F491123
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1169 | 513 | 1122 | 184 |
Family's Representative Sequence
| Representative Sequence | 3300005455|Ga0070663_100002929|Ga0070663_10000292913 |
| Length | 194 |
| Sequence | VSAQRIEGYVIVSADGMLADACNVMPDELKFGGDKAFFTAALDRADLIVHGRNSYEDQPNSPHRKRVILTQKIEAIAPDPSNPKATLWNPAGASFEAACAHAGVRSGTIAIIGGPGVFGMFMDRYDVFWLSVAPRVRLPDGEPCFPGVPACTPQEVLAANGLHAGEPQMLDPAEGVTVTPWRATPRLSLTYTSP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 4 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 5 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 6 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 7 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 8 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 9 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 10 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 11 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 12 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 13 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 14 | 2791355199 | |||
| 15 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 16 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 17 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 18 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 19 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 20 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 21 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 22 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 23 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 24 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 25 | 2904699407 | |||
| 26 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 27 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 28 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 29 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 30 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 31 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 32 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 33 | 2922425934 | |||
| 34 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 35 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 36 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 37 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 38 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 39 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 40 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 41 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 43 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 44 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 49 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 53 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 94 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 95 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 96 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 102 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 103 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 104 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 105 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 106 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 107 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 108 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 112 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 113 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 118 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 119 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 122 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 123 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 124 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 125 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 154 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 155 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 221 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 222 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 223 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 225 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 229 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 230 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 232 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 233 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 235 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 236 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 237 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 239 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 240 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 242 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 243 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 244 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 246 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 247 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 248 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 249 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 250 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 251 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 252 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 253 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 254 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 255 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 256 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 257 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 258 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 259 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 260 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 261 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 262 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 263 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 264 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 265 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 269 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 270 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 271 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 273 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 274 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 277 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 278 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 279 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 280 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 281 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 282 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 283 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 286 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 287 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 288 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 289 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 290 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 291 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 292 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 293 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 294 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 295 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 296 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 297 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 298 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 299 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 300 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 301 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 302 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 303 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 304 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 305 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 306 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 401 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 402 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 403 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 404 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 405 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 406 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 407 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 408 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 409 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 410 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 411 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 412 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 413 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 414 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 415 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 416 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 417 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 418 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 419 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 420 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 421 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 422 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 423 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 424 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 425 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 456 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 457 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 458 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 459 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 460 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 461 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 465 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 469 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 470 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 471 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 472 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 473 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 474 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 475 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 476 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 477 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 478 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 479 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 480 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 481 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 482 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 483 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 484 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 485 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 486 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 487 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 488 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 489 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 490 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 491 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 492 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 493 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 494 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 495 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 496 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 497 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 498 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 499 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 500 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 501 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 502 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 503 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 504 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 505 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 506 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 507 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 508 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 509 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 510 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 511 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 512 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 513 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.88 |
| Metatranscriptomes | 0.34 |
| Isolates | 3.77 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.13 |
| Nodule | 3.08 |
| Rhizoplane | 7.44 |
| Rhizosphere | 71.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10044120 | 3300001990 | Bacteria | 1364 |
| 2 | JGI24744J21845_10007871 | 3300002077 | Bacteria | 2201 |
| 3 | JGI25406J46586_10000104 | 3300003203 | Bacteria | 37774 |
| 4 | JGI25153J46596_10001106 | 3300003215 | Bacteria | 16363 |
| 5 | rootH2_10125295 | 3300003320 | Bacteria | 1347 |
| 6 | Ga0070676_10042094 | 3300005328 | Bacteria | 2651 |
| 7 | Ga0070676_10680029 | 3300005328 | Bacteria | 750 |
| 8 | Ga0070683_100390438 | 3300005329 | Bacteria | 1327 |
| 9 | Ga0070690_100377428 | 3300005330 | Bacteria | 1036 |
| 10 | Ga0070690_100414628 | 3300005330 | Bacteria | 992 |
| 11 | Ga0070670_100217605 | 3300005331 | Bacteria | 1661 |
| 12 | Ga0070670_100446574 | 3300005331 | Bacteria | 1145 |
| 13 | Ga0068869_100086035 | 3300005334 | Bacteria | 2355 |
| 14 | Ga0068869_100102861 | 3300005334 | Bacteria | 2163 |
| 15 | Ga0068869_100974494 | 3300005334 | Bacteria | 737 |
| 16 | Ga0070666_10539928 | 3300005335 | Bacteria | 847 |
| 17 | Ga0070680_100081052 | 3300005336 | Bacteria | 2677 |
| 18 | Ga0070682_100110843 | 3300005337 | Bacteria | 1829 |
| 19 | Ga0070682_100163513 | 3300005337 | Bacteria | 1540 |
| 20 | Ga0070682_100165434 | 3300005337 | Bacteria | 1532 |
| 21 | Ga0070682_100182044 | 3300005337 | Bacteria | 1469 |
| 22 | Ga0070682_100216401 | 3300005337 | Bacteria | 1361 |
| 23 | Ga0068868_100007248 | 3300005338 | Bacteria | 7885 |
| 24 | Ga0068868_100034333 | 3300005338 | Bacteria | 3915 |
| 25 | Ga0068868_100663556 | 3300005338 | Bacteria | 930 |
| 26 | Ga0068868_100671185 | 3300005338 | Bacteria | 925 |
| 27 | Ga0068868_100701086 | 3300005338 | Bacteria | 906 |
| 28 | Ga0070660_100075327 | 3300005339 | Bacteria | 2642 |
| 29 | Ga0070660_100176267 | 3300005339 | Bacteria | 1729 |
| 30 | Ga0070689_100627965 | 3300005340 | Bacteria | 933 |
| 31 | Ga0070661_100064797 | 3300005344 | Bacteria | 2686 |
| 32 | Ga0070661_100539269 | 3300005344 | Bacteria | 938 |
| 33 | Ga0070668_100071521 | 3300005347 | Bacteria | 2702 |
| 34 | Ga0070668_100169745 | 3300005347 | Bacteria | 1775 |
| 35 | Ga0070668_100429114 | 3300005347 | Bacteria | 1133 |
| 36 | Ga0070668_100524107 | 3300005347 | Bacteria | 1028 |
| 37 | Ga0070669_100313835 | 3300005353 | Bacteria | 1264 |
| 38 | Ga0070675_101132990 | 3300005354 | Bacteria | 720 |
| 39 | Ga0070671_100141963 | 3300005355 | Bacteria | 2027 |
| 40 | Ga0070671_100160036 | 3300005355 | Bacteria | 1903 |
| 41 | Ga0070671_100249989 | 3300005355 | Bacteria | 1506 |
| 42 | Ga0070659_100029963 | 3300005366 | Bacteria | 4208 |
| 43 | Ga0070659_100120478 | 3300005366 | Bacteria | 2124 |
| 44 | Ga0070659_100650705 | 3300005366 | Bacteria | 909 |
| 45 | Ga0070659_100722896 | 3300005366 | Bacteria | 862 |
| 46 | Ga0070659_101009091 | 3300005366 | Bacteria | 731 |
| 47 | Ga0070667_100062286 | 3300005367 | Bacteria | 3159 |
| 48 | Ga0070667_100257503 | 3300005367 | Bacteria | 1561 |
| 49 | Ga0070709_10175697 | 3300005434 | Bacteria | 1500 |
| 50 | Ga0070709_10471830 | 3300005434 | Bacteria | 949 |
| 51 | Ga0070713_100359384 | 3300005436 | Bacteria | 1353 |
| 52 | Ga0070710_10000842 | 3300005437 | Bacteria | 14763 |
| 53 | Ga0070710_10099270 | 3300005437 | Bacteria | 1731 |
| 54 | Ga0070710_10252981 | 3300005437 | Bacteria | 1133 |
| 55 | Ga0070710_10462722 | 3300005437 | Bacteria | 862 |
| 56 | Ga0070701_10051111 | 3300005438 | Bacteria | 2143 |
| 57 | Ga0070711_100007982 | 3300005439 | Bacteria | 6460 |
| 58 | Ga0070700_100029109 | 3300005441 | Bacteria | 3290 |
| 59 | Ga0070700_100212205 | 3300005441 | Bacteria | 1367 |
| 60 | Ga0070663_100002929 | 3300005455 | Bacteria | 9711 |
| 61 | Ga0070663_100031336 | 3300005455 | Bacteria | 3654 |
| 62 | Ga0070663_100039960 | 3300005455 | Bacteria | 3281 |
| 63 | Ga0070663_100054728 | 3300005455 | Bacteria | 2853 |
| 64 | Ga0070663_100078560 | 3300005455 | Bacteria | 2419 |
| 65 | Ga0070663_100616613 | 3300005455 | Bacteria | 914 |
| 66 | Ga0070663_100651462 | 3300005455 | Bacteria | 891 |
| 67 | Ga0070663_101042183 | 3300005455 | Bacteria | 713 |
| 68 | Ga0070678_100048839 | 3300005456 | Bacteria | 3050 |
| 69 | Ga0070678_100169375 | 3300005456 | Bacteria | 1777 |
| 70 | Ga0070678_100338181 | 3300005456 | Bacteria | 1291 |
| 71 | Ga0070678_100378193 | 3300005456 | Bacteria | 1224 |
| 72 | Ga0070678_100410784 | 3300005456 | Bacteria | 1178 |
| 73 | Ga0070662_100028974 | 3300005457 | Bacteria | 3859 |
| 74 | Ga0070662_100045363 | 3300005457 | Bacteria | 3153 |
| 75 | Ga0070662_100217027 | 3300005457 | Bacteria | 1524 |
| 76 | Ga0070662_100310416 | 3300005457 | Bacteria | 1284 |
| 77 | Ga0070681_10036057 | 3300005458 | Bacteria | 4968 |
| 78 | Ga0070681_10219486 | 3300005458 | Bacteria | 1816 |
| 79 | Ga0070681_10491334 | 3300005458 | Bacteria | 1140 |
| 80 | Ga0070681_10699284 | 3300005458 | Bacteria | 929 |
| 81 | Ga0068867_100186194 | 3300005459 | Bacteria | 1654 |
| 82 | Ga0070685_10074039 | 3300005466 | Bacteria | 2026 |
| 83 | Ga0070706_100371768 | 3300005467 | Bacteria | 1332 |
| 84 | Ga0070698_100080796 | 3300005471 | Bacteria | 3245 |
| 85 | Ga0070698_100112992 | 3300005471 | Bacteria | 2681 |
| 86 | Ga0070679_100020404 | 3300005530 | Bacteria | 6461 |
| 87 | Ga0070679_100043395 | 3300005530 | Bacteria | 4479 |
| 88 | Ga0070679_100066920 | 3300005530 | Bacteria | 3582 |
| 89 | Ga0070684_100095276 | 3300005535 | Bacteria | 2652 |
| 90 | Ga0070684_100221335 | 3300005535 | Bacteria | 1727 |
| 91 | Ga0070697_100128010 | 3300005536 | Bacteria | 2128 |
| 92 | Ga0070697_100261043 | 3300005536 | Bacteria | 1483 |
| 93 | Ga0068853_100029364 | 3300005539 | Bacteria | 4634 |
| 94 | Ga0068853_100084664 | 3300005539 | Bacteria | 2778 |
| 95 | Ga0068853_100282325 | 3300005539 | Bacteria | 1531 |
| 96 | Ga0070672_100048601 | 3300005543 | Bacteria | 3297 |
| 97 | Ga0070686_100339296 | 3300005544 | Bacteria | 1126 |
| 98 | Ga0070693_100022866 | 3300005547 | Bacteria | 3332 |
| 99 | Ga0070693_100052550 | 3300005547 | Bacteria | 2336 |
| 100 | Ga0070665_100042917 | 3300005548 | Bacteria | 4546 |
| 101 | Ga0070665_100052300 | 3300005548 | Bacteria | 4097 |
| 102 | Ga0070665_100079662 | 3300005548 | Bacteria | 3281 |
| 103 | Ga0070665_100160319 | 3300005548 | Bacteria | 2251 |
| 104 | Ga0070665_100312102 | 3300005548 | Bacteria | 1576 |
| 105 | Ga0070665_100390460 | 3300005548 | Bacteria | 1399 |
| 106 | Ga0070665_100619145 | 3300005548 | Bacteria | 1096 |
| 107 | Ga0068855_100070167 | 3300005563 | Bacteria | 4077 |
| 108 | Ga0068855_100669825 | 3300005563 | Bacteria | 1113 |
| 109 | Ga0070664_100149315 | 3300005564 | Bacteria | 2063 |
| 110 | Ga0070664_100545762 | 3300005564 | Bacteria | 1071 |
| 111 | Ga0068857_100003351 | 3300005577 | Bacteria | 13343 |
| 112 | Ga0068857_100228560 | 3300005577 | Bacteria | 1701 |
| 113 | Ga0068857_100325994 | 3300005577 | Bacteria | 1419 |
| 114 | Ga0068857_101000316 | 3300005577 | Bacteria | 805 |
| 115 | Ga0068854_100117469 | 3300005578 | Bacteria | 2014 |
| 116 | Ga0068854_100236089 | 3300005578 | Bacteria | 1454 |
| 117 | Ga0068854_100334583 | 3300005578 | Bacteria | 1235 |
| 118 | Ga0068854_100451257 | 3300005578 | Bacteria | 1074 |
| 119 | Ga0068854_101067737 | 3300005578 | Bacteria | 718 |
| 120 | Ga0068856_100000082 | 3300005614 | Bacteria | 88302 |
| 121 | Ga0068856_100027659 | 3300005614 | Bacteria | 5533 |
| 122 | Ga0068856_100044548 | 3300005614 | Bacteria | 4366 |
| 123 | Ga0070702_100570022 | 3300005615 | Bacteria | 844 |
| 124 | Ga0070702_100759358 | 3300005615 | Bacteria | 746 |
| 125 | Ga0068852_100056294 | 3300005616 | Bacteria | 3398 |
| 126 | Ga0068852_100096821 | 3300005616 | Bacteria | 2653 |
| 127 | Ga0068852_100112587 | 3300005616 | Bacteria | 2477 |
| 128 | Ga0068852_100755725 | 3300005616 | Bacteria | 985 |
| 129 | Ga0068852_101353155 | 3300005616 | Bacteria | 734 |
| 130 | Ga0068859_100102030 | 3300005617 | Bacteria | 2926 |
| 131 | Ga0068859_100226342 | 3300005617 | Bacteria | 1958 |
| 132 | Ga0068859_100285421 | 3300005617 | Bacteria | 1743 |
| 133 | Ga0068864_100025302 | 3300005618 | Bacteria | 4998 |
| 134 | Ga0068864_100080894 | 3300005618 | Bacteria | 2847 |
| 135 | Ga0068866_10012084 | 3300005718 | Bacteria | 3756 |
| 136 | Ga0068866_10137352 | 3300005718 | Bacteria | 1399 |
| 137 | Ga0068866_10517967 | 3300005718 | Bacteria | 792 |
| 138 | Ga0068861_100135031 | 3300005719 | Bacteria | 2006 |
| 139 | Ga0068861_100495736 | 3300005719 | Bacteria | 1103 |
| 140 | Ga0068851_10249285 | 3300005834 | Bacteria | 1007 |
| 141 | Ga0068870_10059157 | 3300005840 | Bacteria | 2054 |
| 142 | Ga0068870_10129406 | 3300005840 | Bacteria | 1465 |
| 143 | Ga0068863_100450869 | 3300005841 | Bacteria | 1262 |
| 144 | Ga0068863_100714978 | 3300005841 | Bacteria | 996 |
| 145 | Ga0068863_100946924 | 3300005841 | Bacteria | 862 |
| 146 | Ga0068858_100091420 | 3300005842 | Bacteria | 2833 |
| 147 | Ga0068858_100121056 | 3300005842 | Bacteria | 2447 |
| 148 | Ga0068858_100429826 | 3300005842 | Bacteria | 1270 |
| 149 | Ga0068860_100173616 | 3300005843 | Bacteria | 2083 |
| 150 | Ga0068860_100439021 | 3300005843 | Bacteria | 1296 |
| 151 | Ga0068860_100643963 | 3300005843 | Bacteria | 1067 |
| 152 | Ga0068862_100032642 | 3300005844 | Bacteria | 4399 |
| 153 | Ga0068862_100053834 | 3300005844 | Bacteria | 3445 |
| 154 | Ga0068862_100152717 | 3300005844 | Bacteria | 2056 |
| 155 | Ga0068862_100502988 | 3300005844 | Bacteria | 1150 |
| 156 | Ga0081455_10002419 | 3300005937 | Bacteria | 22263 |
| 157 | Ga0081455_10220768 | 3300005937 | Bacteria | 1405 |
| 158 | Ga0081455_10388858 | 3300005937 | Bacteria | 972 |
| 159 | Ga0081540_1002092 | 3300005983 | Bacteria | 16629 |
| 160 | Ga0081540_1004102 | 3300005983 | Bacteria | 11245 |
| 161 | Ga0081540_1004519 | 3300005983 | Bacteria | 10561 |
| 162 | Ga0081540_1016640 | 3300005983 | Bacteria | 4591 |
| 163 | Ga0081540_1056399 | 3300005983 | Bacteria | 1907 |
| 164 | Ga0081539_10000273 | 3300005985 | Bacteria | 117936 |
| 165 | Ga0081539_10009974 | 3300005985 | Bacteria | 7826 |
| 166 | Ga0081539_10084603 | 3300005985 | Bacteria | 1657 |
| 167 | Ga0075365_10005918 | 3300006038 | Bacteria | 6658 |
| 168 | Ga0075365_10032588 | 3300006038 | Bacteria | 3351 |
| 169 | Ga0075365_10033942 | 3300006038 | Bacteria | 3292 |
| 170 | Ga0075368_10022328 | 3300006042 | Bacteria | 2408 |
| 171 | Ga0075363_100010147 | 3300006048 | Bacteria | 4455 |
| 172 | Ga0075363_100039459 | 3300006048 | Bacteria | 2485 |
| 173 | Ga0075363_100138720 | 3300006048 | Bacteria | 1368 |
| 174 | Ga0075363_100245716 | 3300006048 | Bacteria | 1030 |
| 175 | Ga0075364_10026565 | 3300006051 | Bacteria | 3694 |
| 176 | Ga0075364_10064370 | 3300006051 | Bacteria | 2407 |
| 177 | Ga0070715_10000599 | 3300006163 | Bacteria | 9516 |
| 178 | Ga0070716_100001743 | 3300006173 | Bacteria | 9822 |
| 179 | Ga0070712_100007030 | 3300006175 | Bacteria | 7016 |
| 180 | Ga0070712_100013006 | 3300006175 | Bacteria | 5308 |
| 181 | Ga0070712_100048117 | 3300006175 | Bacteria | 2955 |
| 182 | Ga0075367_10033118 | 3300006178 | Bacteria | 2976 |
| 183 | Ga0075367_10067366 | 3300006178 | Bacteria | 2146 |
| 184 | Ga0075367_10070568 | 3300006178 | Bacteria | 2100 |
| 185 | Ga0075369_10194898 | 3300006186 | Unclassified | 934 |
| 186 | Ga0075366_10189891 | 3300006195 | Bacteria | 1248 |
| 187 | Ga0097621_100083061 | 3300006237 | Bacteria | 2668 |
| 188 | Ga0097621_100194605 | 3300006237 | Bacteria | 1757 |
| 189 | Ga0097621_100431168 | 3300006237 | Bacteria | 1185 |
| 190 | Ga0097621_100763182 | 3300006237 | Bacteria | 894 |
| 191 | Ga0075370_10017192 | 3300006353 | Bacteria | 3904 |
| 192 | Ga0075370_10047236 | 3300006353 | Bacteria | 2438 |
| 193 | Ga0075370_10052063 | 3300006353 | Bacteria | 2322 |
| 194 | Ga0075370_10409544 | 3300006353 | Bacteria | 814 |
| 195 | Ga0068871_100304142 | 3300006358 | Bacteria | 1400 |
| 196 | Ga0075428_100174800 | 3300006844 | Bacteria | 2326 |
| 197 | Ga0075428_100263228 | 3300006844 | Bacteria | 1856 |
| 198 | Ga0075434_100203577 | 3300006871 | Bacteria | 1999 |
| 199 | Ga0068865_100507280 | 3300006881 | Bacteria | 1007 |
| 200 | Ga0097620_100102032 | 3300006931 | Bacteria | 2926 |
| 201 | Ga0097620_100226341 | 3300006931 | Bacteria | 1958 |
| 202 | Ga0097620_100285417 | 3300006931 | Bacteria | 1743 |
| 203 | Ga0097620_100438716 | 3300006931 | Bacteria | 1402 |
| 204 | Ga0099824_1023248 | 3300006942 | Bacteria | 3886 |
| 205 | Ga0099822_1000080 | 3300006943 | Bacteria | 54304 |
| 206 | Ga0099794_10008554 | 3300007265 | Bacteria | 4258 |
| 207 | Ga0099795_10009675 | 3300007788 | Bacteria | 2807 |
| 208 | Ga0099795_10029828 | 3300007788 | Bacteria | 1867 |
| 209 | Ga0099795_10029973 | 3300007788 | Bacteria | 1864 |
| 210 | Ga0105240_10007507 | 3300009093 | Bacteria | 15822 |
| 211 | Ga0105240_10050611 | 3300009093 | Bacteria | 5236 |
| 212 | Ga0105240_10095181 | 3300009093 | Bacteria | 3631 |
| 213 | Ga0111539_10136421 | 3300009094 | Bacteria | 2873 |
| 214 | Ga0105247_10016251 | 3300009101 | Bacteria | 4458 |
| 215 | Ga0105247_10064365 | 3300009101 | Bacteria | 2278 |
| 216 | Ga0105247_10235465 | 3300009101 | Bacteria | 1245 |
| 217 | Ga0105247_10367823 | 3300009101 | Bacteria | 1016 |
| 218 | Ga0114129_10064849 | 3300009147 | Bacteria | 5098 |
| 219 | Ga0105243_10027582 | 3300009148 | Bacteria | 4352 |
| 220 | Ga0105243_10196369 | 3300009148 | Bacteria | 1766 |
| 221 | Ga0105243_10324591 | 3300009148 | Bacteria | 1404 |
| 222 | Ga0105243_10908670 | 3300009148 | Bacteria | 876 |
| 223 | Ga0105243_10946454 | 3300009148 | Bacteria | 860 |
| 224 | Ga0105243_11074339 | 3300009148 | Bacteria | 812 |
| 225 | Ga0105241_10010606 | 3300009174 | Bacteria | 6758 |
| 226 | Ga0105241_10032329 | 3300009174 | Bacteria | 3922 |
| 227 | Ga0105241_10041152 | 3300009174 | Bacteria | 3490 |
| 228 | Ga0105241_10219524 | 3300009174 | Bacteria | 1597 |
| 229 | Ga0105242_10125087 | 3300009176 | Bacteria | 2212 |
| 230 | Ga0105242_10398219 | 3300009176 | Bacteria | 1284 |
| 231 | Ga0105248_10033538 | 3300009177 | Bacteria | 5736 |
| 232 | Ga0105248_10223621 | 3300009177 | Bacteria | 2119 |
| 233 | Ga0105248_10238890 | 3300009177 | Bacteria | 2045 |
| 234 | Ga0105248_10478146 | 3300009177 | Bacteria | 1404 |
| 235 | Ga0105248_10546523 | 3300009177 | Bacteria | 1307 |
| 236 | Ga0105248_11203018 | 3300009177 | Bacteria | 857 |
| 237 | Ga0105237_10052204 | 3300009545 | Bacteria | 4105 |
| 238 | Ga0105237_10124318 | 3300009545 | Bacteria | 2574 |
| 239 | Ga0105237_10250559 | 3300009545 | Bacteria | 1773 |
| 240 | Ga0105237_10262981 | 3300009545 | Bacteria | 1728 |
| 241 | Ga0105237_10475461 | 3300009545 | Bacteria | 1256 |
| 242 | Ga0105238_10027110 | 3300009551 | Bacteria | 5840 |
| 243 | Ga0105238_10205293 | 3300009551 | Bacteria | 1946 |
| 244 | Ga0105249_10241385 | 3300009553 | Bacteria | 1786 |
| 245 | Ga0099796_10002843 | 3300010159 | Bacteria | 3896 |
| 246 | Ga0099796_10262689 | 3300010159 | Bacteria | 721 |
| 247 | Ga0105239_10016782 | 3300010375 | Bacteria | 8094 |
| 248 | Ga0105239_10043449 | 3300010375 | Bacteria | 4926 |
| 249 | Ga0105239_10214770 | 3300010375 | Bacteria | 2156 |
| 250 | Ga0105239_10272943 | 3300010375 | Bacteria | 1902 |
| 251 | Ga0105239_10280590 | 3300010375 | Bacteria | 1875 |
| 252 | Ga0105239_10528120 | 3300010375 | Bacteria | 1343 |
| 253 | Ga0157371_10103344 | 3300013102 | Bacteria | 2022 |
| 254 | Ga0157369_10003890 | 3300013105 | Bacteria | 17720 |
| 255 | Ga0157369_10008785 | 3300013105 | Bacteria | 11576 |
| 256 | Ga0157369_10160692 | 3300013105 | Bacteria | 2371 |
| 257 | Ga0157369_10586469 | 3300013105 | Bacteria | 1151 |
| 258 | Ga0157374_10595416 | 3300013296 | Bacteria | 1115 |
| 259 | Ga0157374_10698894 | 3300013296 | Bacteria | 1027 |
| 260 | Ga0157378_10043554 | 3300013297 | Bacteria | 3986 |
| 261 | Ga0157378_10052830 | 3300013297 | Bacteria | 3615 |
| 262 | Ga0157378_10493435 | 3300013297 | Bacteria | 1222 |
| 263 | Ga0157378_10840866 | 3300013297 | Bacteria | 946 |
| 264 | Ga0163162_10003676 | 3300013306 | Bacteria | 14707 |
| 265 | Ga0163162_10100717 | 3300013306 | Bacteria | 2981 |
| 266 | Ga0163162_10387927 | 3300013306 | Bacteria | 1530 |
| 267 | Ga0163162_10529953 | 3300013306 | Bacteria | 1307 |
| 268 | Ga0163162_10545219 | 3300013306 | Bacteria | 1288 |
| 269 | Ga0163162_10635620 | 3300013306 | Bacteria | 1192 |
| 270 | Ga0157372_10093100 | 3300013307 | Bacteria | 3429 |
| 271 | Ga0157372_10221124 | 3300013307 | Bacteria | 2195 |
| 272 | Ga0157375_10336630 | 3300013308 | Bacteria | 1674 |
| 273 | Ga0157375_10752300 | 3300013308 | Bacteria | 1126 |
| 274 | Ga0157375_11329358 | 3300013308 | Bacteria | 845 |
| 275 | Ga0157375_11654959 | 3300013308 | Bacteria | 757 |
| 276 | Ga0163163_10144284 | 3300014325 | Bacteria | 2424 |
| 277 | Ga0157380_10204726 | 3300014326 | Bacteria | 1754 |
| 278 | Ga0157380_10447494 | 3300014326 | Bacteria | 1239 |
| 279 | Ga0157377_10144231 | 3300014745 | Bacteria | 1466 |
| 280 | Ga0157379_10075745 | 3300014968 | Bacteria | 3013 |
| 281 | Ga0157379_10085223 | 3300014968 | Bacteria | 2831 |
| 282 | Ga0157376_10013748 | 3300014969 | Bacteria | 6052 |
| 283 | Ga0163161_10382935 | 3300017792 | Bacteria | 1125 |
| 284 | Ga0163161_10549107 | 3300017792 | Bacteria | 947 |
| 285 | Ga0206354_10882167 | 3300020081 | Bacteria | 819 |
| 286 | Ga0206353_10028130 | 3300020082 | Bacteria | 1740 |
| 287 | Ga0206353_11059723 | 3300020082 | Bacteria | 951 |
| 288 | Ga0213876_10183644 | 3300021384 | Bacteria | 1112 |
| 289 | Ga0213875_10024351 | 3300021388 | Bacteria | 2888 |
| 290 | Ga0224712_10009301 | 3300022467 | Bacteria | 2955 |
| 291 | Ga0209233_1002573 | 3300025261 | Bacteria | 6599 |
| 292 | Ga0209130_1025167 | 3300025284 | Bacteria | 1291 |
| 293 | Ga0209758_1007614 | 3300025297 | Bacteria | 7304 |
| 294 | Ga0209758_1036773 | 3300025297 | Bacteria | 1904 |
| 295 | Ga0207697_10007446 | 3300025315 | Bacteria | 4883 |
| 296 | Ga0207656_10016121 | 3300025321 | Bacteria | 2904 |
| 297 | Ga0207656_10034050 | 3300025321 | Bacteria | 2125 |
| 298 | Ga0207692_10092661 | 3300025898 | Bacteria | 1642 |
| 299 | Ga0207692_10180757 | 3300025898 | Bacteria | 1229 |
| 300 | Ga0207692_10332900 | 3300025898 | Bacteria | 932 |
| 301 | Ga0207642_10415068 | 3300025899 | Bacteria | 808 |
| 302 | Ga0207710_10012692 | 3300025900 | Bacteria | 3546 |
| 303 | Ga0207710_10030090 | 3300025900 | Bacteria | 2366 |
| 304 | Ga0207710_10166674 | 3300025900 | Bacteria | 1075 |
| 305 | Ga0207688_10063847 | 3300025901 | Bacteria | 2077 |
| 306 | Ga0207688_10088380 | 3300025901 | Bacteria | 1777 |
| 307 | Ga0207680_10144957 | 3300025903 | Bacteria | 1578 |
| 308 | Ga0207680_10389013 | 3300025903 | Bacteria | 984 |
| 309 | Ga0207647_10073492 | 3300025904 | Bacteria | 2060 |
| 310 | Ga0207685_10002037 | 3300025905 | Bacteria | 4504 |
| 311 | Ga0207699_10065182 | 3300025906 | Bacteria | 2207 |
| 312 | Ga0207645_10144718 | 3300025907 | Bacteria | 1549 |
| 313 | Ga0207645_10212347 | 3300025907 | Bacteria | 1275 |
| 314 | Ga0207643_10037354 | 3300025908 | Bacteria | 2725 |
| 315 | Ga0207643_10168286 | 3300025908 | Bacteria | 1321 |
| 316 | Ga0207705_10492075 | 3300025909 | Bacteria | 952 |
| 317 | Ga0207684_10118590 | 3300025910 | Bacteria | 2268 |
| 318 | Ga0207684_10517856 | 3300025910 | Bacteria | 1022 |
| 319 | Ga0207684_10541520 | 3300025910 | Bacteria | 996 |
| 320 | Ga0207654_10011369 | 3300025911 | Bacteria | 4542 |
| 321 | Ga0207654_10012520 | 3300025911 | Bacteria | 4347 |
| 322 | Ga0207707_10002249 | 3300025912 | Bacteria | 17455 |
| 323 | Ga0207707_10135199 | 3300025912 | Bacteria | 2156 |
| 324 | Ga0207707_10245836 | 3300025912 | Bacteria | 1554 |
| 325 | Ga0207695_10139649 | 3300025913 | Bacteria | 2373 |
| 326 | Ga0207695_10187481 | 3300025913 | Bacteria | 1987 |
| 327 | Ga0207695_10193093 | 3300025913 | Bacteria | 1953 |
| 328 | Ga0207671_10040002 | 3300025914 | Bacteria | 3471 |
| 329 | Ga0207671_10078202 | 3300025914 | Bacteria | 2477 |
| 330 | Ga0207671_10166173 | 3300025914 | Bacteria | 1711 |
| 331 | Ga0207671_10320000 | 3300025914 | Bacteria | 1227 |
| 332 | Ga0207693_10000095 | 3300025915 | Bacteria | 78764 |
| 333 | Ga0207693_10022609 | 3300025915 | Bacteria | 4995 |
| 334 | Ga0207693_10200987 | 3300025915 | Bacteria | 1567 |
| 335 | Ga0207663_10099139 | 3300025916 | Bacteria | 1953 |
| 336 | Ga0207660_10046822 | 3300025917 | Bacteria | 3054 |
| 337 | Ga0207660_10107578 | 3300025917 | Bacteria | 2093 |
| 338 | Ga0207657_10007732 | 3300025919 | Bacteria | 10976 |
| 339 | Ga0207657_10069057 | 3300025919 | Bacteria | 3000 |
| 340 | Ga0207657_10159573 | 3300025919 | Bacteria | 1832 |
| 341 | Ga0207649_10071248 | 3300025920 | Bacteria | 2219 |
| 342 | Ga0207652_10099410 | 3300025921 | Bacteria | 2567 |
| 343 | Ga0207652_10121286 | 3300025921 | Bacteria | 2326 |
| 344 | Ga0207652_10806909 | 3300025921 | Bacteria | 833 |
| 345 | Ga0207694_10157408 | 3300025924 | Bacteria | 1833 |
| 346 | Ga0207694_10310874 | 3300025924 | Bacteria | 1299 |
| 347 | Ga0207694_10478871 | 3300025924 | Bacteria | 1041 |
| 348 | Ga0207650_10413726 | 3300025925 | Bacteria | 1118 |
| 349 | Ga0207687_10035364 | 3300025927 | Bacteria | 3397 |
| 350 | Ga0207687_10092287 | 3300025927 | Bacteria | 2211 |
| 351 | Ga0207664_10527674 | 3300025929 | Bacteria | 1058 |
| 352 | Ga0207644_10242514 | 3300025931 | Bacteria | 1435 |
| 353 | Ga0207644_10287687 | 3300025931 | Bacteria | 1321 |
| 354 | Ga0207644_10480571 | 3300025931 | Bacteria | 1023 |
| 355 | Ga0207690_10025604 | 3300025932 | Bacteria | 3707 |
| 356 | Ga0207690_10218753 | 3300025932 | Bacteria | 1456 |
| 357 | Ga0207690_10727909 | 3300025932 | Bacteria | 817 |
| 358 | Ga0207706_10042603 | 3300025933 | Bacteria | 4023 |
| 359 | Ga0207706_10067659 | 3300025933 | Bacteria | 3143 |
| 360 | Ga0207706_10091791 | 3300025933 | Bacteria | 2670 |
| 361 | Ga0207706_10262175 | 3300025933 | Bacteria | 1509 |
| 362 | Ga0207686_10049830 | 3300025934 | Bacteria | 2602 |
| 363 | Ga0207709_10145504 | 3300025935 | Bacteria | 1635 |
| 364 | Ga0207709_10708284 | 3300025935 | Bacteria | 806 |
| 365 | Ga0207670_10489586 | 3300025936 | Bacteria | 997 |
| 366 | Ga0207669_10852329 | 3300025937 | Bacteria | 758 |
| 367 | Ga0207704_10143682 | 3300025938 | Bacteria | 1673 |
| 368 | Ga0207704_10403491 | 3300025938 | Bacteria | 1079 |
| 369 | Ga0207665_10000133 | 3300025939 | Bacteria | 49199 |
| 370 | Ga0207665_10240753 | 3300025939 | Bacteria | 1333 |
| 371 | Ga0207665_10405589 | 3300025939 | Bacteria | 1039 |
| 372 | Ga0207665_10592992 | 3300025939 | Bacteria | 864 |
| 373 | Ga0207691_10026804 | 3300025940 | Bacteria | 5408 |
| 374 | Ga0207691_10252104 | 3300025940 | Bacteria | 1523 |
| 375 | Ga0207711_10032973 | 3300025941 | Bacteria | 4380 |
| 376 | Ga0207711_10135139 | 3300025941 | Bacteria | 2214 |
| 377 | Ga0207711_10277232 | 3300025941 | Bacteria | 1544 |
| 378 | Ga0207689_10013575 | 3300025942 | Bacteria | 6952 |
| 379 | Ga0207689_10016101 | 3300025942 | Bacteria | 6329 |
| 380 | Ga0207689_10032079 | 3300025942 | Bacteria | 4370 |
| 381 | Ga0207689_10282952 | 3300025942 | Bacteria | 1373 |
| 382 | Ga0207661_10056472 | 3300025944 | Bacteria | 3152 |
| 383 | Ga0207661_10138341 | 3300025944 | Bacteria | 2093 |
| 384 | Ga0207679_10103264 | 3300025945 | Bacteria | 2234 |
| 385 | Ga0207679_10406243 | 3300025945 | Bacteria | 1199 |
| 386 | Ga0207667_10078922 | 3300025949 | Bacteria | 3411 |
| 387 | Ga0207667_10124426 | 3300025949 | Bacteria | 2656 |
| 388 | Ga0207667_10373265 | 3300025949 | Bacteria | 1453 |
| 389 | Ga0207651_10194943 | 3300025960 | Bacteria | 1619 |
| 390 | Ga0207651_10259520 | 3300025960 | Bacteria | 1426 |
| 391 | Ga0207712_10143860 | 3300025961 | Bacteria | 1833 |
| 392 | Ga0207668_10212704 | 3300025972 | Bacteria | 1547 |
| 393 | Ga0207668_10251943 | 3300025972 | Bacteria | 1434 |
| 394 | Ga0207668_10296081 | 3300025972 | Bacteria | 1333 |
| 395 | Ga0207668_10661205 | 3300025972 | Bacteria | 915 |
| 396 | Ga0207640_10108236 | 3300025981 | Bacteria | 1964 |
| 397 | Ga0207640_10208305 | 3300025981 | Bacteria | 1487 |
| 398 | Ga0207640_10263763 | 3300025981 | Bacteria | 1344 |
| 399 | Ga0207640_11201095 | 3300025981 | Bacteria | 674 |
| 400 | Ga0207658_10075699 | 3300025986 | Bacteria | 2562 |
| 401 | Ga0207658_10142037 | 3300025986 | Bacteria | 1944 |
| 402 | Ga0207677_10040296 | 3300026023 | Bacteria | 3078 |
| 403 | Ga0207677_10081207 | 3300026023 | Bacteria | 2326 |
| 404 | Ga0207677_10227651 | 3300026023 | Bacteria | 1500 |
| 405 | Ga0207703_10025797 | 3300026035 | Bacteria | 4625 |
| 406 | Ga0207639_10088194 | 3300026041 | Bacteria | 2475 |
| 407 | Ga0207639_10308315 | 3300026041 | Bacteria | 1401 |
| 408 | Ga0207639_10317014 | 3300026041 | Bacteria | 1383 |
| 409 | Ga0207678_10026492 | 3300026067 | Bacteria | 5057 |
| 410 | Ga0207678_10028300 | 3300026067 | Bacteria | 4893 |
| 411 | Ga0207678_10075795 | 3300026067 | Bacteria | 2881 |
| 412 | Ga0207678_10264852 | 3300026067 | Bacteria | 1473 |
| 413 | Ga0207678_10293294 | 3300026067 | Bacteria | 1397 |
| 414 | Ga0207678_10298427 | 3300026067 | Bacteria | 1384 |
| 415 | Ga0207678_10638284 | 3300026067 | Bacteria | 935 |
| 416 | Ga0207678_10797257 | 3300026067 | Bacteria | 834 |
| 417 | Ga0207708_10370013 | 3300026075 | Bacteria | 1180 |
| 418 | Ga0207702_10000048 | 3300026078 | Bacteria | 143125 |
| 419 | Ga0207702_10003315 | 3300026078 | Bacteria | 14804 |
| 420 | Ga0207702_10345601 | 3300026078 | Bacteria | 1422 |
| 421 | Ga0207702_10445797 | 3300026078 | Bacteria | 1255 |
| 422 | Ga0207641_10102895 | 3300026088 | Bacteria | 2519 |
| 423 | Ga0207648_10016066 | 3300026089 | Bacteria | 6858 |
| 424 | Ga0207676_10307804 | 3300026095 | Bacteria | 1449 |
| 425 | Ga0207674_10005787 | 3300026116 | Bacteria | 14663 |
| 426 | Ga0207674_10033065 | 3300026116 | Bacteria | 5418 |
| 427 | Ga0207674_10060928 | 3300026116 | Bacteria | 3814 |
| 428 | Ga0207674_10238357 | 3300026116 | Bacteria | 1766 |
| 429 | Ga0207674_10557135 | 3300026116 | Bacteria | 1107 |
| 430 | Ga0207675_100041520 | 3300026118 | Bacteria | 4296 |
| 431 | Ga0207675_100262760 | 3300026118 | Bacteria | 1673 |
| 432 | Ga0207675_100392224 | 3300026118 | Bacteria | 1367 |
| 433 | Ga0207683_10016292 | 3300026121 | Bacteria | 6326 |
| 434 | Ga0207683_10067330 | 3300026121 | Bacteria | 3159 |
| 435 | Ga0207683_10082790 | 3300026121 | Bacteria | 2851 |
| 436 | Ga0207683_10096169 | 3300026121 | Bacteria | 2641 |
| 437 | Ga0207683_10107128 | 3300026121 | Bacteria | 2500 |
| 438 | Ga0207683_10172085 | 3300026121 | Bacteria | 1961 |
| 439 | Ga0207683_10322542 | 3300026121 | Bacteria | 1415 |
| 440 | Ga0207698_10069860 | 3300026142 | Bacteria | 2780 |
| 441 | Ga0207698_10083649 | 3300026142 | Bacteria | 2583 |
| 442 | Ga0207698_10151503 | 3300026142 | Bacteria | 2013 |
| 443 | Ga0207698_10713644 | 3300026142 | Bacteria | 999 |
| 444 | Ga0207698_10950268 | 3300026142 | Bacteria | 868 |
| 445 | Ga0209589_1000003 | 3300027357 | Bacteria | 629130 |
| 446 | Ga0209489_100003 | 3300027361 | Bacteria | 663105 |
| 447 | Ga0209700_100003 | 3300027363 | Bacteria | 663105 |
| 448 | Ga0209179_1011432 | 3300027512 | Bacteria | 1573 |
| 449 | Ga0207428_10069972 | 3300027907 | Bacteria | 2759 |
| 450 | Ga0268266_10002475 | 3300028379 | Bacteria | 19733 |
| 451 | Ga0268266_10004442 | 3300028379 | Bacteria | 13419 |
| 452 | Ga0268266_10073602 | 3300028379 | Bacteria | 2965 |
| 453 | Ga0268266_10119237 | 3300028379 | Bacteria | 2346 |
| 454 | Ga0268266_10126879 | 3300028379 | Bacteria | 2278 |
| 455 | Ga0268266_10209865 | 3300028379 | Bacteria | 1785 |
| 456 | Ga0268266_10669616 | 3300028379 | Bacteria | 999 |
| 457 | Ga0268265_10071618 | 3300028380 | Bacteria | 2700 |
| 458 | Ga0268265_10162624 | 3300028380 | Bacteria | 1898 |
| 459 | Ga0268265_10485260 | 3300028380 | Bacteria | 1161 |
| 460 | Ga0268265_11081574 | 3300028380 | Bacteria | 795 |
| 461 | Ga0268265_11225659 | 3300028380 | Bacteria | 748 |
| 462 | Ga0268264_10000022 | 3300028381 | Bacteria | 476624 |
| 463 | Ga0268264_10177357 | 3300028381 | Bacteria | 1932 |
| 464 | Ga0268264_10294999 | 3300028381 | Bacteria | 1524 |
| 465 | Ga0265326_10022316 | 3300028558 | Bacteria | 1813 |
| 466 | Ga0265319_1011881 | 3300028563 | Bacteria | 3543 |
| 467 | Ga0265334_10000447 | 3300028573 | Bacteria | 21504 |
| 468 | Ga0265318_10195061 | 3300028577 | Bacteria | 740 |
| 469 | Ga0265323_10001236 | 3300028653 | Bacteria | 12840 |
| 470 | Ga0265322_10003757 | 3300028654 | Bacteria | 4566 |
| 471 | Ga0265336_10000686 | 3300028666 | Bacteria | 18257 |
| 472 | Ga0307517_10000063 | 3300028786 | Bacteria | 144304 |
| 473 | Ga0307517_10226476 | 3300028786 | Bacteria | 1129 |
| 474 | Ga0307515_10007547 | 3300028794 | Bacteria | 21484 |
| 475 | Ga0307515_10289618 | 3300028794 | Bacteria | 1335 |
| 476 | Ga0265338_10000086 | 3300028800 | Bacteria | 175026 |
| 477 | Ga0265324_10031738 | 3300029957 | Bacteria | 1848 |
| 478 | Ga0307511_10056903 | 3300030521 | Bacteria | 3049 |
| 479 | Ga0265330_10013362 | 3300031235 | Bacteria | 3828 |
| 480 | Ga0265330_10015725 | 3300031235 | Bacteria | 3498 |
| 481 | Ga0265325_10038531 | 3300031241 | Bacteria | 2522 |
| 482 | Ga0265329_10114475 | 3300031242 | Bacteria | 863 |
| 483 | Ga0265340_10007187 | 3300031247 | Bacteria | 6066 |
| 484 | Ga0265339_10046894 | 3300031249 | Bacteria | 2373 |
| 485 | Ga0265339_10210956 | 3300031249 | Bacteria | 954 |
| 486 | Ga0265331_10039137 | 3300031250 | Bacteria | 2314 |
| 487 | Ga0265316_10397287 | 3300031344 | Bacteria | 993 |
| 488 | Ga0265316_10511624 | 3300031344 | Bacteria | 857 |
| 489 | Ga0307513_10166927 | 3300031456 | Bacteria | 2084 |
| 490 | Ga0307509_10075236 | 3300031507 | Bacteria | 3508 |
| 491 | Ga0307408_100160361 | 3300031548 | Bacteria | 1786 |
| 492 | Ga0307508_10000009 | 3300031616 | Bacteria | 256966 |
| 493 | Ga0307508_10047463 | 3300031616 | Bacteria | 3830 |
| 494 | Ga0307508_10096367 | 3300031616 | Bacteria | 2549 |
| 495 | Ga0265342_10080887 | 3300031712 | Bacteria | 1877 |
| 496 | Ga0265342_10094370 | 3300031712 | Bacteria | 1712 |
| 497 | Ga0265342_10157414 | 3300031712 | Bacteria | 1257 |
| 498 | Ga0307516_10058764 | 3300031730 | Bacteria | 3741 |
| 499 | Ga0307516_10087356 | 3300031730 | Bacteria | 2953 |
| 500 | Ga0307516_10254800 | 3300031730 | Bacteria | 1448 |
| 501 | Ga0307516_10286914 | 3300031730 | Bacteria | 1326 |
| 502 | Ga0307405_10248432 | 3300031731 | Bacteria | 1322 |
| 503 | Ga0307405_10384116 | 3300031731 | Bacteria | 1094 |
| 504 | Ga0307405_10852369 | 3300031731 | Bacteria | 767 |
| 505 | Ga0307413_10016410 | 3300031824 | Bacteria | 3825 |
| 506 | Ga0307410_10273312 | 3300031852 | Bacteria | 1323 |
| 507 | Ga0307410_10692832 | 3300031852 | Bacteria | 858 |
| 508 | Ga0307406_10454726 | 3300031901 | Bacteria | 1028 |
| 509 | Ga0307412_10199327 | 3300031911 | Bacteria | 1519 |
| 510 | Ga0307409_100018794 | 3300031995 | Bacteria | 4659 |
| 511 | Ga0307409_100292315 | 3300031995 | Bacteria | 1511 |
| 512 | Ga0307411_10017127 | 3300032005 | Bacteria | 4118 |
| 513 | Ga0307415_100153327 | 3300032126 | Bacteria | 1776 |
| 514 | Ga0307415_100555325 | 3300032126 | Bacteria | 1014 |
| 515 | Ga0307510_10041082 | 3300033180 | Bacteria | 5064 |
| 516 | Ga0307510_10213579 | 3300033180 | Bacteria | 1449 |
| 517 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 518 | Ga0373938_0034867 | 3300034957 | Bacteria | 1095 |
| 519 | Ga0373926_0031879 | 3300035083 | Bacteria | 1859 |
| 520 | Ga0373934_0011895 | 3300035086 | Bacteria | 3281 |
| 521 | Ga0373934_0017581 | 3300035086 | Bacteria | 2731 |
| 522 | Ga0373934_0189899 | 3300035086 | Bacteria | 845 |
| 523 | Ga0373923_0002332 | 3300035111 | Bacteria | 5818 |
| 524 | Ga0373923_0015548 | 3300035111 | Bacteria | 2875 |
| 525 | Ga0373932_0033968 | 3300035112 | Bacteria | 1435 |
| 526 | Ga0373936_0026082 | 3300035113 | Bacteria | 2288 |
| 527 | Ga0373936_0049360 | 3300035113 | Bacteria | 1700 |
| 528 | Ga0373936_0270770 | 3300035113 | Bacteria | 762 |
| 529 | Ga0373953_0000473 | 3300035117 | Bacteria | 11091 |
| 530 | Ga0373953_0128326 | 3300035117 | Bacteria | 1080 |
| 531 | Ga0373954_0000442 | 3300035118 | Bacteria | 15520 |
| 532 | Ga0373956_0001159 | 3300035119 | Bacteria | 10897 |
| 533 | Ga0373956_0025732 | 3300035119 | Bacteria | 2545 |
| 534 | Ga0373957_0000837 | 3300035120 | Bacteria | 8045 |
| 535 | Ga0373957_0428639 | 3300035120 | Bacteria | 571 |
| 536 | Ga0373943_0035787 | 3300035170 | Bacteria | 2375 |
| 537 | Ga0373946_0276641 | 3300035171 | Bacteria | 825 |
| 538 | Ga0373955_0000840 | 3300035172 | Bacteria | 13157 |
| 539 | Ga0373955_0019884 | 3300035172 | Bacteria | 3366 |
| 540 | Ga0373955_0149633 | 3300035172 | Bacteria | 1373 |
| 541 | Ga0373955_0282791 | 3300035172 | Bacteria | 998 |
| 542 | Ga0373955_0422469 | 3300035172 | Bacteria | 811 |
| 543 | Ga0373955_1001133 | 3300035172 | Bacteria | 515 |
| 544 | Ga0373962_0045346 | 3300035242 | Bacteria | 1252 |
| 545 | Ga0373924_0138901 | 3300035410 | Bacteria | 1059 |
| 546 | Ga0373931_0143286 | 3300035691 | Bacteria | 1386 |
| 547 | Ga0373935_0108638 | 3300035692 | Bacteria | 1838 |
| 548 | Ga0373927_0010992 | 3300035695 | Bacteria | 6028 |
| 549 | Ga0373927_0039434 | 3300035695 | Bacteria | 3065 |
| 550 | Ga0373927_0109939 | 3300035695 | Bacteria | 1795 |
| 551 | Ga0373927_0322953 | 3300035695 | Bacteria | 1016 |
| 552 | Ga0373927_0452385 | 3300035695 | Bacteria | 848 |
| 553 | Ga0373933_0000041 | 3300035724 | Bacteria | 79805 |
| 554 | Ga0373933_0012552 | 3300035724 | Bacteria | 4681 |
| 555 | Ga0373933_0039675 | 3300035724 | Bacteria | 2771 |
| 556 | Ga0373947_0015464 | 3300035725 | Bacteria | 4381 |
| 557 | Ga0373947_0029904 | 3300035725 | Bacteria | 3198 |
| 558 | Ga0373947_0059844 | 3300035725 | Bacteria | 2311 |
| 559 | Ga0373947_0062881 | 3300035725 | Bacteria | 2260 |
| 560 | Ga0373947_0241622 | 3300035725 | Bacteria | 1192 |
| 561 | Ga0373937_0014572 | 3300036401 | Bacteria | 6943 |
| 562 | Ga0373937_0163049 | 3300036401 | Bacteria | 2090 |
| 563 | Ga0373925_0013749 | 3300037068 | Bacteria | 5858 |
| 564 | Ga0373925_0165400 | 3300037068 | Bacteria | 1744 |
| 565 | Ga0373925_0198098 | 3300037068 | Bacteria | 1596 |
| 566 | Ga0373925_0207070 | 3300037068 | Bacteria | 1562 |
| 567 | Ga0395900_0071894 | 3300037418 | Bacteria | 3557 |
| 568 | Ga0395900_0123379 | 3300037418 | Bacteria | 2657 |
| 569 | Ga0395900_0313915 | 3300037418 | Bacteria | 1550 |
| 570 | Ga0395900_0510520 | 3300037418 | Bacteria | 1151 |
| 571 | Ga0395898_0072896 | 3300037466 | Bacteria | 3317 |
| 572 | Ga0395898_0185817 | 3300037466 | Bacteria | 1986 |
| 573 | Ga0395898_0361367 | 3300037466 | Bacteria | 1384 |
| 574 | Ga0395898_0461098 | 3300037466 | Bacteria | 1210 |
| 575 | Ga0395898_0501886 | 3300037466 | Bacteria | 1154 |
| 576 | Ga0395905_0104806 | 3300037471 | Bacteria | 2655 |
| 577 | Ga0395905_0361255 | 3300037471 | Bacteria | 1345 |
| 578 | Ga0436364_0294722 | 3300037853 | Bacteria | 3279 |
| 579 | Ga0436364_1384833 | 3300037853 | Bacteria | 1340 |
| 580 | Ga0395901_0190304 | 3300038443 | Bacteria | 2152 |
| 581 | Ga0395901_0608874 | 3300038443 | Bacteria | 1101 |
| 582 | Ga0395901_0813583 | 3300038443 | Bacteria | 922 |
| 583 | Ga0395901_1211200 | 3300038443 | Bacteria | 720 |
| 584 | Ga0395901_1365315 | 3300038443 | Bacteria | 668 |
| 585 | Ga0436365_0038677 | 3300039437 | Bacteria | 917 |
| 586 | Ga0436365_0328412 | 3300039437 | Bacteria | 2294 |
| 587 | Ga0436365_0400158 | 3300039437 | Bacteria | 1092 |
| 588 | Ga0436365_0873305 | 3300039437 | Bacteria | 601 |
| 589 | Ga0436363_0716916 | 3300039450 | Bacteria | 1189 |
| 590 | Ga0451795_0235683 | 3300041456 | Bacteria | 794 |
| 591 | Ga0451800_0619150 | 3300041459 | Bacteria | 1468 |
| 592 | Ga0451802_0026346 | 3300041460 | Bacteria | 571 |
| 593 | Ga0451804_0741096 | 3300041463 | Bacteria | 1166 |
| 594 | Ga0451807_1417304 | 3300041486 | Bacteria | 1453 |
| 595 | Ga0451833_0306985 | 3300041491 | Bacteria | 1073 |
| 596 | Ga0451845_0567644 | 3300041501 | Bacteria | 785 |
| 597 | Ga0451855_1946904 | 3300041511 | Bacteria | 1040 |
| 598 | Ga0451853_0411756 | 3300041512 | Bacteria | 947 |
| 599 | Ga0439458_0054032 | 3300042157 | Bacteria | 995 |
| 600 | Ga0439459_0004969 | 3300042438 | Bacteria | 2164 |
| 601 | Ga0466966_0172332 | 3300044684 | Bacteria | 1315 |
| 602 | Ga0466957_0236416 | 3300044842 | Bacteria | 1211 |
| 603 | Ga0466967_0195962 | 3300045976 | Bacteria | 1911 |
| 604 | Ga0495617_003836 | 3300046452 | Bacteria | 5545 |
| 605 | Ga0495592_0028166 | 3300046454 | Bacteria | 4256 |
| 606 | Ga0495592_0192784 | 3300046454 | Bacteria | 1380 |
| 607 | Ga0495592_0553618 | 3300046454 | Bacteria | 707 |
| 608 | Ga0495603_0003551 | 3300046455 | Bacteria | 9285 |
| 609 | Ga0495603_0114512 | 3300046455 | Bacteria | 1572 |
| 610 | Ga0495603_0308905 | 3300046455 | Bacteria | 908 |
| 611 | Ga0495590_0035303 | 3300046457 | Bacteria | 1746 |
| 612 | Ga0495629_0008864 | 3300046459 | Bacteria | 7396 |
| 613 | Ga0495629_0048589 | 3300046459 | Bacteria | 2974 |
| 614 | Ga0495629_0220837 | 3300046459 | Bacteria | 1307 |
| 615 | Ga0495638_0087439 | 3300046460 | Bacteria | 1882 |
| 616 | Ga0495638_0188903 | 3300046460 | Bacteria | 1170 |
| 617 | Ga0495638_0244669 | 3300046460 | Bacteria | 991 |
| 618 | Ga0495641_0056028 | 3300046461 | Bacteria | 1788 |
| 619 | Ga0495651_0026680 | 3300046462 | Bacteria | 4498 |
| 620 | Ga0495651_0041214 | 3300046462 | Bacteria | 3587 |
| 621 | Ga0495651_0186619 | 3300046462 | Bacteria | 1463 |
| 622 | Ga0495653_0035279 | 3300046463 | Bacteria | 3948 |
| 623 | Ga0495650_0074710 | 3300046471 | Bacteria | 1321 |
| 624 | Ga0495580_0015247 | 3300046472 | Bacteria | 5806 |
| 625 | Ga0495580_0182066 | 3300046472 | Bacteria | 1451 |
| 626 | Ga0495582_0004844 | 3300046473 | Bacteria | 7551 |
| 627 | Ga0495605_0019743 | 3300046474 | Bacteria | 3594 |
| 628 | Ga0495605_0085506 | 3300046474 | Bacteria | 1469 |
| 629 | Ga0495605_0119536 | 3300046474 | Bacteria | 1195 |
| 630 | Ga0495605_0303649 | 3300046474 | Bacteria | 675 |
| 631 | Ga0495639_0227194 | 3300046475 | Bacteria | 919 |
| 632 | Ga0495664_0041604 | 3300046477 | Bacteria | 2719 |
| 633 | Ga0495664_0130686 | 3300046477 | Bacteria | 1520 |
| 634 | Ga0495584_0138605 | 3300046491 | Bacteria | 1235 |
| 635 | Ga0495584_0389390 | 3300046491 | Bacteria | 708 |
| 636 | Ga0495585_0281270 | 3300046492 | Bacteria | 822 |
| 637 | Ga0495585_0312333 | 3300046492 | Bacteria | 770 |
| 638 | Ga0495594_0038684 | 3300046499 | Bacteria | 2606 |
| 639 | Ga0495594_0159685 | 3300046499 | Bacteria | 1281 |
| 640 | Ga0495596_0066028 | 3300046500 | Bacteria | 1407 |
| 641 | Ga0495596_0103656 | 3300046500 | Bacteria | 1105 |
| 642 | Ga0495607_0008614 | 3300046501 | Bacteria | 6958 |
| 643 | Ga0495583_0064074 | 3300046506 | Bacteria | 1632 |
| 644 | Ga0495583_0377093 | 3300046506 | Bacteria | 558 |
| 645 | Ga0495606_0008403 | 3300046507 | Bacteria | 8979 |
| 646 | Ga0495606_0231593 | 3300046507 | Bacteria | 1035 |
| 647 | Ga0495608_0005163 | 3300046511 | Bacteria | 9327 |
| 648 | Ga0495608_0148048 | 3300046511 | Bacteria | 1497 |
| 649 | Ga0495610_0011973 | 3300046512 | Bacteria | 5256 |
| 650 | Ga0495610_0106889 | 3300046512 | Bacteria | 1245 |
| 651 | Ga0495610_0175974 | 3300046512 | Bacteria | 893 |
| 652 | Ga0495616_0028143 | 3300046513 | Bacteria | 2977 |
| 653 | Ga0495616_0194492 | 3300046513 | Bacteria | 895 |
| 654 | Ga0495618_0072535 | 3300046514 | Bacteria | 2191 |
| 655 | Ga0495618_0553698 | 3300046514 | Bacteria | 688 |
| 656 | Ga0495620_0038328 | 3300046515 | Bacteria | 2128 |
| 657 | Ga0495620_0067396 | 3300046515 | Bacteria | 1473 |
| 658 | Ga0495620_0077187 | 3300046515 | Bacteria | 1353 |
| 659 | Ga0495628_0029777 | 3300046516 | Bacteria | 4425 |
| 660 | Ga0495628_0224556 | 3300046516 | Bacteria | 1409 |
| 661 | Ga0495630_0049692 | 3300046517 | Bacteria | 3138 |
| 662 | Ga0495631_0224731 | 3300046518 | Bacteria | 801 |
| 663 | Ga0495631_0299436 | 3300046518 | Bacteria | 684 |
| 664 | Ga0495632_0023259 | 3300046519 | Bacteria | 3312 |
| 665 | Ga0495637_0086262 | 3300046520 | Bacteria | 1245 |
| 666 | Ga0495637_0185095 | 3300046520 | Bacteria | 771 |
| 667 | Ga0495643_0071150 | 3300046522 | Bacteria | 1826 |
| 668 | Ga0495643_0293324 | 3300046522 | Bacteria | 744 |
| 669 | Ga0495644_0066798 | 3300046523 | Bacteria | 1351 |
| 670 | Ga0495648_0002320 | 3300046524 | Bacteria | 17720 |
| 671 | Ga0495648_0032560 | 3300046524 | Bacteria | 3418 |
| 672 | Ga0495648_0049954 | 3300046524 | Bacteria | 2560 |
| 673 | Ga0495648_0132614 | 3300046524 | Bacteria | 1322 |
| 674 | Ga0495648_0312598 | 3300046524 | Bacteria | 732 |
| 675 | Ga0495663_0080059 | 3300046525 | Bacteria | 1051 |
| 676 | Ga0495663_0242731 | 3300046525 | Bacteria | 638 |
| 677 | Ga0495666_0062260 | 3300046526 | Bacteria | 1782 |
| 678 | Ga0495642_0133298 | 3300046528 | Bacteria | 1070 |
| 679 | Ga0495652_0002339 | 3300046529 | Bacteria | 19668 |
| 680 | Ga0495652_0071585 | 3300046529 | Bacteria | 2893 |
| 681 | Ga0495652_0073700 | 3300046529 | Bacteria | 2842 |
| 682 | Ga0495654_0013864 | 3300046530 | Bacteria | 4302 |
| 683 | Ga0495654_0035071 | 3300046530 | Bacteria | 2529 |
| 684 | Ga0495640_0020781 | 3300046533 | Bacteria | 4826 |
| 685 | Ga0495586_0060362 | 3300046535 | Bacteria | 2062 |
| 686 | Ga0495586_0177428 | 3300046535 | Bacteria | 1205 |
| 687 | Ga0495587_0033793 | 3300046536 | Bacteria | 3085 |
| 688 | Ga0495587_0156726 | 3300046536 | Bacteria | 1297 |
| 689 | Ga0495598_0074485 | 3300046537 | Bacteria | 1076 |
| 690 | Ga0495598_0084680 | 3300046537 | Bacteria | 1023 |
| 691 | Ga0495609_0203335 | 3300046538 | Bacteria | 827 |
| 692 | Ga0495609_0369624 | 3300046538 | Bacteria | 577 |
| 693 | Ga0495621_0018331 | 3300046539 | Bacteria | 2272 |
| 694 | Ga0495597_0045099 | 3300046542 | Bacteria | 1958 |
| 695 | Ga0495597_0163321 | 3300046542 | Bacteria | 908 |
| 696 | Ga0495597_0176264 | 3300046542 | Bacteria | 866 |
| 697 | Ga0495645_0268065 | 3300046543 | Bacteria | 1128 |
| 698 | Ga0495622_0108440 | 3300046557 | Bacteria | 1271 |
| 699 | Ga0495633_0039118 | 3300046558 | Bacteria | 2264 |
| 700 | Ga0495667_0001528 | 3300046559 | Bacteria | 15306 |
| 701 | Ga0495667_0481556 | 3300046559 | Bacteria | 778 |
| 702 | Ga0495667_0732129 | 3300046559 | Bacteria | 612 |
| 703 | Ga0495656_0016790 | 3300046615 | Bacteria | 2783 |
| 704 | Ga0495656_0120853 | 3300046615 | Bacteria | 1236 |
| 705 | Ga0495668_0038513 | 3300046616 | Bacteria | 2670 |
| 706 | Ga0495668_0051022 | 3300046616 | Bacteria | 2291 |
| 707 | Ga0495668_0067929 | 3300046616 | Bacteria | 1961 |
| 708 | Ga0495668_0300501 | 3300046616 | Bacteria | 880 |
| 709 | Ga0495634_0002573 | 3300046642 | Bacteria | 14976 |
| 710 | Ga0495634_0028503 | 3300046642 | Bacteria | 3875 |
| 711 | Ga0495634_0779624 | 3300046642 | Bacteria | 546 |
| 712 | Ga0495611_0169251 | 3300046648 | Bacteria | 1021 |
| 713 | Ga0495611_0178333 | 3300046648 | Bacteria | 993 |
| 714 | Ga0495625_0129082 | 3300046660 | Bacteria | 1713 |
| 715 | Ga0495625_0152712 | 3300046660 | Bacteria | 1551 |
| 716 | Ga0495625_0249464 | 3300046660 | Bacteria | 1153 |
| 717 | Ga0495635_0001091 | 3300046663 | Bacteria | 18022 |
| 718 | Ga0495659_0056519 | 3300046664 | Bacteria | 1440 |
| 719 | Ga0495661_0151994 | 3300046665 | Bacteria | 1250 |
| 720 | Ga0495661_0441980 | 3300046665 | Bacteria | 627 |
| 721 | Ga0495588_0001370 | 3300046674 | Bacteria | 10406 |
| 722 | Ga0495657_0016934 | 3300046675 | Bacteria | 5297 |
| 723 | Ga0495657_0150724 | 3300046675 | Bacteria | 1444 |
| 724 | Ga0495657_0194216 | 3300046675 | Bacteria | 1239 |
| 725 | Ga0495657_0279754 | 3300046675 | Bacteria | 999 |
| 726 | Ga0495599_0002320 | 3300046678 | Bacteria | 11052 |
| 727 | Ga0495623_0019613 | 3300046679 | Bacteria | 4370 |
| 728 | Ga0495623_0160335 | 3300046679 | Bacteria | 1322 |
| 729 | Ga0495623_0386319 | 3300046679 | Bacteria | 756 |
| 730 | Ga0495623_0659927 | 3300046679 | Bacteria | 539 |
| 731 | Ga0495646_0005680 | 3300046680 | Bacteria | 7901 |
| 732 | Ga0495646_0079508 | 3300046680 | Bacteria | 1914 |
| 733 | Ga0495647_0012606 | 3300046681 | Bacteria | 2914 |
| 734 | Ga0495658_0005658 | 3300046683 | Bacteria | 6143 |
| 735 | Ga0495658_0435843 | 3300046683 | Bacteria | 837 |
| 736 | Ga0495669_0048629 | 3300046684 | Bacteria | 1897 |
| 737 | Ga0495669_0160818 | 3300046684 | Bacteria | 1066 |
| 738 | Ga0495669_0258716 | 3300046684 | Bacteria | 836 |
| 739 | Ga0495613_0023851 | 3300046689 | Bacteria | 4559 |
| 740 | Ga0495613_0165019 | 3300046689 | Bacteria | 1574 |
| 741 | Ga0495613_0361916 | 3300046689 | Bacteria | 995 |
| 742 | Ga0495624_0428599 | 3300046690 | Bacteria | 793 |
| 743 | Ga0495670_0006136 | 3300046691 | Bacteria | 5899 |
| 744 | Ga0495671_0151030 | 3300046692 | Bacteria | 1131 |
| 745 | Ga0495649_0065974 | 3300046694 | Bacteria | 1943 |
| 746 | Ga0495649_0217699 | 3300046694 | Bacteria | 988 |
| 747 | Ga0495589_0144441 | 3300046794 | Bacteria | 1138 |
| 748 | Ga0495600_0002218 | 3300046809 | Bacteria | 11048 |
| 749 | Ga0495600_0048611 | 3300046809 | Bacteria | 2767 |
| 750 | Ga0495660_0211719 | 3300046810 | Bacteria | 919 |
| 751 | Ga0495660_0280765 | 3300046810 | Bacteria | 762 |
| 752 | Ga0495581_0016629 | 3300047315 | Bacteria | 4276 |
| 753 | Ga0495581_0196590 | 3300047315 | Bacteria | 1180 |
| 754 | Ga0495604_0393309 | 3300047317 | Bacteria | 914 |
| 755 | Ga0495636_0083176 | 3300047318 | Bacteria | 1381 |
| 756 | Ga0495674_0007800 | 3300047319 | Bacteria | 10219 |
| 757 | Ga0495674_0051843 | 3300047319 | Bacteria | 3615 |
| 758 | Ga0495672_0010426 | 3300047320 | Bacteria | 6618 |
| 759 | Ga0495672_0272082 | 3300047320 | Bacteria | 813 |
| 760 | Ga0495676_0034176 | 3300047321 | Bacteria | 4269 |
| 761 | Ga0495680_0005405 | 3300047322 | Bacteria | 12029 |
| 762 | Ga0495680_0433784 | 3300047322 | Bacteria | 902 |
| 763 | Ga0495675_0038736 | 3300047444 | Bacteria | 3035 |
| 764 | Ga0495675_0256419 | 3300047444 | Bacteria | 1049 |
| 765 | Ga0495677_0056687 | 3300047445 | Bacteria | 1448 |
| 766 | Ga0495677_0112036 | 3300047445 | Bacteria | 1038 |
| 767 | Ga0495677_0159259 | 3300047445 | Bacteria | 871 |
| 768 | Ga0495677_0245592 | 3300047445 | Bacteria | 700 |
| 769 | Ga0495679_035890 | 3300047446 | Bacteria | 1569 |
| 770 | Ga0495673_0042451 | 3300047469 | Bacteria | 2041 |
| 771 | Ga0495681_0097065 | 3300047470 | Bacteria | 1293 |
| 772 | Ga0495684_0001482 | 3300047471 | Bacteria | 18783 |
| 773 | Ga0495684_0097309 | 3300047471 | Bacteria | 2226 |
| 774 | Ga0495686_0011245 | 3300047472 | Bacteria | 6312 |
| 775 | Ga0495686_0086992 | 3300047472 | Bacteria | 1901 |
| 776 | Ga0495686_0186345 | 3300047472 | Bacteria | 1199 |
| 777 | Ga0495593_0026677 | 3300047673 | Bacteria | 3187 |
| 778 | Ga0495593_0070853 | 3300047673 | Bacteria | 1811 |
| 779 | Ga0495602_0068925 | 3300048088 | Bacteria | 3035 |
| 780 | Ga0495602_0349615 | 3300048088 | Bacteria | 1067 |
| 781 | Ga0495626_0111386 | 3300048091 | Bacteria | 1185 |
| 782 | Ga0495626_0117971 | 3300048091 | Bacteria | 1144 |
| 783 | Ga0496100_0002635 | 3300048903 | Bacteria | 9149 |
| 784 | Ga0496100_0245834 | 3300048903 | Bacteria | 1322 |
| 785 | Ga0496100_0664093 | 3300048903 | Bacteria | 812 |
| 786 | Ga0496101_0043040 | 3300048904 | Bacteria | 3225 |
| 787 | Ga0496101_0163644 | 3300048904 | Bacteria | 1707 |
| 788 | Ga0496101_0554973 | 3300048904 | Bacteria | 908 |
| 789 | Ga0496101_0616530 | 3300048904 | Bacteria | 858 |
| 790 | Ga0496102_0003268 | 3300048905 | Bacteria | 13736 |
| 791 | Ga0496102_0097762 | 3300048905 | Bacteria | 2723 |
| 792 | Ga0496102_0204326 | 3300048905 | Bacteria | 1862 |
| 793 | Ga0496102_0306661 | 3300048905 | Bacteria | 1496 |
| 794 | Ga0496102_0324465 | 3300048905 | Bacteria | 1450 |
| 795 | Ga0496102_0334889 | 3300048905 | Bacteria | 1425 |
| 796 | Ga0496102_0505834 | 3300048905 | Bacteria | 1130 |
| 797 | Ga0496102_0564602 | 3300048905 | Bacteria | 1061 |
| 798 | Ga0496102_1797928 | 3300048905 | Bacteria | 530 |
| 799 | Ga0496103_0011931 | 3300048906 | Bacteria | 5159 |
| 800 | Ga0496103_0090433 | 3300048906 | Bacteria | 1931 |
| 801 | Ga0496103_0241289 | 3300048906 | Bacteria | 1163 |
| 802 | Ga0496103_0381660 | 3300048906 | Bacteria | 905 |
| 803 | Ga0496103_0405211 | 3300048906 | Bacteria | 876 |
| 804 | Ga0496104_0016540 | 3300048907 | Bacteria | 6702 |
| 805 | Ga0496104_0064760 | 3300048907 | Bacteria | 3467 |
| 806 | Ga0496104_0089038 | 3300048907 | Bacteria | 2949 |
| 807 | Ga0496104_0926928 | 3300048907 | Bacteria | 776 |
| 808 | Ga0496105_0027843 | 3300048908 | Bacteria | 4620 |
| 809 | Ga0496106_0000477 | 3300048909 | Bacteria | 28442 |
| 810 | Ga0496106_0017964 | 3300048909 | Bacteria | 5231 |
| 811 | Ga0496106_0027131 | 3300048909 | Bacteria | 4265 |
| 812 | Ga0496106_0042197 | 3300048909 | Bacteria | 3421 |
| 813 | Ga0496106_0065167 | 3300048909 | Bacteria | 2773 |
| 814 | Ga0496106_0207349 | 3300048909 | Bacteria | 1561 |
| 815 | Ga0496107_0002282 | 3300048910 | Bacteria | 12380 |
| 816 | Ga0496107_0006460 | 3300048910 | Bacteria | 8061 |
| 817 | Ga0496107_0041128 | 3300048910 | Bacteria | 3319 |
| 818 | Ga0496107_0105014 | 3300048910 | Bacteria | 2073 |
| 819 | Ga0496107_0434291 | 3300048910 | Bacteria | 976 |
| 820 | Ga0496107_0623862 | 3300048910 | Bacteria | 796 |
| 821 | Ga0496107_0836265 | 3300048910 | Bacteria | 673 |
| 822 | Ga0496107_1105454 | 3300048910 | Bacteria | 572 |
| 823 | Ga0496108_0015096 | 3300048911 | Bacteria | 6304 |
| 824 | Ga0496108_0034091 | 3300048911 | Bacteria | 4229 |
| 825 | Ga0496108_0371059 | 3300048911 | Bacteria | 1249 |
| 826 | Ga0496108_0517281 | 3300048911 | Bacteria | 1042 |
| 827 | Ga0496108_0786760 | 3300048911 | Bacteria | 821 |
| 828 | Ga0496109_0001422 | 3300048912 | Bacteria | 19864 |
| 829 | Ga0496109_0103827 | 3300048912 | Bacteria | 2638 |
| 830 | Ga0496109_0230541 | 3300048912 | Bacteria | 1742 |
| 831 | Ga0496109_0323092 | 3300048912 | Bacteria | 1456 |
| 832 | Ga0496109_0360581 | 3300048912 | Bacteria | 1373 |
| 833 | Ga0496110_0010493 | 3300048913 | Bacteria | 7539 |
| 834 | Ga0496110_0043572 | 3300048913 | Bacteria | 3919 |
| 835 | Ga0496110_0047741 | 3300048913 | Bacteria | 3751 |
| 836 | Ga0496110_0079042 | 3300048913 | Bacteria | 2928 |
| 837 | Ga0496110_0151390 | 3300048913 | Bacteria | 2101 |
| 838 | Ga0496111_0150239 | 3300048914 | Bacteria | 1728 |
| 839 | Ga0496111_0221913 | 3300048914 | Bacteria | 1404 |
| 840 | Ga0496111_0429867 | 3300048914 | Bacteria | 975 |
| 841 | Ga0496111_0581912 | 3300048914 | Bacteria | 820 |
| 842 | Ga0496112_0000021 | 3300048915 | Bacteria | 156561 |
| 843 | Ga0496112_0003647 | 3300048915 | Bacteria | 12826 |
| 844 | Ga0496112_0023640 | 3300048915 | Bacteria | 5876 |
| 845 | Ga0496112_0155738 | 3300048915 | Bacteria | 2251 |
| 846 | Ga0496112_0214871 | 3300048915 | Bacteria | 1880 |
| 847 | Ga0496112_0596511 | 3300048915 | Bacteria | 1037 |
| 848 | Ga0496112_1631968 | 3300048915 | Bacteria | 558 |
| 849 | Ga0496113_0012966 | 3300048916 | Bacteria | 5623 |
| 850 | Ga0496113_0064609 | 3300048916 | Bacteria | 2767 |
| 851 | Ga0496113_0127028 | 3300048916 | Bacteria | 1998 |
| 852 | Ga0496113_0906156 | 3300048916 | Bacteria | 697 |
| 853 | Ga0496114_0020349 | 3300048917 | Bacteria | 5386 |
| 854 | Ga0496114_0460686 | 3300048917 | Bacteria | 1125 |
| 855 | Ga0496114_0460781 | 3300048917 | Bacteria | 1125 |
| 856 | Ga0496114_0758248 | 3300048917 | Bacteria | 848 |
| 857 | Ga0496115_0001335 | 3300048918 | Bacteria | 17580 |
| 858 | Ga0496115_0013365 | 3300048918 | Bacteria | 6211 |
| 859 | Ga0496115_0118076 | 3300048918 | Bacteria | 2182 |
| 860 | Ga0496115_0217884 | 3300048918 | Bacteria | 1575 |
| 861 | Ga0496115_0880263 | 3300048918 | Bacteria | 692 |
| 862 | Ga0496115_1086964 | 3300048918 | Bacteria | 607 |
| 863 | Ga0496116_0001763 | 3300048919 | Bacteria | 23588 |
| 864 | Ga0496116_0350255 | 3300048919 | Bacteria | 677 |
| 865 | Ga0496117_0020387 | 3300048920 | Bacteria | 5405 |
| 866 | Ga0496117_0055575 | 3300048920 | Bacteria | 2765 |
| 867 | Ga0496117_0153340 | 3300048920 | Bacteria | 1360 |
| 868 | Ga0496117_0256143 | 3300048920 | Bacteria | 951 |
| 869 | Ga0496118_0004957 | 3300048921 | Bacteria | 15416 |
| 870 | Ga0496118_0045377 | 3300048921 | Bacteria | 3432 |
| 871 | Ga0496118_0070368 | 3300048921 | Bacteria | 2526 |
| 872 | Ga0496118_0079370 | 3300048921 | Bacteria | 2316 |
| 873 | Ga0496118_0093442 | 3300048921 | Bacteria | 2060 |
| 874 | Ga0496118_0275041 | 3300048921 | Bacteria | 941 |
| 875 | Ga0496118_0351781 | 3300048921 | Bacteria | 785 |
| 876 | Ga0496119_0037471 | 3300048922 | Bacteria | 3149 |
| 877 | Ga0496119_0093097 | 3300048922 | Bacteria | 1708 |
| 878 | Ga0496119_0132778 | 3300048922 | Bacteria | 1354 |
| 879 | Ga0496119_0158597 | 3300048922 | Bacteria | 1205 |
| 880 | Ga0496119_0249811 | 3300048922 | Bacteria | 895 |
| 881 | Ga0496119_0507855 | 3300048922 | Bacteria | 560 |
| 882 | Ga0496120_0066345 | 3300048923 | Bacteria | 1996 |
| 883 | Ga0496120_0326959 | 3300048923 | Bacteria | 695 |
| 884 | Ga0496121_0000456 | 3300048924 | Bacteria | 80536 |
| 885 | Ga0496121_0002176 | 3300048924 | Bacteria | 30692 |
| 886 | Ga0496121_0005356 | 3300048924 | Bacteria | 16491 |
| 887 | Ga0496121_0011588 | 3300048924 | Bacteria | 9761 |
| 888 | Ga0496121_0011976 | 3300048924 | Bacteria | 9536 |
| 889 | Ga0496121_0012754 | 3300048924 | Bacteria | 9105 |
| 890 | Ga0496121_0080209 | 3300048924 | Bacteria | 2588 |
| 891 | Ga0496121_0093992 | 3300048924 | Bacteria | 2333 |
| 892 | Ga0496121_0138045 | 3300048924 | Bacteria | 1813 |
| 893 | Ga0496121_0148955 | 3300048924 | Bacteria | 1725 |
| 894 | Ga0496121_0237255 | 3300048924 | Bacteria | 1273 |
| 895 | Ga0496121_0252522 | 3300048924 | Bacteria | 1222 |
| 896 | Ga0496121_0349583 | 3300048924 | Bacteria | 985 |
| 897 | Ga0496122_0076366 | 3300048925 | Bacteria | 2358 |
| 898 | Ga0496123_0036303 | 3300048926 | Bacteria | 3497 |
| 899 | Ga0496123_0078705 | 3300048926 | Bacteria | 2018 |
| 900 | Ga0496123_0157411 | 3300048926 | Bacteria | 1216 |
| 901 | Ga0496124_0000685 | 3300048927 | Bacteria | 55748 |
| 902 | Ga0496124_0146691 | 3300048927 | Bacteria | 1856 |
| 903 | Ga0496124_0165241 | 3300048927 | Bacteria | 1721 |
| 904 | Ga0496124_0197088 | 3300048927 | Bacteria | 1535 |
| 905 | Ga0496124_0218781 | 3300048927 | Bacteria | 1434 |
| 906 | Ga0496124_0323162 | 3300048927 | Bacteria | 1104 |
| 907 | Ga0496124_0338774 | 3300048927 | Bacteria | 1069 |
| 908 | Ga0496124_0697430 | 3300048927 | Bacteria | 644 |
| 909 | Ga0496125_0001801 | 3300048928 | Bacteria | 29601 |
| 910 | Ga0496125_0017146 | 3300048928 | Bacteria | 6922 |
| 911 | Ga0496125_0062506 | 3300048928 | Bacteria | 2977 |
| 912 | Ga0496125_0091527 | 3300048928 | Bacteria | 2278 |
| 913 | Ga0496125_0364308 | 3300048928 | Bacteria | 858 |
| 914 | Ga0496126_0002820 | 3300048929 | Bacteria | 22789 |
| 915 | Ga0496126_0007653 | 3300048929 | Bacteria | 11790 |
| 916 | Ga0496126_0010701 | 3300048929 | Bacteria | 9583 |
| 917 | Ga0496126_0018173 | 3300048929 | Bacteria | 6976 |
| 918 | Ga0496126_0031823 | 3300048929 | Bacteria | 4977 |
| 919 | Ga0496126_0087475 | 3300048929 | Bacteria | 2745 |
| 920 | Ga0496126_0111157 | 3300048929 | Bacteria | 2386 |
| 921 | Ga0496126_0120159 | 3300048929 | Bacteria | 2280 |
| 922 | Ga0496126_0130828 | 3300048929 | Bacteria | 2169 |
| 923 | Ga0496126_0171898 | 3300048929 | Bacteria | 1845 |
| 924 | Ga0496126_0250345 | 3300048929 | Bacteria | 1477 |
| 925 | Ga0496126_0294066 | 3300048929 | Bacteria | 1342 |
| 926 | Ga0496126_0569921 | 3300048929 | Bacteria | 896 |
| 927 | Ga0496126_0718572 | 3300048929 | Bacteria | 774 |
| 928 | Ga0495678_081562 | 3300049459 | Bacteria | 1160 |
| 929 | Ga0495678_084293 | 3300049459 | Bacteria | 1134 |
| 930 | Ga0495682_0070310 | 3300049460 | Bacteria | 1260 |
| 931 | Ga0495682_0123455 | 3300049460 | Bacteria | 927 |
| 932 | Ga0495682_0189895 | 3300049460 | Bacteria | 729 |
| 933 | Ga0501031_0047144 | 3300049568 | Bacteria | 2809 |
| 934 | Ga0501031_0113824 | 3300049568 | Bacteria | 1767 |
| 935 | Ga0501031_0466179 | 3300049568 | Bacteria | 816 |
| 936 | Ga0501032_0043001 | 3300049569 | Bacteria | 3062 |
| 937 | Ga0501032_0067270 | 3300049569 | Bacteria | 2393 |
| 938 | Ga0501032_0079485 | 3300049569 | Bacteria | 2183 |
| 939 | Ga0501032_0103685 | 3300049569 | Bacteria | 1884 |
| 940 | Ga0501032_0318234 | 3300049569 | Bacteria | 1004 |
| 941 | Ga0501032_0858829 | 3300049569 | Bacteria | 572 |
| 942 | Ga0501033_0000155 | 3300049570 | Bacteria | 65906 |
| 943 | Ga0501033_0013872 | 3300049570 | Bacteria | 6131 |
| 944 | Ga0501033_0172854 | 3300049570 | Bacteria | 1551 |
| 945 | Ga0501033_0179861 | 3300049570 | Bacteria | 1516 |
| 946 | Ga0501033_0189541 | 3300049570 | Bacteria | 1472 |
| 947 | Ga0501033_0452646 | 3300049570 | Bacteria | 891 |
| 948 | Ga0501034_0096763 | 3300049571 | Bacteria | 2948 |
| 949 | Ga0501034_0103504 | 3300049571 | Bacteria | 2840 |
| 950 | Ga0501034_0278758 | 3300049571 | Bacteria | 1611 |
| 951 | Ga0501034_0541784 | 3300049571 | Bacteria | 1074 |
| 952 | Ga0501036_0037945 | 3300049572 | Bacteria | 4076 |
| 953 | Ga0501036_0083557 | 3300049572 | Bacteria | 2699 |
| 954 | Ga0501036_0100512 | 3300049572 | Bacteria | 2446 |
| 955 | Ga0501036_0318517 | 3300049572 | Bacteria | 1299 |
| 956 | Ga0501036_0337572 | 3300049572 | Bacteria | 1258 |
| 957 | Ga0501036_0440016 | 3300049572 | Bacteria | 1086 |
| 958 | Ga0501036_0527856 | 3300049572 | Bacteria | 981 |
| 959 | Ga0501037_0005405 | 3300049573 | Bacteria | 9304 |
| 960 | Ga0501037_0008746 | 3300049573 | Bacteria | 7421 |
| 961 | Ga0501037_0050716 | 3300049573 | Bacteria | 3036 |
| 962 | Ga0501037_0266080 | 3300049573 | Bacteria | 1197 |
| 963 | Ga0501037_0789971 | 3300049573 | Bacteria | 627 |
| 964 | Ga0501038_0016381 | 3300049574 | Bacteria | 6718 |
| 965 | Ga0501038_0072616 | 3300049574 | Bacteria | 2916 |
| 966 | Ga0501038_0075930 | 3300049574 | Bacteria | 2839 |
| 967 | Ga0501038_0137917 | 3300049574 | Bacteria | 1997 |
| 968 | Ga0501038_0258372 | 3300049574 | Bacteria | 1377 |
| 969 | Ga0501038_0325970 | 3300049574 | Bacteria | 1200 |
| 970 | Ga0501038_0540862 | 3300049574 | Bacteria | 887 |
| 971 | Ga0501038_0570168 | 3300049574 | Bacteria | 859 |
| 972 | Ga0501039_0005420 | 3300049575 | Bacteria | 9644 |
| 973 | Ga0501039_0096859 | 3300049575 | Bacteria | 2300 |
| 974 | Ga0501039_0303405 | 3300049575 | Bacteria | 1255 |
| 975 | Ga0501040_0660270 | 3300049576 | Unclassified | 756 |
| 976 | Ga0501042_0013715 | 3300049578 | Bacteria | 5519 |
| 977 | Ga0501042_0187066 | 3300049578 | Bacteria | 1494 |
| 978 | Ga0501043_0011238 | 3300049579 | Bacteria | 7014 |
| 979 | Ga0501043_0062194 | 3300049579 | Bacteria | 2931 |
| 980 | Ga0501043_0109395 | 3300049579 | Bacteria | 2170 |
| 981 | Ga0501043_0374543 | 3300049579 | Bacteria | 1079 |
| 982 | Ga0501043_0771404 | 3300049579 | Bacteria | 697 |
| 983 | Ga0501043_0778655 | 3300049579 | Bacteria | 693 |
| 984 | Ga0501043_1050360 | 3300049579 | Bacteria | 578 |
| 985 | Ga0501046_0019846 | 3300049580 | Bacteria | 5566 |
| 986 | Ga0501046_0047997 | 3300049580 | Bacteria | 3383 |
| 987 | Ga0501046_0113550 | 3300049580 | Bacteria | 2067 |
| 988 | Ga0501046_0308562 | 3300049580 | Bacteria | 1154 |
| 989 | Ga0501047_0015453 | 3300049581 | Bacteria | 7274 |
| 990 | Ga0501047_0037479 | 3300049581 | Bacteria | 4688 |
| 991 | Ga0501047_0199225 | 3300049581 | Bacteria | 1863 |
| 992 | Ga0501048_0012334 | 3300049582 | Bacteria | 6359 |
| 993 | Ga0501048_0186063 | 3300049582 | Bacteria | 1472 |
| 994 | Ga0501048_0504419 | 3300049582 | Bacteria | 867 |
| 995 | Ga0501048_0512113 | 3300049582 | Bacteria | 861 |
| 996 | Ga0501067_0028432 | 3300049583 | Bacteria | 3097 |
| 997 | Ga0501067_0032110 | 3300049583 | Bacteria | 2914 |
| 998 | Ga0501067_0499132 | 3300049583 | Bacteria | 681 |
| 999 | Ga0501068_0120528 | 3300049584 | Bacteria | 1635 |
| 1000 | Ga0501068_0170986 | 3300049584 | Bacteria | 1371 |
| 1001 | Ga0501068_0210316 | 3300049584 | Bacteria | 1235 |
| 1002 | Ga0501070_0021175 | 3300049586 | Bacteria | 5457 |
| 1003 | Ga0501070_0064966 | 3300049586 | Bacteria | 3022 |
| 1004 | Ga0501070_0153638 | 3300049586 | Bacteria | 1898 |
| 1005 | Ga0501070_0200465 | 3300049586 | Bacteria | 1639 |
| 1006 | Ga0501070_0244814 | 3300049586 | Bacteria | 1467 |
| 1007 | Ga0501070_0410220 | 3300049586 | Bacteria | 1095 |
| 1008 | Ga0501071_0034910 | 3300049587 | Bacteria | 3581 |
| 1009 | Ga0501072_0489956 | 3300049588 | Bacteria | 972 |
| 1010 | Ga0501074_0028355 | 3300049590 | Bacteria | 4058 |
| 1011 | Ga0501074_0124656 | 3300049590 | Bacteria | 1842 |
| 1012 | Ga0501076_0156640 | 3300049592 | Bacteria | 1854 |
| 1013 | Ga0501077_0193564 | 3300049593 | Bacteria | 1292 |
| 1014 | Ga0501079_0318541 | 3300049741 | Bacteria | 1217 |
| 1015 | Ga0501079_0341516 | 3300049741 | Bacteria | 1173 |
| 1016 | Ga0501079_0427587 | 3300049741 | Bacteria | 1040 |
| 1017 | Ga0501079_0737766 | 3300049741 | Bacteria | 775 |
| 1018 | Ga0501080_0022612 | 3300049742 | Bacteria | 5824 |
| 1019 | Ga0501080_0139213 | 3300049742 | Bacteria | 2244 |
| 1020 | Ga0501080_0449131 | 3300049742 | Bacteria | 1156 |
| 1021 | Ga0501080_0726981 | 3300049742 | Bacteria | 874 |
| 1022 | Ga0501081_0388528 | 3300049743 | Bacteria | 1032 |
| 1023 | Ga0501083_0077194 | 3300049744 | Bacteria | 2210 |
| 1024 | Ga0501035_0002887 | 3300049822 | Bacteria | 16563 |
| 1025 | Ga0501035_0095584 | 3300049822 | Bacteria | 2612 |
| 1026 | Ga0501035_0102401 | 3300049822 | Bacteria | 2512 |
| 1027 | Ga0501035_0201326 | 3300049822 | Bacteria | 1707 |
| 1028 | Ga0501035_0314239 | 3300049822 | Bacteria | 1317 |
| 1029 | Ga0501035_0545410 | 3300049822 | Bacteria | 950 |
| 1030 | Ga0501044_0002908 | 3300049823 | Bacteria | 19491 |
| 1031 | Ga0501044_0025575 | 3300049823 | Bacteria | 6258 |
| 1032 | Ga0501044_0060570 | 3300049823 | Bacteria | 3875 |
| 1033 | Ga0501044_0193273 | 3300049823 | Bacteria | 1996 |
| 1034 | Ga0501044_0348337 | 3300049823 | Bacteria | 1401 |
| 1035 | Ga0501044_0363699 | 3300049823 | Bacteria | 1364 |
| 1036 | Ga0501044_0371525 | 3300049823 | Bacteria | 1346 |
| 1037 | Ga0501044_1347316 | 3300049823 | Bacteria | 580 |
| 1038 | nmdc:mga03n38_16168_c1 | 3300050490 | Bacteria | 2899 |
| 1039 | nmdc:mga03n38_27443_c1 | 3300050490 | Bacteria | 2362 |
| 1040 | nmdc:mga03n38_37121_c1 | 3300050490 | Bacteria | 2099 |
| 1041 | nmdc:mga00v17_205461_c1 | 3300050491 | Bacteria | 1274 |
| 1042 | nmdc:mga00v17_22557_c1 | 3300050491 | Bacteria | 3633 |
| 1043 | nmdc:mga00v17_638554_c1 | 3300050491 | Bacteria | 685 |
| 1044 | nmdc:mga0yw44_12117_c1 | 3300050492 | Bacteria | 4482 |
| 1045 | nmdc:mga0yw44_375268_c1 | 3300050492 | Bacteria | 960 |
| 1046 | nmdc:mga0yw44_43796_c1 | 3300050492 | Bacteria | 2674 |
| 1047 | nmdc:mga0yw44_5923_c1 | 3300050492 | Bacteria | 5845 |
| 1048 | nmdc:mga0yw44_855444_c1 | 3300050492 | Bacteria | 617 |
| 1049 | nmdc:mga06z11_118768_c1 | 3300050494 | Bacteria | 1473 |
| 1050 | nmdc:mga06z11_407496_c1 | 3300050494 | Bacteria | 819 |
| 1051 | nmdc:mga06z11_78699_c1 | 3300050494 | Bacteria | 1763 |
| 1052 | nmdc:mga04h51_210507_c1 | 3300050495 | Bacteria | 767 |
| 1053 | nmdc:mga07m45_315516_c1 | 3300050496 | Bacteria | 909 |
| 1054 | nmdc:mga07m45_52779_c1 | 3300050496 | Bacteria | 2296 |
| 1055 | nmdc:mga07m45_55711_c1 | 3300050496 | Bacteria | 2235 |
| 1056 | nmdc:mga0n895_251935_c1 | 3300050512 | Bacteria | 1792 |
| 1057 | Ga0495601_0037539 | 3300053077 | Bacteria | 3029 |
| 1058 | Ga0495601_0575910 | 3300053077 | Bacteria | 723 |
| 1059 | Ga0495612_0024671 | 3300053078 | Bacteria | 2414 |
| 1060 | Ga0495612_0158490 | 3300053078 | Bacteria | 987 |
| 1061 | Ga0500610_0236581 | 3300053079 | Bacteria | 853 |
| 1062 | Ga0495655_0053411 | 3300053083 | Bacteria | 1078 |
| 1063 | Ga0495595_0006061 | 3300053084 | Bacteria | 4913 |
| 1064 | Ga0495619_0002231 | 3300053085 | Bacteria | 12815 |
| 1065 | Ga0495619_0037434 | 3300053085 | Bacteria | 3161 |
| 1066 | Ga0495619_0064858 | 3300053085 | Bacteria | 2436 |
| 1067 | Ga0495619_0206880 | 3300053085 | Bacteria | 1359 |
| 1068 | Ga0500643_076922 | 3300053087 | Bacteria | 920 |
| 1069 | Ga0500643_151961 | 3300053087 | Bacteria | 621 |
| 1070 | Ga0500646_0012795 | 3300053090 | Bacteria | 2169 |
| 1071 | Ga0500647_0147659 | 3300053091 | Bacteria | 1099 |
| 1072 | Ga0500583_0119853 | 3300053092 | Bacteria | 1301 |
| 1073 | Ga0500583_0137708 | 3300053092 | Bacteria | 1212 |
| 1074 | Ga0500651_0048753 | 3300053093 | Bacteria | 2661 |
| 1075 | Ga0500651_0062354 | 3300053093 | Bacteria | 2327 |
| 1076 | Ga0500651_0211880 | 3300053093 | Bacteria | 1139 |
| 1077 | Ga0500651_0365165 | 3300053093 | Bacteria | 817 |
| 1078 | Ga0500641_0011445 | 3300053096 | Bacteria | 3220 |
| 1079 | Ga0500641_0015263 | 3300053096 | Bacteria | 2847 |
| 1080 | Ga0500648_074567 | 3300053097 | Bacteria | 1916 |
| 1081 | Ga0500650_0003901 | 3300053098 | Bacteria | 5290 |
| 1082 | Ga0500556_0000004 | 3300053104 | Bacteria | 666287 |
| 1083 | Ga0500562_015798 | 3300053108 | Bacteria | 1938 |
| 1084 | Ga0500592_001008 | 3300053116 | Bacteria | 4593 |
| 1085 | Ga0500595_000324 | 3300053119 | Bacteria | 31413 |
| 1086 | Ga0500595_034504 | 3300053119 | Bacteria | 1673 |
| 1087 | Ga0500595_046627 | 3300053119 | Bacteria | 1361 |
| 1088 | Ga0500595_145508 | 3300053119 | Bacteria | 663 |
| 1089 | Ga0500628_130796 | 3300053129 | Bacteria | 689 |
| 1090 | Ga0500642_0011049 | 3300053130 | Bacteria | 3214 |
| 1091 | Ga0500652_000276 | 3300053131 | Bacteria | 19061 |
| 1092 | Ga0500658_0224298 | 3300053134 | Bacteria | 862 |
| 1093 | Ga0500559_0194296 | 3300053136 | Bacteria | 956 |
| 1094 | Ga0500568_0002961 | 3300053139 | Bacteria | 9718 |
| 1095 | Ga0500568_0191005 | 3300053139 | Unclassified | 751 |
| 1096 | Ga0500573_0069876 | 3300053140 | Bacteria | 2003 |
| 1097 | Ga0500577_0000144 | 3300053142 | Bacteria | 17408 |
| 1098 | Ga0500577_0053573 | 3300053142 | Bacteria | 1525 |
| 1099 | Ga0500586_011778 | 3300053145 | Bacteria | 2519 |
| 1100 | Ga0500588_0054151 | 3300053146 | Bacteria | 1262 |
| 1101 | Ga0500604_0006492 | 3300053151 | Bacteria | 3094 |
| 1102 | Ga0500604_0023541 | 3300053151 | Bacteria | 1757 |
| 1103 | Ga0500604_0033664 | 3300053151 | Bacteria | 1517 |
| 1104 | Ga0500616_0000014 | 3300053153 | Bacteria | 637918 |
| 1105 | Ga0500622_0005136 | 3300053156 | Bacteria | 7938 |
| 1106 | Ga0500622_0038757 | 3300053156 | Bacteria | 2487 |
| 1107 | Ga0500627_0189790 | 3300053158 | Bacteria | 923 |
| 1108 | Ga0500634_0008812 | 3300053161 | Bacteria | 5063 |
| 1109 | Ga0500634_0022055 | 3300053161 | Bacteria | 3454 |
| 1110 | Ga0500634_0182676 | 3300053161 | Bacteria | 942 |
| 1111 | Ga0500638_071658 | 3300053162 | Bacteria | 1656 |
| 1112 | Ga0500638_246877 | 3300053162 | Bacteria | 721 |
| 1113 | Ga0500636_0093571 | 3300053177 | Bacteria | 1718 |
| 1114 | Ga0500636_0138945 | 3300053177 | Bacteria | 1346 |
| 1115 | Ga0500567_068705 | 3300053723 | Bacteria | 1563 |
| 1116 | Ga0500570_091658 | 3300053724 | Bacteria | 1320 |
| 1117 | Ga0500611_028884 | 3300053727 | Bacteria | 1130 |
| 1118 | Ga0500609_010620 | 3300053731 | Bacteria | 1241 |
| 1119 | Ga0500552_021269 | 3300053733 | Bacteria | 926 |
| 1120 | Ga0501084_0111229 | 3300054114 | Bacteria | 2302 |
| 1121 | Ga0501082_0203287 | 3300060353 | Bacteria | 1723 |
| 1122 | Ga0466962_0096498 | 3300061719 | Bacteria | 1418 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046475 | Ga0495639_0227194 | Ga0495639_0227194_395_877 | 160 |
| 2 | 3300046535 | Ga0495586_0177428 | Ga0495586_0177428_701_1183 | 160 |
| 3 | 3300049569 | Ga0501032_0858829 | Ga0501032_0858829_17_499 | 160 |
| 4 | 3300035086 | Ga0373934_0189899 | Ga0373934_0189899_343_828 | 161 |
| 5 | 3300035120 | Ga0373957_0428639 | Ga0373957_0428639_14_499 | 161 |
| 6 | 3300035172 | Ga0373955_1001133 | Ga0373955_1001133_19_504 | 161 |
| 7 | 3300038443 | Ga0395901_1365315 | Ga0395901_1365315_23_508 | 161 |
| 8 | 3300041460 | Ga0451802_0026346 | Ga0451802_0026346_13_498 | 161 |
| 9 | 3300046454 | Ga0495592_0192784 | Ga0495592_0192784_15_500 | 161 |
| 10 | 3300046460 | Ga0495638_0087439 | Ga0495638_0087439_17_502 | 161 |
| 11 | 3300046474 | Ga0495605_0303649 | Ga0495605_0303649_20_505 | 161 |
| 12 | 3300046518 | Ga0495631_0299436 | Ga0495631_0299436_10_501 | 161 |
| 13 | 3300046538 | Ga0495609_0369624 | Ga0495609_0369624_18_503 | 161 |
| 14 | 3300046559 | Ga0495667_0732129 | Ga0495667_0732129_14_499 | 161 |
| 15 | 3300048905 | Ga0496102_1797928 | Ga0496102_1797928_12_497 | 161 |
| 16 | 3300048906 | Ga0496103_0381660 | Ga0496103_0381660_399_884 | 161 |
| 17 | 3300048921 | Ga0496118_0275041 | Ga0496118_0275041_12_497 | 161 |
| 18 | 3300048924 | Ga0496121_0080209 | Ga0496121_0080209_19_504 | 161 |
| 19 | 3300049569 | Ga0501032_0318234 | Ga0501032_0318234_509_994 | 161 |
| 20 | 3300049576 | Ga0501040_0660270 | Ga0501040_0660270_250_735 | 161 |
| 21 | 3300048929 | Ga0496126_0718572 | Ga0496126_0718572_73_621 | 166 |
| 22 | 3300006173 | Ga0070716_100001743 | Ga0070716_1000017434 | 168 |
| 23 | 3300025939 | Ga0207665_10405589 | Ga0207665_104055892 | 169 |
| 24 | 3300026118 | Ga0207675_100392224 | Ga0207675_1003922242 | 169 |
| 25 | 3300031824 | Ga0307413_10016410 | Ga0307413_100164104 | 169 |
| 26 | 3300032005 | Ga0307411_10017127 | Ga0307411_100171273 | 169 |
| 27 | 3300034957 | Ga0373938_0034867 | Ga0373938_0034867_25_543 | 169 |
| 28 | 3300039437 | Ga0436365_0873305 | Ga0436365_0873305_31_540 | 169 |
| 29 | 3300041511 | Ga0451855_1946904 | Ga0451855_1946904_12_521 | 169 |
| 30 | 3300046454 | Ga0495592_0553618 | Ga0495592_0553618_188_697 | 169 |
| 31 | 3300046506 | Ga0495583_0377093 | Ga0495583_0377093_24_533 | 169 |
| 32 | 3300046512 | Ga0495610_0011973 | Ga0495610_0011973_4734_5243 | 169 |
| 33 | 3300046524 | Ga0495648_0049954 | Ga0495648_0049954_14_523 | 169 |
| 34 | 3300046542 | Ga0495597_0176264 | Ga0495597_0176264_21_530 | 169 |
| 35 | 3300046642 | Ga0495634_0779624 | Ga0495634_0779624_24_533 | 169 |
| 36 | 3300046679 | Ga0495623_0659927 | Ga0495623_0659927_17_526 | 169 |
| 37 | 3300046690 | Ga0495624_0428599 | Ga0495624_0428599_260_769 | 169 |
| 38 | 3300047322 | Ga0495680_0433784 | Ga0495680_0433784_12_521 | 169 |
| 39 | 3300047445 | Ga0495677_0245592 | Ga0495677_0245592_171_680 | 169 |
| 40 | 3300048091 | Ga0495626_0117971 | Ga0495626_0117971_614_1123 | 169 |
| 41 | 3300048906 | Ga0496103_0241289 | Ga0496103_0241289_610_1146 | 169 |
| 42 | 3300048910 | Ga0496107_1105454 | Ga0496107_1105454_11_520 | 169 |
| 43 | 3300048911 | Ga0496108_0786760 | Ga0496108_0786760_287_796 | 169 |
| 44 | 3300048915 | Ga0496112_1631968 | Ga0496112_1631968_26_535 | 169 |
| 45 | 3300048918 | Ga0496115_0880263 | Ga0496115_0880263_21_539 | 169 |
| 46 | 3300048922 | Ga0496119_0507855 | Ga0496119_0507855_34_543 | 169 |
| 47 | 3300048929 | Ga0496126_0294066 | Ga0496126_0294066_792_1328 | 169 |
| 48 | 3300049571 | Ga0501034_0278758 | Ga0501034_0278758_1060_1575 | 169 |
| 49 | 3300049579 | Ga0501043_0778655 | Ga0501043_0778655_17_532 | 169 |
| 50 | 3300049579 | Ga0501043_1050360 | Ga0501043_1050360_23_532 | 169 |
| 51 | 3300049823 | Ga0501044_1347316 | Ga0501044_1347316_14_526 | 169 |
| 52 | 3300050492 | nmdc:mga0yw44_375268_c1 | nmdc:mga0yw44_375268_c1_404_940 | 169 |
| 53 | 3300053087 | Ga0500643_151961 | Ga0500643_151961_87_596 | 169 |
| 54 | 3300053092 | Ga0500583_0137708 | Ga0500583_0137708_676_1185 | 169 |
| 55 | 3300049579 | Ga0501043_0374543 | Ga0501043_0374543_403_948 | 170 |
| 56 | 3300049568 | Ga0501031_0113824 | Ga0501031_0113824_489_1034 | 171 |
| 57 | 3300049570 | Ga0501033_0179861 | Ga0501033_0179861_312_857 | 171 |
| 58 | 3300049571 | Ga0501034_0096763 | Ga0501034_0096763_164_709 | 171 |
| 59 | 3300049581 | Ga0501047_0015453 | Ga0501047_0015453_4235_4780 | 171 |
| 60 | 3300049586 | Ga0501070_0200465 | Ga0501070_0200465_970_1515 | 171 |
| 61 | 3300049822 | Ga0501035_0095584 | Ga0501035_0095584_559_1104 | 171 |
| 62 | 3300049823 | Ga0501044_0348337 | Ga0501044_0348337_664_1209 | 171 |
| 63 | 3300006942 | Ga0099824_1023248 | Ga0099824_10232485 | 172 |
| 64 | 3300006943 | Ga0099822_1000080 | Ga0099822_10000803 | 172 |
| 65 | 3300027357 | Ga0209589_1000003 | Ga0209589_1000003600 | 172 |
| 66 | 3300027361 | Ga0209489_100003 | Ga0209489_100003651 | 172 |
| 67 | 3300027363 | Ga0209700_100003 | Ga0209700_100003651 | 172 |
| 68 | 3300053177 | Ga0500636_0138945 | Ga0500636_0138945_130_684 | 172 |
| 69 | 3300028558 | Ga0265326_10022316 | Ga0265326_100223162 | 176 |
| 70 | 3300028563 | Ga0265319_1011881 | Ga0265319_10118813 | 176 |
| 71 | 3300028653 | Ga0265323_10001236 | Ga0265323_100012368 | 176 |
| 72 | 3300028654 | Ga0265322_10003757 | Ga0265322_100037573 | 176 |
| 73 | 3300028800 | Ga0265338_10000086 | Ga0265338_10000086109 | 176 |
| 74 | 3300029957 | Ga0265324_10031738 | Ga0265324_100317383 | 176 |
| 75 | iso_pu_bacteria | 2643221651 | 2644288741 | 177 |
| 76 | iso_pu_bacteria | 2885374607 | 2885379479 | 178 |
| 77 | 3300006237 | Ga0097621_100763182 | Ga0097621_1007631822 | 179 |
| 78 | iso_pu_bacteria | 2791355199 | 2793082104 | 180 |
| 79 | iso_pu_bacteria | 2889033259 | 2889039781 | 180 |
| 80 | iso_pu_bacteria | 2922386360 | 2922391023 | 180 |
| 81 | 3300028794 | Ga0307515_10289618 | Ga0307515_102896182 | 181 |
| 82 | 3300048910 | Ga0496107_0041128 | Ga0496107_0041128_2574_3122 | 181 |
| 83 | 3300048924 | Ga0496121_0002176 | Ga0496121_0002176_26160_26708 | 181 |
| 84 | 3300048929 | Ga0496126_0018173 | Ga0496126_0018173_3630_4178 | 181 |
| 85 | iso_pu_bacteria | 2513237096 | 2513654785 | 181 |
| 86 | iso_pu_bacteria | 2513237098 | 2513675888 | 181 |
| 87 | iso_pu_bacteria | 2513237101 | 2513692585 | 181 |
| 88 | iso_pu_bacteria | 2513237137 | 2513855794 | 181 |
| 89 | iso_pu_bacteria | 2513237145 | 2513915035 | 181 |
| 90 | iso_pu_bacteria | 2517572143 | 2517892332 | 181 |
| 91 | iso_pu_bacteria | 2602042107 | 2603859513 | 181 |
| 92 | iso_pu_bacteria | 2667528175 | 2671120420 | 181 |
| 93 | iso_pu_bacteria | 2728368998 | 2728751131 | 181 |
| 94 | iso_pu_bacteria | 2791355197 | 2793072325 | 181 |
| 95 | iso_pu_bacteria | 2857524615 | 2857529083 | 181 |
| 96 | iso_pu_bacteria | 2874604998 | 2874605254 | 181 |
| 97 | iso_pu_bacteria | 2876808645 | 2876814323 | 181 |
| 98 | iso_pu_bacteria | 2879110137 | 2879111249 | 181 |
| 99 | iso_pu_bacteria | 2885383462 | 2885386550 | 181 |
| 100 | iso_pu_bacteria | 2903748898 | 2903749358 | 181 |
| 101 | iso_pu_bacteria | 2903768456 | 2903774129 | 181 |
| 102 | iso_pu_bacteria | 2904690495 | 2904695888 | 181 |
| 103 | iso_pu_bacteria | 2906635258 | 2906638867 | 181 |
| 104 | iso_pu_bacteria | 2906660503 | 2906666310 | 181 |
| 105 | iso_pu_bacteria | 2908739725 | 2908742627 | 181 |
| 106 | iso_pu_bacteria | 2908756301 | 2908761189 | 181 |
| 107 | iso_pu_bacteria | 2919073203 | 2919076483 | 181 |
| 108 | iso_pu_bacteria | 2922361189 | 2922365414 | 181 |
| 109 | iso_pu_bacteria | 2922425934 | 2922430352 | 181 |
| 110 | iso_pu_bacteria | 2935630451 | 2935631606 | 181 |
| 111 | iso_pu_bacteria | 2941507105 | 2941511400 | 181 |
| 112 | iso_pu_bacteria | 3005474847 | 3005480275 | 181 |
| 113 | iso_pu_bacteria | 8006964411 | 8006965799 | 181 |
| 114 | iso_pu_bacteria | 8006984368 | 8006986453 | 181 |
| 115 | iso_pu_bacteria | 8006994254 | 8006995978 | 181 |
| 116 | iso_pu_bacteria | 8019555841 | 8019556678 | 181 |
| 117 | iso_pu_bacteria | 8019565922 | 8019568628 | 181 |
| 118 | iso_pu_bacteria | 8056673599 | 8056673811 | 181 |
| 119 | iso_pu_bacteria | 8056689827 | 8056695261 | 181 |
| 120 | 3300037068 | Ga0373925_0198098 | Ga0373925_0198098_531_1091 | 182 |
| 121 | 3300046462 | Ga0495651_0041214 | Ga0495651_0041214_396_944 | 182 |
| 122 | 3300046524 | Ga0495648_0032560 | Ga0495648_0032560_2236_2793 | 182 |
| 123 | 3300053119 | Ga0500595_000324 | Ga0500595_000324_18097_18651 | 182 |
| 124 | 3300053162 | Ga0500638_246877 | Ga0500638_246877_10_567 | 182 |
| 125 | 3300005437 | Ga0070710_10000842 | Ga0070710_100008428 | 183 |
| 126 | 3300006163 | Ga0070715_10000599 | Ga0070715_100005995 | 183 |
| 127 | 3300006175 | Ga0070712_100013006 | Ga0070712_1000130064 | 183 |
| 128 | 3300006353 | Ga0075370_10409544 | Ga0075370_104095442 | 183 |
| 129 | 3300017792 | Ga0163161_10549107 | Ga0163161_105491072 | 183 |
| 130 | 3300025284 | Ga0209130_1025167 | Ga0209130_10251672 | 183 |
| 131 | 3300025905 | Ga0207685_10002037 | Ga0207685_100020372 | 183 |
| 132 | 3300025915 | Ga0207693_10000095 | Ga0207693_1000009552 | 183 |
| 133 | 3300025939 | Ga0207665_10000133 | Ga0207665_1000013310 | 183 |
| 134 | 3300037466 | Ga0395898_0361367 | Ga0395898_0361367_510_1064 | 183 |
| 135 | 3300038443 | Ga0395901_1211200 | Ga0395901_1211200_13_567 | 183 |
| 136 | 3300039450 | Ga0436363_0716916 | Ga0436363_0716916_138_689 | 183 |
| 137 | 3300044842 | Ga0466957_0236416 | Ga0466957_0236416_328_879 | 183 |
| 138 | 3300048907 | Ga0496104_0064760 | Ga0496104_0064760_1188_1739 | 183 |
| 139 | 3300048909 | Ga0496106_0017964 | Ga0496106_0017964_129_680 | 183 |
| 140 | 3300048910 | Ga0496107_0006460 | Ga0496107_0006460_5539_6090 | 183 |
| 141 | 3300048910 | Ga0496107_0836265 | Ga0496107_0836265_90_641 | 183 |
| 142 | 3300048911 | Ga0496108_0034091 | Ga0496108_0034091_2798_3349 | 183 |
| 143 | 3300048912 | Ga0496109_0001422 | Ga0496109_0001422_15308_15859 | 183 |
| 144 | 3300048913 | Ga0496110_0043572 | Ga0496110_0043572_2718_3269 | 183 |
| 145 | 3300048914 | Ga0496111_0221913 | Ga0496111_0221913_600_1151 | 183 |
| 146 | 3300048915 | Ga0496112_0000021 | Ga0496112_0000021_107568_108119 | 183 |
| 147 | 3300048915 | Ga0496112_0003647 | Ga0496112_0003647_4056_4607 | 183 |
| 148 | 3300048916 | Ga0496113_0127028 | Ga0496113_0127028_1259_1810 | 183 |
| 149 | 3300048917 | Ga0496114_0460781 | Ga0496114_0460781_149_700 | 183 |
| 150 | 3300049568 | Ga0501031_0047144 | Ga0501031_0047144_462_1013 | 183 |
| 151 | 3300049569 | Ga0501032_0043001 | Ga0501032_0043001_665_1216 | 183 |
| 152 | 3300049569 | Ga0501032_0079485 | Ga0501032_0079485_919_1470 | 183 |
| 153 | 3300049570 | Ga0501033_0000155 | Ga0501033_0000155_85_636 | 183 |
| 154 | 3300049570 | Ga0501033_0172854 | Ga0501033_0172854_590_1144 | 183 |
| 155 | 3300049570 | Ga0501033_0189541 | Ga0501033_0189541_502_1056 | 183 |
| 156 | 3300049571 | Ga0501034_0103504 | Ga0501034_0103504_1747_2298 | 183 |
| 157 | 3300049571 | Ga0501034_0541784 | Ga0501034_0541784_64_615 | 183 |
| 158 | 3300049572 | Ga0501036_0037945 | Ga0501036_0037945_1285_1836 | 183 |
| 159 | 3300049572 | Ga0501036_0083557 | Ga0501036_0083557_2088_2639 | 183 |
| 160 | 3300049572 | Ga0501036_0318517 | Ga0501036_0318517_433_984 | 183 |
| 161 | 3300049572 | Ga0501036_0337572 | Ga0501036_0337572_243_794 | 183 |
| 162 | 3300049572 | Ga0501036_0440016 | Ga0501036_0440016_189_740 | 183 |
| 163 | 3300049573 | Ga0501037_0005405 | Ga0501037_0005405_3834_4385 | 183 |
| 164 | 3300049573 | Ga0501037_0266080 | Ga0501037_0266080_412_963 | 183 |
| 165 | 3300049574 | Ga0501038_0072616 | Ga0501038_0072616_863_1417 | 183 |
| 166 | 3300049574 | Ga0501038_0075930 | Ga0501038_0075930_234_785 | 183 |
| 167 | 3300049574 | Ga0501038_0137917 | Ga0501038_0137917_1324_1875 | 183 |
| 168 | 3300049574 | Ga0501038_0258372 | Ga0501038_0258372_725_1276 | 183 |
| 169 | 3300049574 | Ga0501038_0325970 | Ga0501038_0325970_639_1190 | 183 |
| 170 | 3300049574 | Ga0501038_0570168 | Ga0501038_0570168_95_649 | 183 |
| 171 | 3300049575 | Ga0501039_0005420 | Ga0501039_0005420_3618_4169 | 183 |
| 172 | 3300049575 | Ga0501039_0303405 | Ga0501039_0303405_306_857 | 183 |
| 173 | 3300049578 | Ga0501042_0013715 | Ga0501042_0013715_2989_3540 | 183 |
| 174 | 3300049579 | Ga0501043_0011238 | Ga0501043_0011238_5377_5928 | 183 |
| 175 | 3300049579 | Ga0501043_0062194 | Ga0501043_0062194_1573_2124 | 183 |
| 176 | 3300049579 | Ga0501043_0109395 | Ga0501043_0109395_992_1543 | 183 |
| 177 | 3300049579 | Ga0501043_0771404 | Ga0501043_0771404_72_626 | 183 |
| 178 | 3300049580 | Ga0501046_0019846 | Ga0501046_0019846_2888_3439 | 183 |
| 179 | 3300049580 | Ga0501046_0113550 | Ga0501046_0113550_203_754 | 183 |
| 180 | 3300049580 | Ga0501046_0308562 | Ga0501046_0308562_347_901 | 183 |
| 181 | 3300049581 | Ga0501047_0037479 | Ga0501047_0037479_1628_2179 | 183 |
| 182 | 3300049582 | Ga0501048_0504419 | Ga0501048_0504419_170_721 | 183 |
| 183 | 3300049582 | Ga0501048_0512113 | Ga0501048_0512113_83_637 | 183 |
| 184 | 3300049583 | Ga0501067_0028432 | Ga0501067_0028432_1013_1564 | 183 |
| 185 | 3300049583 | Ga0501067_0499132 | Ga0501067_0499132_31_582 | 183 |
| 186 | 3300049584 | Ga0501068_0170986 | Ga0501068_0170986_352_903 | 183 |
| 187 | 3300049584 | Ga0501068_0210316 | Ga0501068_0210316_526_1077 | 183 |
| 188 | 3300049586 | Ga0501070_0064966 | Ga0501070_0064966_1470_2021 | 183 |
| 189 | 3300049586 | Ga0501070_0153638 | Ga0501070_0153638_827_1378 | 183 |
| 190 | 3300049586 | Ga0501070_0410220 | Ga0501070_0410220_424_975 | 183 |
| 191 | 3300049587 | Ga0501071_0034910 | Ga0501071_0034910_2043_2594 | 183 |
| 192 | 3300049590 | Ga0501074_0124656 | Ga0501074_0124656_864_1415 | 183 |
| 193 | 3300049593 | Ga0501077_0193564 | Ga0501077_0193564_381_932 | 183 |
| 194 | 3300049741 | Ga0501079_0341516 | Ga0501079_0341516_365_916 | 183 |
| 195 | 3300049742 | Ga0501080_0139213 | Ga0501080_0139213_748_1299 | 183 |
| 196 | 3300049742 | Ga0501080_0449131 | Ga0501080_0449131_148_699 | 183 |
| 197 | 3300049744 | Ga0501083_0077194 | Ga0501083_0077194_113_664 | 183 |
| 198 | 3300049822 | Ga0501035_0002887 | Ga0501035_0002887_462_1013 | 183 |
| 199 | 3300049822 | Ga0501035_0102401 | Ga0501035_0102401_1024_1578 | 183 |
| 200 | 3300049823 | Ga0501044_0002908 | Ga0501044_0002908_18216_18767 | 183 |
| 201 | 3300049823 | Ga0501044_0025575 | Ga0501044_0025575_620_1171 | 183 |
| 202 | 3300049823 | Ga0501044_0060570 | Ga0501044_0060570_2294_2845 | 183 |
| 203 | 3300049823 | Ga0501044_0363699 | Ga0501044_0363699_323_877 | 183 |
| 204 | 3300050491 | nmdc:mga00v17_638554_c1 | nmdc:mga00v17_638554_c1_17_568 | 183 |
| 205 | 3300054114 | Ga0501084_0111229 | Ga0501084_0111229_1536_2087 | 183 |
| 206 | 3300060353 | Ga0501082_0203287 | Ga0501082_0203287_381_932 | 183 |
| 207 | 3300003320 | rootH2_10125295 | rootH2_101252952 | 184 |
| 208 | 3300005331 | Ga0070670_100446574 | Ga0070670_1004465742 | 184 |
| 209 | 3300005334 | Ga0068869_100086035 | Ga0068869_1000860351 | 184 |
| 210 | 3300005337 | Ga0070682_100165434 | Ga0070682_1001654342 | 184 |
| 211 | 3300005337 | Ga0070682_100216401 | Ga0070682_1002164012 | 184 |
| 212 | 3300005338 | Ga0068868_100663556 | Ga0068868_1006635561 | 184 |
| 213 | 3300005344 | Ga0070661_100064797 | Ga0070661_1000647972 | 184 |
| 214 | 3300005344 | Ga0070661_100539269 | Ga0070661_1005392691 | 184 |
| 215 | 3300005347 | Ga0070668_100429114 | Ga0070668_1004291142 | 184 |
| 216 | 3300005353 | Ga0070669_100313835 | Ga0070669_1003138351 | 184 |
| 217 | 3300005366 | Ga0070659_101009091 | Ga0070659_1010090911 | 184 |
| 218 | 3300005367 | Ga0070667_100257503 | Ga0070667_1002575032 | 184 |
| 219 | 3300005441 | Ga0070700_100212205 | Ga0070700_1002122051 | 184 |
| 220 | 3300005455 | Ga0070663_100054728 | Ga0070663_1000547283 | 184 |
| 221 | 3300005455 | Ga0070663_100651462 | Ga0070663_1006514622 | 184 |
| 222 | 3300005456 | Ga0070678_100338181 | Ga0070678_1003381812 | 184 |
| 223 | 3300005456 | Ga0070678_100378193 | Ga0070678_1003781932 | 184 |
| 224 | 3300005457 | Ga0070662_100310416 | Ga0070662_1003104162 | 184 |
| 225 | 3300005458 | Ga0070681_10219486 | Ga0070681_102194862 | 184 |
| 226 | 3300005466 | Ga0070685_10074039 | Ga0070685_100740392 | 184 |
| 227 | 3300005467 | Ga0070706_100371768 | Ga0070706_1003717682 | 184 |
| 228 | 3300005471 | Ga0070698_100080796 | Ga0070698_1000807961 | 184 |
| 229 | 3300005536 | Ga0070697_100261043 | Ga0070697_1002610432 | 184 |
| 230 | 3300005548 | Ga0070665_100042917 | Ga0070665_1000429174 | 184 |
| 231 | 3300005548 | Ga0070665_100079662 | Ga0070665_1000796623 | 184 |
| 232 | 3300005548 | Ga0070665_100312102 | Ga0070665_1003121022 | 184 |
| 233 | 3300005548 | Ga0070665_100619145 | Ga0070665_1006191452 | 184 |
| 234 | 3300005564 | Ga0070664_100149315 | Ga0070664_1001493152 | 184 |
| 235 | 3300005577 | Ga0068857_101000316 | Ga0068857_1010003162 | 184 |
| 236 | 3300005578 | Ga0068854_101067737 | Ga0068854_1010677372 | 184 |
| 237 | 3300005616 | Ga0068852_101353155 | Ga0068852_1013531551 | 184 |
| 238 | 3300005617 | Ga0068859_100102030 | Ga0068859_1001020302 | 184 |
| 239 | 3300005719 | Ga0068861_100495736 | Ga0068861_1004957362 | 184 |
| 240 | 3300005840 | Ga0068870_10129406 | Ga0068870_101294062 | 184 |
| 241 | 3300005841 | Ga0068863_100450869 | Ga0068863_1004508692 | 184 |
| 242 | 3300005842 | Ga0068858_100091420 | Ga0068858_1000914202 | 184 |
| 243 | 3300005842 | Ga0068858_100429826 | Ga0068858_1004298262 | 184 |
| 244 | 3300005843 | Ga0068860_100439021 | Ga0068860_1004390211 | 184 |
| 245 | 3300005844 | Ga0068862_100032642 | Ga0068862_1000326423 | 184 |
| 246 | 3300005937 | Ga0081455_10002419 | Ga0081455_1000241916 | 184 |
| 247 | 3300006038 | Ga0075365_10005918 | Ga0075365_100059184 | 184 |
| 248 | 3300006048 | Ga0075363_100010147 | Ga0075363_1000101472 | 184 |
| 249 | 3300006048 | Ga0075363_100138720 | Ga0075363_1001387202 | 184 |
| 250 | 3300006237 | Ga0097621_100194605 | Ga0097621_1001946053 | 184 |
| 251 | 3300006237 | Ga0097621_100431168 | Ga0097621_1004311682 | 184 |
| 252 | 3300006353 | Ga0075370_10047236 | Ga0075370_100472362 | 184 |
| 253 | 3300006931 | Ga0097620_100102032 | Ga0097620_1001020322 | 184 |
| 254 | 3300007788 | Ga0099795_10029828 | Ga0099795_100298282 | 184 |
| 255 | 3300009101 | Ga0105247_10064365 | Ga0105247_100643652 | 184 |
| 256 | 3300009148 | Ga0105243_10324591 | Ga0105243_103245913 | 184 |
| 257 | 3300009148 | Ga0105243_10908670 | Ga0105243_109086702 | 184 |
| 258 | 3300009148 | Ga0105243_11074339 | Ga0105243_110743392 | 184 |
| 259 | 3300009176 | Ga0105242_10398219 | Ga0105242_103982191 | 184 |
| 260 | 3300009177 | Ga0105248_10033538 | Ga0105248_100335384 | 184 |
| 261 | 3300010375 | Ga0105239_10528120 | Ga0105239_105281202 | 184 |
| 262 | 3300013105 | Ga0157369_10008785 | Ga0157369_1000878510 | 184 |
| 263 | 3300013105 | Ga0157369_10586469 | Ga0157369_105864692 | 184 |
| 264 | 3300013296 | Ga0157374_10698894 | Ga0157374_106988942 | 184 |
| 265 | 3300013306 | Ga0163162_10387927 | Ga0163162_103879272 | 184 |
| 266 | 3300013306 | Ga0163162_10545219 | Ga0163162_105452192 | 184 |
| 267 | 3300013308 | Ga0157375_10752300 | Ga0157375_107523002 | 184 |
| 268 | 3300014326 | Ga0157380_10204726 | Ga0157380_102047262 | 184 |
| 269 | 3300014968 | Ga0157379_10085223 | Ga0157379_100852232 | 184 |
| 270 | 3300020081 | Ga0206354_10882167 | Ga0206354_108821671 | 184 |
| 271 | 3300020082 | Ga0206353_10028130 | Ga0206353_100281302 | 184 |
| 272 | 3300022467 | Ga0224712_10009301 | Ga0224712_100093012 | 184 |
| 273 | 3300025297 | Ga0209758_1007614 | Ga0209758_10076145 | 184 |
| 274 | 3300025900 | Ga0207710_10012692 | Ga0207710_100126924 | 184 |
| 275 | 3300025903 | Ga0207680_10144957 | Ga0207680_101449572 | 184 |
| 276 | 3300025908 | Ga0207643_10168286 | Ga0207643_101682862 | 184 |
| 277 | 3300025910 | Ga0207684_10118590 | Ga0207684_101185903 | 184 |
| 278 | 3300025910 | Ga0207684_10541520 | Ga0207684_105415202 | 184 |
| 279 | 3300025912 | Ga0207707_10135199 | Ga0207707_101351992 | 184 |
| 280 | 3300025920 | Ga0207649_10071248 | Ga0207649_100712482 | 184 |
| 281 | 3300025921 | Ga0207652_10099410 | Ga0207652_100994103 | 184 |
| 282 | 3300025924 | Ga0207694_10478871 | Ga0207694_104788712 | 184 |
| 283 | 3300025925 | Ga0207650_10413726 | Ga0207650_104137262 | 184 |
| 284 | 3300025933 | Ga0207706_10262175 | Ga0207706_102621752 | 184 |
| 285 | 3300025938 | Ga0207704_10403491 | Ga0207704_104034912 | 184 |
| 286 | 3300025941 | Ga0207711_10135139 | Ga0207711_101351392 | 184 |
| 287 | 3300025942 | Ga0207689_10013575 | Ga0207689_100135754 | 184 |
| 288 | 3300025945 | Ga0207679_10103264 | Ga0207679_101032642 | 184 |
| 289 | 3300025972 | Ga0207668_10212704 | Ga0207668_102127042 | 184 |
| 290 | 3300025986 | Ga0207658_10142037 | Ga0207658_101420372 | 184 |
| 291 | 3300026041 | Ga0207639_10308315 | Ga0207639_103083152 | 184 |
| 292 | 3300026067 | Ga0207678_10298427 | Ga0207678_102984271 | 184 |
| 293 | 3300026067 | Ga0207678_10638284 | Ga0207678_106382842 | 184 |
| 294 | 3300026067 | Ga0207678_10797257 | Ga0207678_107972572 | 184 |
| 295 | 3300026075 | Ga0207708_10370013 | Ga0207708_103700132 | 184 |
| 296 | 3300026088 | Ga0207641_10102895 | Ga0207641_101028953 | 184 |
| 297 | 3300026116 | Ga0207674_10557135 | Ga0207674_105571352 | 184 |
| 298 | 3300026118 | Ga0207675_100041520 | Ga0207675_1000415202 | 184 |
| 299 | 3300026121 | Ga0207683_10096169 | Ga0207683_100961692 | 184 |
| 300 | 3300026121 | Ga0207683_10172085 | Ga0207683_101720852 | 184 |
| 301 | 3300026142 | Ga0207698_10950268 | Ga0207698_109502682 | 184 |
| 302 | 3300028379 | Ga0268266_10002475 | Ga0268266_1000247518 | 184 |
| 303 | 3300028379 | Ga0268266_10073602 | Ga0268266_100736024 | 184 |
| 304 | 3300028379 | Ga0268266_10119237 | Ga0268266_101192372 | 184 |
| 305 | 3300028379 | Ga0268266_10669616 | Ga0268266_106696162 | 184 |
| 306 | 3300028380 | Ga0268265_11225659 | Ga0268265_112256592 | 184 |
| 307 | 3300028381 | Ga0268264_10294999 | Ga0268264_102949992 | 184 |
| 308 | 3300028786 | Ga0307517_10000063 | Ga0307517_100000631 | 184 |
| 309 | 3300028794 | Ga0307515_10007547 | Ga0307515_100075472 | 184 |
| 310 | 3300031507 | Ga0307509_10075236 | Ga0307509_100752364 | 184 |
| 311 | 3300031616 | Ga0307508_10000009 | Ga0307508_10000009159 | 184 |
| 312 | 3300031730 | Ga0307516_10087356 | Ga0307516_100873563 | 184 |
| 313 | 3300031730 | Ga0307516_10254800 | Ga0307516_102548002 | 184 |
| 314 | 3300031730 | Ga0307516_10286914 | Ga0307516_102869142 | 184 |
| 315 | 3300031731 | Ga0307405_10248432 | Ga0307405_102484322 | 184 |
| 316 | 3300031731 | Ga0307405_10384116 | Ga0307405_103841162 | 184 |
| 317 | 3300031731 | Ga0307405_10852369 | Ga0307405_108523692 | 184 |
| 318 | 3300031901 | Ga0307406_10454726 | Ga0307406_104547262 | 184 |
| 319 | 3300031911 | Ga0307412_10199327 | Ga0307412_101993271 | 184 |
| 320 | 3300031995 | Ga0307409_100018794 | Ga0307409_1000187942 | 184 |
| 321 | 3300031995 | Ga0307409_100292315 | Ga0307409_1002923151 | 184 |
| 322 | 3300032126 | Ga0307415_100153327 | Ga0307415_1001533272 | 184 |
| 323 | 3300032126 | Ga0307415_100555325 | Ga0307415_1005553251 | 184 |
| 324 | 3300033180 | Ga0307510_10041082 | Ga0307510_100410822 | 184 |
| 325 | 3300035113 | Ga0373936_0270770 | Ga0373936_0270770_97_654 | 184 |
| 326 | 3300035172 | Ga0373955_0422469 | Ga0373955_0422469_117_674 | 184 |
| 327 | 3300035695 | Ga0373927_0109939 | Ga0373927_0109939_135_689 | 184 |
| 328 | 3300035725 | Ga0373947_0062881 | Ga0373947_0062881_554_1108 | 184 |
| 329 | 3300036401 | Ga0373937_0163049 | Ga0373937_0163049_494_1051 | 184 |
| 330 | 3300037068 | Ga0373925_0165400 | Ga0373925_0165400_76_630 | 184 |
| 331 | 3300037418 | Ga0395900_0313915 | Ga0395900_0313915_591_1166 | 184 |
| 332 | 3300037853 | Ga0436364_1384833 | Ga0436364_1384833_93_647 | 184 |
| 333 | 3300041456 | Ga0451795_0235683 | Ga0451795_0235683_32_601 | 184 |
| 334 | 3300041486 | Ga0451807_1417304 | Ga0451807_1417304_134_688 | 184 |
| 335 | 3300041491 | Ga0451833_0306985 | Ga0451833_0306985_212_766 | 184 |
| 336 | 3300041501 | Ga0451845_0567644 | Ga0451845_0567644_64_630 | 184 |
| 337 | 3300046452 | Ga0495617_003836 | Ga0495617_003836_3608_4162 | 184 |
| 338 | 3300046455 | Ga0495603_0003551 | Ga0495603_0003551_6517_7071 | 184 |
| 339 | 3300046455 | Ga0495603_0308905 | Ga0495603_0308905_297_851 | 184 |
| 340 | 3300046459 | Ga0495629_0220837 | Ga0495629_0220837_120_674 | 184 |
| 341 | 3300046460 | Ga0495638_0244669 | Ga0495638_0244669_213_767 | 184 |
| 342 | 3300046461 | Ga0495641_0056028 | Ga0495641_0056028_1025_1579 | 184 |
| 343 | 3300046471 | Ga0495650_0074710 | Ga0495650_0074710_106_660 | 184 |
| 344 | 3300046474 | Ga0495605_0085506 | Ga0495605_0085506_156_710 | 184 |
| 345 | 3300046474 | Ga0495605_0119536 | Ga0495605_0119536_596_1165 | 184 |
| 346 | 3300046477 | Ga0495664_0130686 | Ga0495664_0130686_510_1064 | 184 |
| 347 | 3300046492 | Ga0495585_0312333 | Ga0495585_0312333_58_612 | 184 |
| 348 | 3300046499 | Ga0495594_0038684 | Ga0495594_0038684_903_1457 | 184 |
| 349 | 3300046500 | Ga0495596_0103656 | Ga0495596_0103656_439_993 | 184 |
| 350 | 3300046512 | Ga0495610_0106889 | Ga0495610_0106889_436_990 | 184 |
| 351 | 3300046512 | Ga0495610_0175974 | Ga0495610_0175974_240_794 | 184 |
| 352 | 3300046513 | Ga0495616_0194492 | Ga0495616_0194492_57_611 | 184 |
| 353 | 3300046515 | Ga0495620_0067396 | Ga0495620_0067396_273_827 | 184 |
| 354 | 3300046518 | Ga0495631_0224731 | Ga0495631_0224731_17_571 | 184 |
| 355 | 3300046522 | Ga0495643_0293324 | Ga0495643_0293324_122_676 | 184 |
| 356 | 3300046523 | Ga0495644_0066798 | Ga0495644_0066798_511_1065 | 184 |
| 357 | 3300046524 | Ga0495648_0002320 | Ga0495648_0002320_15441_15995 | 184 |
| 358 | 3300046525 | Ga0495663_0242731 | Ga0495663_0242731_56_610 | 184 |
| 359 | 3300046530 | Ga0495654_0035071 | Ga0495654_0035071_1087_1641 | 184 |
| 360 | 3300046537 | Ga0495598_0084680 | Ga0495598_0084680_239_793 | 184 |
| 361 | 3300046542 | Ga0495597_0163321 | Ga0495597_0163321_67_621 | 184 |
| 362 | 3300046557 | Ga0495622_0108440 | Ga0495622_0108440_678_1232 | 184 |
| 363 | 3300046615 | Ga0495656_0120853 | Ga0495656_0120853_274_828 | 184 |
| 364 | 3300046616 | Ga0495668_0038513 | Ga0495668_0038513_1910_2464 | 184 |
| 365 | 3300046648 | Ga0495611_0169251 | Ga0495611_0169251_303_857 | 184 |
| 366 | 3300046660 | Ga0495625_0152712 | Ga0495625_0152712_972_1526 | 184 |
| 367 | 3300046660 | Ga0495625_0249464 | Ga0495625_0249464_453_1022 | 184 |
| 368 | 3300046665 | Ga0495661_0151994 | Ga0495661_0151994_49_603 | 184 |
| 369 | 3300046675 | Ga0495657_0150724 | Ga0495657_0150724_32_589 | 184 |
| 370 | 3300046679 | Ga0495623_0160335 | Ga0495623_0160335_630_1187 | 184 |
| 371 | 3300046684 | Ga0495669_0160818 | Ga0495669_0160818_217_771 | 184 |
| 372 | 3300046684 | Ga0495669_0258716 | Ga0495669_0258716_41_595 | 184 |
| 373 | 3300046694 | Ga0495649_0065974 | Ga0495649_0065974_292_861 | 184 |
| 374 | 3300046694 | Ga0495649_0217699 | Ga0495649_0217699_172_726 | 184 |
| 375 | 3300047320 | Ga0495672_0010426 | Ga0495672_0010426_5816_6385 | 184 |
| 376 | 3300047445 | Ga0495677_0159259 | Ga0495677_0159259_202_756 | 184 |
| 377 | 3300047446 | Ga0495679_035890 | Ga0495679_035890_351_905 | 184 |
| 378 | 3300047469 | Ga0495673_0042451 | Ga0495673_0042451_256_810 | 184 |
| 379 | 3300047470 | Ga0495681_0097065 | Ga0495681_0097065_128_682 | 184 |
| 380 | 3300047472 | Ga0495686_0186345 | Ga0495686_0186345_313_867 | 184 |
| 381 | 3300048904 | Ga0496101_0616530 | Ga0496101_0616530_217_771 | 184 |
| 382 | 3300048906 | Ga0496103_0405211 | Ga0496103_0405211_300_854 | 184 |
| 383 | 3300048910 | Ga0496107_0623862 | Ga0496107_0623862_49_603 | 184 |
| 384 | 3300048912 | Ga0496109_0323092 | Ga0496109_0323092_804_1358 | 184 |
| 385 | 3300048913 | Ga0496110_0047741 | Ga0496110_0047741_133_687 | 184 |
| 386 | 3300048914 | Ga0496111_0581912 | Ga0496111_0581912_100_654 | 184 |
| 387 | 3300048915 | Ga0496112_0596511 | Ga0496112_0596511_55_609 | 184 |
| 388 | 3300048916 | Ga0496113_0906156 | Ga0496113_0906156_85_639 | 184 |
| 389 | 3300048917 | Ga0496114_0758248 | Ga0496114_0758248_94_648 | 184 |
| 390 | 3300048918 | Ga0496115_0118076 | Ga0496115_0118076_606_1160 | 184 |
| 391 | 3300048920 | Ga0496117_0153340 | Ga0496117_0153340_445_999 | 184 |
| 392 | 3300048921 | Ga0496118_0045377 | Ga0496118_0045377_349_903 | 184 |
| 393 | 3300048922 | Ga0496119_0249811 | Ga0496119_0249811_39_614 | 184 |
| 394 | 3300048923 | Ga0496120_0326959 | Ga0496120_0326959_13_585 | 184 |
| 395 | 3300048924 | Ga0496121_0005356 | Ga0496121_0005356_14762_15316 | 184 |
| 396 | 3300048924 | Ga0496121_0148955 | Ga0496121_0148955_442_1005 | 184 |
| 397 | 3300048924 | Ga0496121_0237255 | Ga0496121_0237255_419_973 | 184 |
| 398 | 3300048927 | Ga0496124_0165241 | Ga0496124_0165241_214_768 | 184 |
| 399 | 3300048927 | Ga0496124_0218781 | Ga0496124_0218781_230_784 | 184 |
| 400 | 3300048928 | Ga0496125_0364308 | Ga0496125_0364308_103_657 | 184 |
| 401 | 3300048929 | Ga0496126_0010701 | Ga0496126_0010701_3593_4147 | 184 |
| 402 | 3300048929 | Ga0496126_0111157 | Ga0496126_0111157_329_883 | 184 |
| 403 | 3300049459 | Ga0495678_084293 | Ga0495678_084293_533_1087 | 184 |
| 404 | 3300049460 | Ga0495682_0070310 | Ga0495682_0070310_368_922 | 184 |
| 405 | 3300049460 | Ga0495682_0123455 | Ga0495682_0123455_158_727 | 184 |
| 406 | 3300049572 | Ga0501036_0527856 | Ga0501036_0527856_320_874 | 184 |
| 407 | 3300049573 | Ga0501037_0789971 | Ga0501037_0789971_24_578 | 184 |
| 408 | 3300049578 | Ga0501042_0187066 | Ga0501042_0187066_272_826 | 184 |
| 409 | 3300049582 | Ga0501048_0186063 | Ga0501048_0186063_821_1375 | 184 |
| 410 | 3300049592 | Ga0501076_0156640 | Ga0501076_0156640_708_1262 | 184 |
| 411 | 3300049741 | Ga0501079_0737766 | Ga0501079_0737766_129_683 | 184 |
| 412 | 3300049743 | Ga0501081_0388528 | Ga0501081_0388528_41_595 | 184 |
| 413 | 3300049822 | Ga0501035_0545410 | Ga0501035_0545410_331_885 | 184 |
| 414 | 3300050490 | nmdc:mga03n38_27443_c1 | nmdc:mga03n38_27443_c1_1693_2262 | 184 |
| 415 | 3300050490 | nmdc:mga03n38_37121_c1 | nmdc:mga03n38_37121_c1_665_1228 | 184 |
| 416 | 3300050492 | nmdc:mga0yw44_5923_c1 | nmdc:mga0yw44_5923_c1_3160_3723 | 184 |
| 417 | 3300050494 | nmdc:mga06z11_118768_c1 | nmdc:mga06z11_118768_c1_734_1297 | 184 |
| 418 | 3300050495 | nmdc:mga04h51_210507_c1 | nmdc:mga04h51_210507_c1_16_570 | 184 |
| 419 | 3300050496 | nmdc:mga07m45_52779_c1 | nmdc:mga07m45_52779_c1_1637_2191 | 184 |
| 420 | 3300053077 | Ga0495601_0575910 | Ga0495601_0575910_98_652 | 184 |
| 421 | 3300053083 | Ga0495655_0053411 | Ga0495655_0053411_223_777 | 184 |
| 422 | 3300053091 | Ga0500647_0147659 | Ga0500647_0147659_225_797 | 184 |
| 423 | 3300053093 | Ga0500651_0365165 | Ga0500651_0365165_178_732 | 184 |
| 424 | 3300053097 | Ga0500648_074567 | Ga0500648_074567_816_1385 | 184 |
| 425 | 3300053139 | Ga0500568_0191005 | Ga0500568_0191005_83_637 | 184 |
| 426 | 3300053145 | Ga0500586_011778 | Ga0500586_011778_1578_2132 | 184 |
| 427 | 3300053158 | Ga0500627_0189790 | Ga0500627_0189790_76_630 | 184 |
| 428 | 3300053723 | Ga0500567_068705 | Ga0500567_068705_822_1376 | 184 |
| 429 | iso_pu_bacteria | 2524023228 | 2524538581 | 184 |
| 430 | iso_pu_bacteria | 2904699407 | 2904703521 | 184 |
| 431 | iso_pu_bacteria | 8006933436 | 8006940610 | 184 |
| 432 | iso_pu_bacteria | 8006973647 | 8006980299 | 184 |
| 433 | 3300001990 | JGI24737J22298_10044120 | JGI24737J22298_100441202 | 185 |
| 434 | 3300002077 | JGI24744J21845_10007871 | JGI24744J21845_100078712 | 185 |
| 435 | 3300003203 | JGI25406J46586_10000104 | JGI25406J46586_1000010417 | 185 |
| 436 | 3300003215 | JGI25153J46596_10001106 | JGI25153J46596_1000110610 | 185 |
| 437 | 3300005328 | Ga0070676_10042094 | Ga0070676_100420943 | 185 |
| 438 | 3300005328 | Ga0070676_10680029 | Ga0070676_106800291 | 185 |
| 439 | 3300005329 | Ga0070683_100390438 | Ga0070683_1003904382 | 185 |
| 440 | 3300005330 | Ga0070690_100377428 | Ga0070690_1003774282 | 185 |
| 441 | 3300005330 | Ga0070690_100414628 | Ga0070690_1004146282 | 185 |
| 442 | 3300005331 | Ga0070670_100217605 | Ga0070670_1002176052 | 185 |
| 443 | 3300005334 | Ga0068869_100102861 | Ga0068869_1001028612 | 185 |
| 444 | 3300005334 | Ga0068869_100974494 | Ga0068869_1009744941 | 185 |
| 445 | 3300005335 | Ga0070666_10539928 | Ga0070666_105399281 | 185 |
| 446 | 3300005336 | Ga0070680_100081052 | Ga0070680_1000810522 | 185 |
| 447 | 3300005337 | Ga0070682_100110843 | Ga0070682_1001108432 | 185 |
| 448 | 3300005337 | Ga0070682_100163513 | Ga0070682_1001635132 | 185 |
| 449 | 3300005337 | Ga0070682_100182044 | Ga0070682_1001820441 | 185 |
| 450 | 3300005338 | Ga0068868_100007248 | Ga0068868_1000072486 | 185 |
| 451 | 3300005338 | Ga0068868_100034333 | Ga0068868_1000343334 | 185 |
| 452 | 3300005338 | Ga0068868_100671185 | Ga0068868_1006711851 | 185 |
| 453 | 3300005338 | Ga0068868_100701086 | Ga0068868_1007010861 | 185 |
| 454 | 3300005339 | Ga0070660_100075327 | Ga0070660_1000753273 | 185 |
| 455 | 3300005339 | Ga0070660_100176267 | Ga0070660_1001762672 | 185 |
| 456 | 3300005340 | Ga0070689_100627965 | Ga0070689_1006279652 | 185 |
| 457 | 3300005347 | Ga0070668_100071521 | Ga0070668_1000715212 | 185 |
| 458 | 3300005347 | Ga0070668_100169745 | Ga0070668_1001697452 | 185 |
| 459 | 3300005347 | Ga0070668_100524107 | Ga0070668_1005241072 | 185 |
| 460 | 3300005354 | Ga0070675_101132990 | Ga0070675_1011329901 | 185 |
| 461 | 3300005355 | Ga0070671_100141963 | Ga0070671_1001419633 | 185 |
| 462 | 3300005355 | Ga0070671_100160036 | Ga0070671_1001600362 | 185 |
| 463 | 3300005355 | Ga0070671_100249989 | Ga0070671_1002499892 | 185 |
| 464 | 3300005366 | Ga0070659_100029963 | Ga0070659_1000299633 | 185 |
| 465 | 3300005366 | Ga0070659_100120478 | Ga0070659_1001204782 | 185 |
| 466 | 3300005366 | Ga0070659_100650705 | Ga0070659_1006507051 | 185 |
| 467 | 3300005366 | Ga0070659_100722896 | Ga0070659_1007228962 | 185 |
| 468 | 3300005367 | Ga0070667_100062286 | Ga0070667_1000622863 | 185 |
| 469 | 3300005434 | Ga0070709_10175697 | Ga0070709_101756972 | 185 |
| 470 | 3300005434 | Ga0070709_10471830 | Ga0070709_104718301 | 185 |
| 471 | 3300005436 | Ga0070713_100359384 | Ga0070713_1003593842 | 185 |
| 472 | 3300005437 | Ga0070710_10099270 | Ga0070710_100992702 | 185 |
| 473 | 3300005437 | Ga0070710_10252981 | Ga0070710_102529812 | 185 |
| 474 | 3300005437 | Ga0070710_10462722 | Ga0070710_104627222 | 185 |
| 475 | 3300005438 | Ga0070701_10051111 | Ga0070701_100511112 | 185 |
| 476 | 3300005439 | Ga0070711_100007982 | Ga0070711_1000079825 | 185 |
| 477 | 3300005441 | Ga0070700_100029109 | Ga0070700_1000291092 | 185 |
| 478 | 3300005455 | Ga0070663_100002929 | Ga0070663_10000292913 | 185 |
| 479 | 3300005455 | Ga0070663_100031336 | Ga0070663_1000313363 | 185 |
| 480 | 3300005455 | Ga0070663_100039960 | Ga0070663_1000399601 | 185 |
| 481 | 3300005455 | Ga0070663_100078560 | Ga0070663_1000785603 | 185 |
| 482 | 3300005455 | Ga0070663_100616613 | Ga0070663_1006166132 | 185 |
| 483 | 3300005455 | Ga0070663_101042183 | Ga0070663_1010421831 | 185 |
| 484 | 3300005456 | Ga0070678_100048839 | Ga0070678_1000488391 | 185 |
| 485 | 3300005456 | Ga0070678_100169375 | Ga0070678_1001693752 | 185 |
| 486 | 3300005456 | Ga0070678_100410784 | Ga0070678_1004107842 | 185 |
| 487 | 3300005457 | Ga0070662_100028974 | Ga0070662_1000289742 | 185 |
| 488 | 3300005457 | Ga0070662_100045363 | Ga0070662_1000453633 | 185 |
| 489 | 3300005457 | Ga0070662_100217027 | Ga0070662_1002170272 | 185 |
| 490 | 3300005458 | Ga0070681_10036057 | Ga0070681_100360573 | 185 |
| 491 | 3300005458 | Ga0070681_10491334 | Ga0070681_104913341 | 185 |
| 492 | 3300005458 | Ga0070681_10699284 | Ga0070681_106992841 | 185 |
| 493 | 3300005459 | Ga0068867_100186194 | Ga0068867_1001861942 | 185 |
| 494 | 3300005471 | Ga0070698_100112992 | Ga0070698_1001129923 | 185 |
| 495 | 3300005530 | Ga0070679_100020404 | Ga0070679_1000204043 | 185 |
| 496 | 3300005530 | Ga0070679_100043395 | Ga0070679_1000433953 | 185 |
| 497 | 3300005530 | Ga0070679_100066920 | Ga0070679_1000669203 | 185 |
| 498 | 3300005535 | Ga0070684_100095276 | Ga0070684_1000952763 | 185 |
| 499 | 3300005535 | Ga0070684_100221335 | Ga0070684_1002213352 | 185 |
| 500 | 3300005536 | Ga0070697_100128010 | Ga0070697_1001280102 | 185 |
| 501 | 3300005539 | Ga0068853_100029364 | Ga0068853_1000293643 | 185 |
| 502 | 3300005539 | Ga0068853_100084664 | Ga0068853_1000846643 | 185 |
| 503 | 3300005539 | Ga0068853_100282325 | Ga0068853_1002823251 | 185 |
| 504 | 3300005543 | Ga0070672_100048601 | Ga0070672_1000486012 | 185 |
| 505 | 3300005544 | Ga0070686_100339296 | Ga0070686_1003392962 | 185 |
| 506 | 3300005547 | Ga0070693_100022866 | Ga0070693_1000228664 | 185 |
| 507 | 3300005547 | Ga0070693_100052550 | Ga0070693_1000525503 | 185 |
| 508 | 3300005548 | Ga0070665_100052300 | Ga0070665_1000523004 | 185 |
| 509 | 3300005548 | Ga0070665_100160319 | Ga0070665_1001603192 | 185 |
| 510 | 3300005548 | Ga0070665_100390460 | Ga0070665_1003904602 | 185 |
| 511 | 3300005563 | Ga0068855_100070167 | Ga0068855_1000701673 | 185 |
| 512 | 3300005563 | Ga0068855_100669825 | Ga0068855_1006698252 | 185 |
| 513 | 3300005564 | Ga0070664_100545762 | Ga0070664_1005457622 | 185 |
| 514 | 3300005577 | Ga0068857_100003351 | Ga0068857_1000033512 | 185 |
| 515 | 3300005577 | Ga0068857_100228560 | Ga0068857_1002285602 | 185 |
| 516 | 3300005577 | Ga0068857_100325994 | Ga0068857_1003259942 | 185 |
| 517 | 3300005578 | Ga0068854_100117469 | Ga0068854_1001174692 | 185 |
| 518 | 3300005578 | Ga0068854_100236089 | Ga0068854_1002360892 | 185 |
| 519 | 3300005578 | Ga0068854_100334583 | Ga0068854_1003345832 | 185 |
| 520 | 3300005578 | Ga0068854_100451257 | Ga0068854_1004512572 | 185 |
| 521 | 3300005614 | Ga0068856_100000082 | Ga0068856_10000008269 | 185 |
| 522 | 3300005614 | Ga0068856_100027659 | Ga0068856_1000276594 | 185 |
| 523 | 3300005614 | Ga0068856_100044548 | Ga0068856_1000445483 | 185 |
| 524 | 3300005615 | Ga0070702_100570022 | Ga0070702_1005700221 | 185 |
| 525 | 3300005615 | Ga0070702_100759358 | Ga0070702_1007593582 | 185 |
| 526 | 3300005616 | Ga0068852_100056294 | Ga0068852_1000562942 | 185 |
| 527 | 3300005616 | Ga0068852_100096821 | Ga0068852_1000968212 | 185 |
| 528 | 3300005616 | Ga0068852_100112587 | Ga0068852_1001125872 | 185 |
| 529 | 3300005616 | Ga0068852_100755725 | Ga0068852_1007557252 | 185 |
| 530 | 3300005617 | Ga0068859_100226342 | Ga0068859_1002263422 | 185 |
| 531 | 3300005617 | Ga0068859_100285421 | Ga0068859_1002854212 | 185 |
| 532 | 3300005618 | Ga0068864_100025302 | Ga0068864_1000253024 | 185 |
| 533 | 3300005618 | Ga0068864_100080894 | Ga0068864_1000808942 | 185 |
| 534 | 3300005718 | Ga0068866_10012084 | Ga0068866_100120842 | 185 |
| 535 | 3300005718 | Ga0068866_10137352 | Ga0068866_101373522 | 185 |
| 536 | 3300005718 | Ga0068866_10517967 | Ga0068866_105179672 | 185 |
| 537 | 3300005719 | Ga0068861_100135031 | Ga0068861_1001350311 | 185 |
| 538 | 3300005834 | Ga0068851_10249285 | Ga0068851_102492851 | 185 |
| 539 | 3300005840 | Ga0068870_10059157 | Ga0068870_100591572 | 185 |
| 540 | 3300005841 | Ga0068863_100714978 | Ga0068863_1007149781 | 185 |
| 541 | 3300005841 | Ga0068863_100946924 | Ga0068863_1009469241 | 185 |
| 542 | 3300005842 | Ga0068858_100121056 | Ga0068858_1001210562 | 185 |
| 543 | 3300005843 | Ga0068860_100173616 | Ga0068860_1001736163 | 185 |
| 544 | 3300005843 | Ga0068860_100643963 | Ga0068860_1006439632 | 185 |
| 545 | 3300005844 | Ga0068862_100053834 | Ga0068862_1000538342 | 185 |
| 546 | 3300005844 | Ga0068862_100152717 | Ga0068862_1001527172 | 185 |
| 547 | 3300005844 | Ga0068862_100502988 | Ga0068862_1005029882 | 185 |
| 548 | 3300005937 | Ga0081455_10220768 | Ga0081455_102207682 | 185 |
| 549 | 3300005937 | Ga0081455_10388858 | Ga0081455_103888582 | 185 |
| 550 | 3300005983 | Ga0081540_1002092 | Ga0081540_10020929 | 185 |
| 551 | 3300005983 | Ga0081540_1004102 | Ga0081540_10041025 | 185 |
| 552 | 3300005983 | Ga0081540_1004519 | Ga0081540_100451913 | 185 |
| 553 | 3300005983 | Ga0081540_1016640 | Ga0081540_10166402 | 185 |
| 554 | 3300005983 | Ga0081540_1056399 | Ga0081540_10563992 | 185 |
| 555 | 3300005985 | Ga0081539_10000273 | Ga0081539_10000273109 | 185 |
| 556 | 3300005985 | Ga0081539_10009974 | Ga0081539_100099742 | 185 |
| 557 | 3300005985 | Ga0081539_10084603 | Ga0081539_100846032 | 185 |
| 558 | 3300006038 | Ga0075365_10032588 | Ga0075365_100325882 | 185 |
| 559 | 3300006038 | Ga0075365_10033942 | Ga0075365_100339423 | 185 |
| 560 | 3300006042 | Ga0075368_10022328 | Ga0075368_100223283 | 185 |
| 561 | 3300006048 | Ga0075363_100039459 | Ga0075363_1000394593 | 185 |
| 562 | 3300006048 | Ga0075363_100245716 | Ga0075363_1002457162 | 185 |
| 563 | 3300006051 | Ga0075364_10026565 | Ga0075364_100265653 | 185 |
| 564 | 3300006051 | Ga0075364_10064370 | Ga0075364_100643703 | 185 |
| 565 | 3300006175 | Ga0070712_100007030 | Ga0070712_1000070304 | 185 |
| 566 | 3300006175 | Ga0070712_100048117 | Ga0070712_1000481172 | 185 |
| 567 | 3300006178 | Ga0075367_10033118 | Ga0075367_100331184 | 185 |
| 568 | 3300006178 | Ga0075367_10067366 | Ga0075367_100673663 | 185 |
| 569 | 3300006178 | Ga0075367_10070568 | Ga0075367_100705682 | 185 |
| 570 | 3300006186 | Ga0075369_10194898 | Ga0075369_101948982 | 185 |
| 571 | 3300006195 | Ga0075366_10189891 | Ga0075366_101898912 | 185 |
| 572 | 3300006237 | Ga0097621_100083061 | Ga0097621_1000830613 | 185 |
| 573 | 3300006353 | Ga0075370_10017192 | Ga0075370_100171922 | 185 |
| 574 | 3300006353 | Ga0075370_10052063 | Ga0075370_100520632 | 185 |
| 575 | 3300006358 | Ga0068871_100304142 | Ga0068871_1003041422 | 185 |
| 576 | 3300006844 | Ga0075428_100174800 | Ga0075428_1001748002 | 185 |
| 577 | 3300006844 | Ga0075428_100263228 | Ga0075428_1002632281 | 185 |
| 578 | 3300006871 | Ga0075434_100203577 | Ga0075434_1002035772 | 185 |
| 579 | 3300006881 | Ga0068865_100507280 | Ga0068865_1005072801 | 185 |
| 580 | 3300006931 | Ga0097620_100226341 | Ga0097620_1002263412 | 185 |
| 581 | 3300006931 | Ga0097620_100285417 | Ga0097620_1002854172 | 185 |
| 582 | 3300006931 | Ga0097620_100438716 | Ga0097620_1004387162 | 185 |
| 583 | 3300007265 | Ga0099794_10008554 | Ga0099794_100085544 | 185 |
| 584 | 3300007788 | Ga0099795_10009675 | Ga0099795_100096752 | 185 |
| 585 | 3300007788 | Ga0099795_10029973 | Ga0099795_100299733 | 185 |
| 586 | 3300009093 | Ga0105240_10007507 | Ga0105240_100075076 | 185 |
| 587 | 3300009093 | Ga0105240_10050611 | Ga0105240_100506113 | 185 |
| 588 | 3300009093 | Ga0105240_10095181 | Ga0105240_100951813 | 185 |
| 589 | 3300009094 | Ga0111539_10136421 | Ga0111539_101364213 | 185 |
| 590 | 3300009101 | Ga0105247_10016251 | Ga0105247_100162514 | 185 |
| 591 | 3300009101 | Ga0105247_10235465 | Ga0105247_102354652 | 185 |
| 592 | 3300009101 | Ga0105247_10367823 | Ga0105247_103678232 | 185 |
| 593 | 3300009147 | Ga0114129_10064849 | Ga0114129_100648494 | 185 |
| 594 | 3300009148 | Ga0105243_10027582 | Ga0105243_100275824 | 185 |
| 595 | 3300009148 | Ga0105243_10196369 | Ga0105243_101963693 | 185 |
| 596 | 3300009148 | Ga0105243_10946454 | Ga0105243_109464542 | 185 |
| 597 | 3300009174 | Ga0105241_10010606 | Ga0105241_100106062 | 185 |
| 598 | 3300009174 | Ga0105241_10032329 | Ga0105241_100323294 | 185 |
| 599 | 3300009174 | Ga0105241_10041152 | Ga0105241_100411523 | 185 |
| 600 | 3300009174 | Ga0105241_10219524 | Ga0105241_102195242 | 185 |
| 601 | 3300009176 | Ga0105242_10125087 | Ga0105242_101250873 | 185 |
| 602 | 3300009177 | Ga0105248_10223621 | Ga0105248_102236213 | 185 |
| 603 | 3300009177 | Ga0105248_10238890 | Ga0105248_102388902 | 185 |
| 604 | 3300009177 | Ga0105248_10478146 | Ga0105248_104781463 | 185 |
| 605 | 3300009177 | Ga0105248_10546523 | Ga0105248_105465232 | 185 |
| 606 | 3300009177 | Ga0105248_11203018 | Ga0105248_112030182 | 185 |
| 607 | 3300009545 | Ga0105237_10052204 | Ga0105237_100522043 | 185 |
| 608 | 3300009545 | Ga0105237_10124318 | Ga0105237_101243183 | 185 |
| 609 | 3300009545 | Ga0105237_10250559 | Ga0105237_102505593 | 185 |
| 610 | 3300009545 | Ga0105237_10262981 | Ga0105237_102629812 | 185 |
| 611 | 3300009545 | Ga0105237_10475461 | Ga0105237_104754612 | 185 |
| 612 | 3300009551 | Ga0105238_10027110 | Ga0105238_100271104 | 185 |
| 613 | 3300009551 | Ga0105238_10205293 | Ga0105238_102052932 | 185 |
| 614 | 3300009553 | Ga0105249_10241385 | Ga0105249_102413853 | 185 |
| 615 | 3300010159 | Ga0099796_10002843 | Ga0099796_100028433 | 185 |
| 616 | 3300010159 | Ga0099796_10262689 | Ga0099796_102626892 | 185 |
| 617 | 3300010375 | Ga0105239_10016782 | Ga0105239_100167823 | 185 |
| 618 | 3300010375 | Ga0105239_10043449 | Ga0105239_100434493 | 185 |
| 619 | 3300010375 | Ga0105239_10214770 | Ga0105239_102147702 | 185 |
| 620 | 3300010375 | Ga0105239_10272943 | Ga0105239_102729432 | 185 |
| 621 | 3300010375 | Ga0105239_10280590 | Ga0105239_102805902 | 185 |
| 622 | 3300013102 | Ga0157371_10103344 | Ga0157371_101033442 | 185 |
| 623 | 3300013105 | Ga0157369_10003890 | Ga0157369_1000389022 | 185 |
| 624 | 3300013105 | Ga0157369_10160692 | Ga0157369_101606922 | 185 |
| 625 | 3300013296 | Ga0157374_10595416 | Ga0157374_105954162 | 185 |
| 626 | 3300013297 | Ga0157378_10043554 | Ga0157378_100435544 | 185 |
| 627 | 3300013297 | Ga0157378_10052830 | Ga0157378_100528303 | 185 |
| 628 | 3300013297 | Ga0157378_10493435 | Ga0157378_104934352 | 185 |
| 629 | 3300013297 | Ga0157378_10840866 | Ga0157378_108408662 | 185 |
| 630 | 3300013306 | Ga0163162_10003676 | Ga0163162_1000367613 | 185 |
| 631 | 3300013306 | Ga0163162_10100717 | Ga0163162_101007174 | 185 |
| 632 | 3300013306 | Ga0163162_10529953 | Ga0163162_105299532 | 185 |
| 633 | 3300013306 | Ga0163162_10635620 | Ga0163162_106356201 | 185 |
| 634 | 3300013307 | Ga0157372_10093100 | Ga0157372_100931003 | 185 |
| 635 | 3300013307 | Ga0157372_10221124 | Ga0157372_102211243 | 185 |
| 636 | 3300013308 | Ga0157375_10336630 | Ga0157375_103366302 | 185 |
| 637 | 3300013308 | Ga0157375_11329358 | Ga0157375_113293581 | 185 |
| 638 | 3300013308 | Ga0157375_11654959 | Ga0157375_116549592 | 185 |
| 639 | 3300014325 | Ga0163163_10144284 | Ga0163163_101442842 | 185 |
| 640 | 3300014326 | Ga0157380_10447494 | Ga0157380_104474941 | 185 |
| 641 | 3300014745 | Ga0157377_10144231 | Ga0157377_101442312 | 185 |
| 642 | 3300014968 | Ga0157379_10075745 | Ga0157379_100757454 | 185 |
| 643 | 3300014969 | Ga0157376_10013748 | Ga0157376_100137482 | 185 |
| 644 | 3300017792 | Ga0163161_10382935 | Ga0163161_103829352 | 185 |
| 645 | 3300020082 | Ga0206353_11059723 | Ga0206353_110597232 | 185 |
| 646 | 3300021384 | Ga0213876_10183644 | Ga0213876_101836442 | 185 |
| 647 | 3300021388 | Ga0213875_10024351 | Ga0213875_100243512 | 185 |
| 648 | 3300025261 | Ga0209233_1002573 | Ga0209233_10025733 | 185 |
| 649 | 3300025297 | Ga0209758_1036773 | Ga0209758_10367731 | 185 |
| 650 | 3300025315 | Ga0207697_10007446 | Ga0207697_100074465 | 185 |
| 651 | 3300025321 | Ga0207656_10016121 | Ga0207656_100161212 | 185 |
| 652 | 3300025321 | Ga0207656_10034050 | Ga0207656_100340502 | 185 |
| 653 | 3300025898 | Ga0207692_10092661 | Ga0207692_100926611 | 185 |
| 654 | 3300025898 | Ga0207692_10180757 | Ga0207692_101807572 | 185 |
| 655 | 3300025898 | Ga0207692_10332900 | Ga0207692_103329002 | 185 |
| 656 | 3300025899 | Ga0207642_10415068 | Ga0207642_104150682 | 185 |
| 657 | 3300025900 | Ga0207710_10030090 | Ga0207710_100300902 | 185 |
| 658 | 3300025900 | Ga0207710_10166674 | Ga0207710_101666742 | 185 |
| 659 | 3300025901 | Ga0207688_10063847 | Ga0207688_100638472 | 185 |
| 660 | 3300025901 | Ga0207688_10088380 | Ga0207688_100883802 | 185 |
| 661 | 3300025903 | Ga0207680_10389013 | Ga0207680_103890131 | 185 |
| 662 | 3300025904 | Ga0207647_10073492 | Ga0207647_100734921 | 185 |
| 663 | 3300025906 | Ga0207699_10065182 | Ga0207699_100651823 | 185 |
| 664 | 3300025907 | Ga0207645_10144718 | Ga0207645_101447182 | 185 |
| 665 | 3300025907 | Ga0207645_10212347 | Ga0207645_102123471 | 185 |
| 666 | 3300025908 | Ga0207643_10037354 | Ga0207643_100373542 | 185 |
| 667 | 3300025909 | Ga0207705_10492075 | Ga0207705_104920751 | 185 |
| 668 | 3300025910 | Ga0207684_10517856 | Ga0207684_105178562 | 185 |
| 669 | 3300025911 | Ga0207654_10011369 | Ga0207654_100113693 | 185 |
| 670 | 3300025911 | Ga0207654_10012520 | Ga0207654_100125205 | 185 |
| 671 | 3300025912 | Ga0207707_10002249 | Ga0207707_100022495 | 185 |
| 672 | 3300025912 | Ga0207707_10245836 | Ga0207707_102458362 | 185 |
| 673 | 3300025913 | Ga0207695_10139649 | Ga0207695_101396493 | 185 |
| 674 | 3300025913 | Ga0207695_10187481 | Ga0207695_101874813 | 185 |
| 675 | 3300025913 | Ga0207695_10193093 | Ga0207695_101930933 | 185 |
| 676 | 3300025914 | Ga0207671_10040002 | Ga0207671_100400023 | 185 |
| 677 | 3300025914 | Ga0207671_10078202 | Ga0207671_100782022 | 185 |
| 678 | 3300025914 | Ga0207671_10166173 | Ga0207671_101661732 | 185 |
| 679 | 3300025914 | Ga0207671_10320000 | Ga0207671_103200002 | 185 |
| 680 | 3300025915 | Ga0207693_10022609 | Ga0207693_100226092 | 185 |
| 681 | 3300025915 | Ga0207693_10200987 | Ga0207693_102009872 | 185 |
| 682 | 3300025916 | Ga0207663_10099139 | Ga0207663_100991392 | 185 |
| 683 | 3300025917 | Ga0207660_10046822 | Ga0207660_100468223 | 185 |
| 684 | 3300025917 | Ga0207660_10107578 | Ga0207660_101075782 | 185 |
| 685 | 3300025919 | Ga0207657_10007732 | Ga0207657_100077327 | 185 |
| 686 | 3300025919 | Ga0207657_10069057 | Ga0207657_100690572 | 185 |
| 687 | 3300025919 | Ga0207657_10159573 | Ga0207657_101595733 | 185 |
| 688 | 3300025921 | Ga0207652_10121286 | Ga0207652_101212862 | 185 |
| 689 | 3300025921 | Ga0207652_10806909 | Ga0207652_108069092 | 185 |
| 690 | 3300025924 | Ga0207694_10157408 | Ga0207694_101574082 | 185 |
| 691 | 3300025924 | Ga0207694_10310874 | Ga0207694_103108742 | 185 |
| 692 | 3300025927 | Ga0207687_10035364 | Ga0207687_100353643 | 185 |
| 693 | 3300025927 | Ga0207687_10092287 | Ga0207687_100922872 | 185 |
| 694 | 3300025929 | Ga0207664_10527674 | Ga0207664_105276742 | 185 |
| 695 | 3300025931 | Ga0207644_10242514 | Ga0207644_102425142 | 185 |
| 696 | 3300025931 | Ga0207644_10287687 | Ga0207644_102876872 | 185 |
| 697 | 3300025931 | Ga0207644_10480571 | Ga0207644_104805711 | 185 |
| 698 | 3300025932 | Ga0207690_10025604 | Ga0207690_100256043 | 185 |
| 699 | 3300025932 | Ga0207690_10218753 | Ga0207690_102187532 | 185 |
| 700 | 3300025932 | Ga0207690_10727909 | Ga0207690_107279092 | 185 |
| 701 | 3300025933 | Ga0207706_10042603 | Ga0207706_100426033 | 185 |
| 702 | 3300025933 | Ga0207706_10067659 | Ga0207706_100676592 | 185 |
| 703 | 3300025933 | Ga0207706_10091791 | Ga0207706_100917913 | 185 |
| 704 | 3300025934 | Ga0207686_10049830 | Ga0207686_100498302 | 185 |
| 705 | 3300025935 | Ga0207709_10145504 | Ga0207709_101455041 | 185 |
| 706 | 3300025935 | Ga0207709_10708284 | Ga0207709_107082842 | 185 |
| 707 | 3300025936 | Ga0207670_10489586 | Ga0207670_104895861 | 185 |
| 708 | 3300025937 | Ga0207669_10852329 | Ga0207669_108523291 | 185 |
| 709 | 3300025938 | Ga0207704_10143682 | Ga0207704_101436822 | 185 |
| 710 | 3300025939 | Ga0207665_10240753 | Ga0207665_102407532 | 185 |
| 711 | 3300025939 | Ga0207665_10592992 | Ga0207665_105929922 | 185 |
| 712 | 3300025940 | Ga0207691_10026804 | Ga0207691_100268044 | 185 |
| 713 | 3300025940 | Ga0207691_10252104 | Ga0207691_102521042 | 185 |
| 714 | 3300025941 | Ga0207711_10032973 | Ga0207711_100329733 | 185 |
| 715 | 3300025941 | Ga0207711_10277232 | Ga0207711_102772322 | 185 |
| 716 | 3300025942 | Ga0207689_10016101 | Ga0207689_100161013 | 185 |
| 717 | 3300025942 | Ga0207689_10032079 | Ga0207689_100320792 | 185 |
| 718 | 3300025942 | Ga0207689_10282952 | Ga0207689_102829522 | 185 |
| 719 | 3300025944 | Ga0207661_10056472 | Ga0207661_100564722 | 185 |
| 720 | 3300025944 | Ga0207661_10138341 | Ga0207661_101383412 | 185 |
| 721 | 3300025945 | Ga0207679_10406243 | Ga0207679_104062432 | 185 |
| 722 | 3300025949 | Ga0207667_10078922 | Ga0207667_100789222 | 185 |
| 723 | 3300025949 | Ga0207667_10124426 | Ga0207667_101244261 | 185 |
| 724 | 3300025949 | Ga0207667_10373265 | Ga0207667_103732653 | 185 |
| 725 | 3300025960 | Ga0207651_10194943 | Ga0207651_101949432 | 185 |
| 726 | 3300025960 | Ga0207651_10259520 | Ga0207651_102595203 | 185 |
| 727 | 3300025961 | Ga0207712_10143860 | Ga0207712_101438602 | 185 |
| 728 | 3300025972 | Ga0207668_10251943 | Ga0207668_102519432 | 185 |
| 729 | 3300025972 | Ga0207668_10296081 | Ga0207668_102960812 | 185 |
| 730 | 3300025972 | Ga0207668_10661205 | Ga0207668_106612051 | 185 |
| 731 | 3300025981 | Ga0207640_10108236 | Ga0207640_101082363 | 185 |
| 732 | 3300025981 | Ga0207640_10208305 | Ga0207640_102083052 | 185 |
| 733 | 3300025981 | Ga0207640_10263763 | Ga0207640_102637631 | 185 |
| 734 | 3300025981 | Ga0207640_11201095 | Ga0207640_112010952 | 185 |
| 735 | 3300025986 | Ga0207658_10075699 | Ga0207658_100756993 | 185 |
| 736 | 3300026023 | Ga0207677_10040296 | Ga0207677_100402964 | 185 |
| 737 | 3300026023 | Ga0207677_10081207 | Ga0207677_100812073 | 185 |
| 738 | 3300026023 | Ga0207677_10227651 | Ga0207677_102276512 | 185 |
| 739 | 3300026035 | Ga0207703_10025797 | Ga0207703_100257973 | 185 |
| 740 | 3300026041 | Ga0207639_10088194 | Ga0207639_100881942 | 185 |
| 741 | 3300026041 | Ga0207639_10317014 | Ga0207639_103170142 | 185 |
| 742 | 3300026067 | Ga0207678_10026492 | Ga0207678_100264923 | 185 |
| 743 | 3300026067 | Ga0207678_10028300 | Ga0207678_100283003 | 185 |
| 744 | 3300026067 | Ga0207678_10075795 | Ga0207678_100757953 | 185 |
| 745 | 3300026067 | Ga0207678_10264852 | Ga0207678_102648521 | 185 |
| 746 | 3300026067 | Ga0207678_10293294 | Ga0207678_102932942 | 185 |
| 747 | 3300026078 | Ga0207702_10000048 | Ga0207702_1000004864 | 185 |
| 748 | 3300026078 | Ga0207702_10003315 | Ga0207702_100033153 | 185 |
| 749 | 3300026078 | Ga0207702_10345601 | Ga0207702_103456012 | 185 |
| 750 | 3300026078 | Ga0207702_10445797 | Ga0207702_104457972 | 185 |
| 751 | 3300026089 | Ga0207648_10016066 | Ga0207648_100160662 | 185 |
| 752 | 3300026095 | Ga0207676_10307804 | Ga0207676_103078042 | 185 |
| 753 | 3300026116 | Ga0207674_10005787 | Ga0207674_1000578718 | 185 |
| 754 | 3300026116 | Ga0207674_10033065 | Ga0207674_100330653 | 185 |
| 755 | 3300026116 | Ga0207674_10060928 | Ga0207674_100609282 | 185 |
| 756 | 3300026116 | Ga0207674_10238357 | Ga0207674_102383572 | 185 |
| 757 | 3300026118 | Ga0207675_100262760 | Ga0207675_1002627601 | 185 |
| 758 | 3300026121 | Ga0207683_10016292 | Ga0207683_100162925 | 185 |
| 759 | 3300026121 | Ga0207683_10067330 | Ga0207683_100673302 | 185 |
| 760 | 3300026121 | Ga0207683_10082790 | Ga0207683_100827902 | 185 |
| 761 | 3300026121 | Ga0207683_10107128 | Ga0207683_101071282 | 185 |
| 762 | 3300026121 | Ga0207683_10322542 | Ga0207683_103225422 | 185 |
| 763 | 3300026142 | Ga0207698_10069860 | Ga0207698_100698602 | 185 |
| 764 | 3300026142 | Ga0207698_10083649 | Ga0207698_100836493 | 185 |
| 765 | 3300026142 | Ga0207698_10151503 | Ga0207698_101515032 | 185 |
| 766 | 3300026142 | Ga0207698_10713644 | Ga0207698_107136441 | 185 |
| 767 | 3300027512 | Ga0209179_1011432 | Ga0209179_10114323 | 185 |
| 768 | 3300027907 | Ga0207428_10069972 | Ga0207428_100699723 | 185 |
| 769 | 3300028379 | Ga0268266_10004442 | Ga0268266_1000444214 | 185 |
| 770 | 3300028379 | Ga0268266_10126879 | Ga0268266_101268793 | 185 |
| 771 | 3300028379 | Ga0268266_10209865 | Ga0268266_102098652 | 185 |
| 772 | 3300028380 | Ga0268265_10071618 | Ga0268265_100716183 | 185 |
| 773 | 3300028380 | Ga0268265_10162624 | Ga0268265_101626242 | 185 |
| 774 | 3300028380 | Ga0268265_10485260 | Ga0268265_104852602 | 185 |
| 775 | 3300028380 | Ga0268265_11081574 | Ga0268265_110815742 | 185 |
| 776 | 3300028381 | Ga0268264_10000022 | Ga0268264_10000022464 | 185 |
| 777 | 3300028381 | Ga0268264_10177357 | Ga0268264_101773571 | 185 |
| 778 | 3300028573 | Ga0265334_10000447 | Ga0265334_100004477 | 185 |
| 779 | 3300028577 | Ga0265318_10195061 | Ga0265318_101950612 | 185 |
| 780 | 3300028666 | Ga0265336_10000686 | Ga0265336_100006863 | 185 |
| 781 | 3300028786 | Ga0307517_10226476 | Ga0307517_102264762 | 185 |
| 782 | 3300030521 | Ga0307511_10056903 | Ga0307511_100569033 | 185 |
| 783 | 3300031235 | Ga0265330_10013362 | Ga0265330_100133622 | 185 |
| 784 | 3300031235 | Ga0265330_10015725 | Ga0265330_100157254 | 185 |
| 785 | 3300031241 | Ga0265325_10038531 | Ga0265325_100385313 | 185 |
| 786 | 3300031242 | Ga0265329_10114475 | Ga0265329_101144752 | 185 |
| 787 | 3300031247 | Ga0265340_10007187 | Ga0265340_100071876 | 185 |
| 788 | 3300031249 | Ga0265339_10046894 | Ga0265339_100468943 | 185 |
| 789 | 3300031249 | Ga0265339_10210956 | Ga0265339_102109561 | 185 |
| 790 | 3300031250 | Ga0265331_10039137 | Ga0265331_100391373 | 185 |
| 791 | 3300031344 | Ga0265316_10397287 | Ga0265316_103972872 | 185 |
| 792 | 3300031344 | Ga0265316_10511624 | Ga0265316_105116242 | 185 |
| 793 | 3300031456 | Ga0307513_10166927 | Ga0307513_101669272 | 185 |
| 794 | 3300031548 | Ga0307408_100160361 | Ga0307408_1001603612 | 185 |
| 795 | 3300031616 | Ga0307508_10047463 | Ga0307508_100474632 | 185 |
| 796 | 3300031616 | Ga0307508_10096367 | Ga0307508_100963672 | 185 |
| 797 | 3300031712 | Ga0265342_10080887 | Ga0265342_100808872 | 185 |
| 798 | 3300031712 | Ga0265342_10094370 | Ga0265342_100943702 | 185 |
| 799 | 3300031712 | Ga0265342_10157414 | Ga0265342_101574142 | 185 |
| 800 | 3300031730 | Ga0307516_10058764 | Ga0307516_100587642 | 185 |
| 801 | 3300031852 | Ga0307410_10273312 | Ga0307410_102733122 | 185 |
| 802 | 3300031852 | Ga0307410_10692832 | Ga0307410_106928322 | 185 |
| 803 | 3300033180 | Ga0307510_10213579 | Ga0307510_102135792 | 185 |
| 804 | 3300033442 | Ga0315911_1000001 | Ga0315911_100000178 | 185 |
| 805 | 3300035083 | Ga0373926_0031879 | Ga0373926_0031879_1073_1630 | 185 |
| 806 | 3300035086 | Ga0373934_0011895 | Ga0373934_0011895_287_844 | 185 |
| 807 | 3300035086 | Ga0373934_0017581 | Ga0373934_0017581_1664_2233 | 185 |
| 808 | 3300035111 | Ga0373923_0002332 | Ga0373923_0002332_2464_3033 | 185 |
| 809 | 3300035111 | Ga0373923_0015548 | Ga0373923_0015548_226_783 | 185 |
| 810 | 3300035112 | Ga0373932_0033968 | Ga0373932_0033968_744_1301 | 185 |
| 811 | 3300035113 | Ga0373936_0026082 | Ga0373936_0026082_541_1098 | 185 |
| 812 | 3300035113 | Ga0373936_0049360 | Ga0373936_0049360_311_868 | 185 |
| 813 | 3300035117 | Ga0373953_0000473 | Ga0373953_0000473_5064_5633 | 185 |
| 814 | 3300035117 | Ga0373953_0128326 | Ga0373953_0128326_461_1018 | 185 |
| 815 | 3300035118 | Ga0373954_0000442 | Ga0373954_0000442_6511_7080 | 185 |
| 816 | 3300035119 | Ga0373956_0001159 | Ga0373956_0001159_861_1430 | 185 |
| 817 | 3300035119 | Ga0373956_0025732 | Ga0373956_0025732_1183_1740 | 185 |
| 818 | 3300035120 | Ga0373957_0000837 | Ga0373957_0000837_4173_4742 | 185 |
| 819 | 3300035170 | Ga0373943_0035787 | Ga0373943_0035787_1373_1930 | 185 |
| 820 | 3300035171 | Ga0373946_0276641 | Ga0373946_0276641_129_692 | 185 |
| 821 | 3300035172 | Ga0373955_0000840 | Ga0373955_0000840_1833_2402 | 185 |
| 822 | 3300035172 | Ga0373955_0019884 | Ga0373955_0019884_733_1293 | 185 |
| 823 | 3300035172 | Ga0373955_0149633 | Ga0373955_0149633_229_786 | 185 |
| 824 | 3300035172 | Ga0373955_0282791 | Ga0373955_0282791_399_971 | 185 |
| 825 | 3300035242 | Ga0373962_0045346 | Ga0373962_0045346_568_1125 | 185 |
| 826 | 3300035410 | Ga0373924_0138901 | Ga0373924_0138901_389_958 | 185 |
| 827 | 3300035691 | Ga0373931_0143286 | Ga0373931_0143286_803_1360 | 185 |
| 828 | 3300035692 | Ga0373935_0108638 | Ga0373935_0108638_577_1134 | 185 |
| 829 | 3300035695 | Ga0373927_0010992 | Ga0373927_0010992_1781_2353 | 185 |
| 830 | 3300035695 | Ga0373927_0039434 | Ga0373927_0039434_102_659 | 185 |
| 831 | 3300035695 | Ga0373927_0322953 | Ga0373927_0322953_102_659 | 185 |
| 832 | 3300035695 | Ga0373927_0452385 | Ga0373927_0452385_30_587 | 185 |
| 833 | 3300035724 | Ga0373933_0000041 | Ga0373933_0000041_27892_28449 | 185 |
| 834 | 3300035724 | Ga0373933_0012552 | Ga0373933_0012552_2202_2771 | 185 |
| 835 | 3300035724 | Ga0373933_0039675 | Ga0373933_0039675_778_1335 | 185 |
| 836 | 3300035725 | Ga0373947_0015464 | Ga0373947_0015464_1073_1630 | 185 |
| 837 | 3300035725 | Ga0373947_0029904 | Ga0373947_0029904_1820_2401 | 185 |
| 838 | 3300035725 | Ga0373947_0059844 | Ga0373947_0059844_23_580 | 185 |
| 839 | 3300035725 | Ga0373947_0241622 | Ga0373947_0241622_298_855 | 185 |
| 840 | 3300036401 | Ga0373937_0014572 | Ga0373937_0014572_5179_5748 | 185 |
| 841 | 3300037068 | Ga0373925_0013749 | Ga0373925_0013749_2401_2973 | 185 |
| 842 | 3300037068 | Ga0373925_0207070 | Ga0373925_0207070_148_705 | 185 |
| 843 | 3300037418 | Ga0395900_0071894 | Ga0395900_0071894_631_1188 | 185 |
| 844 | 3300037418 | Ga0395900_0123379 | Ga0395900_0123379_790_1347 | 185 |
| 845 | 3300037418 | Ga0395900_0510520 | Ga0395900_0510520_402_959 | 185 |
| 846 | 3300037466 | Ga0395898_0072896 | Ga0395898_0072896_1591_2148 | 185 |
| 847 | 3300037466 | Ga0395898_0185817 | Ga0395898_0185817_851_1411 | 185 |
| 848 | 3300037466 | Ga0395898_0461098 | Ga0395898_0461098_532_1089 | 185 |
| 849 | 3300037466 | Ga0395898_0501886 | Ga0395898_0501886_290_847 | 185 |
| 850 | 3300037471 | Ga0395905_0104806 | Ga0395905_0104806_202_762 | 185 |
| 851 | 3300037471 | Ga0395905_0361255 | Ga0395905_0361255_475_1032 | 185 |
| 852 | 3300037853 | Ga0436364_0294722 | Ga0436364_0294722_1487_2044 | 185 |
| 853 | 3300038443 | Ga0395901_0190304 | Ga0395901_0190304_260_817 | 185 |
| 854 | 3300038443 | Ga0395901_0608874 | Ga0395901_0608874_215_778 | 185 |
| 855 | 3300038443 | Ga0395901_0813583 | Ga0395901_0813583_311_868 | 185 |
| 856 | 3300039437 | Ga0436365_0038677 | Ga0436365_0038677_176_733 | 185 |
| 857 | 3300039437 | Ga0436365_0328412 | Ga0436365_0328412_72_629 | 185 |
| 858 | 3300039437 | Ga0436365_0400158 | Ga0436365_0400158_176_733 | 185 |
| 859 | 3300041459 | Ga0451800_0619150 | Ga0451800_0619150_708_1268 | 185 |
| 860 | 3300041463 | Ga0451804_0741096 | Ga0451804_0741096_196_771 | 185 |
| 861 | 3300041512 | Ga0451853_0411756 | Ga0451853_0411756_42_602 | 185 |
| 862 | 3300042157 | Ga0439458_0054032 | Ga0439458_0054032_141_698 | 185 |
| 863 | 3300042438 | Ga0439459_0004969 | Ga0439459_0004969_1238_1795 | 185 |
| 864 | 3300044684 | Ga0466966_0172332 | Ga0466966_0172332_619_1176 | 185 |
| 865 | 3300045976 | Ga0466967_0195962 | Ga0466967_0195962_669_1226 | 185 |
| 866 | 3300046454 | Ga0495592_0028166 | Ga0495592_0028166_1598_2167 | 185 |
| 867 | 3300046455 | Ga0495603_0114512 | Ga0495603_0114512_533_1096 | 185 |
| 868 | 3300046457 | Ga0495590_0035303 | Ga0495590_0035303_64_621 | 185 |
| 869 | 3300046459 | Ga0495629_0008864 | Ga0495629_0008864_5076_5645 | 185 |
| 870 | 3300046459 | Ga0495629_0048589 | Ga0495629_0048589_1954_2511 | 185 |
| 871 | 3300046460 | Ga0495638_0188903 | Ga0495638_0188903_130_693 | 185 |
| 872 | 3300046462 | Ga0495651_0026680 | Ga0495651_0026680_2039_2608 | 185 |
| 873 | 3300046462 | Ga0495651_0186619 | Ga0495651_0186619_154_711 | 185 |
| 874 | 3300046463 | Ga0495653_0035279 | Ga0495653_0035279_1979_2548 | 185 |
| 875 | 3300046472 | Ga0495580_0015247 | Ga0495580_0015247_4072_4629 | 185 |
| 876 | 3300046472 | Ga0495580_0182066 | Ga0495580_0182066_399_962 | 185 |
| 877 | 3300046473 | Ga0495582_0004844 | Ga0495582_0004844_776_1333 | 185 |
| 878 | 3300046474 | Ga0495605_0019743 | Ga0495605_0019743_361_918 | 185 |
| 879 | 3300046477 | Ga0495664_0041604 | Ga0495664_0041604_525_1082 | 185 |
| 880 | 3300046491 | Ga0495584_0138605 | Ga0495584_0138605_592_1149 | 185 |
| 881 | 3300046491 | Ga0495584_0389390 | Ga0495584_0389390_23_580 | 185 |
| 882 | 3300046492 | Ga0495585_0281270 | Ga0495585_0281270_112_675 | 185 |
| 883 | 3300046499 | Ga0495594_0159685 | Ga0495594_0159685_28_591 | 185 |
| 884 | 3300046500 | Ga0495596_0066028 | Ga0495596_0066028_332_889 | 185 |
| 885 | 3300046501 | Ga0495607_0008614 | Ga0495607_0008614_2671_3228 | 185 |
| 886 | 3300046506 | Ga0495583_0064074 | Ga0495583_0064074_567_1124 | 185 |
| 887 | 3300046507 | Ga0495606_0008403 | Ga0495606_0008403_7825_8394 | 185 |
| 888 | 3300046507 | Ga0495606_0231593 | Ga0495606_0231593_273_848 | 185 |
| 889 | 3300046511 | Ga0495608_0005163 | Ga0495608_0005163_6469_7038 | 185 |
| 890 | 3300046511 | Ga0495608_0148048 | Ga0495608_0148048_487_1044 | 185 |
| 891 | 3300046513 | Ga0495616_0028143 | Ga0495616_0028143_2049_2606 | 185 |
| 892 | 3300046514 | Ga0495618_0072535 | Ga0495618_0072535_514_1071 | 185 |
| 893 | 3300046514 | Ga0495618_0553698 | Ga0495618_0553698_23_592 | 185 |
| 894 | 3300046515 | Ga0495620_0038328 | Ga0495620_0038328_596_1153 | 185 |
| 895 | 3300046515 | Ga0495620_0077187 | Ga0495620_0077187_675_1232 | 185 |
| 896 | 3300046516 | Ga0495628_0029777 | Ga0495628_0029777_1330_1887 | 185 |
| 897 | 3300046516 | Ga0495628_0224556 | Ga0495628_0224556_349_918 | 185 |
| 898 | 3300046517 | Ga0495630_0049692 | Ga0495630_0049692_437_994 | 185 |
| 899 | 3300046519 | Ga0495632_0023259 | Ga0495632_0023259_2303_2860 | 185 |
| 900 | 3300046520 | Ga0495637_0086262 | Ga0495637_0086262_597_1154 | 185 |
| 901 | 3300046520 | Ga0495637_0185095 | Ga0495637_0185095_92_649 | 185 |
| 902 | 3300046522 | Ga0495643_0071150 | Ga0495643_0071150_321_878 | 185 |
| 903 | 3300046524 | Ga0495648_0132614 | Ga0495648_0132614_635_1192 | 185 |
| 904 | 3300046524 | Ga0495648_0312598 | Ga0495648_0312598_146_703 | 185 |
| 905 | 3300046525 | Ga0495663_0080059 | Ga0495663_0080059_126_689 | 185 |
| 906 | 3300046526 | Ga0495666_0062260 | Ga0495666_0062260_528_1085 | 185 |
| 907 | 3300046528 | Ga0495642_0133298 | Ga0495642_0133298_484_1041 | 185 |
| 908 | 3300046529 | Ga0495652_0002339 | Ga0495652_0002339_5386_5955 | 185 |
| 909 | 3300046529 | Ga0495652_0071585 | Ga0495652_0071585_341_898 | 185 |
| 910 | 3300046529 | Ga0495652_0073700 | Ga0495652_0073700_2060_2617 | 185 |
| 911 | 3300046530 | Ga0495654_0013864 | Ga0495654_0013864_3020_3577 | 185 |
| 912 | 3300046533 | Ga0495640_0020781 | Ga0495640_0020781_747_1316 | 185 |
| 913 | 3300046535 | Ga0495586_0060362 | Ga0495586_0060362_1048_1605 | 185 |
| 914 | 3300046536 | Ga0495587_0033793 | Ga0495587_0033793_1705_2274 | 185 |
| 915 | 3300046536 | Ga0495587_0156726 | Ga0495587_0156726_623_1180 | 185 |
| 916 | 3300046537 | Ga0495598_0074485 | Ga0495598_0074485_471_1034 | 185 |
| 917 | 3300046538 | Ga0495609_0203335 | Ga0495609_0203335_149_706 | 185 |
| 918 | 3300046539 | Ga0495621_0018331 | Ga0495621_0018331_1105_1668 | 185 |
| 919 | 3300046542 | Ga0495597_0045099 | Ga0495597_0045099_1005_1562 | 185 |
| 920 | 3300046543 | Ga0495645_0268065 | Ga0495645_0268065_145_702 | 185 |
| 921 | 3300046558 | Ga0495633_0039118 | Ga0495633_0039118_462_1019 | 185 |
| 922 | 3300046559 | Ga0495667_0001528 | Ga0495667_0001528_10137_10706 | 185 |
| 923 | 3300046559 | Ga0495667_0481556 | Ga0495667_0481556_166_723 | 185 |
| 924 | 3300046615 | Ga0495656_0016790 | Ga0495656_0016790_1961_2524 | 185 |
| 925 | 3300046616 | Ga0495668_0051022 | Ga0495668_0051022_994_1551 | 185 |
| 926 | 3300046616 | Ga0495668_0067929 | Ga0495668_0067929_122_679 | 185 |
| 927 | 3300046616 | Ga0495668_0300501 | Ga0495668_0300501_221_778 | 185 |
| 928 | 3300046642 | Ga0495634_0002573 | Ga0495634_0002573_1606_2175 | 185 |
| 929 | 3300046642 | Ga0495634_0028503 | Ga0495634_0028503_1053_1610 | 185 |
| 930 | 3300046648 | Ga0495611_0178333 | Ga0495611_0178333_157_714 | 185 |
| 931 | 3300046660 | Ga0495625_0129082 | Ga0495625_0129082_1060_1617 | 185 |
| 932 | 3300046663 | Ga0495635_0001091 | Ga0495635_0001091_4511_5080 | 185 |
| 933 | 3300046664 | Ga0495659_0056519 | Ga0495659_0056519_680_1243 | 185 |
| 934 | 3300046665 | Ga0495661_0441980 | Ga0495661_0441980_18_581 | 185 |
| 935 | 3300046674 | Ga0495588_0001370 | Ga0495588_0001370_8666_9229 | 185 |
| 936 | 3300046675 | Ga0495657_0016934 | Ga0495657_0016934_4282_4851 | 185 |
| 937 | 3300046675 | Ga0495657_0194216 | Ga0495657_0194216_436_993 | 185 |
| 938 | 3300046675 | Ga0495657_0279754 | Ga0495657_0279754_318_884 | 185 |
| 939 | 3300046678 | Ga0495599_0002320 | Ga0495599_0002320_9997_10566 | 185 |
| 940 | 3300046679 | Ga0495623_0019613 | Ga0495623_0019613_1911_2480 | 185 |
| 941 | 3300046679 | Ga0495623_0386319 | Ga0495623_0386319_101_658 | 185 |
| 942 | 3300046680 | Ga0495646_0005680 | Ga0495646_0005680_5594_6163 | 185 |
| 943 | 3300046680 | Ga0495646_0079508 | Ga0495646_0079508_349_906 | 185 |
| 944 | 3300046681 | Ga0495647_0012606 | Ga0495647_0012606_548_1105 | 185 |
| 945 | 3300046683 | Ga0495658_0005658 | Ga0495658_0005658_4480_5037 | 185 |
| 946 | 3300046683 | Ga0495658_0435843 | Ga0495658_0435843_172_738 | 185 |
| 947 | 3300046684 | Ga0495669_0048629 | Ga0495669_0048629_799_1356 | 185 |
| 948 | 3300046689 | Ga0495613_0023851 | Ga0495613_0023851_681_1250 | 185 |
| 949 | 3300046689 | Ga0495613_0165019 | Ga0495613_0165019_553_1110 | 185 |
| 950 | 3300046689 | Ga0495613_0361916 | Ga0495613_0361916_179_736 | 185 |
| 951 | 3300046691 | Ga0495670_0006136 | Ga0495670_0006136_4809_5366 | 185 |
| 952 | 3300046692 | Ga0495671_0151030 | Ga0495671_0151030_163_726 | 185 |
| 953 | 3300046794 | Ga0495589_0144441 | Ga0495589_0144441_454_1011 | 185 |
| 954 | 3300046809 | Ga0495600_0002218 | Ga0495600_0002218_4282_4851 | 185 |
| 955 | 3300046809 | Ga0495600_0048611 | Ga0495600_0048611_1823_2380 | 185 |
| 956 | 3300046810 | Ga0495660_0211719 | Ga0495660_0211719_96_653 | 185 |
| 957 | 3300046810 | Ga0495660_0280765 | Ga0495660_0280765_49_606 | 185 |
| 958 | 3300047315 | Ga0495581_0016629 | Ga0495581_0016629_716_1273 | 185 |
| 959 | 3300047315 | Ga0495581_0196590 | Ga0495581_0196590_535_1104 | 185 |
| 960 | 3300047317 | Ga0495604_0393309 | Ga0495604_0393309_70_627 | 185 |
| 961 | 3300047318 | Ga0495636_0083176 | Ga0495636_0083176_694_1257 | 185 |
| 962 | 3300047319 | Ga0495674_0007800 | Ga0495674_0007800_3976_4533 | 185 |
| 963 | 3300047319 | Ga0495674_0051843 | Ga0495674_0051843_1832_2401 | 185 |
| 964 | 3300047320 | Ga0495672_0272082 | Ga0495672_0272082_38_595 | 185 |
| 965 | 3300047321 | Ga0495676_0034176 | Ga0495676_0034176_3208_3771 | 185 |
| 966 | 3300047322 | Ga0495680_0005405 | Ga0495680_0005405_10137_10706 | 185 |
| 967 | 3300047444 | Ga0495675_0038736 | Ga0495675_0038736_575_1144 | 185 |
| 968 | 3300047444 | Ga0495675_0256419 | Ga0495675_0256419_127_684 | 185 |
| 969 | 3300047445 | Ga0495677_0056687 | Ga0495677_0056687_244_807 | 185 |
| 970 | 3300047445 | Ga0495677_0112036 | Ga0495677_0112036_214_771 | 185 |
| 971 | 3300047471 | Ga0495684_0001482 | Ga0495684_0001482_4979_5548 | 185 |
| 972 | 3300047471 | Ga0495684_0097309 | Ga0495684_0097309_768_1325 | 185 |
| 973 | 3300047472 | Ga0495686_0011245 | Ga0495686_0011245_2406_2963 | 185 |
| 974 | 3300047472 | Ga0495686_0086992 | Ga0495686_0086992_260_817 | 185 |
| 975 | 3300047673 | Ga0495593_0026677 | Ga0495593_0026677_1198_1755 | 185 |
| 976 | 3300047673 | Ga0495593_0070853 | Ga0495593_0070853_887_1456 | 185 |
| 977 | 3300048088 | Ga0495602_0068925 | Ga0495602_0068925_1892_2461 | 185 |
| 978 | 3300048088 | Ga0495602_0349615 | Ga0495602_0349615_458_1024 | 185 |
| 979 | 3300048091 | Ga0495626_0111386 | Ga0495626_0111386_83_640 | 185 |
| 980 | 3300048903 | Ga0496100_0002635 | Ga0496100_0002635_2438_2995 | 185 |
| 981 | 3300048903 | Ga0496100_0245834 | Ga0496100_0245834_500_1057 | 185 |
| 982 | 3300048903 | Ga0496100_0664093 | Ga0496100_0664093_96_653 | 185 |
| 983 | 3300048904 | Ga0496101_0043040 | Ga0496101_0043040_121_678 | 185 |
| 984 | 3300048904 | Ga0496101_0163644 | Ga0496101_0163644_739_1296 | 185 |
| 985 | 3300048904 | Ga0496101_0554973 | Ga0496101_0554973_102_659 | 185 |
| 986 | 3300048905 | Ga0496102_0003268 | Ga0496102_0003268_10141_10698 | 185 |
| 987 | 3300048905 | Ga0496102_0097762 | Ga0496102_0097762_2101_2658 | 185 |
| 988 | 3300048905 | Ga0496102_0204326 | Ga0496102_0204326_478_1062 | 185 |
| 989 | 3300048905 | Ga0496102_0306661 | Ga0496102_0306661_822_1379 | 185 |
| 990 | 3300048905 | Ga0496102_0324465 | Ga0496102_0324465_795_1352 | 185 |
| 991 | 3300048905 | Ga0496102_0334889 | Ga0496102_0334889_203_760 | 185 |
| 992 | 3300048905 | Ga0496102_0505834 | Ga0496102_0505834_192_749 | 185 |
| 993 | 3300048905 | Ga0496102_0564602 | Ga0496102_0564602_236_793 | 185 |
| 994 | 3300048906 | Ga0496103_0011931 | Ga0496103_0011931_2601_3158 | 185 |
| 995 | 3300048906 | Ga0496103_0090433 | Ga0496103_0090433_1249_1806 | 185 |
| 996 | 3300048907 | Ga0496104_0016540 | Ga0496104_0016540_5143_5700 | 185 |
| 997 | 3300048907 | Ga0496104_0089038 | Ga0496104_0089038_1890_2474 | 185 |
| 998 | 3300048907 | Ga0496104_0926928 | Ga0496104_0926928_170_727 | 185 |
| 999 | 3300048908 | Ga0496105_0027843 | Ga0496105_0027843_2655_3212 | 185 |
| 1000 | 3300048909 | Ga0496106_0000477 | Ga0496106_0000477_1302_1874 | 185 |
| 1001 | 3300048909 | Ga0496106_0027131 | Ga0496106_0027131_2415_2972 | 185 |
| 1002 | 3300048909 | Ga0496106_0042197 | Ga0496106_0042197_306_863 | 185 |
| 1003 | 3300048909 | Ga0496106_0065167 | Ga0496106_0065167_242_799 | 185 |
| 1004 | 3300048909 | Ga0496106_0207349 | Ga0496106_0207349_148_705 | 185 |
| 1005 | 3300048910 | Ga0496107_0002282 | Ga0496107_0002282_8892_9449 | 185 |
| 1006 | 3300048910 | Ga0496107_0105014 | Ga0496107_0105014_673_1230 | 185 |
| 1007 | 3300048910 | Ga0496107_0434291 | Ga0496107_0434291_324_881 | 185 |
| 1008 | 3300048911 | Ga0496108_0015096 | Ga0496108_0015096_4731_5288 | 185 |
| 1009 | 3300048911 | Ga0496108_0371059 | Ga0496108_0371059_672_1229 | 185 |
| 1010 | 3300048911 | Ga0496108_0517281 | Ga0496108_0517281_428_985 | 185 |
| 1011 | 3300048912 | Ga0496109_0103827 | Ga0496109_0103827_1442_1999 | 185 |
| 1012 | 3300048912 | Ga0496109_0230541 | Ga0496109_0230541_149_733 | 185 |
| 1013 | 3300048912 | Ga0496109_0360581 | Ga0496109_0360581_561_1118 | 185 |
| 1014 | 3300048913 | Ga0496110_0010493 | Ga0496110_0010493_474_1031 | 185 |
| 1015 | 3300048913 | Ga0496110_0079042 | Ga0496110_0079042_2258_2815 | 185 |
| 1016 | 3300048913 | Ga0496110_0151390 | Ga0496110_0151390_1340_1897 | 185 |
| 1017 | 3300048914 | Ga0496111_0150239 | Ga0496111_0150239_853_1419 | 185 |
| 1018 | 3300048914 | Ga0496111_0429867 | Ga0496111_0429867_32_589 | 185 |
| 1019 | 3300048915 | Ga0496112_0023640 | Ga0496112_0023640_1387_1944 | 185 |
| 1020 | 3300048915 | Ga0496112_0155738 | Ga0496112_0155738_1420_1977 | 185 |
| 1021 | 3300048915 | Ga0496112_0214871 | Ga0496112_0214871_773_1357 | 185 |
| 1022 | 3300048916 | Ga0496113_0012966 | Ga0496113_0012966_2720_3277 | 185 |
| 1023 | 3300048916 | Ga0496113_0064609 | Ga0496113_0064609_865_1422 | 185 |
| 1024 | 3300048917 | Ga0496114_0020349 | Ga0496114_0020349_1934_2491 | 185 |
| 1025 | 3300048917 | Ga0496114_0460686 | Ga0496114_0460686_169_726 | 185 |
| 1026 | 3300048918 | Ga0496115_0001335 | Ga0496115_0001335_6788_7345 | 185 |
| 1027 | 3300048918 | Ga0496115_0013365 | Ga0496115_0013365_4715_5299 | 185 |
| 1028 | 3300048918 | Ga0496115_0217884 | Ga0496115_0217884_825_1382 | 185 |
| 1029 | 3300048918 | Ga0496115_1086964 | Ga0496115_1086964_10_567 | 185 |
| 1030 | 3300048919 | Ga0496116_0001763 | Ga0496116_0001763_14773_15330 | 185 |
| 1031 | 3300048919 | Ga0496116_0350255 | Ga0496116_0350255_11_577 | 185 |
| 1032 | 3300048920 | Ga0496117_0020387 | Ga0496117_0020387_3256_3828 | 185 |
| 1033 | 3300048920 | Ga0496117_0055575 | Ga0496117_0055575_1378_1935 | 185 |
| 1034 | 3300048920 | Ga0496117_0256143 | Ga0496117_0256143_92_649 | 185 |
| 1035 | 3300048921 | Ga0496118_0004957 | Ga0496118_0004957_13815_14387 | 185 |
| 1036 | 3300048921 | Ga0496118_0070368 | Ga0496118_0070368_486_1043 | 185 |
| 1037 | 3300048921 | Ga0496118_0079370 | Ga0496118_0079370_1670_2227 | 185 |
| 1038 | 3300048921 | Ga0496118_0093442 | Ga0496118_0093442_282_839 | 185 |
| 1039 | 3300048921 | Ga0496118_0351781 | Ga0496118_0351781_200_757 | 185 |
| 1040 | 3300048922 | Ga0496119_0037471 | Ga0496119_0037471_2061_2618 | 185 |
| 1041 | 3300048922 | Ga0496119_0093097 | Ga0496119_0093097_64_621 | 185 |
| 1042 | 3300048922 | Ga0496119_0132778 | Ga0496119_0132778_203_760 | 185 |
| 1043 | 3300048922 | Ga0496119_0158597 | Ga0496119_0158597_531_1103 | 185 |
| 1044 | 3300048923 | Ga0496120_0066345 | Ga0496120_0066345_833_1390 | 185 |
| 1045 | 3300048924 | Ga0496121_0000456 | Ga0496121_0000456_43764_44336 | 185 |
| 1046 | 3300048924 | Ga0496121_0011588 | Ga0496121_0011588_8842_9405 | 185 |
| 1047 | 3300048924 | Ga0496121_0011976 | Ga0496121_0011976_2005_2562 | 185 |
| 1048 | 3300048924 | Ga0496121_0012754 | Ga0496121_0012754_7816_8373 | 185 |
| 1049 | 3300048924 | Ga0496121_0093992 | Ga0496121_0093992_1496_2053 | 185 |
| 1050 | 3300048924 | Ga0496121_0138045 | Ga0496121_0138045_290_847 | 185 |
| 1051 | 3300048924 | Ga0496121_0252522 | Ga0496121_0252522_637_1209 | 185 |
| 1052 | 3300048924 | Ga0496121_0349583 | Ga0496121_0349583_56_613 | 185 |
| 1053 | 3300048925 | Ga0496122_0076366 | Ga0496122_0076366_803_1360 | 185 |
| 1054 | 3300048926 | Ga0496123_0036303 | Ga0496123_0036303_2256_2813 | 185 |
| 1055 | 3300048926 | Ga0496123_0078705 | Ga0496123_0078705_608_1165 | 185 |
| 1056 | 3300048926 | Ga0496123_0157411 | Ga0496123_0157411_472_1029 | 185 |
| 1057 | 3300048927 | Ga0496124_0000685 | Ga0496124_0000685_7580_8152 | 185 |
| 1058 | 3300048927 | Ga0496124_0146691 | Ga0496124_0146691_361_918 | 185 |
| 1059 | 3300048927 | Ga0496124_0197088 | Ga0496124_0197088_92_652 | 185 |
| 1060 | 3300048927 | Ga0496124_0323162 | Ga0496124_0323162_497_1054 | 185 |
| 1061 | 3300048927 | Ga0496124_0338774 | Ga0496124_0338774_408_965 | 185 |
| 1062 | 3300048927 | Ga0496124_0697430 | Ga0496124_0697430_59_616 | 185 |
| 1063 | 3300048928 | Ga0496125_0001801 | Ga0496125_0001801_4870_5427 | 185 |
| 1064 | 3300048928 | Ga0496125_0017146 | Ga0496125_0017146_4785_5342 | 185 |
| 1065 | 3300048928 | Ga0496125_0062506 | Ga0496125_0062506_322_894 | 185 |
| 1066 | 3300048928 | Ga0496125_0091527 | Ga0496125_0091527_1005_1565 | 185 |
| 1067 | 3300048929 | Ga0496126_0002820 | Ga0496126_0002820_14872_15429 | 185 |
| 1068 | 3300048929 | Ga0496126_0007653 | Ga0496126_0007653_3453_4010 | 185 |
| 1069 | 3300048929 | Ga0496126_0031823 | Ga0496126_0031823_445_1017 | 185 |
| 1070 | 3300048929 | Ga0496126_0087475 | Ga0496126_0087475_1670_2227 | 185 |
| 1071 | 3300048929 | Ga0496126_0120159 | Ga0496126_0120159_770_1333 | 185 |
| 1072 | 3300048929 | Ga0496126_0130828 | Ga0496126_0130828_1403_1960 | 185 |
| 1073 | 3300048929 | Ga0496126_0171898 | Ga0496126_0171898_923_1480 | 185 |
| 1074 | 3300048929 | Ga0496126_0250345 | Ga0496126_0250345_584_1141 | 185 |
| 1075 | 3300048929 | Ga0496126_0569921 | Ga0496126_0569921_224_808 | 185 |
| 1076 | 3300049459 | Ga0495678_081562 | Ga0495678_081562_321_878 | 185 |
| 1077 | 3300049460 | Ga0495682_0189895 | Ga0495682_0189895_32_595 | 185 |
| 1078 | 3300049568 | Ga0501031_0466179 | Ga0501031_0466179_179_736 | 185 |
| 1079 | 3300049569 | Ga0501032_0067270 | Ga0501032_0067270_157_720 | 185 |
| 1080 | 3300049569 | Ga0501032_0103685 | Ga0501032_0103685_85_654 | 185 |
| 1081 | 3300049570 | Ga0501033_0013872 | Ga0501033_0013872_2857_3420 | 185 |
| 1082 | 3300049570 | Ga0501033_0452646 | Ga0501033_0452646_130_699 | 185 |
| 1083 | 3300049572 | Ga0501036_0100512 | Ga0501036_0100512_1728_2291 | 185 |
| 1084 | 3300049573 | Ga0501037_0008746 | Ga0501037_0008746_231_800 | 185 |
| 1085 | 3300049573 | Ga0501037_0050716 | Ga0501037_0050716_2436_2999 | 185 |
| 1086 | 3300049574 | Ga0501038_0016381 | Ga0501038_0016381_3024_3587 | 185 |
| 1087 | 3300049574 | Ga0501038_0540862 | Ga0501038_0540862_268_825 | 185 |
| 1088 | 3300049575 | Ga0501039_0096859 | Ga0501039_0096859_1493_2056 | 185 |
| 1089 | 3300049580 | Ga0501046_0047997 | Ga0501046_0047997_2576_3139 | 185 |
| 1090 | 3300049581 | Ga0501047_0199225 | Ga0501047_0199225_857_1420 | 185 |
| 1091 | 3300049582 | Ga0501048_0012334 | Ga0501048_0012334_1128_1691 | 185 |
| 1092 | 3300049583 | Ga0501067_0032110 | Ga0501067_0032110_515_1078 | 185 |
| 1093 | 3300049584 | Ga0501068_0120528 | Ga0501068_0120528_158_721 | 185 |
| 1094 | 3300049586 | Ga0501070_0021175 | Ga0501070_0021175_4732_5301 | 185 |
| 1095 | 3300049586 | Ga0501070_0244814 | Ga0501070_0244814_11_574 | 185 |
| 1096 | 3300049588 | Ga0501072_0489956 | Ga0501072_0489956_278_841 | 185 |
| 1097 | 3300049590 | Ga0501074_0028355 | Ga0501074_0028355_1929_2492 | 185 |
| 1098 | 3300049741 | Ga0501079_0318541 | Ga0501079_0318541_12_575 | 185 |
| 1099 | 3300049741 | Ga0501079_0427587 | Ga0501079_0427587_21_578 | 185 |
| 1100 | 3300049742 | Ga0501080_0022612 | Ga0501080_0022612_4159_4722 | 185 |
| 1101 | 3300049742 | Ga0501080_0726981 | Ga0501080_0726981_199_768 | 185 |
| 1102 | 3300049822 | Ga0501035_0201326 | Ga0501035_0201326_482_1051 | 185 |
| 1103 | 3300049822 | Ga0501035_0314239 | Ga0501035_0314239_482_1045 | 185 |
| 1104 | 3300049823 | Ga0501044_0193273 | Ga0501044_0193273_185_748 | 185 |
| 1105 | 3300049823 | Ga0501044_0371525 | Ga0501044_0371525_296_865 | 185 |
| 1106 | 3300050490 | nmdc:mga03n38_16168_c1 | nmdc:mga03n38_16168_c1_636_1220 | 185 |
| 1107 | 3300050491 | nmdc:mga00v17_205461_c1 | nmdc:mga00v17_205461_c1_701_1258 | 185 |
| 1108 | 3300050491 | nmdc:mga00v17_22557_c1 | nmdc:mga00v17_22557_c1_670_1227 | 185 |
| 1109 | 3300050492 | nmdc:mga0yw44_12117_c1 | nmdc:mga0yw44_12117_c1_2542_3099 | 185 |
| 1110 | 3300050492 | nmdc:mga0yw44_43796_c1 | nmdc:mga0yw44_43796_c1_730_1287 | 185 |
| 1111 | 3300050492 | nmdc:mga0yw44_855444_c1 | nmdc:mga0yw44_855444_c1_44_601 | 185 |
| 1112 | 3300050494 | nmdc:mga06z11_407496_c1 | nmdc:mga06z11_407496_c1_138_695 | 185 |
| 1113 | 3300050494 | nmdc:mga06z11_78699_c1 | nmdc:mga06z11_78699_c1_786_1370 | 185 |
| 1114 | 3300050496 | nmdc:mga07m45_315516_c1 | nmdc:mga07m45_315516_c1_197_754 | 185 |
| 1115 | 3300050496 | nmdc:mga07m45_55711_c1 | nmdc:mga07m45_55711_c1_678_1262 | 185 |
| 1116 | 3300050512 | nmdc:mga0n895_251935_c1 | nmdc:mga0n895_251935_c1_750_1307 | 185 |
| 1117 | 3300053077 | Ga0495601_0037539 | Ga0495601_0037539_1437_1994 | 185 |
| 1118 | 3300053078 | Ga0495612_0024671 | Ga0495612_0024671_933_1490 | 185 |
| 1119 | 3300053078 | Ga0495612_0158490 | Ga0495612_0158490_35_592 | 185 |
| 1120 | 3300053079 | Ga0500610_0236581 | Ga0500610_0236581_44_601 | 185 |
| 1121 | 3300053084 | Ga0495595_0006061 | Ga0495595_0006061_2806_3375 | 185 |
| 1122 | 3300053085 | Ga0495619_0002231 | Ga0495619_0002231_947_1516 | 185 |
| 1123 | 3300053085 | Ga0495619_0037434 | Ga0495619_0037434_635_1192 | 185 |
| 1124 | 3300053085 | Ga0495619_0064858 | Ga0495619_0064858_1354_1911 | 185 |
| 1125 | 3300053085 | Ga0495619_0206880 | Ga0495619_0206880_524_1081 | 185 |
| 1126 | 3300053087 | Ga0500643_076922 | Ga0500643_076922_202_759 | 185 |
| 1127 | 3300053090 | Ga0500646_0012795 | Ga0500646_0012795_258_815 | 185 |
| 1128 | 3300053092 | Ga0500583_0119853 | Ga0500583_0119853_433_990 | 185 |
| 1129 | 3300053093 | Ga0500651_0048753 | Ga0500651_0048753_597_1154 | 185 |
| 1130 | 3300053093 | Ga0500651_0062354 | Ga0500651_0062354_1089_1652 | 185 |
| 1131 | 3300053093 | Ga0500651_0211880 | Ga0500651_0211880_72_629 | 185 |
| 1132 | 3300053096 | Ga0500641_0011445 | Ga0500641_0011445_677_1243 | 185 |
| 1133 | 3300053096 | Ga0500641_0015263 | Ga0500641_0015263_1592_2149 | 185 |
| 1134 | 3300053098 | Ga0500650_0003901 | Ga0500650_0003901_4147_4704 | 185 |
| 1135 | 3300053104 | Ga0500556_0000004 | Ga0500556_0000004_519222_519779 | 185 |
| 1136 | 3300053108 | Ga0500562_015798 | Ga0500562_015798_771_1328 | 185 |
| 1137 | 3300053116 | Ga0500592_001008 | Ga0500592_001008_1364_1921 | 185 |
| 1138 | 3300053119 | Ga0500595_034504 | Ga0500595_034504_160_732 | 185 |
| 1139 | 3300053119 | Ga0500595_046627 | Ga0500595_046627_669_1226 | 185 |
| 1140 | 3300053119 | Ga0500595_145508 | Ga0500595_145508_34_591 | 185 |
| 1141 | 3300053129 | Ga0500628_130796 | Ga0500628_130796_97_654 | 185 |
| 1142 | 3300053130 | Ga0500642_0011049 | Ga0500642_0011049_2231_2794 | 185 |
| 1143 | 3300053131 | Ga0500652_000276 | Ga0500652_000276_6445_7002 | 185 |
| 1144 | 3300053134 | Ga0500658_0224298 | Ga0500658_0224298_295_852 | 185 |
| 1145 | 3300053136 | Ga0500559_0194296 | Ga0500559_0194296_211_768 | 185 |
| 1146 | 3300053139 | Ga0500568_0002961 | Ga0500568_0002961_1427_1984 | 185 |
| 1147 | 3300053140 | Ga0500573_0069876 | Ga0500573_0069876_1363_1935 | 185 |
| 1148 | 3300053142 | Ga0500577_0000144 | Ga0500577_0000144_3747_4304 | 185 |
| 1149 | 3300053142 | Ga0500577_0053573 | Ga0500577_0053573_225_782 | 185 |
| 1150 | 3300053146 | Ga0500588_0054151 | Ga0500588_0054151_638_1195 | 185 |
| 1151 | 3300053151 | Ga0500604_0006492 | Ga0500604_0006492_276_833 | 185 |
| 1152 | 3300053151 | Ga0500604_0023541 | Ga0500604_0023541_26_592 | 185 |
| 1153 | 3300053151 | Ga0500604_0033664 | Ga0500604_0033664_401_964 | 185 |
| 1154 | 3300053153 | Ga0500616_0000014 | Ga0500616_0000014_493424_493981 | 185 |
| 1155 | 3300053156 | Ga0500622_0005136 | Ga0500622_0005136_6097_6654 | 185 |
| 1156 | 3300053156 | Ga0500622_0038757 | Ga0500622_0038757_340_903 | 185 |
| 1157 | 3300053161 | Ga0500634_0008812 | Ga0500634_0008812_2043_2600 | 185 |
| 1158 | 3300053161 | Ga0500634_0022055 | Ga0500634_0022055_1310_1867 | 185 |
| 1159 | 3300053161 | Ga0500634_0182676 | Ga0500634_0182676_68_625 | 185 |
| 1160 | 3300053162 | Ga0500638_071658 | Ga0500638_071658_719_1276 | 185 |
| 1161 | 3300053177 | Ga0500636_0093571 | Ga0500636_0093571_24_596 | 185 |
| 1162 | 3300053724 | Ga0500570_091658 | Ga0500570_091658_103_663 | 185 |
| 1163 | 3300053727 | Ga0500611_028884 | Ga0500611_028884_423_980 | 185 |
| 1164 | 3300053731 | Ga0500609_010620 | Ga0500609_010620_316_879 | 185 |
| 1165 | 3300053733 | Ga0500552_021269 | Ga0500552_021269_122_694 | 185 |
| 1166 | 3300061719 | Ga0466962_0096498 | Ga0466962_0096498_71_628 | 185 |
| 1167 | iso_pu_bacteria | 2721755755 | 2723845029 | 185 |
| 1168 | iso_pu_bacteria | 2941515067 | 2941519101 | 185 |
| 1169 | iso_pu_bacteria | 2941523033 | 2941526319 | 185 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7reg-assembly1.cif.gz_A | dfra1 complexed with nadph and 4'-chloro-3'-(4-(2,4-diamino-6-ethylpyrimidin-5-yl)but-3-yn-2-yl)-[1,1'-biphenyl]-4-carboxamide (ucp1228) | 0.8063 | 5 | 183 |
| 5ecx-assembly1.cif.gz_B | klebsiella pneumoniae dfra1 complexed with nadph and 6-ethyl-5-(3-(6-(pyridin-4-yl)benzo[d][1,3]dioxol-4-yl)but-1-yn-1-yl)pyrimidine-2,4-diamine | 0.8049 | 5 | 183 |
| 7rgj-assembly1.cif.gz_A | dfra1 complexed with nadph and 5-(3-(7-(4-(aminomethyl)phenyl)benzo[d][1,3]dioxol-5-yl)but-1-yn-1-yl)-6-ethylpyrimidine-2,4-diamine (ucp1223) | 0.8009 | 5 | 182 |
| 7rgo-assembly1.cif.gz_B | dfra5 complexed with nadph and 4'-chloro-3'-(4-(2,4-diamino-6-ethylpyrimidin-5-yl)but-3-yn-2-yl)-[1,1'-biphenyl]-4-carboxamide (ucp1228) | 0.7976 | 5 | 182 |
| 7reg-assembly1.cif.gz_A | dfra1 complexed with nadph and 4'-chloro-3'-(4-(2,4-diamino-6-ethylpyrimidin-5-yl)but-3-yn-2-yl)-[1,1'-biphenyl]-4-carboxamide (ucp1228) | 0.7971 | 5 | 183 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ecxB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8049 | 5 | 183 | 3.40.430.10 |
| 5ecxB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7958 | 5 | 183 | 3.40.430.10 |
| 3tqaA00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7678 | 5 | 182 | 3.40.430.10 |
| 1cz3B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7601 | 5 | 184 | 3.40.430.10 |
| 3tqaA00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7592 | 5 | 182 | 3.40.430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q3SS94-F1-model_v4 | Uncharacterized protein | 0.9932 | 4 | 183 |
|
| AF-A0A4V2E9B5-F1-model_v4 | Dihydrofolate reductase | 0.9932 | 25 | 184 |
|
| AF-Q3SS94-F1-model_v4 | Uncharacterized protein | 0.977 | 4 | 183 |
|
| AF-A0A4V2E9B5-F1-model_v4 | Dihydrofolate reductase | 0.975 | 25 | 184 |
|
| AF-A0A259MJZ8-F1-model_v4 | Dihydrofolate reductase | 0.9601 | 2 | 184 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar