121286 3300025921 Bacteria 2326
344 Ga0207652_10806909 3300025921 Bacteria 833
345 Ga0207694_10157408 3300025924 Bacteria 1833
346 Ga0207694_10310874 3300025924 Bacteria 1299
347 Ga0207694_10478871 3300025924 Bacteria 1041
348 Ga0207650_10413726 3300025925 Bacteria 1118
349 Ga0207687_10035364 3300025927 Bacteria 3397
350 Ga0207687_10092287 3300025927 Bacteria 2211
351 Ga0207664_10527674 3300025929 Bacteria 1058
352 Ga0207644_10242514 3300025931 Bacteria 1435
353 Ga0207644_10287687 3300025931 Bacteria 1321
354 Ga0207644_10480571 3300025931 Bacteria 1023
355 Ga0207690_10025604 3300025932 Bacteria 3707
356 Ga0207690_10218753 3300025932 Bacteria 1456
357 Ga0207690_10727909 3300025932 Bacteria 817
358 Ga0207706_10042603 3300025933 Bacteria 4023
359 Ga0207706_10067659 3300025933 Bacteria 3143
360 Ga0207706_10091791 3300025933 Bacteria 2670
361 Ga0207706_10262175 3300025933 Bacteria 1509
362 Ga0207686_10049830 3300025934 Bacteria 2602
363 Ga0207709_10145504 3300025935 Bacteria 1635
364 Ga0207709_10708284 3300025935 Bacteria 806
365 Ga0207670_10489586 3300025936 Bacteria 997
366 Ga0207669_10852329 3300025937 Bacteria 758
367 Ga0207704_10143682 3300025938 Bacteria 1673
368 Ga0207704_10403491 3300025938 Bacteria 1079
369 Ga0207665_10000133 3300025939 Bacteria 49199
370 Ga0207665_10240753 3300025939 Bacteria 1333
371 Ga0207665_10405589 3300025939 Bacteria 1039
372 Ga0207665_10592992 3300025939 Bacteria 864
373 Ga0207691_10026804 3300025940 Bacteria 5408
374 Ga0207691_10252104 3300025940 Bacteria 1523
375 Ga0207711_10032973 3300025941 Bacteria 4380
376 Ga0207711_10135139 3300025941 Bacteria 2214
377 Ga0207711_10277232 3300025941 Bacteria 1544
378 Ga0207689_10013575 3300025942 Bacteria 6952
379 Ga0207689_10016101 3300025942 Bacteria 6329
380 Ga0207689_10032079 3300025942 Bacteria 4370
381 Ga0207689_10282952 3300025942 Bacteria 1373
382 Ga0207661_10056472 3300025944 Bacteria 3152
383 Ga0207661_10138341 3300025944 Bacteria 2093
384 Ga0207679_10103264 3300025945 Bacteria 2234
385 Ga0207679_10406243 3300025945 Bacteria 1199
386 Ga0207667_10078922 3300025949 Bacteria 3411
387 Ga0207667_10124426 3300025949 Bacteria 2656
388 Ga0207667_10373265 3300025949 Bacteria 1453
389 Ga0207651_10194943 3300025960 Bacteria 1619
390 Ga0207651_10259520 3300025960 Bacteria 1426
391 Ga0207712_10143860 3300025961 Bacteria 1833
392 Ga0207668_10212704 3300025972 Bacteria 1547
393 Ga0207668_10251943 3300025972 Bacteria 1434
394 Ga0207668_10296081 3300025972 Bacteria 1333
395 Ga0207668_10661205 3300025972 Bacteria 915
396 Ga0207640_10108236 3300025981 Bacteria 1964
397 Ga0207640_10208305 3300025981 Bacteria 1487
398 Ga0207640_10263763 3300025981 Bacteria 1344
399 Ga0207640_11201095 3300025981 Bacteria 674
400 Ga0207658_10075699 3300025986 Bacteria 2562
401 Ga0207658_10142037 3300025986 Bacteria 1944
402 Ga0207677_10040296 3300026023 Bacteria 3078
403 Ga0207677_10081207 3300026023 Bacteria 2326
404 Ga0207677_10227651 3300026023 Bacteria 1500
405 Ga0207703_10025797 3300026035 Bacteria 4625
406 Ga0207639_10088194 3300026041 Bacteria 2475
407 Ga0207639_10308315 3300026041 Bacteria 1401
408 Ga0207639_10317014 3300026041 Bacteria 1383
409 Ga0207678_10026492 3300026067 Bacteria 5057
410 Ga0207678_10028300 3300026067 Bacteria 4893
411 Ga0207678_10075795 3300026067 Bacteria 2881
412 Ga0207678_10264852 3300026067 Bacteria 1473
413 Ga0207678_10293294 3300026067 Bacteria 1397
414 Ga0207678_10298427 3300026067 Bacteria 1384
415 Ga0207678_10638284 3300026067 Bacteria 935
416 Ga0207678_10797257 3300026067 Bacteria 834
417 Ga0207708_10370013 3300026075 Bacteria 1180
418 Ga0207702_10000048 3300026078 Bacteria 143125
419 Ga0207702_10003315 3300026078 Bacteria 14804
420 Ga0207702_10345601 3300026078 Bacteria 1422
421 Ga0207702_10445797 3300026078 Bacteria 1255
422 Ga0207641_10102895 3300026088 Bacteria 2519
423 Ga0207648_10016066 3300026089 Bacteria 6858
424 Ga0207676_10307804 3300026095 Bacteria 1449
425 Ga0207674_10005787 3300026116 Bacteria 14663
426 Ga0207674_10033065 3300026116 Bacteria 5418
427 Ga0207674_10060928 3300026116 Bacteria 3814
428 Ga0207674_10238357 3300026116 Bacteria 1766
429 Ga0207674_10557135 3300026116 Bacteria 1107
430 Ga0207675_100041520 3300026118 Bacteria 4296
431 Ga0207675_100262760 3300026118 Bacteria 1673
432 Ga0207675_100392224 3300026118 Bacteria 1367
433 Ga0207683_10016292 3300026121 Bacteria 6326
434 Ga0207683_10067330 3300026121 Bacteria 3159
435 Ga0207683_10082790 3300026121 Bacteria 2851
436 Ga0207683_10096169 3300026121 Bacteria 2641
437 Ga0207683_10107128 3300026121 Bacteria 2500
438 Ga0207683_10172085 3300026121 Bacteria 1961
439 Ga0207683_10322542 3300026121 Bacteria 1415
440 Ga0207698_10069860 3300026142 Bacteria 2780
441 Ga0207698_10083649 3300026142 Bacteria 2583
442 Ga0207698_10151503 3300026142 Bacteria 2013
443 Ga0207698_10713644 3300026142 Bacteria 999
444 Ga0207698_10950268 3300026142 Bacteria 868
445 Ga0209589_1000003 3300027357 Bacteria 629130
446 Ga0209489_100003 3300027361 Bacteria 663105
447 Ga0209700_100003 3300027363 Bacteria 663105
448 Ga0209179_1011432 3300027512 Bacteria 1573
449 Ga0207428_10069972 3300027907 Bacteria 2759
450 Ga0268266_10002475 3300028379 Bacteria 19733
451 Ga0268266_10004442 3300028379 Bacteria 13419
452 Ga0268266_10073602 3300028379 Bacteria 2965
453 Ga0268266_10119237 3300028379 Bacteria 2346
454 Ga0268266_10126879 3300028379 Bacteria 2278
455 Ga0268266_10209865 3300028379 Bacteria 1785
456 Ga0268266_10669616 3300028379 Bacteria 999
457 Ga0268265_10071618 3300028380 Bacteria 2700
458 Ga0268265_10162624 3300028380 Bacteria 1898
459 Ga0268265_10485260 3300028380 Bacteria 1161
460 Ga0268265_11081574 3300028380 Bacteria 795
461 Ga0268265_11225659 3300028380 Bacteria 748
462 Ga0268264_10000022 3300028381 Bacteria 476624
463 Ga0268264_10177357 3300028381 Bacteria 1932
464 Ga0268264_10294999 3300028381 Bacteria 1524
465 Ga0265326_10022316 3300028558 Bacteria 1813
466 Ga0265319_1011881 3300028563 Bacteria 3543
467 Ga0265334_10000447 3300028573 Bacteria 21504
468 Ga0265318_10195061 3300028577 Bacteria 740
469 Ga0265323_10001236 3300028653 Bacteria 12840
470 Ga0265322_10003757 3300028654 Bacteria 4566
471 Ga0265336_10000686 3300028666 Bacteria 18257
472 Ga0307517_10000063 3300028786 Bacteria 144304
473 Ga0307517_10226476 3300028786 Bacteria 1129
474 Ga0307515_10007547 3300028794 Bacteria 21484
475 Ga0307515_10289618 3300028794 Bacteria 1335
476 Ga0265338_10000086 3300028800 Bacteria 175026
477 Ga0265324_10031738 3300029957 Bacteria 1848
478 Ga0307511_10056903 3300030521 Bacteria 3049
479 Ga0265330_10013362 3300031235 Bacteria 3828
480 Ga0265330_10015725 3300031235 Bacteria 3498
481 Ga0265325_10038531 3300031241 Bacteria 2522
482 Ga0265329_10114475 3300031242 Bacteria 863
483 Ga0265340_10007187 3300031247 Bacteria 6066
484 Ga0265339_10046894 3300031249 Bacteria 2373
485 Ga0265339_10210956 3300031249 Bacteria 954
486 Ga0265331_10039137 3300031250 Bacteria 2314
487 Ga0265316_10397287 3300031344 Bacteria 993
488 Ga0265316_10511624 3300031344 Bacteria 857
489 Ga0307513_10166927 3300031456 Bacteria 2084
490 Ga0307509_10075236 3300031507 Bacteria 3508
491 Ga0307408_100160361 3300031548 Bacteria 1786
492 Ga0307508_10000009 3300031616 Bacteria 256966
493 Ga0307508_10047463 3300031616 Bacteria 3830
494 Ga0307508_10096367 3300031616 Bacteria 2549
495 Ga0265342_10080887 3300031712 Bacteria 1877
496 Ga0265342_10094370 3300031712 Bacteria 1712
497 Ga0265342_10157414 3300031712 Bacteria 1257
498 Ga0307516_10058764 3300031730 Bacteria 3741
499 Ga0307516_10087356 3300031730 Bacteria 2953
500 Ga0307516_10254800 3300031730 Bacteria 1448
501 Ga0307516_10286914 3300031730 Bacteria 1326
502 Ga0307405_10248432 3300031731 Bacteria 1322
503 Ga0307405_10384116 3300031731 Bacteria 1094
504 Ga0307405_10852369 3300031731 Bacteria 767
505 Ga0307413_10016410 3300031824 Bacteria 3825
506 Ga0307410_10273312 3300031852 Bacteria 1323
507 Ga0307410_10692832 3300031852 Bacteria 858
508 Ga0307406_10454726 3300031901 Bacteria 1028
509 Ga0307412_10199327 3300031911 Bacteria 1519
510 Ga0307409_100018794 3300031995 Bacteria 4659
511 Ga0307409_100292315 3300031995 Bacteria 1511
512 Ga0307411_10017127 3300032005 Bacteria 4118
513 Ga0307415_100153327 3300032126 Bacteria 1776
514 Ga0307415_100555325 3300032126 Bacteria 1014
515 Ga0307510_10041082 3300033180 Bacteria 5064
516 Ga0307510_10213579 3300033180 Bacteria 1449
517 Ga0315911_1000001 3300033442 Bacteria 1088602
518 Ga0373938_0034867 3300034957 Bacteria 1095
519 Ga0373926_0031879 3300035083 Bacteria 1859
520 Ga0373934_0011895 3300035086 Bacteria 3281
521 Ga0373934_0017581 3300035086 Bacteria 2731
522 Ga0373934_0189899 3300035086 Bacteria 845
523 Ga0373923_0002332 3300035111 Bacteria 5818
524 Ga0373923_0015548 3300035111 Bacteria 2875
525 Ga0373932_0033968 3300035112 Bacteria 1435
526 Ga0373936_0026082 3300035113 Bacteria 2288
527 Ga0373936_0049360 3300035113 Bacteria 1700
528 Ga0373936_0270770 3300035113 Bacteria 762
529 Ga0373953_0000473 3300035117 Bacteria 11091
530 Ga0373953_0128326 3300035117 Bacteria 1080
531 Ga0373954_0000442 3300035118 Bacteria 15520
532 Ga0373956_0001159 3300035119 Bacteria 10897
533 Ga0373956_0025732 3300035119 Bacteria 2545
534 Ga0373957_0000837 3300035120 Bacteria 8045
535 Ga0373957_0428639 3300035120 Bacteria 571
536 Ga0373943_0035787 3300035170 Bacteria 2375
537 Ga0373946_0276641 3300035171 Bacteria 825
538 Ga0373955_0000840 3300035172 Bacteria 13157
539 Ga0373955_0019884 3300035172 Bacteria 3366
540 Ga0373955_0149633 3300035172 Bacteria 1373
541 Ga0373955_0282791 3300035172 Bacteria 998
542 Ga0373955_0422469 3300035172 Bacteria 811
543 Ga0373955_1001133 3300035172 Bacteria 515
544 Ga0373962_0045346 3300035242 Bacteria 1252
545 Ga0373924_0138901 3300035410 Bacteria 1059
546 Ga0373931_0143286 3300035691 Bacteria 1386
547 Ga0373935_0108638 3300035692 Bacteria 1838
548 Ga0373927_0010992 3300035695 Bacteria 6028
549 Ga0373927_0039434 3300035695 Bacteria 3065
550 Ga0373927_0109939 3300035695 Bacteria 1795
551 Ga0373927_0322953 3300035695 Bacteria 1016
552 Ga0373927_0452385 3300035695 Bacteria 848
553 Ga0373933_0000041 3300035724 Bacteria 79805
554 Ga0373933_0012552 3300035724 Bacteria 4681
555 Ga0373933_0039675 3300035724 Bacteria 2771
556 Ga0373947_0015464 3300035725 Bacteria 4381
557 Ga0373947_0029904 3300035725 Bacteria 3198
558 Ga0373947_0059844 3300035725 Bacteria 2311
559 Ga0373947_0062881 3300035725 Bacteria 2260
560 Ga0373947_0241622 3300035725 Bacteria 1192
561 Ga0373937_0014572 3300036401 Bacteria 6943
562 Ga0373937_0163049 3300036401 Bacteria 2090
563 Ga0373925_0013749 3300037068 Bacteria 5858
564 Ga0373925_0165400 3300037068 Bacteria 1744
565 Ga0373925_0198098 3300037068 Bacteria 1596
566 Ga0373925_0207070 3300037068 Bacteria 1562
567 Ga0395900_0071894 3300037418 Bacteria 3557
568 Ga0395900_0123379 3300037418 Bacteria 2657
569 Ga0395900_0313915 3300037418 Bacteria 1550
570 Ga0395900_0510520 3300037418 Bacteria 1151
571 Ga0395898_0072896 3300037466 Bacteria 3317
572 Ga0395898_0185817 3300037466 Bacteria 1986
573 Ga0395898_0361367 3300037466 Bacteria 1384
574 Ga0395898_0461098 3300037466 Bacteria 1210
575 Ga0395898_0501886 3300037466 Bacteria 1154
576 Ga0395905_0104806 3300037471 Bacteria 2655
577 Ga0395905_0361255 3300037471 Bacteria 1345
578 Ga0436364_0294722 3300037853 Bacteria 3279
579 Ga0436364_1384833 3300037853 Bacteria 1340
580 Ga0395901_0190304 3300038443 Bacteria 2152
581 Ga0395901_0608874 3300038443 Bacteria 1101
582 Ga0395901_0813583 3300038443 Bacteria 922
583 Ga0395901_1211200 3300038443 Bacteria 720
584 Ga0395901_1365315 3300038443 Bacteria 668
585 Ga0436365_0038677 3300039437 Bacteria 917
586 Ga0436365_0328412 3300039437 Bacteria 2294
587 Ga0436365_0400158 3300039437 Bacteria 1092
588 Ga0436365_0873305 3300039437 Bacteria 601
589 Ga0436363_0716916 3300039450 Bacteria 1189
590 Ga0451795_0235683 3300041456 Bacteria 794
591 Ga0451800_0619150 3300041459 Bacteria 1468
592 Ga0451802_0026346 3300041460 Bacteria 571
593 Ga0451804_0741096 3300041463 Bacteria 1166
594 Ga0451807_1417304 3300041486 Bacteria 1453
595 Ga0451833_0306985 3300041491 Bacteria 1073
596 Ga0451845_0567644 3300041501 Bacteria 785
597 Ga0451855_1946904 3300041511 Bacteria 1040
598 Ga0451853_0411756 3300041512 Bacteria 947
599 Ga0439458_0054032 3300042157 Bacteria 995
600 Ga0439459_0004969 3300042438 Bacteria 2164
601 Ga0466966_0172332 3300044684 Bacteria 1315
602 Ga0466957_0236416 3300044842 Bacteria 1211
603 Ga0466967_0195962 3300045976 Bacteria 1911
604 Ga0495617_003836 3300046452 Bacteria 5545
605 Ga0495592_0028166 3300046454 Bacteria 4256
606 Ga0495592_0192784 3300046454 Bacteria 1380
607 Ga0495592_0553618 3300046454 Bacteria 707
608 Ga0495603_0003551 3300046455 Bacteria 9285
609 Ga0495603_0114512 3300046455 Bacteria 1572
610 Ga0495603_0308905 3300046455 Bacteria 908
611 Ga0495590_0035303 3300046457 Bacteria 1746
612 Ga0495629_0008864 3300046459 Bacteria 7396
613 Ga0495629_0048589 3300046459 Bacteria 2974
614 Ga0495629_0220837 3300046459 Bacteria 1307
615 Ga0495638_0087439 3300046460 Bacteria 1882
616 Ga0495638_0188903 3300046460 Bacteria 1170
617 Ga0495638_0244669 3300046460 Bacteria 991
618 Ga0495641_0056028 3300046461 Bacteria 1788
619 Ga0495651_0026680 3300046462 Bacteria 4498
620 Ga0495651_0041214 3300046462 Bacteria 3587
621 Ga0495651_0186619 3300046462 Bacteria 1463
622 Ga0495653_0035279 3300046463 Bacteria 3948
623 Ga0495650_0074710 3300046471 Bacteria 1321
624 Ga0495580_0015247 3300046472 Bacteria 5806
625 Ga0495580_0182066 3300046472 Bacteria 1451
626 Ga0495582_0004844 3300046473 Bacteria 7551
627 Ga0495605_0019743 3300046474 Bacteria 3594
628 Ga0495605_0085506 3300046474 Bacteria 1469
629 Ga0495605_0119536 3300046474 Bacteria 1195
630 Ga0495605_0303649 3300046474 Bacteria 675
631 Ga0495639_0227194 3300046475 Bacteria 919
632 Ga0495664_0041604 3300046477 Bacteria 2719
633 Ga0495664_0130686 3300046477 Bacteria 1520
634 Ga0495584_0138605 3300046491 Bacteria 1235
635 Ga0495584_0389390 3300046491 Bacteria 708
636 Ga0495585_0281270 3300046492 Bacteria 822
637 Ga0495585_0312333 3300046492 Bacteria 770
638 Ga0495594_0038684 3300046499 Bacteria 2606
639 Ga0495594_0159685 3300046499 Bacteria 1281
640 Ga0495596_0066028 3300046500 Bacteria 1407
641 Ga0495596_0103656 3300046500 Bacteria 1105
642 Ga0495607_0008614 3300046501 Bacteria 6958
643 Ga0495583_0064074 3300046506 Bacteria 1632
644 Ga0495583_0377093 3300046506 Bacteria 558
645 Ga0495606_0008403 3300046507 Bacteria 8979
646 Ga0495606_0231593 3300046507 Bacteria 1035
647 Ga0495608_0005163 3300046511 Bacteria 9327
648 Ga0495608_0148048 3300046511 Bacteria 1497
649 Ga0495610_0011973 3300046512 Bacteria 5256
650 Ga0495610_0106889 3300046512 Bacteria 1245
651 Ga0495610_0175974 3300046512 Bacteria 893
652 Ga0495616_0028143 3300046513 Bacteria 2977
653 Ga0495616_0194492 3300046513 Bacteria 895
654 Ga0495618_0072535 3300046514 Bacteria 2191
655 Ga0495618_0553698 3300046514 Bacteria 688
656 Ga0495620_0038328 3300046515 Bacteria 2128
657 Ga0495620_0067396 3300046515 Bacteria 1473
658 Ga0495620_0077187 3300046515 Bacteria 1353
659 Ga0495628_0029777 3300046516 Bacteria 4425
660 Ga0495628_0224556 3300046516 Bacteria 1409
661 Ga0495630_0049692 3300046517 Bacteria 3138
662 Ga0495631_0224731 3300046518 Bacteria 801
663 Ga0495631_0299436 3300046518 Bacteria 684
664 Ga0495632_0023259 3300046519 Bacteria 3312
665 Ga0495637_0086262 3300046520 Bacteria 1245
666 Ga0495637_0185095 3300046520 Bacteria 771
667 Ga0495643_0071150 3300046522 Bacteria 1826
668 Ga0495643_0293324 3300046522 Bacteria 744
669 Ga0495644_0066798 3300046523 Bacteria 1351
670 Ga0495648_0002320 3300046524 Bacteria 17720
671 Ga0495648_0032560 3300046524 Bacteria 3418
672 Ga0495648_0049954 3300046524 Bacteria 2560
673 Ga0495648_0132614 3300046524 Bacteria 1322
674 Ga0495648_0312598 3300046524 Bacteria 732
675 Ga0495663_0080059 3300046525 Bacteria 1051
676 Ga0495663_0242731 3300046525 Bacteria 638
677 Ga0495666_0062260 3300046526 Bacteria 1782
678 Ga0495642_0133298 3300046528 Bacteria 1070
679 Ga0495652_0002339 3300046529 Bacteria 19668
680 Ga0495652_0071585 3300046529 Bacteria 2893
681 Ga0495652_0073700 3300046529 Bacteria 2842
682 Ga0495654_0013864 3300046530 Bacteria 4302
683 Ga0495654_0035071 3300046530 Bacteria 2529
684 Ga0495640_0020781 3300046533 Bacteria 4826
685 Ga0495586_0060362 3300046535 Bacteria 2062
686 Ga0495586_0177428 3300046535 Bacteria 1205
687 Ga0495587_0033793 3300046536 Bacteria 3085
688 Ga0495587_0156726 3300046536 Bacteria 1297
689 Ga0495598_0074485 3300046537 Bacteria 1076
690 Ga0495598_0084680 3300046537 Bacteria 1023
691 Ga0495609_0203335 3300046538 Bacteria 827
692 Ga0495609_0369624 3300046538 Bacteria 577
693 Ga0495621_0018331 3300046539 Bacteria 2272
694 Ga0495597_0045099 3300046542 Bacteria 1958
695 Ga0495597_0163321 3300046542 Bacteria 908
696 Ga0495597_0176264 3300046542 Bacteria 866
697 Ga0495645_0268065 3300046543 Bacteria 1128
698 Ga0495622_0108440 3300046557 Bacteria 1271
699 Ga0495633_0039118 3300046558 Bacteria 2264
700 Ga0495667_0001528 3300046559 Bacteria 15306
701 Ga0495667_0481556 3300046559 Bacteria 778
702 Ga0495667_0732129 3300046559 Bacteria 612
703 Ga0495656_0016790 3300046615 Bacteria 2783
704 Ga0495656_0120853 3300046615 Bacteria 1236
705 Ga0495668_0038513 3300046616 Bacteria 2670
706 Ga0495668_0051022 3300046616 Bacteria 2291
707 Ga0495668_0067929 3300046616 Bacteria 1961
708 Ga0495668_0300501 3300046616 Bacteria 880
709 Ga0495634_0002573 3300046642 Bacteria 14976
710 Ga0495634_0028503 3300046642 Bacteria 3875
711 Ga0495634_0779624 3300046642 Bacteria 546
712 Ga0495611_0169251 3300046648 Bacteria 1021
713 Ga0495611_0178333 3300046648 Bacteria 993
714 Ga0495625_0129082 3300046660 Bacteria 1713
715 Ga0495625_0152712 3300046660 Bacteria 1551
716 Ga0495625_0249464 3300046660 Bacteria 1153
717 Ga0495635_0001091 3300046663 Bacteria 18022
718 Ga0495659_0056519 3300046664 Bacteria 1440
719 Ga0495661_0151994 3300046665 Bacteria 1250
720 Ga0495661_0441980 3300046665 Bacteria 627
721 Ga0495588_0001370 3300046674 Bacteria 10406
722 Ga0495657_0016934 3300046675 Bacteria 5297
723 Ga0495657_0150724 3300046675 Bacteria 1444
724 Ga0495657_0194216 3300046675 Bacteria 1239
725 Ga0495657_0279754 3300046675 Bacteria 999
726 Ga0495599_0002320 3300046678 Bacteria 11052
727 Ga0495623_0019613 3300046679 Bacteria 4370
728 Ga0495623_0160335 3300046679 Bacteria 1322
729 Ga0495623_0386319 3300046679 Bacteria 756
730 Ga0495623_0659927 3300046679 Bacteria 539
731 Ga0495646_0005680 3300046680 Bacteria 7901
732 Ga0495646_0079508 3300046680 Bacteria 1914
733 Ga0495647_0012606 3300046681 Bacteria 2914
734 Ga0495658_0005658 3300046683 Bacteria 6143
735 Ga0495658_0435843 3300046683 Bacteria 837
736 Ga0495669_0048629 3300046684 Bacteria 1897
737 Ga0495669_0160818 3300046684 Bacteria 1066
738 Ga0495669_0258716 3300046684 Bacteria 836
739 Ga0495613_0023851 3300046689 Bacteria 4559
740 Ga0495613_0165019 3300046689 Bacteria 1574
741 Ga0495613_0361916 3300046689 Bacteria 995
742 Ga0495624_0428599 3300046690 Bacteria 793
743 Ga0495670_0006136 3300046691 Bacteria 5899
744 Ga0495671_0151030 3300046692 Bacteria 1131
745 Ga0495649_0065974 3300046694 Bacteria 1943
746 Ga0495649_0217699 3300046694 Bacteria 988
747 Ga0495589_0144441 3300046794 Bacteria 1138
748 Ga0495600_0002218 3300046809 Bacteria 11048
749 Ga0495600_0048611 3300046809 Bacteria 2767
750 Ga0495660_0211719 3300046810 Bacteria 919
751 Ga0495660_0280765 3300046810 Bacteria 762
752 Ga0495581_0016629 3300047315 Bacteria 4276
753 Ga0495581_0196590 3300047315 Bacteria 1180
754 Ga0495604_0393309 3300047317 Bacteria 914
755 Ga0495636_0083176 3300047318 Bacteria 1381
756 Ga0495674_0007800 3300047319 Bacteria 10219
757 Ga0495674_0051843 3300047319 Bacteria 3615
758 Ga0495672_0010426 3300047320 Bacteria 6618
759 Ga0495672_0272082 3300047320 Bacteria 813
760 Ga0495676_0034176 3300047321 Bacteria 4269
761 Ga0495680_0005405 3300047322 Bacteria 12029
762 Ga0495680_0433784 3300047322 Bacteria 902
763 Ga0495675_0038736 3300047444 Bacteria 3035
764 Ga0495675_0256419 3300047444 Bacteria 1049
765 Ga0495677_0056687 3300047445 Bacteria 1448
766 Ga0495677_0112036 3300047445 Bacteria 1038
767 Ga0495677_0159259 3300047445 Bacteria 871
768 Ga0495677_0245592 3300047445 Bacteria 700
769 Ga0495679_035890 3300047446 Bacteria 1569
770 Ga0495673_0042451 3300047469 Bacteria 2041
771 Ga0495681_0097065 3300047470 Bacteria 1293
772 Ga0495684_0001482 3300047471 Bacteria 18783
773 Ga0495684_0097309 3300047471 Bacteria 2226
774 Ga0495686_0011245 3300047472 Bacteria 6312
775 Ga0495686_0086992 3300047472 Bacteria 1901
776 Ga0495686_0186345 3300047472 Bacteria 1199
777 Ga0495593_0026677 3300047673 Bacteria 3187
778 Ga0495593_0070853 3300047673 Bacteria 1811
779 Ga0495602_0068925 3300048088 Bacteria 3035
780 Ga0495602_0349615 3300048088 Bacteria 1067
781 Ga0495626_0111386 3300048091 Bacteria 1185
782 Ga0495626_0117971 3300048091 Bacteria 1144
783 Ga0496100_0002635 3300048903 Bacteria 9149
784 Ga0496100_0245834 3300048903 Bacteria 1322
785 Ga0496100_0664093 3300048903 Bacteria 812
786 Ga0496101_0043040 3300048904 Bacteria 3225
787 Ga0496101_0163644 3300048904 Bacteria 1707
788 Ga0496101_0554973 3300048904 Bacteria 908
789 Ga0496101_0616530 3300048904 Bacteria 858
790 Ga0496102_0003268 3300048905 Bacteria 13736
791 Ga0496102_0097762 3300048905 Bacteria 2723
792 Ga0496102_0204326 3300048905 Bacteria 1862
793 Ga0496102_0306661 3300048905 Bacteria 1496
794 Ga0496102_0324465 3300048905 Bacteria 1450
795 Ga0496102_0334889 3300048905 Bacteria 1425
796 Ga0496102_0505834 3300048905 Bacteria 1130
797 Ga0496102_0564602 3300048905 Bacteria 1061
798 Ga0496102_1797928 3300048905 Bacteria 530
799 Ga0496103_0011931 3300048906 Bacteria 5159
800 Ga0496103_0090433 3300048906 Bacteria 1931
801 Ga0496103_0241289 3300048906 Bacteria 1163
802 Ga0496103_0381660 3300048906 Bacteria 905
803 Ga0496103_0405211 3300048906 Bacteria 876
804 Ga0496104_0016540 3300048907 Bacteria 6702
805 Ga0496104_0064760 3300048907 Bacteria 3467
806 Ga0496104_0089038 3300048907 Bacteria 2949
807 Ga0496104_0926928 3300048907 Bacteria 776
808 Ga0496105_0027843 3300048908 Bacteria 4620
809 Ga0496106_0000477 3300048909 Bacteria 28442
810 Ga0496106_0017964 3300048909 Bacteria 5231
811 Ga0496106_0027131 3300048909 Bacteria 4265
812 Ga0496106_0042197 3300048909 Bacteria 3421
813 Ga0496106_0065167 3300048909 Bacteria 2773
814 Ga0496106_0207349 3300048909 Bacteria 1561
815 Ga0496107_0002282 3300048910 Bacteria 12380
816 Ga0496107_0006460 3300048910 Bacteria 8061
817 Ga0496107_0041128 3300048910 Bacteria 3319
818 Ga0496107_0105014 3300048910 Bacteria 2073
819 Ga0496107_0434291 3300048910 Bacteria 976
820 Ga0496107_0623862 3300048910 Bacteria 796
821 Ga0496107_0836265 3300048910 Bacteria 673
822 Ga0496107_1105454 3300048910 Bacteria 572
823 Ga0496108_0015096 3300048911 Bacteria 6304
824 Ga0496108_0034091 3300048911 Bacteria 4229
825 Ga0496108_0371059 3300048911 Bacteria 1249
826 Ga0496108_0517281 3300048911 Bacteria 1042
827 Ga0496108_0786760 3300048911 Bacteria 821
828 Ga0496109_0001422 3300048912 Bacteria 19864
829 Ga0496109_0103827 3300048912 Bacteria 2638
830 Ga0496109_0230541 3300048912 Bacteria 1742
831 Ga0496109_0323092 3300048912 Bacteria 1456
832 Ga0496109_0360581 3300048912 Bacteria 1373
833 Ga0496110_0010493 3300048913 Bacteria 7539
834 Ga0496110_0043572 3300048913 Bacteria 3919
835 Ga0496110_0047741 3300048913 Bacteria 3751
836 Ga0496110_0079042 3300048913 Bacteria 2928
837 Ga0496110_0151390 3300048913 Bacteria 2101
838 Ga0496111_0150239 3300048914 Bacteria 1728
839 Ga0496111_0221913 3300048914 Bacteria 1404
840 Ga0496111_0429867 3300048914 Bacteria 975
841 Ga0496111_0581912 3300048914 Bacteria 820
842 Ga0496112_0000021 3300048915 Bacteria 156561
843 Ga0496112_0003647 3300048915 Bacteria 12826
844 Ga0496112_0023640 3300048915 Bacteria 5876
845 Ga0496112_0155738 3300048915 Bacteria 2251
846 Ga0496112_0214871 3300048915 Bacteria 1880
847 Ga0496112_0596511 3300048915 Bacteria 1037
848 Ga0496112_1631968 3300048915 Bacteria 558
849 Ga0496113_0012966 3300048916 Bacteria 5623
850 Ga0496113_0064609 3300048916 Bacteria 2767
851 Ga0496113_0127028 3300048916 Bacteria 1998
852 Ga0496113_0906156 3300048916 Bacteria 697
853 Ga0496114_0020349 3300048917 Bacteria 5386
854 Ga0496114_0460686 3300048917 Bacteria 1125
855 Ga0496114_0460781 3300048917 Bacteria 1125
856 Ga0496114_0758248 3300048917 Bacteria 848
857 Ga0496115_0001335 3300048918 Bacteria 17580
858 Ga0496115_0013365 3300048918 Bacteria 6211
859 Ga0496115_0118076 3300048918 Bacteria 2182
860 Ga0496115_0217884 3300048918 Bacteria 1575
861 Ga0496115_0880263 3300048918 Bacteria 692
862 Ga0496115_1086964 3300048918 Bacteria 607
863 Ga0496116_0001763 3300048919 Bacteria 23588
864 Ga0496116_0350255 3300048919 Bacteria 677
865 Ga0496117_0020387 3300048920 Bacteria 5405
866 Ga0496117_0055575 3300048920 Bacteria 2765
867 Ga0496117_0153340 3300048920 Bacteria 1360
868 Ga0496117_0256143 3300048920 Bacteria 951
869 Ga0496118_0004957 3300048921 Bacteria 15416
870 Ga0496118_0045377 3300048921 Bacteria 3432
871 Ga0496118_0070368 3300048921 Bacteria 2526
872 Ga0496118_0079370 3300048921 Bacteria 2316
873 Ga0496118_0093442 3300048921 Bacteria 2060
874 Ga0496118_0275041 3300048921 Bacteria 941
875 Ga0496118_0351781 3300048921 Bacteria 785
876 Ga0496119_0037471 3300048922 Bacteria 3149
877 Ga0496119_0093097 3300048922 Bacteria 1708
878 Ga0496119_0132778 3300048922 Bacteria 1354
879 Ga0496119_0158597 3300048922 Bacteria 1205
880 Ga0496119_0249811 3300048922 Bacteria 895
881 Ga0496119_0507855 3300048922 Bacteria 560
882 Ga0496120_0066345 3300048923 Bacteria 1996
883 Ga0496120_0326959 3300048923 Bacteria 695
884 Ga0496121_0000456 3300048924 Bacteria 80536
885 Ga0496121_0002176 3300048924 Bacteria 30692
886 Ga0496121_0005356 3300048924 Bacteria 16491
887 Ga0496121_0011588 3300048924 Bacteria 9761
888 Ga0496121_0011976 3300048924 Bacteria 9536
889 Ga0496121_0012754 3300048924 Bacteria 9105
890 Ga0496121_0080209 3300048924 Bacteria 2588
891 Ga0496121_0093992 3300048924 Bacteria 2333
892 Ga0496121_0138045 3300048924 Bacteria 1813
893 Ga0496121_0148955 3300048924 Bacteria 1725
894 Ga0496121_0237255 3300048924 Bacteria 1273
895 Ga0496121_0252522 3300048924 Bacteria 1222
896 Ga0496121_0349583 3300048924 Bacteria 985
897 Ga0496122_0076366 3300048925 Bacteria 2358
898 Ga0496123_0036303 3300048926 Bacteria 3497
899 Ga0496123_0078705 3300048926 Bacteria 2018
900 Ga0496123_0157411 3300048926 Bacteria 1216
901 Ga0496124_0000685 3300048927 Bacteria 55748
902 Ga0496124_0146691 3300048927 Bacteria 1856
903 Ga0496124_0165241 3300048927 Bacteria 1721
904 Ga0496124_0197088 3300048927 Bacteria 1535
905 Ga0496124_0218781 3300048927 Bacteria 1434
906 Ga0496124_0323162 3300048927 Bacteria 1104
907 Ga0496124_0338774 3300048927 Bacteria 1069
908 Ga0496124_0697430 3300048927 Bacteria 644
909 Ga0496125_0001801 3300048928 Bacteria 29601
910 Ga0496125_0017146 3300048928 Bacteria 6922
911 Ga0496125_0062506 3300048928 Bacteria 2977
912 Ga0496125_0091527 3300048928 Bacteria 2278
913 Ga0496125_0364308 3300048928 Bacteria 858
914 Ga0496126_0002820 3300048929 Bacteria 22789
915 Ga0496126_0007653 3300048929 Bacteria 11790
916 Ga0496126_0010701 3300048929 Bacteria 9583
917 Ga0496126_0018173 3300048929 Bacteria 6976
918 Ga0496126_0031823 3300048929 Bacteria 4977
919 Ga0496126_0087475 3300048929 Bacteria 2745
920 Ga0496126_0111157 3300048929 Bacteria 2386
921 Ga0496126_0120159 3300048929 Bacteria 2280
922 Ga0496126_0130828 3300048929 Bacteria 2169
923 Ga0496126_0171898 3300048929 Bacteria 1845
924 Ga0496126_0250345 3300048929 Bacteria 1477
925 Ga0496126_0294066 3300048929 Bacteria 1342
926 Ga0496126_0569921 3300048929 Bacteria 896
927 Ga0496126_0718572 3300048929 Bacteria 774
928 Ga0495678_081562 3300049459 Bacteria 1160
929 Ga0495678_084293 3300049459 Bacteria 1134
930 Ga0495682_0070310 3300049460 Bacteria 1260
931 Ga0495682_0123455 3300049460 Bacteria 927
932 Ga0495682_0189895 3300049460 Bacteria 729
933 Ga0501031_0047144 3300049568 Bacteria 2809
934 Ga0501031_0113824 3300049568 Bacteria 1767
935 Ga0501031_0466179 3300049568 Bacteria 816
936 Ga0501032_0043001 3300049569 Bacteria 3062
937 Ga0501032_0067270 3300049569 Bacteria 2393
938 Ga0501032_0079485 3300049569 Bacteria 2183
939 Ga0501032_0103685 3300049569 Bacteria 1884
940 Ga0501032_0318234 3300049569 Bacteria 1004
941 Ga0501032_0858829 3300049569 Bacteria 572
942 Ga0501033_0000155 3300049570 Bacteria 65906
943 Ga0501033_0013872 3300049570 Bacteria 6131
944 Ga0501033_0172854 3300049570 Bacteria 1551
945 Ga0501033_0179861 3300049570 Bacteria 1516
946 Ga0501033_0189541 3300049570 Bacteria 1472
947 Ga0501033_0452646 3300049570 Bacteria 891
948 Ga0501034_0096763 3300049571 Bacteria 2948
949 Ga0501034_0103504 3300049571 Bacteria 2840
950 Ga0501034_0278758 3300049571 Bacteria 1611
951 Ga0501034_0541784 3300049571 Bacteria 1074
952 Ga0501036_0037945 3300049572 Bacteria 4076
953 Ga0501036_0083557 3300049572 Bacteria 2699
954 Ga0501036_0100512 3300049572 Bacteria 2446
955 Ga0501036_0318517 3300049572 Bacteria 1299
956 Ga0501036_0337572 3300049572 Bacteria 1258
957 Ga0501036_0440016 3300049572 Bacteria 1086
958 Ga0501036_0527856 3300049572 Bacteria 981
959 Ga0501037_0005405 3300049573 Bacteria 9304
960 Ga0501037_0008746 3300049573 Bacteria 7421
961 Ga0501037_0050716 3300049573 Bacteria 3036
962 Ga0501037_0266080 3300049573 Bacteria 1197
963 Ga0501037_0789971 3300049573 Bacteria 627
964 Ga0501038_0016381 3300049574 Bacteria 6718
965 Ga0501038_0072616 3300049574 Bacteria 2916
966 Ga0501038_0075930 3300049574 Bacteria 2839
967 Ga0501038_0137917 3300049574 Bacteria 1997
968 Ga0501038_0258372 3300049574 Bacteria 1377
969 Ga0501038_0325970 3300049574 Bacteria 1200
970 Ga0501038_0540862 3300049574 Bacteria 887
971 Ga0501038_0570168 3300049574 Bacteria 859
972 Ga0501039_0005420 3300049575 Bacteria 9644
973 Ga0501039_0096859 3300049575 Bacteria 2300
974 Ga0501039_0303405 3300049575 Bacteria 1255
975 Ga0501040_0660270 3300049576 Unclassified 756
976 Ga0501042_0013715 3300049578 Bacteria 5519
977 Ga0501042_0187066 3300049578 Bacteria 1494
978 Ga0501043_0011238 3300049579 Bacteria 7014
979 Ga0501043_0062194 3300049579 Bacteria 2931
980 Ga0501043_0109395 3300049579 Bacteria 2170
981 Ga0501043_0374543 3300049579 Bacteria 1079
982 Ga0501043_0771404 3300049579 Bacteria 697
983 Ga0501043_0778655 3300049579 Bacteria 693
984 Ga0501043_1050360 3300049579 Bacteria 578
985 Ga0501046_0019846 3300049580 Bacteria 5566
986 Ga0501046_0047997 3300049580 Bacteria 3383
987 Ga0501046_0113550 3300049580 Bacteria 2067
988 Ga0501046_0308562 3300049580 Bacteria 1154
989 Ga0501047_0015453 3300049581 Bacteria 7274
990 Ga0501047_0037479 3300049581 Bacteria 4688
991 Ga0501047_0199225 3300049581 Bacteria 1863
992 Ga0501048_0012334 3300049582 Bacteria 6359
993 Ga0501048_0186063 3300049582 Bacteria 1472
994 Ga0501048_0504419 3300049582 Bacteria 867
995 Ga0501048_0512113 3300049582 Bacteria 861
996 Ga0501067_0028432 3300049583 Bacteria 3097
997 Ga0501067_0032110 3300049583 Bacteria 2914
998 Ga0501067_0499132 3300049583 Bacteria 681
999 Ga0501068_0120528 3300049584 Bacteria 1635
1000 Ga0501068_0170986 3300049584 Bacteria 1371
1001 Ga0501068_0210316 3300049584 Bacteria 1235
1002 Ga0501070_0021175 3300049586 Bacteria 5457
1003 Ga0501070_0064966 3300049586 Bacteria 3022
1004 Ga0501070_0153638 3300049586 Bacteria 1898
1005 Ga0501070_0200465 3300049586 Bacteria 1639
1006 Ga0501070_0244814 3300049586 Bacteria 1467
1007 Ga0501070_0410220 3300049586 Bacteria 1095
1008 Ga0501071_0034910 3300049587 Bacteria 3581
1009 Ga0501072_0489956 3300049588 Bacteria 972
1010 Ga0501074_0028355 3300049590 Bacteria 4058
1011 Ga0501074_0124656 3300049590 Bacteria 1842
1012 Ga0501076_0156640 3300049592 Bacteria 1854
1013 Ga0501077_0193564 3300049593 Bacteria 1292
1014 Ga0501079_0318541 3300049741 Bacteria 1217
1015 Ga0501079_0341516 3300049741 Bacteria 1173
1016 Ga0501079_0427587 3300049741 Bacteria 1040
1017 Ga0501079_0737766 3300049741 Bacteria 775
1018 Ga0501080_0022612 3300049742 Bacteria 5824
1019 Ga0501080_0139213 3300049742 Bacteria 2244
1020 Ga0501080_0449131 3300049742 Bacteria 1156
1021 Ga0501080_0726981 3300049742 Bacteria 874
1022 Ga0501081_0388528 3300049743 Bacteria 1032
1023 Ga0501083_0077194 3300049744 Bacteria 2210
1024 Ga0501035_0002887 3300049822 Bacteria 16563
1025 Ga0501035_0095584 3300049822 Bacteria 2612
1026 Ga0501035_0102401 3300049822 Bacteria 2512
1027 Ga0501035_0201326 3300049822 Bacteria 1707
1028 Ga0501035_0314239 3300049822 Bacteria 1317
1029 Ga0501035_0545410 3300049822 Bacteria 950
1030 Ga0501044_0002908 3300049823 Bacteria 19491
1031 Ga0501044_0025575 3300049823 Bacteria 6258
1032 Ga0501044_0060570 3300049823 Bacteria 3875
1033 Ga0501044_0193273 3300049823 Bacteria 1996
1034 Ga0501044_0348337 3300049823 Bacteria 1401
1035 Ga0501044_0363699 3300049823 Bacteria 1364
1036 Ga0501044_0371525 3300049823 Bacteria 1346
1037 Ga0501044_1347316 3300049823 Bacteria 580
1038 nmdc:mga03n38_16168_c1 3300050490 Bacteria 2899
1039 nmdc:mga03n38_27443_c1 3300050490 Bacteria 2362
1040 nmdc:mga03n38_37121_c1 3300050490 Bacteria 2099
1041 nmdc:mga00v17_205461_c1 3300050491 Bacteria 1274
1042 nmdc:mga00v17_22557_c1 3300050491 Bacteria 3633
1043 nmdc:mga00v17_638554_c1 3300050491 Bacteria 685
1044 nmdc:mga0yw44_12117_c1 3300050492 Bacteria 4482
1045 nmdc:mga0yw44_375268_c1 3300050492 Bacteria 960
1046 nmdc:mga0yw44_43796_c1 3300050492 Bacteria 2674
1047 nmdc:mga0yw44_5923_c1 3300050492 Bacteria 5845
1048 nmdc:mga0yw44_855444_c1 3300050492 Bacteria 617
1049 nmdc:mga06z11_118768_c1 3300050494 Bacteria 1473
1050 nmdc:mga06z11_407496_c1 3300050494 Bacteria 819
1051 nmdc:mga06z11_78699_c1 3300050494 Bacteria 1763
1052 nmdc:mga04h51_210507_c1 3300050495 Bacteria 767
1053 nmdc:mga07m45_315516_c1 3300050496 Bacteria 909
1054 nmdc:mga07m45_52779_c1 3300050496 Bacteria 2296
1055 nmdc:mga07m45_55711_c1 3300050496 Bacteria 2235
1056 nmdc:mga0n895_251935_c1 3300050512 Bacteria 1792
1057 Ga0495601_0037539 3300053077 Bacteria 3029
1058 Ga0495601_0575910 3300053077 Bacteria 723
1059 Ga0495612_0024671 3300053078 Bacteria 2414
1060 Ga0495612_0158490 3300053078 Bacteria 987
1061 Ga0500610_0236581 3300053079 Bacteria 853
1062 Ga0495655_0053411 3300053083 Bacteria 1078
1063 Ga0495595_0006061 3300053084 Bacteria 4913
1064 Ga0495619_0002231 3300053085 Bacteria 12815
1065 Ga0495619_0037434 3300053085 Bacteria 3161
1066 Ga0495619_0064858 3300053085 Bacteria 2436
1067 Ga0495619_0206880 3300053085 Bacteria 1359
1068 Ga0500643_076922 3300053087 Bacteria 920
1069 Ga0500643_151961 3300053087 Bacteria 621
1070 Ga0500646_0012795 3300053090 Bacteria 2169
1071 Ga0500647_0147659 3300053091 Bacteria 1099
1072 Ga0500583_0119853 3300053092 Bacteria 1301
1073 Ga0500583_0137708 3300053092 Bacteria 1212
1074 Ga0500651_0048753 3300053093 Bacteria 2661
1075 Ga0500651_0062354 3300053093 Bacteria 2327
1076 Ga0500651_0211880 3300053093 Bacteria 1139
1077 Ga0500651_0365165 3300053093 Bacteria 817
1078 Ga0500641_0011445 3300053096 Bacteria 3220
1079 Ga0500641_0015263 3300053096 Bacteria 2847
1080 Ga0500648_074567 3300053097 Bacteria 1916
1081 Ga0500650_0003901 3300053098 Bacteria 5290
1082 Ga0500556_0000004 3300053104 Bacteria 666287
1083 Ga0500562_015798 3300053108 Bacteria 1938
1084 Ga0500592_001008 3300053116 Bacteria 4593
1085 Ga0500595_000324 3300053119 Bacteria 31413
1086 Ga0500595_034504 3300053119 Bacteria 1673
1087 Ga0500595_046627 3300053119 Bacteria 1361
1088 Ga0500595_145508 3300053119 Bacteria 663
1089 Ga0500628_130796 3300053129 Bacteria 689
1090 Ga0500642_0011049 3300053130 Bacteria 3214
1091 Ga0500652_000276 3300053131 Bacteria 19061
1092 Ga0500658_0224298 3300053134 Bacteria 862
1093 Ga0500559_0194296 3300053136 Bacteria 956
1094 Ga0500568_0002961 3300053139 Bacteria 9718
1095 Ga0500568_0191005 3300053139 Unclassified 751
1096 Ga0500573_0069876 3300053140 Bacteria 2003
1097 Ga0500577_0000144 3300053142 Bacteria 17408
1098 Ga0500577_0053573 3300053142 Bacteria 1525
1099 Ga0500586_011778 3300053145 Bacteria 2519
1100 Ga0500588_0054151 3300053146 Bacteria 1262
1101 Ga0500604_0006492 3300053151 Bacteria 3094
1102 Ga0500604_0023541 3300053151 Bacteria 1757
1103 Ga0500604_0033664 3300053151 Bacteria 1517
1104 Ga0500616_0000014 3300053153 Bacteria 637918
1105 Ga0500622_0005136 3300053156 Bacteria 7938
1106 Ga0500622_0038757 3300053156 Bacteria 2487
1107 Ga0500627_0189790 3300053158 Bacteria 923
1108 Ga0500634_0008812 3300053161 Bacteria 5063
1109 Ga0500634_0022055 3300053161 Bacteria 3454
1110 Ga0500634_0182676 3300053161 Bacteria 942
1111 Ga0500638_071658 3300053162 Bacteria 1656
1112 Ga0500638_246877 3300053162 Bacteria 721
1113 Ga0500636_0093571 3300053177 Bacteria 1718
1114 Ga0500636_0138945 3300053177 Bacteria 1346
1115 Ga0500567_068705 3300053723 Bacteria 1563
1116 Ga0500570_091658 3300053724 Bacteria 1320
1117 Ga0500611_028884 3300053727 Bacteria 1130
1118 Ga0500609_010620 3300053731 Bacteria 1241
1119 Ga0500552_021269 3300053733 Bacteria 926
1120 Ga0501084_0111229 3300054114 Bacteria 2302
1121 Ga0501082_0203287 3300060353 Bacteria 1723
1122 Ga0466962_0096498 3300061719 Bacteria 1418

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046475 Ga0495639_0227194 Ga0495639_0227194_395_877 160
2 3300046535 Ga0495586_0177428 Ga0495586_0177428_701_1183 160
3 3300049569 Ga0501032_0858829 Ga0501032_0858829_17_499 160
4 3300035086 Ga0373934_0189899 Ga0373934_0189899_343_828 161
5 3300035120 Ga0373957_0428639 Ga0373957_0428639_14_499 161
6 3300035172 Ga0373955_1001133 Ga0373955_1001133_19_504 161
7 3300038443 Ga0395901_1365315 Ga0395901_1365315_23_508 161
8 3300041460 Ga0451802_0026346 Ga0451802_0026346_13_498 161
9 3300046454 Ga0495592_0192784 Ga0495592_0192784_15_500 161
10 3300046460 Ga0495638_0087439 Ga0495638_0087439_17_502 161
11 3300046474 Ga0495605_0303649 Ga0495605_0303649_20_505 161
12 3300046518 Ga0495631_0299436 Ga0495631_0299436_10_501 161
13 3300046538 Ga0495609_0369624 Ga0495609_0369624_18_503 161
14 3300046559 Ga0495667_0732129 Ga0495667_0732129_14_499 161
15 3300048905 Ga0496102_1797928 Ga0496102_1797928_12_497 161
16 3300048906 Ga0496103_0381660 Ga0496103_0381660_399_884 161
17 3300048921 Ga0496118_0275041 Ga0496118_0275041_12_497 161
18 3300048924 Ga0496121_0080209 Ga0496121_0080209_19_504 161
19 3300049569 Ga0501032_0318234 Ga0501032_0318234_509_994 161
20 3300049576 Ga0501040_0660270 Ga0501040_0660270_250_735 161
21 3300048929 Ga0496126_0718572 Ga0496126_0718572_73_621 166
22 3300006173 Ga0070716_100001743 Ga0070716_1000017434 168
23 3300025939 Ga0207665_10405589 Ga0207665_104055892 169
24 3300026118 Ga0207675_100392224 Ga0207675_1003922242 169
25 3300031824 Ga0307413_10016410 Ga0307413_100164104 169
26 3300032005 Ga0307411_10017127 Ga0307411_100171273 169
27 3300034957 Ga0373938_0034867 Ga0373938_0034867_25_543 169
28 3300039437 Ga0436365_0873305 Ga0436365_0873305_31_540 169
29 3300041511 Ga0451855_1946904 Ga0451855_1946904_12_521 169
30 3300046454 Ga0495592_0553618 Ga0495592_0553618_188_697 169
31 3300046506 Ga0495583_0377093 Ga0495583_0377093_24_533 169
32 3300046512 Ga0495610_0011973 Ga0495610_0011973_4734_5243 169
33 3300046524 Ga0495648_0049954 Ga0495648_0049954_14_523 169
34 3300046542 Ga0495597_0176264 Ga0495597_0176264_21_530 169
35 3300046642 Ga0495634_0779624 Ga0495634_0779624_24_533 169
36 3300046679 Ga0495623_0659927 Ga0495623_0659927_17_526 169
37 3300046690 Ga0495624_0428599 Ga0495624_0428599_260_769 169
38 3300047322 Ga0495680_0433784 Ga0495680_0433784_12_521 169
39 3300047445 Ga0495677_0245592 Ga0495677_0245592_171_680 169
40 3300048091 Ga0495626_0117971 Ga0495626_0117971_614_1123 169
41 3300048906 Ga0496103_0241289 Ga0496103_0241289_610_1146 169
42 3300048910 Ga0496107_1105454 Ga0496107_1105454_11_520 169
43 3300048911 Ga0496108_0786760 Ga0496108_0786760_287_796 169
44 3300048915 Ga0496112_1631968 Ga0496112_1631968_26_535 169
45 3300048918 Ga0496115_0880263 Ga0496115_0880263_21_539 169
46 3300048922 Ga0496119_0507855 Ga0496119_0507855_34_543 169
47 3300048929 Ga0496126_0294066 Ga0496126_0294066_792_1328 169
48 3300049571 Ga0501034_0278758 Ga0501034_0278758_1060_1575 169
49 3300049579 Ga0501043_0778655 Ga0501043_0778655_17_532 169
50 3300049579 Ga0501043_1050360 Ga0501043_1050360_23_532 169
51 3300049823 Ga0501044_1347316 Ga0501044_1347316_14_526 169
52 3300050492 nmdc:mga0yw44_375268_c1 nmdc:mga0yw44_375268_c1_404_940 169
53 3300053087 Ga0500643_151961 Ga0500643_151961_87_596 169
54 3300053092 Ga0500583_0137708 Ga0500583_0137708_676_1185 169
55 3300049579 Ga0501043_0374543 Ga0501043_0374543_403_948 170
56 3300049568 Ga0501031_0113824 Ga0501031_0113824_489_1034 171
57 3300049570 Ga0501033_0179861 Ga0501033_0179861_312_857 171
58 3300049571 Ga0501034_0096763 Ga0501034_0096763_164_709 171
59 3300049581 Ga0501047_0015453 Ga0501047_0015453_4235_4780 171
60 3300049586 Ga0501070_0200465 Ga0501070_0200465_970_1515 171
61 3300049822 Ga0501035_0095584 Ga0501035_0095584_559_1104 171
62 3300049823 Ga0501044_0348337 Ga0501044_0348337_664_1209 171
63 3300006942 Ga0099824_1023248 Ga0099824_10232485 172
64 3300006943 Ga0099822_1000080 Ga0099822_10000803 172
65 3300027357 Ga0209589_1000003 Ga0209589_1000003600 172
66 3300027361 Ga0209489_100003 Ga0209489_100003651 172
67 3300027363 Ga0209700_100003 Ga0209700_100003651 172
68 3300053177 Ga0500636_0138945 Ga0500636_0138945_130_684 172
69 3300028558 Ga0265326_10022316 Ga0265326_100223162 176
70 3300028563 Ga0265319_1011881 Ga0265319_10118813 176
71 3300028653 Ga0265323_10001236 Ga0265323_100012368 176
72 3300028654 Ga0265322_10003757 Ga0265322_100037573 176
73 3300028800 Ga0265338_10000086 Ga0265338_10000086109 176
74 3300029957 Ga0265324_10031738 Ga0265324_100317383 176
75 iso_pu_bacteria 2643221651 2644288741 177
76 iso_pu_bacteria 2885374607 2885379479 178
77 3300006237 Ga0097621_100763182 Ga0097621_1007631822 179
78 iso_pu_bacteria 2791355199 2793082104 180
79 iso_pu_bacteria 2889033259 2889039781 180
80 iso_pu_bacteria 2922386360 2922391023 180
81 3300028794 Ga0307515_10289618 Ga0307515_102896182 181
82 3300048910 Ga0496107_0041128 Ga0496107_0041128_2574_3122 181
83 3300048924 Ga0496121_0002176 Ga0496121_0002176_26160_26708 181
84 3300048929 Ga0496126_0018173 Ga0496126_0018173_3630_4178 181
85 iso_pu_bacteria 2513237096 2513654785 181
86 iso_pu_bacteria 2513237098 2513675888 181
87 iso_pu_bacteria 2513237101 2513692585 181
88 iso_pu_bacteria 2513237137 2513855794 181
89 iso_pu_bacteria 2513237145 2513915035 181
90 iso_pu_bacteria 2517572143 2517892332 181
91 iso_pu_bacteria 2602042107 2603859513 181
92 iso_pu_bacteria 2667528175 2671120420 181
93 iso_pu_bacteria 2728368998 2728751131 181
94 iso_pu_bacteria 2791355197 2793072325 181
95 iso_pu_bacteria 2857524615 2857529083 181
96 iso_pu_bacteria 2874604998 2874605254 181
97 iso_pu_bacteria 2876808645 2876814323 181
98 iso_pu_bacteria 2879110137 2879111249 181
99 iso_pu_bacteria 2885383462 2885386550 181
100 iso_pu_bacteria 2903748898 2903749358 181
101 iso_pu_bacteria 2903768456 2903774129 181
102 iso_pu_bacteria 2904690495 2904695888 181
103 iso_pu_bacteria 2906635258 2906638867 181
104 iso_pu_bacteria 2906660503 2906666310 181
105 iso_pu_bacteria 2908739725 2908742627 181
106 iso_pu_bacteria 2908756301 2908761189 181
107 iso_pu_bacteria 2919073203 2919076483 181
108 iso_pu_bacteria 2922361189 2922365414 181
109 iso_pu_bacteria 2922425934 2922430352 181
110 iso_pu_bacteria 2935630451 2935631606 181
111 iso_pu_bacteria 2941507105 2941511400 181
112 iso_pu_bacteria 3005474847 3005480275 181
113 iso_pu_bacteria 8006964411 8006965799 181
114 iso_pu_bacteria 8006984368 8006986453 181
115 iso_pu_bacteria 8006994254 8006995978 181
116 iso_pu_bacteria 8019555841 8019556678 181
117 iso_pu_bacteria 8019565922 8019568628 181
118 iso_pu_bacteria 8056673599 8056673811 181
119 iso_pu_bacteria 8056689827 8056695261 181
120 3300037068 Ga0373925_0198098 Ga0373925_0198098_531_1091 182
121 3300046462 Ga0495651_0041214 Ga0495651_0041214_396_944 182
122 3300046524 Ga0495648_0032560 Ga0495648_0032560_2236_2793 182
123 3300053119 Ga0500595_000324 Ga0500595_000324_18097_18651 182
124 3300053162 Ga0500638_246877 Ga0500638_246877_10_567 182
125 3300005437 Ga0070710_10000842 Ga0070710_100008428 183
126 3300006163 Ga0070715_10000599 Ga0070715_100005995 183
127 3300006175 Ga0070712_100013006 Ga0070712_1000130064 183
128 3300006353 Ga0075370_10409544 Ga0075370_104095442 183
129 3300017792 Ga0163161_10549107 Ga0163161_105491072 183
130 3300025284 Ga0209130_1025167 Ga0209130_10251672 183
131 3300025905 Ga0207685_10002037 Ga0207685_100020372 183
132 3300025915 Ga0207693_10000095 Ga0207693_1000009552 183
133 3300025939 Ga0207665_10000133 Ga0207665_1000013310 183
134 3300037466 Ga0395898_0361367 Ga0395898_0361367_510_1064 183
135 3300038443 Ga0395901_1211200 Ga0395901_1211200_13_567 183
136 3300039450 Ga0436363_0716916 Ga0436363_0716916_138_689 183
137 3300044842 Ga0466957_0236416 Ga0466957_0236416_328_879 183
138 3300048907 Ga0496104_0064760 Ga0496104_0064760_1188_1739 183
139 3300048909 Ga0496106_0017964 Ga0496106_0017964_129_680 183
140 3300048910 Ga0496107_0006460 Ga0496107_0006460_5539_6090 183
141 3300048910 Ga0496107_0836265 Ga0496107_0836265_90_641 183
142 3300048911 Ga0496108_0034091 Ga0496108_0034091_2798_3349 183
143 3300048912 Ga0496109_0001422 Ga0496109_0001422_15308_15859 183
144 3300048913 Ga0496110_0043572 Ga0496110_0043572_2718_3269 183
145 3300048914 Ga0496111_0221913 Ga0496111_0221913_600_1151 183
146 3300048915 Ga0496112_0000021 Ga0496112_0000021_107568_108119 183
147 3300048915 Ga0496112_0003647 Ga0496112_0003647_4056_4607 183
148 3300048916 Ga0496113_0127028 Ga0496113_0127028_1259_1810 183
149 3300048917 Ga0496114_0460781 Ga0496114_0460781_149_700 183
150 3300049568 Ga0501031_0047144 Ga0501031_0047144_462_1013 183
151 3300049569 Ga0501032_0043001 Ga0501032_0043001_665_1216 183
152 3300049569 Ga0501032_0079485 Ga0501032_0079485_919_1470 183
153 3300049570 Ga0501033_0000155 Ga0501033_0000155_85_636 183
154 3300049570 Ga0501033_0172854 Ga0501033_0172854_590_1144 183
155 3300049570 Ga0501033_0189541 Ga0501033_0189541_502_1056 183
156 3300049571 Ga0501034_0103504 Ga0501034_0103504_1747_2298 183
157 3300049571 Ga0501034_0541784 Ga0501034_0541784_64_615 183
158 3300049572 Ga0501036_0037945 Ga0501036_0037945_1285_1836 183
159 3300049572 Ga0501036_0083557 Ga0501036_0083557_2088_2639 183
160 3300049572 Ga0501036_0318517 Ga0501036_0318517_433_984 183
161 3300049572 Ga0501036_0337572 Ga0501036_0337572_243_794 183
162 3300049572 Ga0501036_0440016 Ga0501036_0440016_189_740 183
163 3300049573 Ga0501037_0005405 Ga0501037_0005405_3834_4385 183
164 3300049573 Ga0501037_0266080 Ga0501037_0266080_412_963 183
165 3300049574 Ga0501038_0072616 Ga0501038_0072616_863_1417 183
166 3300049574 Ga0501038_0075930 Ga0501038_0075930_234_785 183
167 3300049574 Ga0501038_0137917 Ga0501038_0137917_1324_1875 183
168 3300049574 Ga0501038_0258372 Ga0501038_0258372_725_1276 183
169 3300049574 Ga0501038_0325970 Ga0501038_0325970_639_1190 183
170 3300049574 Ga0501038_0570168 Ga0501038_0570168_95_649 183
171 3300049575 Ga0501039_0005420 Ga0501039_0005420_3618_4169 183
172 3300049575 Ga0501039_0303405 Ga0501039_0303405_306_857 183
173 3300049578 Ga0501042_0013715 Ga0501042_0013715_2989_3540 183
174 3300049579 Ga0501043_0011238 Ga0501043_0011238_5377_5928 183
175 3300049579 Ga0501043_0062194 Ga0501043_0062194_1573_2124 183
176 3300049579 Ga0501043_0109395 Ga0501043_0109395_992_1543 183
177 3300049579 Ga0501043_0771404 Ga0501043_0771404_72_626 183
178 3300049580 Ga0501046_0019846 Ga0501046_0019846_2888_3439 183
179 3300049580 Ga0501046_0113550 Ga0501046_0113550_203_754 183
180 3300049580 Ga0501046_0308562 Ga0501046_0308562_347_901 183
181 3300049581 Ga0501047_0037479 Ga0501047_0037479_1628_2179 183
182 3300049582 Ga0501048_0504419 Ga0501048_0504419_170_721 183
183 3300049582 Ga0501048_0512113 Ga0501048_0512113_83_637 183
184 3300049583 Ga0501067_0028432 Ga0501067_0028432_1013_1564 183
185 3300049583 Ga0501067_0499132 Ga0501067_0499132_31_582 183
186 3300049584 Ga0501068_0170986 Ga0501068_0170986_352_903 183
187 3300049584 Ga0501068_0210316 Ga0501068_0210316_526_1077 183
188 3300049586 Ga0501070_0064966 Ga0501070_0064966_1470_2021 183
189 3300049586 Ga0501070_0153638 Ga0501070_0153638_827_1378 183
190 3300049586 Ga0501070_0410220 Ga0501070_0410220_424_975 183
191 3300049587 Ga0501071_0034910 Ga0501071_0034910_2043_2594 183
192 3300049590 Ga0501074_0124656 Ga0501074_0124656_864_1415 183
193 3300049593 Ga0501077_0193564 Ga0501077_0193564_381_932 183
194 3300049741 Ga0501079_0341516 Ga0501079_0341516_365_916 183
195 3300049742 Ga0501080_0139213 Ga0501080_0139213_748_1299 183
196 3300049742 Ga0501080_0449131 Ga0501080_0449131_148_699 183
197 3300049744 Ga0501083_0077194 Ga0501083_0077194_113_664 183
198 3300049822 Ga0501035_0002887 Ga0501035_0002887_462_1013 183
199 3300049822 Ga0501035_0102401 Ga0501035_0102401_1024_1578 183
200 3300049823 Ga0501044_0002908 Ga0501044_0002908_18216_18767 183
201 3300049823 Ga0501044_0025575 Ga0501044_0025575_620_1171 183
202 3300049823 Ga0501044_0060570 Ga0501044_0060570_2294_2845 183
203 3300049823 Ga0501044_0363699 Ga0501044_0363699_323_877 183
204 3300050491 nmdc:mga00v17_638554_c1 nmdc:mga00v17_638554_c1_17_568 183
205 3300054114 Ga0501084_0111229 Ga0501084_0111229_1536_2087 183
206 3300060353 Ga0501082_0203287 Ga0501082_0203287_381_932 183
207 3300003320 rootH2_10125295 rootH2_101252952 184
208 3300005331 Ga0070670_100446574 Ga0070670_1004465742 184
209 3300005334 Ga0068869_100086035 Ga0068869_1000860351 184
210 3300005337 Ga0070682_100165434 Ga0070682_1001654342 184
211 3300005337 Ga0070682_100216401 Ga0070682_1002164012 184
212 3300005338 Ga0068868_100663556 Ga0068868_1006635561 184
213 3300005344 Ga0070661_100064797 Ga0070661_1000647972 184
214 3300005344 Ga0070661_100539269 Ga0070661_1005392691 184
215 3300005347 Ga0070668_100429114 Ga0070668_1004291142 184
216 3300005353 Ga0070669_100313835 Ga0070669_1003138351 184
217 3300005366 Ga0070659_101009091 Ga0070659_1010090911 184
218 3300005367 Ga0070667_100257503 Ga0070667_1002575032 184
219 3300005441 Ga0070700_100212205 Ga0070700_1002122051 184
220 3300005455 Ga0070663_100054728 Ga0070663_1000547283 184
221 3300005455 Ga0070663_100651462 Ga0070663_1006514622 184
222 3300005456 Ga0070678_100338181 Ga0070678_1003381812 184
223 3300005456 Ga0070678_100378193 Ga0070678_1003781932 184
224 3300005457 Ga0070662_100310416 Ga0070662_1003104162 184
225 3300005458 Ga0070681_10219486 Ga0070681_102194862 184
226 3300005466 Ga0070685_10074039 Ga0070685_100740392 184
227 3300005467 Ga0070706_100371768 Ga0070706_1003717682 184
228 3300005471 Ga0070698_100080796 Ga0070698_1000807961 184
229 3300005536 Ga0070697_100261043 Ga0070697_1002610432 184
230 3300005548 Ga0070665_100042917 Ga0070665_1000429174 184
231 3300005548 Ga0070665_100079662 Ga0070665_1000796623 184
232 3300005548 Ga0070665_100312102 Ga0070665_1003121022 184
233 3300005548 Ga0070665_100619145 Ga0070665_1006191452 184
234 3300005564 Ga0070664_100149315 Ga0070664_1001493152 184
235 3300005577 Ga0068857_101000316 Ga0068857_1010003162 184
236 3300005578 Ga0068854_101067737 Ga0068854_1010677372 184
237 3300005616 Ga0068852_101353155 Ga0068852_1013531551 184
238 3300005617 Ga0068859_100102030 Ga0068859_1001020302 184
239 3300005719 Ga0068861_100495736 Ga0068861_1004957362 184
240 3300005840 Ga0068870_10129406 Ga0068870_101294062 184
241 3300005841 Ga0068863_100450869 Ga0068863_1004508692 184
242 3300005842 Ga0068858_100091420 Ga0068858_1000914202 184
243 3300005842 Ga0068858_100429826 Ga0068858_1004298262 184
244 3300005843 Ga0068860_100439021 Ga0068860_1004390211 184
245 3300005844 Ga0068862_100032642 Ga0068862_1000326423 184
246 3300005937 Ga0081455_10002419 Ga0081455_1000241916 184
247 3300006038 Ga0075365_10005918 Ga0075365_100059184 184
248 3300006048 Ga0075363_100010147 Ga0075363_1000101472 184
249 3300006048 Ga0075363_100138720 Ga0075363_1001387202 184
250 3300006237 Ga0097621_100194605 Ga0097621_1001946053 184
251 3300006237 Ga0097621_100431168 Ga0097621_1004311682 184
252 3300006353 Ga0075370_10047236 Ga0075370_100472362 184
253 3300006931 Ga0097620_100102032 Ga0097620_1001020322 184
254 3300007788 Ga0099795_10029828 Ga0099795_100298282 184
255 3300009101 Ga0105247_10064365 Ga0105247_100643652 184
256 3300009148 Ga0105243_10324591 Ga0105243_103245913 184
257 3300009148 Ga0105243_10908670 Ga0105243_109086702 184
258 3300009148 Ga0105243_11074339 Ga0105243_110743392 184
259 3300009176 Ga0105242_10398219 Ga0105242_103982191 184
260 3300009177 Ga0105248_10033538 Ga0105248_100335384 184
261 3300010375 Ga0105239_10528120 Ga0105239_105281202 184
262 3300013105 Ga0157369_10008785 Ga0157369_1000878510 184
263 3300013105 Ga0157369_10586469 Ga0157369_105864692 184
264 3300013296 Ga0157374_10698894 Ga0157374_106988942 184
265 3300013306 Ga0163162_10387927 Ga0163162_103879272 184
266 3300013306 Ga0163162_10545219 Ga0163162_105452192 184
267 3300013308 Ga0157375_10752300 Ga0157375_107523002 184
268 3300014326 Ga0157380_10204726 Ga0157380_102047262 184
269 3300014968 Ga0157379_10085223 Ga0157379_100852232 184
270 3300020081 Ga0206354_10882167 Ga0206354_108821671 184
271 3300020082 Ga0206353_10028130 Ga0206353_100281302 184
272 3300022467 Ga0224712_10009301 Ga0224712_100093012 184
273 3300025297 Ga0209758_1007614 Ga0209758_10076145 184
274 3300025900 Ga0207710_10012692 Ga0207710_100126924 184
275 3300025903 Ga0207680_10144957 Ga0207680_101449572 184
276 3300025908 Ga0207643_10168286 Ga0207643_101682862 184
277 3300025910 Ga0207684_10118590 Ga0207684_101185903 184
278 3300025910 Ga0207684_10541520 Ga0207684_105415202 184
279 3300025912 Ga0207707_10135199 Ga0207707_101351992 184
280 3300025920 Ga0207649_10071248 Ga0207649_100712482 184
281 3300025921 Ga0207652_10099410 Ga0207652_100994103 184
282 3300025924 Ga0207694_10478871 Ga0207694_104788712 184
283 3300025925 Ga0207650_10413726 Ga0207650_104137262 184
284 3300025933 Ga0207706_10262175 Ga0207706_102621752 184
285 3300025938 Ga0207704_10403491 Ga0207704_104034912 184
286 3300025941 Ga0207711_10135139 Ga0207711_101351392 184
287 3300025942 Ga0207689_10013575 Ga0207689_100135754 184
288 3300025945 Ga0207679_10103264 Ga0207679_101032642 184
289 3300025972 Ga0207668_10212704 Ga0207668_102127042 184
290 3300025986 Ga0207658_10142037 Ga0207658_101420372 184
291 3300026041 Ga0207639_10308315 Ga0207639_103083152 184
292 3300026067 Ga0207678_10298427 Ga0207678_102984271 184
293 3300026067 Ga0207678_10638284 Ga0207678_106382842 184
294 3300026067 Ga0207678_10797257 Ga0207678_107972572 184
295 3300026075 Ga0207708_10370013 Ga0207708_103700132 184
296 3300026088 Ga0207641_10102895 Ga0207641_101028953 184
297 3300026116 Ga0207674_10557135 Ga0207674_105571352 184
298 3300026118 Ga0207675_100041520 Ga0207675_1000415202 184
299 3300026121 Ga0207683_10096169 Ga0207683_100961692 184
300 3300026121 Ga0207683_10172085 Ga0207683_101720852 184
301 3300026142 Ga0207698_10950268 Ga0207698_109502682 184
302 3300028379 Ga0268266_10002475 Ga0268266_1000247518 184
303 3300028379 Ga0268266_10073602 Ga0268266_100736024 184
304 3300028379 Ga0268266_10119237 Ga0268266_101192372 184
305 3300028379 Ga0268266_10669616 Ga0268266_106696162 184
306 3300028380 Ga0268265_11225659 Ga0268265_112256592 184
307 3300028381 Ga0268264_10294999 Ga0268264_102949992 184
308 3300028786 Ga0307517_10000063 Ga0307517_100000631 184
309 3300028794 Ga0307515_10007547 Ga0307515_100075472 184
310 3300031507 Ga0307509_10075236 Ga0307509_100752364 184
311 3300031616 Ga0307508_10000009 Ga0307508_10000009159 184
312 3300031730 Ga0307516_10087356 Ga0307516_100873563 184
313 3300031730 Ga0307516_10254800 Ga0307516_102548002 184
314 3300031730 Ga0307516_10286914 Ga0307516_102869142 184
315 3300031731 Ga0307405_10248432 Ga0307405_102484322 184
316 3300031731 Ga0307405_10384116 Ga0307405_103841162 184
317 3300031731 Ga0307405_10852369 Ga0307405_108523692 184
318 3300031901 Ga0307406_10454726 Ga0307406_104547262 184
319 3300031911 Ga0307412_10199327 Ga0307412_101993271 184
320 3300031995 Ga0307409_100018794 Ga0307409_1000187942 184
321 3300031995 Ga0307409_100292315 Ga0307409_1002923151 184
322 3300032126 Ga0307415_100153327 Ga0307415_1001533272 184
323 3300032126 Ga0307415_100555325 Ga0307415_1005553251 184
324 3300033180 Ga0307510_10041082 Ga0307510_100410822 184
325 3300035113 Ga0373936_0270770 Ga0373936_0270770_97_654 184
326 3300035172 Ga0373955_0422469 Ga0373955_0422469_117_674 184
327 3300035695 Ga0373927_0109939 Ga0373927_0109939_135_689 184
328 3300035725 Ga0373947_0062881 Ga0373947_0062881_554_1108 184
329 3300036401 Ga0373937_0163049 Ga0373937_0163049_494_1051 184
330 3300037068 Ga0373925_0165400 Ga0373925_0165400_76_630 184
331 3300037418 Ga0395900_0313915 Ga0395900_0313915_591_1166 184
332 3300037853 Ga0436364_1384833 Ga0436364_1384833_93_647 184
333 3300041456 Ga0451795_0235683 Ga0451795_0235683_32_601 184
334 3300041486 Ga0451807_1417304 Ga0451807_1417304_134_688 184
335 3300041491 Ga0451833_0306985 Ga0451833_0306985_212_766 184
336 3300041501 Ga0451845_0567644 Ga0451845_0567644_64_630 184
337 3300046452 Ga0495617_003836 Ga0495617_003836_3608_4162 184
338 3300046455 Ga0495603_0003551 Ga0495603_0003551_6517_7071 184
339 3300046455 Ga0495603_0308905 Ga0495603_0308905_297_851 184
340 3300046459 Ga0495629_0220837 Ga0495629_0220837_120_674 184
341 3300046460 Ga0495638_0244669 Ga0495638_0244669_213_767 184
342 3300046461 Ga0495641_0056028 Ga0495641_0056028_1025_1579 184
343 3300046471 Ga0495650_0074710 Ga0495650_0074710_106_660 184
344 3300046474 Ga0495605_0085506 Ga0495605_0085506_156_710 184
345 3300046474 Ga0495605_0119536 Ga0495605_0119536_596_1165 184
346 3300046477 Ga0495664_0130686 Ga0495664_0130686_510_1064 184
347 3300046492 Ga0495585_0312333 Ga0495585_0312333_58_612 184
348 3300046499 Ga0495594_0038684 Ga0495594_0038684_903_1457 184
349 3300046500 Ga0495596_0103656 Ga0495596_0103656_439_993 184
350 3300046512 Ga0495610_0106889 Ga0495610_0106889_436_990 184
351 3300046512 Ga0495610_0175974 Ga0495610_0175974_240_794 184
352 3300046513 Ga0495616_0194492 Ga0495616_0194492_57_611 184
353 3300046515 Ga0495620_0067396 Ga0495620_0067396_273_827 184
354 3300046518 Ga0495631_0224731 Ga0495631_0224731_17_571 184
355 3300046522 Ga0495643_0293324 Ga0495643_0293324_122_676 184
356 3300046523 Ga0495644_0066798 Ga0495644_0066798_511_1065 184
357 3300046524 Ga0495648_0002320 Ga0495648_0002320_15441_15995 184
358 3300046525 Ga0495663_0242731 Ga0495663_0242731_56_610 184
359 3300046530 Ga0495654_0035071 Ga0495654_0035071_1087_1641 184
360 3300046537 Ga0495598_0084680 Ga0495598_0084680_239_793 184
361 3300046542 Ga0495597_0163321 Ga0495597_0163321_67_621 184
362 3300046557 Ga0495622_0108440 Ga0495622_0108440_678_1232 184
363 3300046615 Ga0495656_0120853 Ga0495656_0120853_274_828 184
364 3300046616 Ga0495668_0038513 Ga0495668_0038513_1910_2464 184
365 3300046648 Ga0495611_0169251 Ga0495611_0169251_303_857 184
366 3300046660 Ga0495625_0152712 Ga0495625_0152712_972_1526 184
367 3300046660 Ga0495625_0249464 Ga0495625_0249464_453_1022 184
368 3300046665 Ga0495661_0151994 Ga0495661_0151994_49_603 184
369 3300046675 Ga0495657_0150724 Ga0495657_0150724_32_589 184
370 3300046679 Ga0495623_0160335 Ga0495623_0160335_630_1187 184
371 3300046684 Ga0495669_0160818 Ga0495669_0160818_217_771 184
372 3300046684 Ga0495669_0258716 Ga0495669_0258716_41_595 184
373 3300046694 Ga0495649_0065974 Ga0495649_0065974_292_861 184
374 3300046694 Ga0495649_0217699 Ga0495649_0217699_172_726 184
375 3300047320 Ga0495672_0010426 Ga0495672_0010426_5816_6385 184
376 3300047445 Ga0495677_0159259 Ga0495677_0159259_202_756 184
377 3300047446 Ga0495679_035890 Ga0495679_035890_351_905 184
378 3300047469 Ga0495673_0042451 Ga0495673_0042451_256_810 184
379 3300047470 Ga0495681_0097065 Ga0495681_0097065_128_682 184
380 3300047472 Ga0495686_0186345 Ga0495686_0186345_313_867 184
381 3300048904 Ga0496101_0616530 Ga0496101_0616530_217_771 184
382 3300048906 Ga0496103_0405211 Ga0496103_0405211_300_854 184
383 3300048910 Ga0496107_0623862 Ga0496107_0623862_49_603 184
384 3300048912 Ga0496109_0323092 Ga0496109_0323092_804_1358 184
385 3300048913 Ga0496110_0047741 Ga0496110_0047741_133_687 184
386 3300048914 Ga0496111_0581912 Ga0496111_0581912_100_654 184
387 3300048915 Ga0496112_0596511 Ga0496112_0596511_55_609 184
388 3300048916 Ga0496113_0906156 Ga0496113_0906156_85_639 184
389 3300048917 Ga0496114_0758248 Ga0496114_0758248_94_648 184
390 3300048918 Ga0496115_0118076 Ga0496115_0118076_606_1160 184
391 3300048920 Ga0496117_0153340 Ga0496117_0153340_445_999 184
392 3300048921 Ga0496118_0045377 Ga0496118_0045377_349_903 184
393 3300048922 Ga0496119_0249811 Ga0496119_0249811_39_614 184
394 3300048923 Ga0496120_0326959 Ga0496120_0326959_13_585 184
395 3300048924 Ga0496121_0005356 Ga0496121_0005356_14762_15316 184
396 3300048924 Ga0496121_0148955 Ga0496121_0148955_442_1005 184
397 3300048924 Ga0496121_0237255 Ga0496121_0237255_419_973 184
398 3300048927 Ga0496124_0165241 Ga0496124_0165241_214_768 184
399 3300048927 Ga0496124_0218781 Ga0496124_0218781_230_784 184
400 3300048928 Ga0496125_0364308 Ga0496125_0364308_103_657 184
401 3300048929 Ga0496126_0010701 Ga0496126_0010701_3593_4147 184
402 3300048929 Ga0496126_0111157 Ga0496126_0111157_329_883 184
403 3300049459 Ga0495678_084293 Ga0495678_084293_533_1087 184
404 3300049460 Ga0495682_0070310 Ga0495682_0070310_368_922 184
405 3300049460 Ga0495682_0123455 Ga0495682_0123455_158_727 184
406 3300049572 Ga0501036_0527856 Ga0501036_0527856_320_874 184
407 3300049573 Ga0501037_0789971 Ga0501037_0789971_24_578 184
408 3300049578 Ga0501042_0187066 Ga0501042_0187066_272_826 184
409 3300049582 Ga0501048_0186063 Ga0501048_0186063_821_1375 184
410 3300049592 Ga0501076_0156640 Ga0501076_0156640_708_1262 184
411 3300049741 Ga0501079_0737766 Ga0501079_0737766_129_683 184
412 3300049743 Ga0501081_0388528 Ga0501081_0388528_41_595 184
413 3300049822 Ga0501035_0545410 Ga0501035_0545410_331_885 184
414 3300050490 nmdc:mga03n38_27443_c1 nmdc:mga03n38_27443_c1_1693_2262 184
415 3300050490 nmdc:mga03n38_37121_c1 nmdc:mga03n38_37121_c1_665_1228 184
416 3300050492 nmdc:mga0yw44_5923_c1 nmdc:mga0yw44_5923_c1_3160_3723 184
417 3300050494 nmdc:mga06z11_118768_c1 nmdc:mga06z11_118768_c1_734_1297 184
418 3300050495 nmdc:mga04h51_210507_c1 nmdc:mga04h51_210507_c1_16_570 184
419 3300050496 nmdc:mga07m45_52779_c1 nmdc:mga07m45_52779_c1_1637_2191 184
420 3300053077 Ga0495601_0575910 Ga0495601_0575910_98_652 184
421 3300053083 Ga0495655_0053411 Ga0495655_0053411_223_777 184
422 3300053091 Ga0500647_0147659 Ga0500647_0147659_225_797 184
423 3300053093 Ga0500651_0365165 Ga0500651_0365165_178_732 184
424 3300053097 Ga0500648_074567 Ga0500648_074567_816_1385 184
425 3300053139 Ga0500568_0191005 Ga0500568_0191005_83_637 184
426 3300053145 Ga0500586_011778 Ga0500586_011778_1578_2132 184
427 3300053158 Ga0500627_0189790 Ga0500627_0189790_76_630 184
428 3300053723 Ga0500567_068705 Ga0500567_068705_822_1376 184
429 iso_pu_bacteria 2524023228 2524538581 184
430 iso_pu_bacteria 2904699407 2904703521 184
431 iso_pu_bacteria 8006933436 8006940610 184
432 iso_pu_bacteria 8006973647 8006980299 184
433 3300001990 JGI24737J22298_10044120 JGI24737J22298_100441202 185
434 3300002077 JGI24744J21845_10007871 JGI24744J21845_100078712 185
435 3300003203 JGI25406J46586_10000104 JGI25406J46586_1000010417 185
436 3300003215 JGI25153J46596_10001106 JGI25153J46596_1000110610 185
437 3300005328 Ga0070676_10042094 Ga0070676_100420943 185
438 3300005328 Ga0070676_10680029 Ga0070676_106800291 185
439 3300005329 Ga0070683_100390438 Ga0070683_1003904382 185
440 3300005330 Ga0070690_100377428 Ga0070690_1003774282 185
441 3300005330 Ga0070690_100414628 Ga0070690_1004146282 185
442 3300005331 Ga0070670_100217605 Ga0070670_1002176052 185
443 3300005334 Ga0068869_100102861 Ga0068869_1001028612 185
444 3300005334 Ga0068869_100974494 Ga0068869_1009744941 185
445 3300005335 Ga0070666_10539928 Ga0070666_105399281 185
446 3300005336 Ga0070680_100081052 Ga0070680_1000810522 185
447 3300005337 Ga0070682_100110843 Ga0070682_1001108432 185
448 3300005337 Ga0070682_100163513 Ga0070682_1001635132 185
449 3300005337 Ga0070682_100182044 Ga0070682_1001820441 185
450 3300005338 Ga0068868_100007248 Ga0068868_1000072486 185
451 3300005338 Ga0068868_100034333 Ga0068868_1000343334 185
452 3300005338 Ga0068868_100671185 Ga0068868_1006711851 185
453 3300005338 Ga0068868_100701086 Ga0068868_1007010861 185
454 3300005339 Ga0070660_100075327 Ga0070660_1000753273 185
455 3300005339 Ga0070660_100176267 Ga0070660_1001762672 185
456 3300005340 Ga0070689_100627965 Ga0070689_1006279652 185
457 3300005347 Ga0070668_100071521 Ga0070668_1000715212 185
458 3300005347 Ga0070668_100169745 Ga0070668_1001697452 185
459 3300005347 Ga0070668_100524107 Ga0070668_1005241072 185
460 3300005354 Ga0070675_101132990 Ga0070675_1011329901 185
461 3300005355 Ga0070671_100141963 Ga0070671_1001419633 185
462 3300005355 Ga0070671_100160036 Ga0070671_1001600362 185
463 3300005355 Ga0070671_100249989 Ga0070671_1002499892 185
464 3300005366 Ga0070659_100029963 Ga0070659_1000299633 185
465 3300005366 Ga0070659_100120478 Ga0070659_1001204782 185
466 3300005366 Ga0070659_100650705 Ga0070659_1006507051 185
467 3300005366 Ga0070659_100722896 Ga0070659_1007228962 185
468 3300005367 Ga0070667_100062286 Ga0070667_1000622863 185
469 3300005434 Ga0070709_10175697 Ga0070709_101756972 185
470 3300005434 Ga0070709_10471830 Ga0070709_104718301 185
471 3300005436 Ga0070713_100359384 Ga0070713_1003593842 185
472 3300005437 Ga0070710_10099270 Ga0070710_100992702 185
473 3300005437 Ga0070710_10252981 Ga0070710_102529812 185
474 3300005437 Ga0070710_10462722 Ga0070710_104627222 185
475 3300005438 Ga0070701_10051111 Ga0070701_100511112 185
476 3300005439 Ga0070711_100007982 Ga0070711_1000079825 185
477 3300005441 Ga0070700_100029109 Ga0070700_1000291092 185
478 3300005455 Ga0070663_100002929 Ga0070663_10000292913 185
479 3300005455 Ga0070663_100031336 Ga0070663_1000313363 185
480 3300005455 Ga0070663_100039960 Ga0070663_1000399601 185
481 3300005455 Ga0070663_100078560 Ga0070663_1000785603 185
482 3300005455 Ga0070663_100616613 Ga0070663_1006166132 185
483 3300005455 Ga0070663_101042183 Ga0070663_1010421831 185
484 3300005456 Ga0070678_100048839 Ga0070678_1000488391 185
485 3300005456 Ga0070678_100169375 Ga0070678_1001693752 185
486 3300005456 Ga0070678_100410784 Ga0070678_1004107842 185
487 3300005457 Ga0070662_100028974 Ga0070662_1000289742 185
488 3300005457 Ga0070662_100045363 Ga0070662_1000453633 185
489 3300005457 Ga0070662_100217027 Ga0070662_1002170272 185
490 3300005458 Ga0070681_10036057 Ga0070681_100360573 185
491 3300005458 Ga0070681_10491334 Ga0070681_104913341 185
492 3300005458 Ga0070681_10699284 Ga0070681_106992841 185
493 3300005459 Ga0068867_100186194 Ga0068867_1001861942 185
494 3300005471 Ga0070698_100112992 Ga0070698_1001129923 185
495 3300005530 Ga0070679_100020404 Ga0070679_1000204043 185
496 3300005530 Ga0070679_100043395 Ga0070679_1000433953 185
497 3300005530 Ga0070679_100066920 Ga0070679_1000669203 185
498 3300005535 Ga0070684_100095276 Ga0070684_1000952763 185
499 3300005535 Ga0070684_100221335 Ga0070684_1002213352 185
500 3300005536 Ga0070697_100128010 Ga0070697_1001280102 185
501 3300005539 Ga0068853_100029364 Ga0068853_1000293643 185
502 3300005539 Ga0068853_100084664 Ga0068853_1000846643 185
503 3300005539 Ga0068853_100282325 Ga0068853_1002823251 185
504 3300005543 Ga0070672_100048601 Ga0070672_1000486012 185
505 3300005544 Ga0070686_100339296 Ga0070686_1003392962 185
506 3300005547 Ga0070693_100022866 Ga0070693_1000228664 185
507 3300005547 Ga0070693_100052550 Ga0070693_1000525503 185
508 3300005548 Ga0070665_100052300 Ga0070665_1000523004 185
509 3300005548 Ga0070665_100160319 Ga0070665_1001603192 185
510 3300005548 Ga0070665_100390460 Ga0070665_1003904602 185
511 3300005563 Ga0068855_100070167 Ga0068855_1000701673 185
512 3300005563 Ga0068855_100669825 Ga0068855_1006698252 185
513 3300005564 Ga0070664_100545762 Ga0070664_1005457622 185
514 3300005577 Ga0068857_100003351 Ga0068857_1000033512 185
515 3300005577 Ga0068857_100228560 Ga0068857_1002285602 185
516 3300005577 Ga0068857_100325994 Ga0068857_1003259942 185
517 3300005578 Ga0068854_100117469 Ga0068854_1001174692 185
518 3300005578 Ga0068854_100236089 Ga0068854_1002360892 185
519 3300005578 Ga0068854_100334583 Ga0068854_1003345832 185
520 3300005578 Ga0068854_100451257 Ga0068854_1004512572 185
521 3300005614 Ga0068856_100000082 Ga0068856_10000008269 185
522 3300005614 Ga0068856_100027659 Ga0068856_1000276594 185
523 3300005614 Ga0068856_100044548 Ga0068856_1000445483 185
524 3300005615 Ga0070702_100570022 Ga0070702_1005700221 185
525 3300005615 Ga0070702_100759358 Ga0070702_1007593582 185
526 3300005616 Ga0068852_100056294 Ga0068852_1000562942 185
527 3300005616 Ga0068852_100096821 Ga0068852_1000968212 185
528 3300005616 Ga0068852_100112587 Ga0068852_1001125872 185
529 3300005616 Ga0068852_100755725 Ga0068852_1007557252 185
530 3300005617 Ga0068859_100226342 Ga0068859_1002263422 185
531 3300005617 Ga0068859_100285421 Ga0068859_1002854212 185
532 3300005618 Ga0068864_100025302 Ga0068864_1000253024 185
533 3300005618 Ga0068864_100080894 Ga0068864_1000808942 185
534 3300005718 Ga0068866_10012084 Ga0068866_100120842 185
535 3300005718 Ga0068866_10137352 Ga0068866_101373522 185
536 3300005718 Ga0068866_10517967 Ga0068866_105179672 185
537 3300005719 Ga0068861_100135031 Ga0068861_1001350311 185
538 3300005834 Ga0068851_10249285 Ga0068851_102492851 185
539 3300005840 Ga0068870_10059157 Ga0068870_100591572 185
540 3300005841 Ga0068863_100714978 Ga0068863_1007149781 185
541 3300005841 Ga0068863_100946924 Ga0068863_1009469241 185
542 3300005842 Ga0068858_100121056 Ga0068858_1001210562 185
543 3300005843 Ga0068860_100173616 Ga0068860_1001736163 185
544 3300005843 Ga0068860_100643963 Ga0068860_1006439632 185
545 3300005844 Ga0068862_100053834 Ga0068862_1000538342 185
546 3300005844 Ga0068862_100152717 Ga0068862_1001527172 185
547 3300005844 Ga0068862_100502988 Ga0068862_1005029882 185
548 3300005937 Ga0081455_10220768 Ga0081455_102207682 185
549 3300005937 Ga0081455_10388858 Ga0081455_103888582 185
550 3300005983 Ga0081540_1002092 Ga0081540_10020929 185
551 3300005983 Ga0081540_1004102 Ga0081540_10041025 185
552 3300005983 Ga0081540_1004519 Ga0081540_100451913 185
553 3300005983 Ga0081540_1016640 Ga0081540_10166402 185
554 3300005983 Ga0081540_1056399 Ga0081540_10563992 185
555 3300005985 Ga0081539_10000273 Ga0081539_10000273109 185
556 3300005985 Ga0081539_10009974 Ga0081539_100099742 185
557 3300005985 Ga0081539_10084603 Ga0081539_100846032 185
558 3300006038 Ga0075365_10032588 Ga0075365_100325882 185
559 3300006038 Ga0075365_10033942 Ga0075365_100339423 185
560 3300006042 Ga0075368_10022328 Ga0075368_100223283 185
561 3300006048 Ga0075363_100039459 Ga0075363_1000394593 185
562 3300006048 Ga0075363_100245716 Ga0075363_1002457162 185
563 3300006051 Ga0075364_10026565 Ga0075364_100265653 185
564 3300006051 Ga0075364_10064370 Ga0075364_100643703 185
565 3300006175 Ga0070712_100007030 Ga0070712_1000070304 185
566 3300006175 Ga0070712_100048117 Ga0070712_1000481172 185
567 3300006178 Ga0075367_10033118 Ga0075367_100331184 185
568 3300006178 Ga0075367_10067366 Ga0075367_100673663 185
569 3300006178 Ga0075367_10070568 Ga0075367_100705682 185
570 3300006186 Ga0075369_10194898 Ga0075369_101948982 185
571 3300006195 Ga0075366_10189891 Ga0075366_101898912 185
572 3300006237 Ga0097621_100083061 Ga0097621_1000830613 185
573 3300006353 Ga0075370_10017192 Ga0075370_100171922 185
574 3300006353 Ga0075370_10052063 Ga0075370_100520632 185
575 3300006358 Ga0068871_100304142 Ga0068871_1003041422 185
576 3300006844 Ga0075428_100174800 Ga0075428_1001748002 185
577 3300006844 Ga0075428_100263228 Ga0075428_1002632281 185
578 3300006871 Ga0075434_100203577 Ga0075434_1002035772 185
579 3300006881 Ga0068865_100507280 Ga0068865_1005072801 185
580 3300006931 Ga0097620_100226341 Ga0097620_1002263412 185
581 3300006931 Ga0097620_100285417 Ga0097620_1002854172 185
582 3300006931 Ga0097620_100438716 Ga0097620_1004387162 185
583 3300007265 Ga0099794_10008554 Ga0099794_100085544 185
584 3300007788 Ga0099795_10009675 Ga0099795_100096752 185
585 3300007788 Ga0099795_10029973 Ga0099795_100299733 185
586 3300009093 Ga0105240_10007507 Ga0105240_100075076 185
587 3300009093 Ga0105240_10050611 Ga0105240_100506113 185
588 3300009093 Ga0105240_10095181 Ga0105240_100951813 185
589 3300009094 Ga0111539_10136421 Ga0111539_101364213 185
590 3300009101 Ga0105247_10016251 Ga0105247_100162514 185
591 3300009101 Ga0105247_10235465 Ga0105247_102354652 185
592 3300009101 Ga0105247_10367823 Ga0105247_103678232 185
593 3300009147 Ga0114129_10064849 Ga0114129_100648494 185
594 3300009148 Ga0105243_10027582 Ga0105243_100275824 185
595 3300009148 Ga0105243_10196369 Ga0105243_101963693 185
596 3300009148 Ga0105243_10946454 Ga0105243_109464542 185
597 3300009174 Ga0105241_10010606 Ga0105241_100106062 185
598 3300009174 Ga0105241_10032329 Ga0105241_100323294 185
599 3300009174 Ga0105241_10041152 Ga0105241_100411523 185
600 3300009174 Ga0105241_10219524 Ga0105241_102195242 185
601 3300009176 Ga0105242_10125087 Ga0105242_101250873 185
602 3300009177 Ga0105248_10223621 Ga0105248_102236213 185
603 3300009177 Ga0105248_10238890 Ga0105248_102388902 185
604 3300009177 Ga0105248_10478146 Ga0105248_104781463 185
605 3300009177 Ga0105248_10546523 Ga0105248_105465232 185
606 3300009177 Ga0105248_11203018 Ga0105248_112030182 185
607 3300009545 Ga0105237_10052204 Ga0105237_100522043 185
608 3300009545 Ga0105237_10124318 Ga0105237_101243183 185
609 3300009545 Ga0105237_10250559 Ga0105237_102505593 185
610 3300009545 Ga0105237_10262981 Ga0105237_102629812 185
611 3300009545 Ga0105237_10475461 Ga0105237_104754612 185
612 3300009551 Ga0105238_10027110 Ga0105238_100271104 185
613 3300009551 Ga0105238_10205293 Ga0105238_102052932 185
614 3300009553 Ga0105249_10241385 Ga0105249_102413853 185
615 3300010159 Ga0099796_10002843 Ga0099796_100028433 185
616 3300010159 Ga0099796_10262689 Ga0099796_102626892 185
617 3300010375 Ga0105239_10016782 Ga0105239_100167823 185
618 3300010375 Ga0105239_10043449 Ga0105239_100434493 185
619 3300010375 Ga0105239_10214770 Ga0105239_102147702 185
620 3300010375 Ga0105239_10272943 Ga0105239_102729432 185
621 3300010375 Ga0105239_10280590 Ga0105239_102805902 185
622 3300013102 Ga0157371_10103344 Ga0157371_101033442 185
623 3300013105 Ga0157369_10003890 Ga0157369_1000389022 185
624 3300013105 Ga0157369_10160692 Ga0157369_101606922 185
625 3300013296 Ga0157374_10595416 Ga0157374_105954162 185
626 3300013297 Ga0157378_10043554 Ga0157378_100435544 185
627 3300013297 Ga0157378_10052830 Ga0157378_100528303 185
628 3300013297 Ga0157378_10493435 Ga0157378_104934352 185
629 3300013297 Ga0157378_10840866 Ga0157378_108408662 185
630 3300013306 Ga0163162_10003676 Ga0163162_1000367613 185
631 3300013306 Ga0163162_10100717 Ga0163162_101007174 185
632 3300013306 Ga0163162_10529953 Ga0163162_105299532 185
633 3300013306 Ga0163162_10635620 Ga0163162_106356201 185
634 3300013307 Ga0157372_10093100 Ga0157372_100931003 185
635 3300013307 Ga0157372_10221124 Ga0157372_102211243 185
636 3300013308 Ga0157375_10336630 Ga0157375_103366302 185
637 3300013308 Ga0157375_11329358 Ga0157375_113293581 185
638 3300013308 Ga0157375_11654959 Ga0157375_116549592 185
639 3300014325 Ga0163163_10144284 Ga0163163_101442842 185
640 3300014326 Ga0157380_10447494 Ga0157380_104474941 185
641 3300014745 Ga0157377_10144231 Ga0157377_101442312 185
642 3300014968 Ga0157379_10075745 Ga0157379_100757454 185
643 3300014969 Ga0157376_10013748 Ga0157376_100137482 185
644 3300017792 Ga0163161_10382935 Ga0163161_103829352 185
645 3300020082 Ga0206353_11059723 Ga0206353_110597232 185
646 3300021384 Ga0213876_10183644 Ga0213876_101836442 185
647 3300021388 Ga0213875_10024351 Ga0213875_100243512 185
648 3300025261 Ga0209233_1002573 Ga0209233_10025733 185
649 3300025297 Ga0209758_1036773 Ga0209758_10367731 185
650 3300025315 Ga0207697_10007446 Ga0207697_100074465 185
651 3300025321 Ga0207656_10016121 Ga0207656_100161212 185
652 3300025321 Ga0207656_10034050 Ga0207656_100340502 185
653 3300025898 Ga0207692_10092661 Ga0207692_100926611 185
654 3300025898 Ga0207692_10180757 Ga0207692_101807572 185
655 3300025898 Ga0207692_10332900 Ga0207692_103329002 185
656 3300025899 Ga0207642_10415068 Ga0207642_104150682 185
657 3300025900 Ga0207710_10030090 Ga0207710_100300902 185
658 3300025900 Ga0207710_10166674 Ga0207710_101666742 185
659 3300025901 Ga0207688_10063847 Ga0207688_100638472 185
660 3300025901 Ga0207688_10088380 Ga0207688_100883802 185
661 3300025903 Ga0207680_10389013 Ga0207680_103890131 185
662 3300025904 Ga0207647_10073492 Ga0207647_100734921 185
663 3300025906 Ga0207699_10065182 Ga0207699_100651823 185
664 3300025907 Ga0207645_10144718 Ga0207645_101447182 185
665 3300025907 Ga0207645_10212347 Ga0207645_102123471 185
666 3300025908 Ga0207643_10037354 Ga0207643_100373542 185
667 3300025909 Ga0207705_10492075 Ga0207705_104920751 185
668 3300025910 Ga0207684_10517856 Ga0207684_105178562 185
669 3300025911 Ga0207654_10011369 Ga0207654_100113693 185
670 3300025911 Ga0207654_10012520 Ga0207654_100125205 185
671 3300025912 Ga0207707_10002249 Ga0207707_100022495 185
672 3300025912 Ga0207707_10245836 Ga0207707_102458362 185
673 3300025913 Ga0207695_10139649 Ga0207695_101396493 185
674 3300025913 Ga0207695_10187481 Ga0207695_101874813 185
675 3300025913 Ga0207695_10193093 Ga0207695_101930933 185
676 3300025914 Ga0207671_10040002 Ga0207671_100400023 185
677 3300025914 Ga0207671_10078202 Ga0207671_100782022 185
678 3300025914 Ga0207671_10166173 Ga0207671_101661732 185
679 3300025914 Ga0207671_10320000 Ga0207671_103200002 185
680 3300025915 Ga0207693_10022609 Ga0207693_100226092 185
681 3300025915 Ga0207693_10200987 Ga0207693_102009872 185
682 3300025916 Ga0207663_10099139 Ga0207663_100991392 185
683 3300025917 Ga0207660_10046822 Ga0207660_100468223 185
684 3300025917 Ga0207660_10107578 Ga0207660_101075782 185
685 3300025919 Ga0207657_10007732 Ga0207657_100077327 185
686 3300025919 Ga0207657_10069057 Ga0207657_100690572 185
687 3300025919 Ga0207657_10159573 Ga0207657_101595733 185
688 3300025921 Ga0207652_10121286 Ga0207652_101212862 185
689 3300025921 Ga0207652_10806909 Ga0207652_108069092 185
690 3300025924 Ga0207694_10157408 Ga0207694_101574082 185
691 3300025924 Ga0207694_10310874 Ga0207694_103108742 185
692 3300025927 Ga0207687_10035364 Ga0207687_100353643 185
693 3300025927 Ga0207687_10092287 Ga0207687_100922872 185
694 3300025929 Ga0207664_10527674 Ga0207664_105276742 185
695 3300025931 Ga0207644_10242514 Ga0207644_102425142 185
696 3300025931 Ga0207644_10287687 Ga0207644_102876872 185
697 3300025931 Ga0207644_10480571 Ga0207644_104805711 185
698 3300025932 Ga0207690_10025604 Ga0207690_100256043 185
699 3300025932 Ga0207690_10218753 Ga0207690_102187532 185
700 3300025932 Ga0207690_10727909 Ga0207690_107279092 185
701 3300025933 Ga0207706_10042603 Ga0207706_100426033 185
702 3300025933 Ga0207706_10067659 Ga0207706_100676592 185
703 3300025933 Ga0207706_10091791 Ga0207706_100917913 185
704 3300025934 Ga0207686_10049830 Ga0207686_100498302 185
705 3300025935 Ga0207709_10145504 Ga0207709_101455041 185
706 3300025935 Ga0207709_10708284 Ga0207709_107082842 185
707 3300025936 Ga0207670_10489586 Ga0207670_104895861 185
708 3300025937 Ga0207669_10852329 Ga0207669_108523291 185
709 3300025938 Ga0207704_10143682 Ga0207704_101436822 185
710 3300025939 Ga0207665_10240753 Ga0207665_102407532 185
711 3300025939 Ga0207665_10592992 Ga0207665_105929922 185
712 3300025940 Ga0207691_10026804 Ga0207691_100268044 185
713 3300025940 Ga0207691_10252104 Ga0207691_102521042 185
714 3300025941 Ga0207711_10032973 Ga0207711_100329733 185
715 3300025941 Ga0207711_10277232 Ga0207711_102772322 185
716 3300025942 Ga0207689_10016101 Ga0207689_100161013 185
717 3300025942 Ga0207689_10032079 Ga0207689_100320792 185
718 3300025942 Ga0207689_10282952 Ga0207689_102829522 185
719 3300025944 Ga0207661_10056472 Ga0207661_100564722 185
720 3300025944 Ga0207661_10138341 Ga0207661_101383412 185
721 3300025945 Ga0207679_10406243 Ga0207679_104062432 185
722 3300025949 Ga0207667_10078922 Ga0207667_100789222 185
723 3300025949 Ga0207667_10124426 Ga0207667_101244261 185
724 3300025949 Ga0207667_10373265 Ga0207667_103732653 185
725 3300025960 Ga0207651_10194943 Ga0207651_101949432 185
726 3300025960 Ga0207651_10259520 Ga0207651_102595203 185
727 3300025961 Ga0207712_10143860 Ga0207712_101438602 185
728 3300025972 Ga0207668_10251943 Ga0207668_102519432 185
729 3300025972 Ga0207668_10296081 Ga0207668_102960812 185
730 3300025972 Ga0207668_10661205 Ga0207668_106612051 185
731 3300025981 Ga0207640_10108236 Ga0207640_101082363 185
732 3300025981 Ga0207640_10208305 Ga0207640_102083052 185
733 3300025981 Ga0207640_10263763 Ga0207640_102637631 185
734 3300025981 Ga0207640_11201095 Ga0207640_112010952 185
735 3300025986 Ga0207658_10075699 Ga0207658_100756993 185
736 3300026023 Ga0207677_10040296 Ga0207677_100402964 185
737 3300026023 Ga0207677_10081207 Ga0207677_100812073 185
738 3300026023 Ga0207677_10227651 Ga0207677_102276512 185
739 3300026035 Ga0207703_10025797 Ga0207703_100257973 185
740 3300026041 Ga0207639_10088194 Ga0207639_100881942 185
741 3300026041 Ga0207639_10317014 Ga0207639_103170142 185
742 3300026067 Ga0207678_10026492 Ga0207678_100264923 185
743 3300026067 Ga0207678_10028300 Ga0207678_100283003 185
744 3300026067 Ga0207678_10075795 Ga0207678_100757953 185
745 3300026067 Ga0207678_10264852 Ga0207678_102648521 185
746 3300026067 Ga0207678_10293294 Ga0207678_102932942 185
747 3300026078 Ga0207702_10000048 Ga0207702_1000004864 185
748 3300026078 Ga0207702_10003315 Ga0207702_100033153 185
749 3300026078 Ga0207702_10345601 Ga0207702_103456012 185
750 3300026078 Ga0207702_10445797 Ga0207702_104457972 185
751 3300026089 Ga0207648_10016066 Ga0207648_100160662 185
752 3300026095 Ga0207676_10307804 Ga0207676_103078042 185
753 3300026116 Ga0207674_10005787 Ga0207674_1000578718 185
754 3300026116 Ga0207674_10033065 Ga0207674_100330653 185
755 3300026116 Ga0207674_10060928 Ga0207674_100609282 185
756 3300026116 Ga0207674_10238357 Ga0207674_102383572 185
757 3300026118 Ga0207675_100262760 Ga0207675_1002627601 185
758 3300026121 Ga0207683_10016292 Ga0207683_100162925 185
759 3300026121 Ga0207683_10067330 Ga0207683_100673302 185
760 3300026121 Ga0207683_10082790 Ga0207683_100827902 185
761 3300026121 Ga0207683_10107128 Ga0207683_101071282 185
762 3300026121 Ga0207683_10322542 Ga0207683_103225422 185
763 3300026142 Ga0207698_10069860 Ga0207698_100698602 185
764 3300026142 Ga0207698_10083649 Ga0207698_100836493 185
765 3300026142 Ga0207698_10151503 Ga0207698_101515032 185
766 3300026142 Ga0207698_10713644 Ga0207698_107136441 185
767 3300027512 Ga0209179_1011432 Ga0209179_10114323 185
768 3300027907 Ga0207428_10069972 Ga0207428_100699723 185
769 3300028379 Ga0268266_10004442 Ga0268266_1000444214 185
770 3300028379 Ga0268266_10126879 Ga0268266_101268793 185
771 3300028379 Ga0268266_10209865 Ga0268266_102098652 185
772 3300028380 Ga0268265_10071618 Ga0268265_100716183 185
773 3300028380 Ga0268265_10162624 Ga0268265_101626242 185
774 3300028380 Ga0268265_10485260 Ga0268265_104852602 185
775 3300028380 Ga0268265_11081574 Ga0268265_110815742 185
776 3300028381 Ga0268264_10000022 Ga0268264_10000022464 185
777 3300028381 Ga0268264_10177357 Ga0268264_101773571 185
778 3300028573 Ga0265334_10000447 Ga0265334_100004477 185
779 3300028577 Ga0265318_10195061 Ga0265318_101950612 185
780 3300028666 Ga0265336_10000686 Ga0265336_100006863 185
781 3300028786 Ga0307517_10226476 Ga0307517_102264762 185
782 3300030521 Ga0307511_10056903 Ga0307511_100569033 185
783 3300031235 Ga0265330_10013362 Ga0265330_100133622 185
784 3300031235 Ga0265330_10015725 Ga0265330_100157254 185
785 3300031241 Ga0265325_10038531 Ga0265325_100385313 185
786 3300031242 Ga0265329_10114475 Ga0265329_101144752 185
787 3300031247 Ga0265340_10007187 Ga0265340_100071876 185
788 3300031249 Ga0265339_10046894 Ga0265339_100468943 185
789 3300031249 Ga0265339_10210956 Ga0265339_102109561 185
790 3300031250 Ga0265331_10039137 Ga0265331_100391373 185
791 3300031344 Ga0265316_10397287 Ga0265316_103972872 185
792 3300031344 Ga0265316_10511624 Ga0265316_105116242 185
793 3300031456 Ga0307513_10166927 Ga0307513_101669272 185
794 3300031548 Ga0307408_100160361 Ga0307408_1001603612 185
795 3300031616 Ga0307508_10047463 Ga0307508_100474632 185
796 3300031616 Ga0307508_10096367 Ga0307508_100963672 185
797 3300031712 Ga0265342_10080887 Ga0265342_100808872 185
798 3300031712 Ga0265342_10094370 Ga0265342_100943702 185
799 3300031712 Ga0265342_10157414 Ga0265342_101574142 185
800 3300031730 Ga0307516_10058764 Ga0307516_100587642 185
801 3300031852 Ga0307410_10273312 Ga0307410_102733122 185
802 3300031852 Ga0307410_10692832 Ga0307410_106928322 185
803 3300033180 Ga0307510_10213579 Ga0307510_102135792 185
804 3300033442 Ga0315911_1000001 Ga0315911_100000178 185
805 3300035083 Ga0373926_0031879 Ga0373926_0031879_1073_1630 185
806 3300035086 Ga0373934_0011895 Ga0373934_0011895_287_844 185
807 3300035086 Ga0373934_0017581 Ga0373934_0017581_1664_2233 185
808 3300035111 Ga0373923_0002332 Ga0373923_0002332_2464_3033 185
809 3300035111 Ga0373923_0015548 Ga0373923_0015548_226_783 185
810 3300035112 Ga0373932_0033968 Ga0373932_0033968_744_1301 185
811 3300035113 Ga0373936_0026082 Ga0373936_0026082_541_1098 185
812 3300035113 Ga0373936_0049360 Ga0373936_0049360_311_868 185
813 3300035117 Ga0373953_0000473 Ga0373953_0000473_5064_5633 185
814 3300035117 Ga0373953_0128326 Ga0373953_0128326_461_1018 185
815 3300035118 Ga0373954_0000442 Ga0373954_0000442_6511_7080 185
816 3300035119 Ga0373956_0001159 Ga0373956_0001159_861_1430 185
817 3300035119 Ga0373956_0025732 Ga0373956_0025732_1183_1740 185
818 3300035120 Ga0373957_0000837 Ga0373957_0000837_4173_4742 185
819 3300035170 Ga0373943_0035787 Ga0373943_0035787_1373_1930 185
820 3300035171 Ga0373946_0276641 Ga0373946_0276641_129_692 185
821 3300035172 Ga0373955_0000840 Ga0373955_0000840_1833_2402 185
822 3300035172 Ga0373955_0019884 Ga0373955_0019884_733_1293 185
823 3300035172 Ga0373955_0149633 Ga0373955_0149633_229_786 185
824 3300035172 Ga0373955_0282791 Ga0373955_0282791_399_971 185
825 3300035242 Ga0373962_0045346 Ga0373962_0045346_568_1125 185
826 3300035410 Ga0373924_0138901 Ga0373924_0138901_389_958 185
827 3300035691 Ga0373931_0143286 Ga0373931_0143286_803_1360 185
828 3300035692 Ga0373935_0108638 Ga0373935_0108638_577_1134 185
829 3300035695 Ga0373927_0010992 Ga0373927_0010992_1781_2353 185
830 3300035695 Ga0373927_0039434 Ga0373927_0039434_102_659 185
831 3300035695 Ga0373927_0322953 Ga0373927_0322953_102_659 185
832 3300035695 Ga0373927_0452385 Ga0373927_0452385_30_587 185
833 3300035724 Ga0373933_0000041 Ga0373933_0000041_27892_28449 185
834 3300035724 Ga0373933_0012552 Ga0373933_0012552_2202_2771 185
835 3300035724 Ga0373933_0039675 Ga0373933_0039675_778_1335 185
836 3300035725 Ga0373947_0015464 Ga0373947_0015464_1073_1630 185
837 3300035725 Ga0373947_0029904 Ga0373947_0029904_1820_2401 185
838 3300035725 Ga0373947_0059844 Ga0373947_0059844_23_580 185
839 3300035725 Ga0373947_0241622 Ga0373947_0241622_298_855 185
840 3300036401 Ga0373937_0014572 Ga0373937_0014572_5179_5748 185
841 3300037068 Ga0373925_0013749 Ga0373925_0013749_2401_2973 185
842 3300037068 Ga0373925_0207070 Ga0373925_0207070_148_705 185
843 3300037418 Ga0395900_0071894 Ga0395900_0071894_631_1188 185
844 3300037418 Ga0395900_0123379 Ga0395900_0123379_790_1347 185
845 3300037418 Ga0395900_0510520 Ga0395900_0510520_402_959 185
846 3300037466 Ga0395898_0072896 Ga0395898_0072896_1591_2148 185
847 3300037466 Ga0395898_0185817 Ga0395898_0185817_851_1411 185
848 3300037466 Ga0395898_0461098 Ga0395898_0461098_532_1089 185
849 3300037466 Ga0395898_0501886 Ga0395898_0501886_290_847 185
850 3300037471 Ga0395905_0104806 Ga0395905_0104806_202_762 185
851 3300037471 Ga0395905_0361255 Ga0395905_0361255_475_1032 185
852 3300037853 Ga0436364_0294722 Ga0436364_0294722_1487_2044 185
853 3300038443 Ga0395901_0190304 Ga0395901_0190304_260_817 185
854 3300038443 Ga0395901_0608874 Ga0395901_0608874_215_778 185
855 3300038443 Ga0395901_0813583 Ga0395901_0813583_311_868 185
856 3300039437 Ga0436365_0038677 Ga0436365_0038677_176_733 185
857 3300039437 Ga0436365_0328412 Ga0436365_0328412_72_629 185
858 3300039437 Ga0436365_0400158 Ga0436365_0400158_176_733 185
859 3300041459 Ga0451800_0619150 Ga0451800_0619150_708_1268 185
860 3300041463 Ga0451804_0741096 Ga0451804_0741096_196_771 185
861 3300041512 Ga0451853_0411756 Ga0451853_0411756_42_602 185
862 3300042157 Ga0439458_0054032 Ga0439458_0054032_141_698 185
863 3300042438 Ga0439459_0004969 Ga0439459_0004969_1238_1795 185
864 3300044684 Ga0466966_0172332 Ga0466966_0172332_619_1176 185
865 3300045976 Ga0466967_0195962 Ga0466967_0195962_669_1226 185
866 3300046454 Ga0495592_0028166 Ga0495592_0028166_1598_2167 185
867 3300046455 Ga0495603_0114512 Ga0495603_0114512_533_1096 185
868 3300046457 Ga0495590_0035303 Ga0495590_0035303_64_621 185
869 3300046459 Ga0495629_0008864 Ga0495629_0008864_5076_5645 185
870 3300046459 Ga0495629_0048589 Ga0495629_0048589_1954_2511 185
871 3300046460 Ga0495638_0188903 Ga0495638_0188903_130_693 185
872 3300046462 Ga0495651_0026680 Ga0495651_0026680_2039_2608 185
873 3300046462 Ga0495651_0186619 Ga0495651_0186619_154_711 185
874 3300046463 Ga0495653_0035279 Ga0495653_0035279_1979_2548 185
875 3300046472 Ga0495580_0015247 Ga0495580_0015247_4072_4629 185
876 3300046472 Ga0495580_0182066 Ga0495580_0182066_399_962 185
877 3300046473 Ga0495582_0004844 Ga0495582_0004844_776_1333 185
878 3300046474 Ga0495605_0019743 Ga0495605_0019743_361_918 185
879 3300046477 Ga0495664_0041604 Ga0495664_0041604_525_1082 185
880 3300046491 Ga0495584_0138605 Ga0495584_0138605_592_1149 185
881 3300046491 Ga0495584_0389390 Ga0495584_0389390_23_580 185
882 3300046492 Ga0495585_0281270 Ga0495585_0281270_112_675 185
883 3300046499 Ga0495594_0159685 Ga0495594_0159685_28_591 185
884 3300046500 Ga0495596_0066028 Ga0495596_0066028_332_889 185
885 3300046501 Ga0495607_0008614 Ga0495607_0008614_2671_3228 185
886 3300046506 Ga0495583_0064074 Ga0495583_0064074_567_1124 185
887 3300046507 Ga0495606_0008403 Ga0495606_0008403_7825_8394 185
888 3300046507 Ga0495606_0231593 Ga0495606_0231593_273_848 185
889 3300046511 Ga0495608_0005163 Ga0495608_0005163_6469_7038 185
890 3300046511 Ga0495608_0148048 Ga0495608_0148048_487_1044 185
891 3300046513 Ga0495616_0028143 Ga0495616_0028143_2049_2606 185
892 3300046514 Ga0495618_0072535 Ga0495618_0072535_514_1071 185
893 3300046514 Ga0495618_0553698 Ga0495618_0553698_23_592 185
894 3300046515 Ga0495620_0038328 Ga0495620_0038328_596_1153 185
895 3300046515 Ga0495620_0077187 Ga0495620_0077187_675_1232 185
896 3300046516 Ga0495628_0029777 Ga0495628_0029777_1330_1887 185
897 3300046516 Ga0495628_0224556 Ga0495628_0224556_349_918 185
898 3300046517 Ga0495630_0049692 Ga0495630_0049692_437_994 185
899 3300046519 Ga0495632_0023259 Ga0495632_0023259_2303_2860 185
900 3300046520 Ga0495637_0086262 Ga0495637_0086262_597_1154 185
901 3300046520 Ga0495637_0185095 Ga0495637_0185095_92_649 185
902 3300046522 Ga0495643_0071150 Ga0495643_0071150_321_878 185
903 3300046524 Ga0495648_0132614 Ga0495648_0132614_635_1192 185
904 3300046524 Ga0495648_0312598 Ga0495648_0312598_146_703 185
905 3300046525 Ga0495663_0080059 Ga0495663_0080059_126_689 185
906 3300046526 Ga0495666_0062260 Ga0495666_0062260_528_1085 185
907 3300046528 Ga0495642_0133298 Ga0495642_0133298_484_1041 185
908 3300046529 Ga0495652_0002339 Ga0495652_0002339_5386_5955 185
909 3300046529 Ga0495652_0071585 Ga0495652_0071585_341_898 185
910 3300046529 Ga0495652_0073700 Ga0495652_0073700_2060_2617 185
911 3300046530 Ga0495654_0013864 Ga0495654_0013864_3020_3577 185
912 3300046533 Ga0495640_0020781 Ga0495640_0020781_747_1316 185
913 3300046535 Ga0495586_0060362 Ga0495586_0060362_1048_1605 185
914 3300046536 Ga0495587_0033793 Ga0495587_0033793_1705_2274 185
915 3300046536 Ga0495587_0156726 Ga0495587_0156726_623_1180 185
916 3300046537 Ga0495598_0074485 Ga0495598_0074485_471_1034 185
917 3300046538 Ga0495609_0203335 Ga0495609_0203335_149_706 185
918 3300046539 Ga0495621_0018331 Ga0495621_0018331_1105_1668 185
919 3300046542 Ga0495597_0045099 Ga0495597_0045099_1005_1562 185
920 3300046543 Ga0495645_0268065 Ga0495645_0268065_145_702 185
921 3300046558 Ga0495633_0039118 Ga0495633_0039118_462_1019 185
922 3300046559 Ga0495667_0001528 Ga0495667_0001528_10137_10706 185
923 3300046559 Ga0495667_0481556 Ga0495667_0481556_166_723 185
924 3300046615 Ga0495656_0016790 Ga0495656_0016790_1961_2524 185
925 3300046616 Ga0495668_0051022 Ga0495668_0051022_994_1551 185
926 3300046616 Ga0495668_0067929 Ga0495668_0067929_122_679 185
927 3300046616 Ga0495668_0300501 Ga0495668_0300501_221_778 185
928 3300046642 Ga0495634_0002573 Ga0495634_0002573_1606_2175 185
929 3300046642 Ga0495634_0028503 Ga0495634_0028503_1053_1610 185
930 3300046648 Ga0495611_0178333 Ga0495611_0178333_157_714 185
931 3300046660 Ga0495625_0129082 Ga0495625_0129082_1060_1617 185
932 3300046663 Ga0495635_0001091 Ga0495635_0001091_4511_5080 185
933 3300046664 Ga0495659_0056519 Ga0495659_0056519_680_1243 185
934 3300046665 Ga0495661_0441980 Ga0495661_0441980_18_581 185
935 3300046674 Ga0495588_0001370 Ga0495588_0001370_8666_9229 185
936 3300046675 Ga0495657_0016934 Ga0495657_0016934_4282_4851 185
937 3300046675 Ga0495657_0194216 Ga0495657_0194216_436_993 185
938 3300046675 Ga0495657_0279754 Ga0495657_0279754_318_884 185
939 3300046678 Ga0495599_0002320 Ga0495599_0002320_9997_10566 185
940 3300046679 Ga0495623_0019613 Ga0495623_0019613_1911_2480 185
941 3300046679 Ga0495623_0386319 Ga0495623_0386319_101_658 185
942 3300046680 Ga0495646_0005680 Ga0495646_0005680_5594_6163 185
943 3300046680 Ga0495646_0079508 Ga0495646_0079508_349_906 185
944 3300046681 Ga0495647_0012606 Ga0495647_0012606_548_1105 185
945 3300046683 Ga0495658_0005658 Ga0495658_0005658_4480_5037 185
946 3300046683 Ga0495658_0435843 Ga0495658_0435843_172_738 185
947 3300046684 Ga0495669_0048629 Ga0495669_0048629_799_1356 185
948 3300046689 Ga0495613_0023851 Ga0495613_0023851_681_1250 185
949 3300046689 Ga0495613_0165019 Ga0495613_0165019_553_1110 185
950 3300046689 Ga0495613_0361916 Ga0495613_0361916_179_736 185
951 3300046691 Ga0495670_0006136 Ga0495670_0006136_4809_5366 185
952 3300046692 Ga0495671_0151030 Ga0495671_0151030_163_726 185
953 3300046794 Ga0495589_0144441 Ga0495589_0144441_454_1011 185
954 3300046809 Ga0495600_0002218 Ga0495600_0002218_4282_4851 185
955 3300046809 Ga0495600_0048611 Ga0495600_0048611_1823_2380 185
956 3300046810 Ga0495660_0211719 Ga0495660_0211719_96_653 185
957 3300046810 Ga0495660_0280765 Ga0495660_0280765_49_606 185
958 3300047315 Ga0495581_0016629 Ga0495581_0016629_716_1273 185
959 3300047315 Ga0495581_0196590 Ga0495581_0196590_535_1104 185
960 3300047317 Ga0495604_0393309 Ga0495604_0393309_70_627 185
961 3300047318 Ga0495636_0083176 Ga0495636_0083176_694_1257 185
962 3300047319 Ga0495674_0007800 Ga0495674_0007800_3976_4533 185
963 3300047319 Ga0495674_0051843 Ga0495674_0051843_1832_2401 185
964 3300047320 Ga0495672_0272082 Ga0495672_0272082_38_595 185
965 3300047321 Ga0495676_0034176 Ga0495676_0034176_3208_3771 185
966 3300047322 Ga0495680_0005405 Ga0495680_0005405_10137_10706 185
967 3300047444 Ga0495675_0038736 Ga0495675_0038736_575_1144 185
968 3300047444 Ga0495675_0256419 Ga0495675_0256419_127_684 185
969 3300047445 Ga0495677_0056687 Ga0495677_0056687_244_807 185
970 3300047445 Ga0495677_0112036 Ga0495677_0112036_214_771 185
971 3300047471 Ga0495684_0001482 Ga0495684_0001482_4979_5548 185
972 3300047471 Ga0495684_0097309 Ga0495684_0097309_768_1325 185
973 3300047472 Ga0495686_0011245 Ga0495686_0011245_2406_2963 185
974 3300047472 Ga0495686_0086992 Ga0495686_0086992_260_817 185
975 3300047673 Ga0495593_0026677 Ga0495593_0026677_1198_1755 185
976 3300047673 Ga0495593_0070853 Ga0495593_0070853_887_1456 185
977 3300048088 Ga0495602_0068925 Ga0495602_0068925_1892_2461 185
978 3300048088 Ga0495602_0349615 Ga0495602_0349615_458_1024 185
979 3300048091 Ga0495626_0111386 Ga0495626_0111386_83_640 185
980 3300048903 Ga0496100_0002635 Ga0496100_0002635_2438_2995 185
981 3300048903 Ga0496100_0245834 Ga0496100_0245834_500_1057 185
982 3300048903 Ga0496100_0664093 Ga0496100_0664093_96_653 185
983 3300048904 Ga0496101_0043040 Ga0496101_0043040_121_678 185
984 3300048904 Ga0496101_0163644 Ga0496101_0163644_739_1296 185
985 3300048904 Ga0496101_0554973 Ga0496101_0554973_102_659 185
986 3300048905 Ga0496102_0003268 Ga0496102_0003268_10141_10698 185
987 3300048905 Ga0496102_0097762 Ga0496102_0097762_2101_2658 185
988 3300048905 Ga0496102_0204326 Ga0496102_0204326_478_1062 185
989 3300048905 Ga0496102_0306661 Ga0496102_0306661_822_1379 185
990 3300048905 Ga0496102_0324465 Ga0496102_0324465_795_1352 185
991 3300048905 Ga0496102_0334889 Ga0496102_0334889_203_760 185
992 3300048905 Ga0496102_0505834 Ga0496102_0505834_192_749 185
993 3300048905 Ga0496102_0564602 Ga0496102_0564602_236_793 185
994 3300048906 Ga0496103_0011931 Ga0496103_0011931_2601_3158 185
995 3300048906 Ga0496103_0090433 Ga0496103_0090433_1249_1806 185
996 3300048907 Ga0496104_0016540 Ga0496104_0016540_5143_5700 185
997 3300048907 Ga0496104_0089038 Ga0496104_0089038_1890_2474 185
998 3300048907 Ga0496104_0926928 Ga0496104_0926928_170_727 185
999 3300048908 Ga0496105_0027843 Ga0496105_0027843_2655_3212 185
1000 3300048909 Ga0496106_0000477 Ga0496106_0000477_1302_1874 185
1001 3300048909 Ga0496106_0027131 Ga0496106_0027131_2415_2972 185
1002 3300048909 Ga0496106_0042197 Ga0496106_0042197_306_863 185
1003 3300048909 Ga0496106_0065167 Ga0496106_0065167_242_799 185
1004 3300048909 Ga0496106_0207349 Ga0496106_0207349_148_705 185
1005 3300048910 Ga0496107_0002282 Ga0496107_0002282_8892_9449 185
1006 3300048910 Ga0496107_0105014 Ga0496107_0105014_673_1230 185
1007 3300048910 Ga0496107_0434291 Ga0496107_0434291_324_881 185
1008 3300048911 Ga0496108_0015096 Ga0496108_0015096_4731_5288 185
1009 3300048911 Ga0496108_0371059 Ga0496108_0371059_672_1229 185
1010 3300048911 Ga0496108_0517281 Ga0496108_0517281_428_985 185
1011 3300048912 Ga0496109_0103827 Ga0496109_0103827_1442_1999 185
1012 3300048912 Ga0496109_0230541 Ga0496109_0230541_149_733 185
1013 3300048912 Ga0496109_0360581 Ga0496109_0360581_561_1118 185
1014 3300048913 Ga0496110_0010493 Ga0496110_0010493_474_1031 185
1015 3300048913 Ga0496110_0079042 Ga0496110_0079042_2258_2815 185
1016 3300048913 Ga0496110_0151390 Ga0496110_0151390_1340_1897 185
1017 3300048914 Ga0496111_0150239 Ga0496111_0150239_853_1419 185
1018 3300048914 Ga0496111_0429867 Ga0496111_0429867_32_589 185
1019 3300048915 Ga0496112_0023640 Ga0496112_0023640_1387_1944 185
1020 3300048915 Ga0496112_0155738 Ga0496112_0155738_1420_1977 185
1021 3300048915 Ga0496112_0214871 Ga0496112_0214871_773_1357 185
1022 3300048916 Ga0496113_0012966 Ga0496113_0012966_2720_3277 185
1023 3300048916 Ga0496113_0064609 Ga0496113_0064609_865_1422 185
1024 3300048917 Ga0496114_0020349 Ga0496114_0020349_1934_2491 185
1025 3300048917 Ga0496114_0460686 Ga0496114_0460686_169_726 185
1026 3300048918 Ga0496115_0001335 Ga0496115_0001335_6788_7345 185
1027 3300048918 Ga0496115_0013365 Ga0496115_0013365_4715_5299 185
1028 3300048918 Ga0496115_0217884 Ga0496115_0217884_825_1382 185
1029 3300048918 Ga0496115_1086964 Ga0496115_1086964_10_567 185
1030 3300048919 Ga0496116_0001763 Ga0496116_0001763_14773_15330 185
1031 3300048919 Ga0496116_0350255 Ga0496116_0350255_11_577 185
1032 3300048920 Ga0496117_0020387 Ga0496117_0020387_3256_3828 185
1033 3300048920 Ga0496117_0055575 Ga0496117_0055575_1378_1935 185
1034 3300048920 Ga0496117_0256143 Ga0496117_0256143_92_649 185
1035 3300048921 Ga0496118_0004957 Ga0496118_0004957_13815_14387 185
1036 3300048921 Ga0496118_0070368 Ga0496118_0070368_486_1043 185
1037 3300048921 Ga0496118_0079370 Ga0496118_0079370_1670_2227 185
1038 3300048921 Ga0496118_0093442 Ga0496118_0093442_282_839 185
1039 3300048921 Ga0496118_0351781 Ga0496118_0351781_200_757 185
1040 3300048922 Ga0496119_0037471 Ga0496119_0037471_2061_2618 185
1041 3300048922 Ga0496119_0093097 Ga0496119_0093097_64_621 185
1042 3300048922 Ga0496119_0132778 Ga0496119_0132778_203_760 185
1043 3300048922 Ga0496119_0158597 Ga0496119_0158597_531_1103 185
1044 3300048923 Ga0496120_0066345 Ga0496120_0066345_833_1390 185
1045 3300048924 Ga0496121_0000456 Ga0496121_0000456_43764_44336 185
1046 3300048924 Ga0496121_0011588 Ga0496121_0011588_8842_9405 185
1047 3300048924 Ga0496121_0011976 Ga0496121_0011976_2005_2562 185
1048 3300048924 Ga0496121_0012754 Ga0496121_0012754_7816_8373 185
1049 3300048924 Ga0496121_0093992 Ga0496121_0093992_1496_2053 185
1050 3300048924 Ga0496121_0138045 Ga0496121_0138045_290_847 185
1051 3300048924 Ga0496121_0252522 Ga0496121_0252522_637_1209 185
1052 3300048924 Ga0496121_0349583 Ga0496121_0349583_56_613 185
1053 3300048925 Ga0496122_0076366 Ga0496122_0076366_803_1360 185
1054 3300048926 Ga0496123_0036303 Ga0496123_0036303_2256_2813 185
1055 3300048926 Ga0496123_0078705 Ga0496123_0078705_608_1165 185
1056 3300048926 Ga0496123_0157411 Ga0496123_0157411_472_1029 185
1057 3300048927 Ga0496124_0000685 Ga0496124_0000685_7580_8152 185
1058 3300048927 Ga0496124_0146691 Ga0496124_0146691_361_918 185
1059 3300048927 Ga0496124_0197088 Ga0496124_0197088_92_652 185
1060 3300048927 Ga0496124_0323162 Ga0496124_0323162_497_1054 185
1061 3300048927 Ga0496124_0338774 Ga0496124_0338774_408_965 185
1062 3300048927 Ga0496124_0697430 Ga0496124_0697430_59_616 185
1063 3300048928 Ga0496125_0001801 Ga0496125_0001801_4870_5427 185
1064 3300048928 Ga0496125_0017146 Ga0496125_0017146_4785_5342 185
1065 3300048928 Ga0496125_0062506 Ga0496125_0062506_322_894 185
1066 3300048928 Ga0496125_0091527 Ga0496125_0091527_1005_1565 185
1067 3300048929 Ga0496126_0002820 Ga0496126_0002820_14872_15429 185
1068 3300048929 Ga0496126_0007653 Ga0496126_0007653_3453_4010 185
1069 3300048929 Ga0496126_0031823 Ga0496126_0031823_445_1017 185
1070 3300048929 Ga0496126_0087475 Ga0496126_0087475_1670_2227 185
1071 3300048929 Ga0496126_0120159 Ga0496126_0120159_770_1333 185
1072 3300048929 Ga0496126_0130828 Ga0496126_0130828_1403_1960 185
1073 3300048929 Ga0496126_0171898 Ga0496126_0171898_923_1480 185
1074 3300048929 Ga0496126_0250345 Ga0496126_0250345_584_1141 185
1075 3300048929 Ga0496126_0569921 Ga0496126_0569921_224_808 185
1076 3300049459 Ga0495678_081562 Ga0495678_081562_321_878 185
1077 3300049460 Ga0495682_0189895 Ga0495682_0189895_32_595 185
1078 3300049568 Ga0501031_0466179 Ga0501031_0466179_179_736 185
1079 3300049569 Ga0501032_0067270 Ga0501032_0067270_157_720 185
1080 3300049569 Ga0501032_0103685 Ga0501032_0103685_85_654 185
1081 3300049570 Ga0501033_0013872 Ga0501033_0013872_2857_3420 185
1082 3300049570 Ga0501033_0452646 Ga0501033_0452646_130_699 185
1083 3300049572 Ga0501036_0100512 Ga0501036_0100512_1728_2291 185
1084 3300049573 Ga0501037_0008746 Ga0501037_0008746_231_800 185
1085 3300049573 Ga0501037_0050716 Ga0501037_0050716_2436_2999 185
1086 3300049574 Ga0501038_0016381 Ga0501038_0016381_3024_3587 185
1087 3300049574 Ga0501038_0540862 Ga0501038_0540862_268_825 185
1088 3300049575 Ga0501039_0096859 Ga0501039_0096859_1493_2056 185
1089 3300049580 Ga0501046_0047997 Ga0501046_0047997_2576_3139 185
1090 3300049581 Ga0501047_0199225 Ga0501047_0199225_857_1420 185
1091 3300049582 Ga0501048_0012334 Ga0501048_0012334_1128_1691 185
1092 3300049583 Ga0501067_0032110 Ga0501067_0032110_515_1078 185
1093 3300049584 Ga0501068_0120528 Ga0501068_0120528_158_721 185
1094 3300049586 Ga0501070_0021175 Ga0501070_0021175_4732_5301 185
1095 3300049586 Ga0501070_0244814 Ga0501070_0244814_11_574 185
1096 3300049588 Ga0501072_0489956 Ga0501072_0489956_278_841 185
1097 3300049590 Ga0501074_0028355 Ga0501074_0028355_1929_2492 185
1098 3300049741 Ga0501079_0318541 Ga0501079_0318541_12_575 185
1099 3300049741 Ga0501079_0427587 Ga0501079_0427587_21_578 185
1100 3300049742 Ga0501080_0022612 Ga0501080_0022612_4159_4722 185
1101 3300049742 Ga0501080_0726981 Ga0501080_0726981_199_768 185
1102 3300049822 Ga0501035_0201326 Ga0501035_0201326_482_1051 185
1103 3300049822 Ga0501035_0314239 Ga0501035_0314239_482_1045 185
1104 3300049823 Ga0501044_0193273 Ga0501044_0193273_185_748 185
1105 3300049823 Ga0501044_0371525 Ga0501044_0371525_296_865 185
1106 3300050490 nmdc:mga03n38_16168_c1 nmdc:mga03n38_16168_c1_636_1220 185
1107 3300050491 nmdc:mga00v17_205461_c1 nmdc:mga00v17_205461_c1_701_1258 185
1108 3300050491 nmdc:mga00v17_22557_c1 nmdc:mga00v17_22557_c1_670_1227 185
1109 3300050492 nmdc:mga0yw44_12117_c1 nmdc:mga0yw44_12117_c1_2542_3099 185
1110 3300050492 nmdc:mga0yw44_43796_c1 nmdc:mga0yw44_43796_c1_730_1287 185
1111 3300050492 nmdc:mga0yw44_855444_c1 nmdc:mga0yw44_855444_c1_44_601 185
1112 3300050494 nmdc:mga06z11_407496_c1 nmdc:mga06z11_407496_c1_138_695 185
1113 3300050494 nmdc:mga06z11_78699_c1 nmdc:mga06z11_78699_c1_786_1370 185
1114 3300050496 nmdc:mga07m45_315516_c1 nmdc:mga07m45_315516_c1_197_754 185
1115 3300050496 nmdc:mga07m45_55711_c1 nmdc:mga07m45_55711_c1_678_1262 185
1116 3300050512 nmdc:mga0n895_251935_c1 nmdc:mga0n895_251935_c1_750_1307 185
1117 3300053077 Ga0495601_0037539 Ga0495601_0037539_1437_1994 185
1118 3300053078 Ga0495612_0024671 Ga0495612_0024671_933_1490 185
1119 3300053078 Ga0495612_0158490 Ga0495612_0158490_35_592 185
1120 3300053079 Ga0500610_0236581 Ga0500610_0236581_44_601 185
1121 3300053084 Ga0495595_0006061 Ga0495595_0006061_2806_3375 185
1122 3300053085 Ga0495619_0002231 Ga0495619_0002231_947_1516 185
1123 3300053085 Ga0495619_0037434 Ga0495619_0037434_635_1192 185
1124 3300053085 Ga0495619_0064858 Ga0495619_0064858_1354_1911 185
1125 3300053085 Ga0495619_0206880 Ga0495619_0206880_524_1081 185
1126 3300053087 Ga0500643_076922 Ga0500643_076922_202_759 185
1127 3300053090 Ga0500646_0012795 Ga0500646_0012795_258_815 185
1128 3300053092 Ga0500583_0119853 Ga0500583_0119853_433_990 185
1129 3300053093 Ga0500651_0048753 Ga0500651_0048753_597_1154 185
1130 3300053093 Ga0500651_0062354 Ga0500651_0062354_1089_1652 185
1131 3300053093 Ga0500651_0211880 Ga0500651_0211880_72_629 185
1132 3300053096 Ga0500641_0011445 Ga0500641_0011445_677_1243 185
1133 3300053096 Ga0500641_0015263 Ga0500641_0015263_1592_2149 185
1134 3300053098 Ga0500650_0003901 Ga0500650_0003901_4147_4704 185
1135 3300053104 Ga0500556_0000004 Ga0500556_0000004_519222_519779 185
1136 3300053108 Ga0500562_015798 Ga0500562_015798_771_1328 185
1137 3300053116 Ga0500592_001008 Ga0500592_001008_1364_1921 185
1138 3300053119 Ga0500595_034504 Ga0500595_034504_160_732 185
1139 3300053119 Ga0500595_046627 Ga0500595_046627_669_1226 185
1140 3300053119 Ga0500595_145508 Ga0500595_145508_34_591 185
1141 3300053129 Ga0500628_130796 Ga0500628_130796_97_654 185
1142 3300053130 Ga0500642_0011049 Ga0500642_0011049_2231_2794 185
1143 3300053131 Ga0500652_000276 Ga0500652_000276_6445_7002 185
1144 3300053134 Ga0500658_0224298 Ga0500658_0224298_295_852 185
1145 3300053136 Ga0500559_0194296 Ga0500559_0194296_211_768 185
1146 3300053139 Ga0500568_0002961 Ga0500568_0002961_1427_1984 185
1147 3300053140 Ga0500573_0069876 Ga0500573_0069876_1363_1935 185
1148 3300053142 Ga0500577_0000144 Ga0500577_0000144_3747_4304 185
1149 3300053142 Ga0500577_0053573 Ga0500577_0053573_225_782 185
1150 3300053146 Ga0500588_0054151 Ga0500588_0054151_638_1195 185
1151 3300053151 Ga0500604_0006492 Ga0500604_0006492_276_833 185
1152 3300053151 Ga0500604_0023541 Ga0500604_0023541_26_592 185
1153 3300053151 Ga0500604_0033664 Ga0500604_0033664_401_964 185
1154 3300053153 Ga0500616_0000014 Ga0500616_0000014_493424_493981 185
1155 3300053156 Ga0500622_0005136 Ga0500622_0005136_6097_6654 185
1156 3300053156 Ga0500622_0038757 Ga0500622_0038757_340_903 185
1157 3300053161 Ga0500634_0008812 Ga0500634_0008812_2043_2600 185
1158 3300053161 Ga0500634_0022055 Ga0500634_0022055_1310_1867 185
1159 3300053161 Ga0500634_0182676 Ga0500634_0182676_68_625 185
1160 3300053162 Ga0500638_071658 Ga0500638_071658_719_1276 185
1161 3300053177 Ga0500636_0093571 Ga0500636_0093571_24_596 185
1162 3300053724 Ga0500570_091658 Ga0500570_091658_103_663 185
1163 3300053727 Ga0500611_028884 Ga0500611_028884_423_980 185
1164 3300053731 Ga0500609_010620 Ga0500609_010620_316_879 185
1165 3300053733 Ga0500552_021269 Ga0500552_021269_122_694 185
1166 3300061719 Ga0466962_0096498 Ga0466962_0096498_71_628 185
1167 iso_pu_bacteria 2721755755 2723845029 185
1168 iso_pu_bacteria 2941515067 2941519101 185
1169 iso_pu_bacteria 2941523033 2941526319 185

Structural Annotation

Top 5 Hits

ID Description Score Start End
7reg-assembly1.cif.gz_A dfra1 complexed with nadph and 4'-chloro-3'-(4-(2,4-diamino-6-ethylpyrimidin-5-yl)but-3-yn-2-yl)-[1,1'-biphenyl]-4-carboxamide (ucp1228) 0.8063 5 183
5ecx-assembly1.cif.gz_B klebsiella pneumoniae dfra1 complexed with nadph and 6-ethyl-5-(3-(6-(pyridin-4-yl)benzo[d][1,3]dioxol-4-yl)but-1-yn-1-yl)pyrimidine-2,4-diamine 0.8049 5 183
7rgj-assembly1.cif.gz_A dfra1 complexed with nadph and 5-(3-(7-(4-(aminomethyl)phenyl)benzo[d][1,3]dioxol-5-yl)but-1-yn-1-yl)-6-ethylpyrimidine-2,4-diamine (ucp1223) 0.8009 5 182
7rgo-assembly1.cif.gz_B dfra5 complexed with nadph and 4'-chloro-3'-(4-(2,4-diamino-6-ethylpyrimidin-5-yl)but-3-yn-2-yl)-[1,1'-biphenyl]-4-carboxamide (ucp1228) 0.7976 5 182
7reg-assembly1.cif.gz_A dfra1 complexed with nadph and 4'-chloro-3'-(4-(2,4-diamino-6-ethylpyrimidin-5-yl)but-3-yn-2-yl)-[1,1'-biphenyl]-4-carboxamide (ucp1228) 0.7971 5 183
ID Description Score Start End Superfamily
5ecxB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8049 5 183 3.40.430.10
5ecxB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7958 5 183 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7678 5 182 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7601 5 184 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7592 5 182 3.40.430.10
ID Description Score Start End GO Terms
AF-Q3SS94-F1-model_v4 Uncharacterized protein 0.9932 4 183
AF-A0A4V2E9B5-F1-model_v4 Dihydrofolate reductase 0.9932 25 184
AF-Q3SS94-F1-model_v4 Uncharacterized protein 0.977 4 183
AF-A0A4V2E9B5-F1-model_v4 Dihydrofolate reductase 0.975 25 184
AF-A0A259MJZ8-F1-model_v4 Dihydrofolate reductase 0.9601 2 184

Feature Viewer

pLDDT pTM Quality
94.55 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map