F491092

General Info

Members Datasets Scaffolds Average Seq Length
1167 451 1166 142

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_101303952|Ga0070699_1013039521
Length 133
Sequence MPSYDPSNIFAKILRGELPCYKVYEDDKVLAFLDIMPRAPGHTLVLPKAPARNLLDVQPDDLTAVAQAAQKFSADGITIQQFNEGAGGQVVFHLHMHVIPRKTGVAMKPPASEKEKPEVLSDHALKLAAALKG

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
12 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
17 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
23 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
100 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
101 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
102 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
103 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
104 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
105 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
106 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
107 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
108 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
109 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
110 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
111 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
112 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
113 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
117 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
118 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
119 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
120 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
121 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
124 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
126 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
127 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
128 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
129 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
130 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
131 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
133 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
134 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
137 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
138 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
139 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
140 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
141 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
142 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
145 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
146 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
147 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
148 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
149 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
156 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
157 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
158 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
159 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
160 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
161 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
164 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
165 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
166 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
167 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
240 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
242 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
246 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
247 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
248 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
249 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
250 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
251 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
252 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
253 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
254 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
255 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
256 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
257 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
258 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
259 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
260 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
261 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
262 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
263 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
264 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
265 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
266 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
267 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
268 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
270 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
271 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
272 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
273 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
274 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
275 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
276 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
277 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
278 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
279 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
280 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
281 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
282 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
283 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
284 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
285 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
286 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
287 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
288 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
289 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
290 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
291 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
292 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
293 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
294 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
295 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
296 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
297 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
298 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
299 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
300 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
301 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
302 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
303 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
304 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
305 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
306 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
307 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
308 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
309 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
310 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
311 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
312 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
313 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
314 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
315 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
316 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
317 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
318 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
319 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
320 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
321 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
322 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
323 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
324 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
325 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
326 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
327 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
328 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
329 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
330 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
331 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
332 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
333 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
334 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
335 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
336 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
337 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
338 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
339 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
340 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
341 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
342 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
343 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
344 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
345 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
346 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
347 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
348 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
349 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
350 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
351 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
352 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
353 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
354 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
355 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
356 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
357 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
358 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
359 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
360 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
361 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
362 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
363 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
364 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
365 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
366 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
367 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
368 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
369 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
370 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
371 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
372 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
373 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
374 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
375 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
376 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
377 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
378 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
379 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
380 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
381 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
382 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
383 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
384 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
385 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
386 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
387 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
388 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
389 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
404 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
405 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
406 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
407 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
408 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
409 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
410 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
411 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
412 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
413 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
414 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
415 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
416 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
417 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
419 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
420 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
421 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
422 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
423 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
424 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
425 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
426 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
427 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
428 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
429 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
430 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
431 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
432 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
433 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
434 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
435 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
436 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
437 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
438 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
439 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
440 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
441 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
442 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
443 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
444 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
445 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
446 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
447 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
448 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
449 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
450 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
451 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.77
Nodule 0
Rhizoplane 10.54
Rhizosphere 85
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1013836 3300001976 Bacteria 1052
2 JGI24746J21847_1000923 3300001977 Bacteria 4595
3 JGI24747J21853_1007884 3300001978 Bacteria 1032
4 JGI24740J21852_10054506 3300001979 Bacteria 1129
5 JGI24739J22299_10040565 3300001989 Bacteria 1553
6 JGI24737J22298_10002170 3300001990 Bacteria 6993
7 JGI24743J22301_10004801 3300001991 Bacteria 2223
8 JGI24735J21928_10144302 3300002067 Bacteria 687
9 JGI24750J21931_1001342 3300002070 Bacteria 3089
10 JGI24745J21846_1000152 3300002073 Bacteria 5479
11 JGI24745J21846_1043856 3300002073 Bacteria 558
12 JGI24748J21848_1002289 3300002074 Bacteria 2149
13 JGI24738J21930_10000909 3300002075 Bacteria 8517
14 JGI24749J21850_1007700 3300002076 Bacteria 1501
15 JGI24744J21845_10002614 3300002077 Bacteria 3681
16 JGI24744J21845_10002742 3300002077 Bacteria 3596
17 JGI24035J26624_1000140 3300002126 Bacteria 6418
18 JGI24033J26618_1000697 3300002155 Bacteria 3216
19 JGI24034J26672_10000370 3300002239 Bacteria 5834
20 JGI24034J26672_10006378 3300002239 Bacteria 1701
21 JGI24742J22300_10001841 3300002244 Bacteria 3377
22 JGI24742J22300_10021793 3300002244 Bacteria 1095
23 JGI24751J29686_10025837 3300002459 Unclassified 1218
24 JGI24751J29686_10052399 3300002459 Bacteria 841
25 rootH1_10035081 3300003316 Bacteria 4035
26 JGI26129J50193_1004962 3300003349 Unclassified 948
27 JGI26145J50221_1012694 3300003371 Bacteria 759
28 Ga0065712_10069903 3300005290 Bacteria 6531
29 Ga0065712_10084253 3300005290 Bacteria 2779
30 Ga0065715_10090726 3300005293 Bacteria 6563
31 Ga0065715_10193889 3300005293 Bacteria 1399
32 Ga0065707_10356031 3300005295 Bacteria 911
33 Ga0070676_10009404 3300005328 Bacteria 5281
34 Ga0070683_100016231 3300005329 Bacteria 6561
35 Ga0070683_100079030 3300005329 Bacteria 3078
36 Ga0070690_100000972 3300005330 Bacteria 14582
37 Ga0070690_100336286 3300005330 Bacteria 1092
38 Ga0070670_100043184 3300005331 Bacteria 3876
39 Ga0070670_100578111 3300005331 Bacteria 1004
40 Ga0070677_10000624 3300005333 Bacteria 11892
41 Ga0068869_100028165 3300005334 Bacteria 3923
42 Ga0070680_100072254 3300005336 Bacteria 2835
43 Ga0070680_101380952 3300005336 Bacteria 610
44 Ga0070682_100022243 3300005337 Bacteria 3753
45 Ga0070682_100023896 3300005337 Bacteria 3632
46 Ga0070682_100562749 3300005337 Bacteria 894
47 Ga0068868_100000287 3300005338 Bacteria 33828
48 Ga0068868_100087725 3300005338 Bacteria 2502
49 Ga0070660_100011348 3300005339 Bacteria 6325
50 Ga0070660_100165868 3300005339 Bacteria 1782
51 Ga0070660_100369679 3300005339 Bacteria 1183
52 Ga0070689_100009382 3300005340 Bacteria 6935
53 Ga0070689_100326596 3300005340 Bacteria 1282
54 Ga0070689_100578161 3300005340 Bacteria 971
55 Ga0070691_10007546 3300005341 Bacteria 4986
56 Ga0070691_10050476 3300005341 Bacteria 1985
57 Ga0070687_100006226 3300005343 Bacteria 4880
58 Ga0070661_100014754 3300005344 Bacteria 5510
59 Ga0070661_100211236 3300005344 Bacteria 1486
60 Ga0070661_100282063 3300005344 Bacteria 1289
61 Ga0070692_10003049 3300005345 Bacteria 6691
62 Ga0070668_100038116 3300005347 Bacteria 3672
63 Ga0070668_100155994 3300005347 Bacteria 1849
64 Ga0070669_100005691 3300005353 Bacteria 8989
65 Ga0070669_100141606 3300005353 Bacteria 1854
66 Ga0070669_101212724 3300005353 Bacteria 652
67 Ga0070675_100009027 3300005354 Bacteria 7744
68 Ga0070675_100199475 3300005354 Bacteria 1736
69 Ga0070675_101202319 3300005354 Bacteria 698
70 Ga0070671_100033279 3300005355 Bacteria 4262
71 Ga0070671_100227972 3300005355 Bacteria 1581
72 Ga0070671_100341927 3300005355 Bacteria 1277
73 Ga0070671_100355244 3300005355 Bacteria 1251
74 Ga0070674_100056194 3300005356 Bacteria 2729
75 Ga0070674_100105413 3300005356 Bacteria 2061
76 Ga0070674_100249689 3300005356 Bacteria 1393
77 Ga0070673_100006385 3300005364 Bacteria 7663
78 Ga0070673_100014645 3300005364 Bacteria 5473
79 Ga0070673_100601432 3300005364 Bacteria 1003
80 Ga0070688_100001436 3300005365 Bacteria 11847
81 Ga0070688_100205308 3300005365 Unclassified 1381
82 Ga0070688_100351961 3300005365 Bacteria 1078
83 Ga0070659_100015882 3300005366 Bacteria 5647
84 Ga0070659_100255889 3300005366 Bacteria 1452
85 Ga0070659_101525028 3300005366 Bacteria 596
86 Ga0070667_100009541 3300005367 Bacteria 8047
87 Ga0070667_100060283 3300005367 Bacteria 3211
88 Ga0070667_100267605 3300005367 Bacteria 1532
89 Ga0070667_100323726 3300005367 Bacteria 1391
90 Ga0070667_100523865 3300005367 Bacteria 1088
91 Ga0070667_100527864 3300005367 Bacteria 1083
92 Ga0070709_10003671 3300005434 Bacteria 8246
93 Ga0070709_10029359 3300005434 Bacteria 3289
94 Ga0070709_10195406 3300005434 Bacteria 1430
95 Ga0070709_10235293 3300005434 Bacteria 1313
96 Ga0070709_10501809 3300005434 Bacteria 922
97 Ga0070714_100103058 3300005435 Bacteria 2517
98 Ga0070714_100619081 3300005435 Bacteria 1041
99 Ga0070714_101983508 3300005435 Bacteria 568
100 Ga0070713_100019221 3300005436 Bacteria 5210
101 Ga0070713_100039180 3300005436 Bacteria 3844
102 Ga0070713_100191291 3300005436 Bacteria 1844
103 Ga0070713_100572504 3300005436 Bacteria 1071
104 Ga0070710_10015364 3300005437 Bacteria 3874
105 Ga0070710_10032037 3300005437 Bacteria 2844
106 Ga0070710_10056697 3300005437 Bacteria 2217
107 Ga0070710_11264920 3300005437 Bacteria 548
108 Ga0070701_10278410 3300005438 Bacteria 1021
109 Ga0070711_100001695 3300005439 Bacteria 12207
110 Ga0070711_100019451 3300005439 Bacteria 4356
111 Ga0070711_100030277 3300005439 Bacteria 3581
112 Ga0070711_100140164 3300005439 Bacteria 1812
113 Ga0070711_100459792 3300005439 Bacteria 1043
114 Ga0070711_100594449 3300005439 Bacteria 922
115 Ga0070705_100028618 3300005440 Bacteria 3054
116 Ga0070705_100033813 3300005440 Bacteria 2853
117 Ga0070700_100027984 3300005441 Bacteria 3349
118 Ga0070700_100084110 3300005441 Bacteria 2061
119 Ga0070700_100544247 3300005441 Bacteria 901
120 Ga0070700_100907242 3300005441 Bacteria 718
121 Ga0070700_101011923 3300005441 Bacteria 684
122 Ga0070694_100003715 3300005444 Bacteria 9100
123 Ga0070694_100098667 3300005444 Bacteria 2063
124 Ga0070694_100131627 3300005444 Bacteria 1807
125 Ga0070708_100129452 3300005445 Bacteria 2335
126 Ga0070708_100633025 3300005445 Bacteria 1008
127 Ga0070663_100007417 3300005455 Bacteria 6674
128 Ga0070663_100084684 3300005455 Bacteria 2338
129 Ga0070663_100088886 3300005455 Bacteria 2285
130 Ga0070663_100101851 3300005455 Bacteria 2144
131 Ga0070678_100004742 3300005456 Bacteria 7750
132 Ga0070678_100005474 3300005456 Bacteria 7346
133 Ga0070678_100119811 3300005456 Bacteria 2073
134 Ga0070678_101396375 3300005456 Bacteria 654
135 Ga0070662_100040160 3300005457 Bacteria 3330
136 Ga0070681_10005630 3300005458 Bacteria 12103
137 Ga0070681_10018191 3300005458 Bacteria 7026
138 Ga0070681_10061315 3300005458 Bacteria 3736
139 Ga0068867_100127668 3300005459 Bacteria 1972
140 Ga0068867_101163386 3300005459 Bacteria 707
141 Ga0068867_101170507 3300005459 Bacteria 705
142 Ga0070685_10001963 3300005466 Bacteria 10678
143 Ga0070685_10147789 3300005466 Bacteria 1486
144 Ga0070685_11167658 3300005466 Unclassified 584
145 Ga0070685_11608589 3300005466 Bacteria 503
146 Ga0070706_102163689 3300005467 Bacteria 502
147 Ga0070707_100210734 3300005468 Bacteria 1894
148 Ga0070698_100524120 3300005471 Bacteria 1123
149 Ga0070698_100594422 3300005471 Bacteria 1047
150 Ga0070698_101557285 3300005471 Bacteria 613
151 Ga0070699_100552611 3300005518 Bacteria 1048
152 Ga0070699_100731683 3300005518 Bacteria 904
153 Ga0070699_101303952 3300005518 Bacteria 666
154 Ga0070679_100028262 3300005530 Bacteria 5528
155 Ga0070679_100265940 3300005530 Bacteria 1670
156 Ga0070679_100276893 3300005530 Bacteria 1631
157 Ga0070679_101895330 3300005530 Bacteria 545
158 Ga0070684_100054756 3300005535 Bacteria 3476
159 Ga0070684_100075913 3300005535 Bacteria 2965
160 Ga0070684_101036785 3300005535 Bacteria 770
161 Ga0070697_100036768 3300005536 Bacteria 3955
162 Ga0070697_100370943 3300005536 Bacteria 1238
163 Ga0068853_100033477 3300005539 Bacteria 4361
164 Ga0070672_100008973 3300005543 Bacteria 6873
165 Ga0070686_100034178 3300005544 Bacteria 3130
166 Ga0070686_100038220 3300005544 Bacteria 2982
167 Ga0070686_100089466 3300005544 Bacteria 2056
168 Ga0070686_100157183 3300005544 Bacteria 1598
169 Ga0070686_100209318 3300005544 Bacteria 1403
170 Ga0070695_100112555 3300005545 Bacteria 1849
171 Ga0070695_100312777 3300005545 Bacteria 1165
172 Ga0070696_100006672 3300005546 Bacteria 7710
173 Ga0070696_100110438 3300005546 Bacteria 1980
174 Ga0070693_100003566 3300005547 Bacteria 7261
175 Ga0070693_100076865 3300005547 Bacteria 1980
176 Ga0070665_100014185 3300005548 Bacteria 8007
177 Ga0070665_100326964 3300005548 Bacteria 1537
178 Ga0070665_102623200 3300005548 Bacteria 504
179 Ga0070704_100086884 3300005549 Bacteria 2319
180 Ga0070704_100087525 3300005549 Bacteria 2312
181 Ga0070704_100581733 3300005549 Bacteria 982
182 Ga0068855_100031527 3300005563 Bacteria 6330
183 Ga0068855_101717317 3300005563 Bacteria 640
184 Ga0070664_100071700 3300005564 Bacteria 2969
185 Ga0070664_100188683 3300005564 Bacteria 1836
186 Ga0070664_100649343 3300005564 Bacteria 980
187 Ga0068857_100006630 3300005577 Bacteria 9945
188 Ga0068857_100452281 3300005577 Bacteria 1201
189 Ga0068854_100141093 3300005578 Bacteria 1849
190 Ga0068856_100037685 3300005614 Bacteria 4745
191 Ga0068856_100067110 3300005614 Bacteria 3545
192 Ga0068856_100248672 3300005614 Bacteria 1793
193 Ga0068856_100444794 3300005614 Bacteria 1317
194 Ga0068856_101703675 3300005614 Bacteria 643
195 Ga0070702_100091083 3300005615 Bacteria 1849
196 Ga0070702_100355537 3300005615 Bacteria 1033
197 Ga0070702_100557270 3300005615 Bacteria 852
198 Ga0068852_100010452 3300005616 Bacteria 6939
199 Ga0068852_100067469 3300005616 Bacteria 3127
200 Ga0068852_100576443 3300005616 Bacteria 1128
201 Ga0068859_100048040 3300005617 Bacteria 4287
202 Ga0068859_100054633 3300005617 Bacteria 4017
203 Ga0068859_100484879 3300005617 Bacteria 1332
204 Ga0068859_100510275 3300005617 Bacteria 1297
205 Ga0068859_100752815 3300005617 Bacteria 1063
206 Ga0068864_100026602 3300005618 Bacteria 4879
207 Ga0068864_100040226 3300005618 Bacteria 3999
208 Ga0068864_100366800 3300005618 Bacteria 1362
209 Ga0068864_100812521 3300005618 Bacteria 919
210 Ga0068866_10007526 3300005718 Bacteria 4563
211 Ga0068866_10546016 3300005718 Bacteria 774
212 Ga0068861_100007303 3300005719 Bacteria 7572
213 Ga0068861_100149423 3300005719 Bacteria 1915
214 Ga0068851_10298156 3300005834 Bacteria 926
215 Ga0068851_10400670 3300005834 Bacteria 807
216 Ga0068870_10007593 3300005840 Bacteria 4846
217 Ga0068863_100045270 3300005841 Bacteria 4176
218 Ga0068863_100580920 3300005841 Bacteria 1108
219 Ga0068863_101478528 3300005841 Bacteria 688
220 Ga0068858_100064184 3300005842 Bacteria 3398
221 Ga0068858_100265133 3300005842 Bacteria 1634
222 Ga0068858_100273467 3300005842 Bacteria 1608
223 Ga0068860_100015452 3300005843 Bacteria 7455
224 Ga0068860_100047742 3300005843 Bacteria 4080
225 Ga0068860_100320286 3300005843 Bacteria 1522
226 Ga0068862_100015822 3300005844 Bacteria 6267
227 Ga0068862_100275368 3300005844 Bacteria 1540
228 Ga0068862_101558907 3300005844 Bacteria 667
229 Ga0081455_10006976 3300005937 Bacteria 12004
230 Ga0081455_10014661 3300005937 Bacteria 7663
231 Ga0081455_10041818 3300005937 Bacteria 4026
232 Ga0081455_10116763 3300005937 Bacteria 2110
233 Ga0081455_10123738 3300005937 Bacteria 2034
234 Ga0081455_10295044 3300005937 Bacteria 1166
235 Ga0081538_10041292 3300005981 Bacteria 2929
236 Ga0081540_1005655 3300005983 Bacteria 9295
237 Ga0070717_10150167 3300006028 Bacteria 2015
238 Ga0070717_10236827 3300006028 Bacteria 1608
239 Ga0070717_10263454 3300006028 Bacteria 1525
240 Ga0070717_10819301 3300006028 Bacteria 847
241 Ga0075363_100073902 3300006048 Unclassified 1855
242 Ga0075363_100254564 3300006048 Bacteria 1012
243 Ga0075363_100356897 3300006048 Bacteria 854
244 Ga0075364_10005596 3300006051 Bacteria 7323
245 Ga0075364_10674752 3300006051 Bacteria 705
246 Ga0075432_10106569 3300006058 Bacteria 1041
247 Ga0070715_10014758 3300006163 Bacteria 2901
248 Ga0070715_10691862 3300006163 Bacteria 608
249 Ga0070716_100009019 3300006173 Bacteria 4963
250 Ga0070712_100001893 3300006175 Bacteria 12771
251 Ga0070712_100002927 3300006175 Bacteria 10579
252 Ga0070712_100055457 3300006175 Bacteria 2776
253 Ga0070712_100183986 3300006175 Bacteria 1630
254 Ga0070712_100275385 3300006175 Bacteria 1354
255 Ga0070712_100315604 3300006175 Bacteria 1270
256 Ga0075362_10015622 3300006177 Bacteria 3091
257 Ga0075362_10256205 3300006177 Bacteria 861
258 Ga0075367_10035515 3300006178 Bacteria 2886
259 Ga0075367_10063419 3300006178 Bacteria 2209
260 Ga0075367_10087404 3300006178 Bacteria 1893
261 Ga0075367_10973832 3300006178 Bacteria 541
262 Ga0075427_10003835 3300006194 Bacteria 2098
263 Ga0075366_10057187 3300006195 Bacteria 2318
264 Ga0097621_100008744 3300006237 Bacteria 7316
265 Ga0097621_100045558 3300006237 Bacteria 3543
266 Ga0097621_100180771 3300006237 Bacteria 1822
267 Ga0075370_10138142 3300006353 Bacteria 1424
268 Ga0075370_10460636 3300006353 Bacteria 765
269 Ga0075370_10676408 3300006353 Bacteria 627
270 Ga0068871_100000922 3300006358 Bacteria 19615
271 Ga0068871_100027615 3300006358 Bacteria 4440
272 Ga0068871_100083567 3300006358 Bacteria 2648
273 Ga0068871_100208014 3300006358 Bacteria 1691
274 Ga0068871_100961362 3300006358 Unclassified 794
275 Ga0075428_100017044 3300006844 Bacteria 8027
276 Ga0075428_100017138 3300006844 Bacteria 8003
277 Ga0075428_100575571 3300006844 Bacteria 1203
278 Ga0075430_100004240 3300006846 Bacteria 12111
279 Ga0075430_100234758 3300006846 Bacteria 1520
280 Ga0075431_100005477 3300006847 Bacteria 12538
281 Ga0075431_100237644 3300006847 Bacteria 1854
282 Ga0075431_100349390 3300006847 Bacteria 1487
283 Ga0075433_10003318 3300006852 Bacteria 12434
284 Ga0075433_10379103 3300006852 Bacteria 1249
285 Ga0075434_100001367 3300006871 Bacteria 20481
286 Ga0075434_100003881 3300006871 Bacteria 13383
287 Ga0075434_100043832 3300006871 Bacteria 4437
288 Ga0075434_100298045 3300006871 Bacteria 1633
289 Ga0075434_100552116 3300006871 Bacteria 1171
290 Ga0075434_100655354 3300006871 Bacteria 1068
291 Ga0075434_100719358 3300006871 Bacteria 1016
292 Ga0075434_101122493 3300006871 Bacteria 799
293 Ga0075429_100008546 3300006880 Bacteria 8907
294 Ga0075429_101039031 3300006880 Bacteria 716
295 Ga0068865_100020346 3300006881 Bacteria 4302
296 Ga0068865_101291279 3300006881 Bacteria 649
297 Ga0075436_100143142 3300006914 Bacteria 1681
298 Ga0075436_100233885 3300006914 Bacteria 1306
299 Ga0097620_100048041 3300006931 Bacteria 4287
300 Ga0097620_100054629 3300006931 Bacteria 4017
301 Ga0097620_100484892 3300006931 Bacteria 1332
302 Ga0097620_100510258 3300006931 Bacteria 1297
303 Ga0097620_100752860 3300006931 Bacteria 1063
304 Ga0075435_100068616 3300007076 Bacteria 2889
305 Ga0075435_100120318 3300007076 Bacteria 2191
306 Ga0075435_100220222 3300007076 Bacteria 1612
307 Ga0075435_100334541 3300007076 Unclassified 1297
308 Ga0075435_100469057 3300007076 Bacteria 1087
309 Ga0075435_100642636 3300007076 Bacteria 921
310 Ga0075435_101550961 3300007076 Bacteria 581
311 Ga0099794_10641639 3300007265 Bacteria 564
312 Ga0105251_10044171 3300009011 Bacteria 2154
313 Ga0105251_10112195 3300009011 Bacteria 1241
314 Ga0105251_10355454 3300009011 Bacteria 669
315 Ga0105251_10464508 3300009011 Unclassified 588
316 Ga0105244_10018443 3300009036 Bacteria 3915
317 Ga0105244_10128202 3300009036 Bacteria 1225
318 Ga0105244_10195507 3300009036 Bacteria 955
319 Ga0105250_10094806 3300009092 Bacteria 1216
320 Ga0105240_10223606 3300009093 Bacteria 2192
321 Ga0105240_11242884 3300009093 Bacteria 787
322 Ga0111539_10002796 3300009094 Bacteria 23160
323 Ga0111539_10053737 3300009094 Bacteria 4795
324 Ga0111539_10072106 3300009094 Bacteria 4074
325 Ga0111539_10215901 3300009094 Bacteria 2234
326 Ga0111539_10330823 3300009094 Bacteria 1773
327 Ga0111539_10429446 3300009094 Bacteria 1538
328 Ga0111539_10583290 3300009094 Bacteria 1302
329 Ga0111539_10603706 3300009094 Bacteria 1278
330 Ga0111539_12263764 3300009094 Bacteria 630
331 Ga0105245_10004252 3300009098 Bacteria 12700
332 Ga0105245_10068509 3300009098 Bacteria 3216
333 Ga0105245_10148592 3300009098 Bacteria 2213
334 Ga0105245_10197571 3300009098 Bacteria 1930
335 Ga0105245_10726667 3300009098 Bacteria 1028
336 Ga0105245_11246174 3300009098 Bacteria 792
337 Ga0105247_10024208 3300009101 Bacteria 3658
338 Ga0105247_10042814 3300009101 Bacteria 2774
339 Ga0105247_10186310 3300009101 Bacteria 1387
340 Ga0105247_10774410 3300009101 Bacteria 729
341 Ga0114129_10006801 3300009147 Bacteria 16237
342 Ga0114129_10029650 3300009147 Bacteria 7749
343 Ga0114129_10037206 3300009147 Bacteria 6872
344 Ga0114129_10079232 3300009147 Bacteria 4568
345 Ga0105243_10016347 3300009148 Bacteria 5614
346 Ga0105243_10019863 3300009148 Bacteria 5096
347 Ga0105241_10021402 3300009174 Bacteria 4780
348 Ga0105241_10048036 3300009174 Bacteria 3246
349 Ga0105241_11280115 3300009174 Bacteria 697
350 Ga0105241_12461476 3300009174 Bacteria 521
351 Ga0105242_10045458 3300009176 Bacteria 3559
352 Ga0105242_10532664 3300009176 Bacteria 1123
353 Ga0105242_11183727 3300009176 Bacteria 783
354 Ga0105242_11430073 3300009176 Bacteria 720
355 Ga0105248_10034642 3300009177 Bacteria 5648
356 Ga0105248_10035800 3300009177 Bacteria 5553
357 Ga0105248_10110124 3300009177 Bacteria 3105
358 Ga0105248_11283656 3300009177 Bacteria 828
359 Ga0105248_11828815 3300009177 Bacteria 689
360 Ga0105248_12207883 3300009177 Bacteria 626
361 Ga0105237_10008357 3300009545 Bacteria 11222
362 Ga0105237_10035386 3300009545 Bacteria 5053
363 Ga0105237_10596307 3300009545 Bacteria 1112
364 Ga0105238_10058732 3300009551 Bacteria 3855
365 Ga0105249_10029412 3300009553 Bacteria 4961
366 Ga0105249_10152330 3300009553 Bacteria 2227
367 Ga0105249_10437090 3300009553 Bacteria 1345
368 Ga0105033_110928 3300009986 Bacteria 800
369 Ga0105239_10025073 3300010375 Bacteria 6569
370 Ga0105239_10059534 3300010375 Bacteria 4192
371 Ga0105239_10519024 3300010375 Bacteria 1355
372 Ga0105239_10834275 3300010375 Bacteria 1057
373 Ga0105239_11545209 3300010375 Bacteria 767
374 Ga0105239_13383082 3300010375 Bacteria 519
375 Ga0105246_10037433 3300011119 Bacteria 3256
376 Ga0105246_10288223 3300011119 Bacteria 1320
377 Ga0105246_10356309 3300011119 Bacteria 1201
378 Ga0105246_10427703 3300011119 Bacteria 1107
379 Ga0157346_1004633 3300012480 Bacteria 821
380 Ga0157320_1038679 3300012481 Bacteria 509
381 Ga0157314_1003712 3300012500 Bacteria 1095
382 Ga0157313_1004711 3300012503 Bacteria 951
383 Ga0157373_10007606 3300013100 Bacteria 8052
384 Ga0157373_10801133 3300013100 Bacteria 695
385 Ga0157369_10196398 3300013105 Bacteria 2119
386 Ga0157369_10557881 3300013105 Bacteria 1184
387 Ga0157369_10589036 3300013105 Bacteria 1148
388 Ga0157369_10947488 3300013105 Bacteria 882
389 Ga0157374_10015848 3300013296 Bacteria 6621
390 Ga0157378_10007970 3300013297 Bacteria 9246
391 Ga0157378_10032054 3300013297 Bacteria 4642
392 Ga0157378_10429633 3300013297 Bacteria 1307
393 Ga0157378_10634683 3300013297 Bacteria 1082
394 Ga0163162_10087113 3300013306 Bacteria 3201
395 Ga0163162_10221007 3300013306 Bacteria 2024
396 Ga0163162_10360873 3300013306 Bacteria 1586
397 Ga0163162_11218121 3300013306 Bacteria 854
398 Ga0157372_10016528 3300013307 Bacteria 7919
399 Ga0157372_10160704 3300013307 Bacteria 2596
400 Ga0157372_11529704 3300013307 Bacteria 768
401 Ga0157375_10017624 3300013308 Bacteria 6449
402 Ga0157375_10397256 3300013308 Bacteria 1545
403 Ga0157375_10540822 3300013308 Bacteria 1327
404 Ga0163163_10001820 3300014325 Bacteria 18002
405 Ga0163163_10003639 3300014325 Bacteria 13106
406 Ga0163163_10369436 3300014325 Bacteria 1491
407 Ga0157380_10009315 3300014326 Bacteria 7033
408 Ga0157380_10126169 3300014326 Bacteria 2176
409 Ga0157380_10136692 3300014326 Bacteria 2099
410 Ga0182008_10242839 3300014497 Bacteria 927
411 Ga0157377_10033977 3300014745 Bacteria 2788
412 Ga0157379_10001178 3300014968 Bacteria 21270
413 Ga0157379_10118428 3300014968 Bacteria 2382
414 Ga0157379_10551695 3300014968 Bacteria 1072
415 Ga0157379_10783047 3300014968 Bacteria 899
416 Ga0157376_10195812 3300014969 Bacteria 1856
417 Ga0157376_10726108 3300014969 Bacteria 1001
418 Ga0163161_10175653 3300017792 Bacteria 1640
419 Ga0213872_10024190 3300021361 Bacteria 2793
420 Ga0213876_10225361 3300021384 Bacteria 997
421 Ga0228598_1024716 3300024227 Bacteria 1182
422 Ga0207673_1000112 3300025290 Bacteria 7483
423 Ga0207697_10000579 3300025315 Bacteria 20843
424 Ga0207656_10286347 3300025321 Bacteria 813
425 Ga0207656_10332443 3300025321 Bacteria 756
426 Ga0207696_1115583 3300025711 Bacteria 725
427 Ga0207713_1219860 3300025735 Unclassified 573
428 Ga0207713_1237877 3300025735 Bacteria 541
429 Ga0207682_10008278 3300025893 Bacteria 4118
430 Ga0207692_10014928 3300025898 Bacteria 3405
431 Ga0207692_10035418 3300025898 Bacteria 2425
432 Ga0207692_10258580 3300025898 Bacteria 1046
433 Ga0207692_10849651 3300025898 Bacteria 599
434 Ga0207642_10013446 3300025899 Bacteria 2987
435 Ga0207642_10023805 3300025899 Bacteria 2452
436 Ga0207710_10016579 3300025900 Bacteria 3118
437 Ga0207710_10025350 3300025900 Bacteria 2559
438 Ga0207710_10088542 3300025900 Bacteria 1446
439 Ga0207688_10001006 3300025901 Bacteria 14351
440 Ga0207688_10015640 3300025901 Bacteria 4115
441 Ga0207680_10131226 3300025903 Bacteria 1652
442 Ga0207647_10012884 3300025904 Bacteria 5810
443 Ga0207647_10025960 3300025904 Bacteria 3839
444 Ga0207647_10730026 3300025904 Bacteria 538
445 Ga0207685_10277583 3300025905 Bacteria 821
446 Ga0207699_10023469 3300025906 Bacteria 3357
447 Ga0207699_10078246 3300025906 Bacteria 2042
448 Ga0207699_10705616 3300025906 Bacteria 739
449 Ga0207645_10001020 3300025907 Bacteria 23147
450 Ga0207645_10058013 3300025907 Bacteria 2472
451 Ga0207643_10000523 3300025908 Bacteria 24625
452 Ga0207643_10001208 3300025908 Bacteria 15269
453 Ga0207684_10067383 3300025910 Bacteria 3042
454 Ga0207684_11153643 3300025910 Bacteria 643
455 Ga0207684_11638964 3300025910 Bacteria 520
456 Ga0207654_10047157 3300025911 Bacteria 2461
457 Ga0207707_10018497 3300025912 Bacteria 6073
458 Ga0207707_10046164 3300025912 Bacteria 3793
459 Ga0207707_10061465 3300025912 Bacteria 3268
460 Ga0207707_10161758 3300025912 Bacteria 1957
461 Ga0207695_10321834 3300025913 Bacteria 1436
462 Ga0207671_10113380 3300025914 Bacteria 2065
463 Ga0207671_10445696 3300025914 Bacteria 1031
464 Ga0207693_10007054 3300025915 Bacteria 9272
465 Ga0207693_10008072 3300025915 Bacteria 8632
466 Ga0207693_10066907 3300025915 Bacteria 2813
467 Ga0207693_10107857 3300025915 Bacteria 2185
468 Ga0207663_10056960 3300025916 Bacteria 2461
469 Ga0207663_10085498 3300025916 Bacteria 2077
470 Ga0207663_10218119 3300025916 Bacteria 1386
471 Ga0207663_10420334 3300025916 Bacteria 1026
472 Ga0207663_10614654 3300025916 Bacteria 855
473 Ga0207663_10632256 3300025916 Bacteria 843
474 Ga0207660_10014892 3300025917 Bacteria 5126
475 Ga0207660_10072595 3300025917 Bacteria 2507
476 Ga0207660_10154346 3300025917 Bacteria 1766
477 Ga0207660_11097233 3300025917 Bacteria 648
478 Ga0207662_10002710 3300025918 Bacteria 8938
479 Ga0207662_10231646 3300025918 Bacteria 1207
480 Ga0207657_10005692 3300025919 Bacteria 13002
481 Ga0207657_10008810 3300025919 Bacteria 10207
482 Ga0207657_10190481 3300025919 Bacteria 1655
483 Ga0207657_10243838 3300025919 Bacteria 1434
484 Ga0207649_10004225 3300025920 Bacteria 7828
485 Ga0207649_10173044 3300025920 Bacteria 1506
486 Ga0207649_10361613 3300025920 Bacteria 1077
487 Ga0207652_10018458 3300025921 Bacteria 5722
488 Ga0207652_10167164 3300025921 Bacteria 1973
489 Ga0207652_10187627 3300025921 Bacteria 1859
490 Ga0207646_10809151 3300025922 Bacteria 834
491 Ga0207681_10004280 3300025923 Bacteria 8810
492 Ga0207681_10146685 3300025923 Bacteria 1764
493 Ga0207681_10408248 3300025923 Bacteria 1098
494 Ga0207681_10599154 3300025923 Bacteria 910
495 Ga0207694_10280897 3300025924 Bacteria 1368
496 Ga0207650_10003662 3300025925 Bacteria 10511
497 Ga0207650_10107215 3300025925 Bacteria 2158
498 Ga0207650_10219149 3300025925 Bacteria 1531
499 Ga0207650_10834846 3300025925 Bacteria 781
500 Ga0207659_10002130 3300025926 Bacteria 11734
501 Ga0207659_10091451 3300025926 Bacteria 2273
502 Ga0207687_10010078 3300025927 Bacteria 6180
503 Ga0207687_10051449 3300025927 Bacteria 2872
504 Ga0207687_10180844 3300025927 Bacteria 1634
505 Ga0207687_11033971 3300025927 Bacteria 705
506 Ga0207700_10046160 3300025928 Bacteria 3220
507 Ga0207700_10051330 3300025928 Bacteria 3078
508 Ga0207700_10107794 3300025928 Bacteria 2235
509 Ga0207700_10172647 3300025928 Bacteria 1805
510 Ga0207700_10201412 3300025928 Bacteria 1678
511 Ga0207700_10596871 3300025928 Bacteria 982
512 Ga0207700_10660825 3300025928 Bacteria 932
513 Ga0207664_10256980 3300025929 Bacteria 1526
514 Ga0207644_10006560 3300025931 Bacteria 7582
515 Ga0207644_10046794 3300025931 Bacteria 3083
516 Ga0207644_10417776 3300025931 Bacteria 1098
517 Ga0207644_10759134 3300025931 Bacteria 810
518 Ga0207690_10003881 3300025932 Bacteria 8837
519 Ga0207690_10077141 3300025932 Bacteria 2316
520 Ga0207690_10262440 3300025932 Bacteria 1339
521 Ga0207706_10004561 3300025933 Bacteria 13002
522 Ga0207706_10118814 3300025933 Bacteria 2325
523 Ga0207706_10265898 3300025933 Bacteria 1497
524 Ga0207686_10002841 3300025934 Bacteria 9345
525 Ga0207686_10032302 3300025934 Bacteria 3115
526 Ga0207686_10084799 3300025934 Bacteria 2076
527 Ga0207709_10003952 3300025935 Bacteria 8652
528 Ga0207670_10020819 3300025936 Bacteria 4036
529 Ga0207670_10800954 3300025936 Bacteria 785
530 Ga0207669_10000737 3300025937 Bacteria 14194
531 Ga0207669_10052926 3300025937 Bacteria 2442
532 Ga0207704_10005685 3300025938 Bacteria 5764
533 Ga0207704_10036572 3300025938 Bacteria 2826
534 Ga0207704_10209749 3300025938 Bacteria 1433
535 Ga0207704_10265516 3300025938 Bacteria 1296
536 Ga0207665_10005721 3300025939 Bacteria 8278
537 Ga0207665_10273127 3300025939 Bacteria 1256
538 Ga0207665_10434307 3300025939 Bacteria 1005
539 Ga0207691_10004854 3300025940 Bacteria 13002
540 Ga0207691_10039179 3300025940 Bacteria 4384
541 Ga0207711_10009494 3300025941 Bacteria 8117
542 Ga0207711_10073214 3300025941 Bacteria 2977
543 Ga0207711_10127495 3300025941 Bacteria 2278
544 Ga0207711_11322816 3300025941 Bacteria 663
545 Ga0207689_10001399 3300025942 Bacteria 23007
546 Ga0207661_10020336 3300025944 Bacteria 4961
547 Ga0207661_10123169 3300025944 Bacteria 2210
548 Ga0207679_10000829 3300025945 Bacteria 19882
549 Ga0207679_10997985 3300025945 Bacteria 767
550 Ga0207667_10057202 3300025949 Bacteria 4094
551 Ga0207651_10006082 3300025960 Bacteria 6273
552 Ga0207651_10044400 3300025960 Bacteria 2974
553 Ga0207651_10147297 3300025960 Bacteria 1828
554 Ga0207712_10062205 3300025961 Bacteria 2652
555 Ga0207712_10180598 3300025961 Bacteria 1657
556 Ga0207712_10391746 3300025961 Bacteria 1165
557 Ga0207712_10458195 3300025961 Bacteria 1083
558 Ga0207668_10002780 3300025972 Bacteria 10231
559 Ga0207668_10619963 3300025972 Bacteria 944
560 Ga0207640_10003641 3300025981 Bacteria 8308
561 Ga0207658_10014267 3300025986 Bacteria 5440
562 Ga0207658_10037047 3300025986 Bacteria 3501
563 Ga0207658_10052210 3300025986 Bacteria 3016
564 Ga0207658_10341638 3300025986 Bacteria 1301
565 Ga0207677_10027035 3300026023 Bacteria 3607
566 Ga0207677_10092877 3300026023 Bacteria 2198
567 Ga0207703_10005080 3300026035 Bacteria 10642
568 Ga0207703_10080054 3300026035 Bacteria 2720
569 Ga0207703_10201956 3300026035 Bacteria 1767
570 Ga0207639_10036135 3300026041 Bacteria 3659
571 Ga0207639_10065082 3300026041 Bacteria 2829
572 Ga0207639_10916842 3300026041 Bacteria 819
573 Ga0207678_10001694 3300026067 Bacteria 20208
574 Ga0207678_10012983 3300026067 Bacteria 7311
575 Ga0207678_10031049 3300026067 Bacteria 4663
576 Ga0207678_10109778 3300026067 Bacteria 2353
577 Ga0207678_11537825 3300026067 Bacteria 587
578 Ga0207708_10003453 3300026075 Bacteria 11648
579 Ga0207708_10254547 3300026075 Bacteria 1416
580 Ga0207708_10315477 3300026075 Bacteria 1274
581 Ga0207708_10615791 3300026075 Bacteria 921
582 Ga0207702_10010469 3300026078 Bacteria 7756
583 Ga0207702_10038277 3300026078 Bacteria 4017
584 Ga0207702_10113346 3300026078 Bacteria 2414
585 Ga0207702_10310197 3300026078 Bacteria 1500
586 Ga0207702_10613610 3300026078 Bacteria 1068
587 Ga0207641_10165514 3300026088 Bacteria 2013
588 Ga0207641_10616601 3300026088 Bacteria 1063
589 Ga0207641_10835457 3300026088 Bacteria 912
590 Ga0207648_10002393 3300026089 Bacteria 20202
591 Ga0207648_10498149 3300026089 Bacteria 1114
592 Ga0207676_10005110 3300026095 Bacteria 9289
593 Ga0207676_10031240 3300026095 Bacteria 4004
594 Ga0207676_10118340 3300026095 Bacteria 2229
595 Ga0207676_11178009 3300026095 Bacteria 759
596 Ga0207674_10058986 3300026116 Bacteria 3885
597 Ga0207675_100001715 3300026118 Bacteria 21956
598 Ga0207675_100003027 3300026118 Bacteria 16488
599 Ga0207683_10001190 3300026121 Bacteria 23550
600 Ga0207683_10013747 3300026121 Bacteria 6900
601 Ga0207683_10028744 3300026121 Bacteria 4809
602 Ga0207683_11406119 3300026121 Bacteria 645
603 Ga0207698_10370313 3300026142 Bacteria 1359
604 Ga0207698_10536497 3300026142 Bacteria 1144
605 Ga0209982_1004172 3300027552 Bacteria 2066
606 Ga0209970_1016555 3300027614 Bacteria 1230
607 Ga0210002_1000122 3300027617 Bacteria 12125
608 Ga0209983_1017838 3300027665 Bacteria 1471
609 Ga0209813_10049551 3300027866 Bacteria 1308
610 Ga0209813_10273215 3300027866 Bacteria 649
611 Ga0209974_10000486 3300027876 Bacteria 13249
612 Ga0207428_10000216 3300027907 Bacteria 79777
613 Ga0207428_10019935 3300027907 Bacteria 5711
614 Ga0207428_10447738 3300027907 Bacteria 942
615 Ga0268266_10016607 3300028379 Bacteria 6291
616 Ga0268266_10159361 3300028379 Bacteria 2040
617 Ga0268265_10068406 3300028380 Bacteria 2753
618 Ga0268265_10095849 3300028380 Bacteria 2383
619 Ga0268265_10493627 3300028380 Bacteria 1152
620 Ga0268265_11049010 3300028380 Bacteria 807
621 Ga0268264_10009868 3300028381 Bacteria 7903
622 Ga0268264_10044721 3300028381 Bacteria 3673
623 Ga0268264_10535331 3300028381 Bacteria 1147
624 Ga0268264_10758583 3300028381 Bacteria 967
625 Ga0268264_10971759 3300028381 Bacteria 855
626 Ga0265337_1003693 3300028556 Bacteria 6551
627 Ga0265338_10134384 3300028800 Bacteria 1948
628 Ga0265338_10239102 3300028800 Bacteria 1346
629 Ga0265338_10361182 3300028800 Bacteria 1042
630 Ga0265330_10020395 3300031235 Bacteria 3029
631 Ga0265332_10058081 3300031238 Bacteria 1657
632 Ga0265325_10000048 3300031241 Bacteria 82899
633 Ga0265325_10001543 3300031241 Bacteria 16115
634 Ga0265325_10006289 3300031241 Bacteria 7226
635 Ga0265325_10042260 3300031241 Bacteria 2385
636 Ga0265325_10056461 3300031241 Bacteria 2005
637 Ga0265340_10241478 3300031247 Bacteria 806
638 Ga0265340_10442588 3300031247 Bacteria 572
639 Ga0265331_10009513 3300031250 Bacteria 5451
640 Ga0265316_10192081 3300031344 Bacteria 1516
641 Ga0265316_10392475 3300031344 Bacteria 1000
642 Ga0265313_10000438 3300031595 Bacteria 44285
643 Ga0265313_10025531 3300031595 Bacteria 3128
644 Ga0265313_10056387 3300031595 Bacteria 1858
645 Ga0316579_10020080 3300031691 Bacteria 2958
646 Ga0307406_10625115 3300031901 Bacteria 891
647 Ga0307409_101664104 3300031995 Bacteria 667
648 Ga0307416_101271832 3300032002 Bacteria 842
649 Ga0307416_102297468 3300032002 Bacteria 640
650 Ga0307411_10359398 3300032005 Bacteria 1190
651 Ga0373930_0012045 3300034816 Bacteria 1572
652 Ga0373958_0004911 3300034819 Bacteria 2003
653 Ga0373926_0021720 3300035083 Bacteria 2223
654 Ga0373928_0004171 3300035084 Bacteria 2754
655 Ga0373934_0111102 3300035086 Bacteria 1111
656 Ga0373940_0001993 3300035088 Bacteria 3864
657 Ga0373944_0019469 3300035089 Bacteria 1948
658 Ga0373949_0027043 3300035090 Bacteria 1347
659 Ga0373949_0040187 3300035090 Bacteria 1147
660 Ga0373952_0026576 3300035092 Bacteria 1258
661 Ga0373923_0001890 3300035111 Bacteria 6246
662 Ga0373923_0035431 3300035111 Bacteria 2032
663 Ga0373932_0003391 3300035112 Bacteria 3838
664 Ga0373932_0093955 3300035112 Bacteria 967
665 Ga0373936_0001798 3300035113 Bacteria 7886
666 Ga0373936_0124188 3300035113 Bacteria 1105
667 Ga0373939_0001329 3300035114 Bacteria 6003
668 Ga0373939_0002892 3300035114 Bacteria 4035
669 Ga0373945_0003540 3300035116 Bacteria 4917
670 Ga0373954_0015360 3300035118 Bacteria 3423
671 Ga0373954_0111502 3300035118 Bacteria 1323
672 Ga0373954_0350883 3300035118 Bacteria 729
673 Ga0373954_0532854 3300035118 Bacteria 582
674 Ga0373956_0072775 3300035119 Bacteria 1570
675 Ga0373956_0123625 3300035119 Bacteria 1209
676 Ga0373957_0054574 3300035120 Bacteria 1535
677 Ga0373960_0062962 3300035121 Bacteria 1129
678 Ga0373960_0234755 3300035121 Bacteria 661
679 Ga0373943_0005045 3300035170 Bacteria 5955
680 Ga0373943_0304288 3300035170 Bacteria 906
681 Ga0373946_0001530 3300035171 Bacteria 8040
682 Ga0373946_0392247 3300035171 Bacteria 700
683 Ga0373955_0036131 3300035172 Bacteria 2620
684 Ga0373955_0095953 3300035172 Bacteria 1696
685 Ga0373942_0015907 3300035207 Bacteria 1839
686 Ga0373942_0026694 3300035207 Bacteria 1497
687 Ga0373942_0066022 3300035207 Bacteria 1047
688 Ga0373942_0372320 3300035207 Bacteria 508
689 Ga0373961_0137393 3300035241 Bacteria 823
690 Ga0373962_0001705 3300035242 Bacteria 5226
691 Ga0373962_0033329 3300035242 Bacteria 1421
692 Ga0373924_0028607 3300035410 Bacteria 2222
693 Ga0373931_0046111 3300035691 Bacteria 2303
694 Ga0373931_0115546 3300035691 Bacteria 1528
695 Ga0373931_0609871 3300035691 Bacteria 714
696 Ga0373935_0003239 3300035692 Bacteria 9407
697 Ga0373935_0041202 3300035692 Bacteria 2901
698 Ga0373935_0425498 3300035692 Bacteria 956
699 Ga0373927_0008421 3300035695 Bacteria 6936
700 Ga0373927_0032885 3300035695 Bacteria 3377
701 Ga0373927_0289826 3300035695 Bacteria 1077
702 Ga0373933_0113728 3300035724 Bacteria 1690
703 Ga0373947_0008462 3300035725 Bacteria 5927
704 Ga0373947_0011056 3300035725 Bacteria 5181
705 Ga0373947_0047520 3300035725 Bacteria 2572
706 Ga0373947_0133220 3300035725 Bacteria 1588
707 Ga0373937_0048364 3300036401 Bacteria 3893
708 Ga0373937_0272923 3300036401 Bacteria 1596
709 Ga0316582_0316671 3300036647 Bacteria 1072
710 Ga0373925_0002135 3300037068 Bacteria 16159
711 Ga0373925_0095869 3300037068 Bacteria 2273
712 Ga0373925_0108205 3300037068 Bacteria 2145
713 Ga0373925_0708022 3300037068 Bacteria 830
714 Ga0373925_1193336 3300037068 Bacteria 625
715 Ga0395899_0009657 3300037312 Bacteria 7405
716 Ga0395899_0387847 3300037312 Bacteria 927
717 Ga0395898_0051585 3300037466 Bacteria 4022
718 Ga0395898_1305619 3300037466 Bacteria 655
719 Ga0316581_0153089 3300037588 Bacteria 711
720 Ga0436364_0031906 3300037853 Bacteria 912
721 Ga0395901_0099569 3300038443 Bacteria 3048
722 Ga0395901_0187087 3300038443 Bacteria 2172
723 Ga0436365_0566814 3300039437 Bacteria 956
724 Ga0436365_1828125 3300039437 Bacteria 5509
725 Ga0436361_0335157 3300039447 Bacteria 10389
726 Ga0436363_1544399 3300039450 Bacteria 516
727 Ga0436362_0568357 3300039453 Bacteria 662
728 Ga0436362_0886180 3300039453 Bacteria 515
729 Ga0439453_0000142 3300041408 Bacteria 6329
730 Ga0439466_0160896 3300041411 Bacteria 687
731 Ga0439441_017133 3300042001 Bacteria 1298
732 Ga0439443_005846 3300042003 Bacteria 1661
733 Ga0439462_0180204 3300042015 Bacteria 599
734 Ga0439446_0142832 3300042156 Bacteria 783
735 Ga0439435_0029912 3300042436 Bacteria 1473
736 Ga0495617_027330 3300046452 Bacteria 1920
737 Ga0495592_0001176 3300046454 Bacteria 18145
738 Ga0495592_0018792 3300046454 Bacteria 5263
739 Ga0495603_0426702 3300046455 Bacteria 759
740 Ga0495629_0002326 3300046459 Bacteria 14645
741 Ga0495629_0027088 3300046459 Bacteria 4071
742 Ga0495629_0038860 3300046459 Bacteria 3351
743 Ga0495629_0052288 3300046459 Bacteria 2858
744 Ga0495641_0003224 3300046461 Bacteria 12382
745 Ga0495651_0014804 3300046462 Bacteria 6032
746 Ga0495651_0321825 3300046462 Bacteria 1031
747 Ga0495653_0012022 3300046463 Bacteria 7066
748 Ga0495653_0251071 3300046463 Bacteria 1174
749 Ga0495653_0405216 3300046463 Bacteria 866
750 Ga0495580_0020532 3300046472 Bacteria 4887
751 Ga0495582_0012004 3300046473 Bacteria 4772
752 Ga0495582_0032157 3300046473 Bacteria 2886
753 Ga0495582_0077819 3300046473 Bacteria 1840
754 Ga0495639_0007594 3300046475 Bacteria 4660
755 Ga0495639_0514909 3300046475 Bacteria 611
756 Ga0495662_0006908 3300046476 Bacteria 5637
757 Ga0495662_0070535 3300046476 Bacteria 1693
758 Ga0495664_0007982 3300046477 Bacteria 5893
759 Ga0495664_0027048 3300046477 Bacteria 3343
760 Ga0495664_0203578 3300046477 Bacteria 1199
761 Ga0495584_0011617 3300046491 Bacteria 4511
762 Ga0495584_0067390 3300046491 Bacteria 1799
763 Ga0495584_0178697 3300046491 Bacteria 1079
764 Ga0495584_0646540 3300046491 Bacteria 539
765 Ga0495585_0038970 3300046492 Bacteria 2673
766 Ga0495594_0031273 3300046499 Bacteria 2885
767 Ga0495594_0065658 3300046499 Bacteria 2012
768 Ga0495594_0169787 3300046499 Bacteria 1241
769 Ga0495608_0702474 3300046511 Bacteria 602
770 Ga0495616_0162135 3300046513 Bacteria 1005
771 Ga0495618_0022415 3300046514 Bacteria 3900
772 Ga0495618_0086239 3300046514 Bacteria 2007
773 Ga0495628_0012601 3300046516 Bacteria 7125
774 Ga0495628_0014768 3300046516 Bacteria 6536
775 Ga0495631_0146871 3300046518 Bacteria 1012
776 Ga0495637_0024298 3300046520 Bacteria 2742
777 Ga0495637_0118637 3300046520 Bacteria 1020
778 Ga0495644_0010451 3300046523 Bacteria 3577
779 Ga0495663_0004223 3300046525 Bacteria 4055
780 Ga0495666_0216948 3300046526 Bacteria 877
781 Ga0495652_0013444 3300046529 Bacteria 7367
782 Ga0495652_0090103 3300046529 Bacteria 2510
783 Ga0495652_0117918 3300046529 Bacteria 2122
784 Ga0495665_0006037 3300046531 Bacteria 6530
785 Ga0495640_0237202 3300046533 Bacteria 1145
786 Ga0495640_0461767 3300046533 Bacteria 775
787 Ga0495586_0006303 3300046535 Bacteria 6337
788 Ga0495587_0020363 3300046536 Bacteria 4096
789 Ga0495598_0015646 3300046537 Bacteria 1919
790 Ga0495609_0147907 3300046538 Bacteria 1000
791 Ga0495621_0078562 3300046539 Bacteria 1227
792 Ga0495645_0062076 3300046543 Bacteria 2707
793 Ga0495645_0202497 3300046543 Bacteria 1345
794 Ga0495622_0010562 3300046557 Bacteria 4262
795 Ga0495633_0019514 3300046558 Bacteria 3428
796 Ga0495667_0006887 3300046559 Bacteria 7719
797 Ga0495667_0117346 3300046559 Bacteria 1719
798 Ga0495667_0206919 3300046559 Bacteria 1255
799 Ga0495656_0001344 3300046615 Bacteria 8020
800 Ga0495656_0118206 3300046615 Bacteria 1248
801 Ga0495634_0009991 3300046642 Bacteria 6971
802 Ga0495634_0055078 3300046642 Bacteria 2660
803 Ga0495611_0007418 3300046648 Bacteria 4658
804 Ga0495635_0062421 3300046663 Bacteria 2559
805 Ga0495635_0104544 3300046663 Bacteria 1935
806 Ga0495635_0199435 3300046663 Bacteria 1357
807 Ga0495659_0001817 3300046664 Bacteria 7080
808 Ga0495588_0002846 3300046674 Bacteria 7447
809 Ga0495657_0534861 3300046675 Bacteria 681
810 Ga0495599_0010609 3300046678 Bacteria 5638
811 Ga0495599_0020143 3300046678 Bacteria 4155
812 Ga0495623_0050706 3300046679 Bacteria 2628
813 Ga0495646_0009173 3300046680 Bacteria 6277
814 Ga0495647_0001804 3300046681 Bacteria 6621
815 Ga0495647_0082258 3300046681 Bacteria 1307
816 Ga0495658_0006028 3300046683 Bacteria 5951
817 Ga0495658_0086285 3300046683 Bacteria 1851
818 Ga0495658_0092954 3300046683 Bacteria 1789
819 Ga0495669_0073885 3300046684 Bacteria 1558
820 Ga0495613_0093005 3300046689 Bacteria 2183
821 Ga0495613_0300916 3300046689 Bacteria 1110
822 Ga0495613_0425436 3300046689 Bacteria 903
823 Ga0495624_0026834 3300046690 Bacteria 3773
824 Ga0495624_0471941 3300046690 Bacteria 751
825 Ga0495670_0005161 3300046691 Bacteria 6425
826 Ga0495589_0404245 3300046794 Bacteria 627
827 Ga0495600_0008802 3300046809 Bacteria 6216
828 Ga0495600_0118383 3300046809 Bacteria 1723
829 Ga0495600_0208072 3300046809 Bacteria 1254
830 Ga0495581_0009356 3300047315 Bacteria 5669
831 Ga0495581_0066511 3300047315 Bacteria 2084
832 Ga0495604_0018521 3300047317 Bacteria 5578
833 Ga0495674_0092176 3300047319 Bacteria 2587
834 Ga0495674_0257428 3300047319 Bacteria 1435
835 Ga0495676_0128194 3300047321 Bacteria 1835
836 Ga0495676_0631197 3300047321 Bacteria 696
837 Ga0495680_0008612 3300047322 Bacteria 9260
838 Ga0495680_0026104 3300047322 Bacteria 4822
839 Ga0495680_0082932 3300047322 Bacteria 2418
840 Ga0495677_0252863 3300047445 Bacteria 689
841 Ga0495684_0004924 3300047471 Bacteria 10427
842 Ga0495684_0156524 3300047471 Bacteria 1702
843 Ga0495684_0444221 3300047471 Bacteria 903
844 Ga0495684_0615990 3300047471 Bacteria 730
845 Ga0495593_0014850 3300047673 Bacteria 4424
846 Ga0495593_0122505 3300047673 Bacteria 1323
847 Ga0495593_0132206 3300047673 Bacteria 1266
848 Ga0495602_0010978 3300048088 Bacteria 9383
849 Ga0495614_0002942 3300048089 Bacteria 7587
850 Ga0496100_0000800 3300048903 Bacteria 15030
851 Ga0496100_0008731 3300048903 Bacteria 5661
852 Ga0496100_0011005 3300048903 Bacteria 5132
853 Ga0496100_0140634 3300048903 Bacteria 1710
854 Ga0496101_0003969 3300048904 Bacteria 9257
855 Ga0496101_0346252 3300048904 Bacteria 1167
856 Ga0496101_0621133 3300048904 Unclassified 854
857 Ga0496101_0669894 3300048904 Bacteria 819
858 Ga0496101_1126837 3300048904 Bacteria 616
859 Ga0496102_0009606 3300048905 Bacteria 8319
860 Ga0496102_0029755 3300048905 Bacteria 4887
861 Ga0496102_0032780 3300048905 Bacteria 4668
862 Ga0496102_0046353 3300048905 Bacteria 3948
863 Ga0496102_0068715 3300048905 Bacteria 3251
864 Ga0496102_0451115 3300048905 Bacteria 1206
865 Ga0496102_0633192 3300048905 Bacteria 993
866 Ga0496103_0003651 3300048906 Bacteria 9370
867 Ga0496103_0006551 3300048906 Bacteria 6947
868 Ga0496103_0017979 3300048906 Bacteria 4237
869 Ga0496103_0025178 3300048906 Bacteria 3595
870 Ga0496103_0031975 3300048906 Bacteria 3209
871 Ga0496103_0043635 3300048906 Bacteria 2761
872 Ga0496103_0258265 3300048906 Bacteria 1121
873 Ga0496103_0348092 3300048906 Unclassified 953
874 Ga0496104_0000196 3300048907 Bacteria 53901
875 Ga0496104_0000495 3300048907 Bacteria 34041
876 Ga0496104_0001900 3300048907 Bacteria 18094
877 Ga0496104_0003411 3300048907 Bacteria 13715
878 Ga0496104_0061470 3300048907 Bacteria 3561
879 Ga0496104_0069936 3300048907 Bacteria 3336
880 Ga0496104_0145276 3300048907 Bacteria 2278
881 Ga0496104_0149269 3300048907 Bacteria 2244
882 Ga0496104_0178276 3300048907 Bacteria 2035
883 Ga0496104_0345947 3300048907 Bacteria 1399
884 Ga0496104_1805782 3300048907 Bacteria 513
885 Ga0496105_0004873 3300048908 Bacteria 10137
886 Ga0496105_0005167 3300048908 Bacteria 9895
887 Ga0496105_0029068 3300048908 Bacteria 4524
888 Ga0496105_0091794 3300048908 Bacteria 2507
889 Ga0496105_0273851 3300048908 Bacteria 1362
890 Ga0496105_0427997 3300048908 Bacteria 1047
891 Ga0496105_0458298 3300048908 Bacteria 1005
892 Ga0496106_0001635 3300048909 Bacteria 16815
893 Ga0496106_0002852 3300048909 Bacteria 12840
894 Ga0496106_0024841 3300048909 Bacteria 4455
895 Ga0496106_0060488 3300048909 Bacteria 2871
896 Ga0496106_0127514 3300048909 Bacteria 1993
897 Ga0496106_0143308 3300048909 Bacteria 1880
898 Ga0496106_0179026 3300048909 Bacteria 1682
899 Ga0496106_0241091 3300048909 Bacteria 1445
900 Ga0496107_0000869 3300048910 Bacteria 17776
901 Ga0496107_0012844 3300048910 Bacteria 5852
902 Ga0496107_0031992 3300048910 Bacteria 3757
903 Ga0496107_0043706 3300048910 Bacteria 3219
904 Ga0496107_0154684 3300048910 Bacteria 1697
905 Ga0496107_0182237 3300048910 Bacteria 1559
906 Ga0496108_0001103 3300048911 Bacteria 21100
907 Ga0496108_0008566 3300048911 Bacteria 8292
908 Ga0496108_0043798 3300048911 Bacteria 3738
909 Ga0496108_0047169 3300048911 Bacteria 3601
910 Ga0496108_0069289 3300048911 Bacteria 2976
911 Ga0496108_0105275 3300048911 Bacteria 2408
912 Ga0496108_0154898 3300048911 Bacteria 1978
913 Ga0496108_0335043 3300048911 Bacteria 1319
914 Ga0496108_0667827 3300048911 Bacteria 903
915 Ga0496109_0001554 3300048912 Bacteria 19107
916 Ga0496109_0003899 3300048912 Bacteria 12464
917 Ga0496109_0008494 3300048912 Bacteria 8730
918 Ga0496109_0037839 3300048912 Bacteria 4360
919 Ga0496109_0112776 3300048912 Bacteria 2528
920 Ga0496109_0118317 3300048912 Bacteria 2466
921 Ga0496109_0248335 3300048912 Bacteria 1675
922 Ga0496109_0497534 3300048912 Bacteria 1151
923 Ga0496109_0529933 3300048912 Bacteria 1111
924 Ga0496110_0015739 3300048913 Bacteria 6303
925 Ga0496110_0019989 3300048913 Bacteria 5645
926 Ga0496110_0022834 3300048913 Bacteria 5315
927 Ga0496110_0044797 3300048913 Bacteria 3864
928 Ga0496110_0072383 3300048913 Bacteria 3058
929 Ga0496110_0084821 3300048913 Bacteria 2827
930 Ga0496110_0165503 3300048913 Bacteria 2005
931 Ga0496110_0234794 3300048913 Bacteria 1668
932 Ga0496110_0325880 3300048913 Bacteria 1399
933 Ga0496110_0782426 3300048913 Bacteria 858
934 Ga0496111_0010303 3300048914 Bacteria 6264
935 Ga0496111_0018262 3300048914 Bacteria 4856
936 Ga0496111_0035114 3300048914 Bacteria 3582
937 Ga0496111_0125823 3300048914 Bacteria 1894
938 Ga0496111_0236609 3300048914 Bacteria 1356
939 Ga0496111_0254702 3300048914 Bacteria 1302
940 Ga0496112_0003337 3300048915 Bacteria 13247
941 Ga0496112_0009038 3300048915 Bacteria 8948
942 Ga0496112_0085451 3300048915 Bacteria 3121
943 Ga0496112_0101787 3300048915 Bacteria 2842
944 Ga0496112_0128268 3300048915 Bacteria 2507
945 Ga0496112_0158741 3300048915 Bacteria 2228
946 Ga0496112_0274241 3300048915 Bacteria 1634
947 Ga0496112_0905917 3300048915 Bacteria 804
948 Ga0496112_0942505 3300048915 Bacteria 784
949 Ga0496112_0978126 3300048915 Bacteria 766
950 Ga0496112_0993100 3300048915 Bacteria 759
951 Ga0496113_0000227 3300048916 Bacteria 26407
952 Ga0496113_0007502 3300048916 Bacteria 7027
953 Ga0496113_0013393 3300048916 Bacteria 5554
954 Ga0496113_0015368 3300048916 Bacteria 5259
955 Ga0496113_0041577 3300048916 Bacteria 3392
956 Ga0496113_0345871 3300048916 Bacteria 1193
957 Ga0496113_0508090 3300048916 Bacteria 967
958 Ga0496114_0001741 3300048917 Bacteria 16526
959 Ga0496114_0012467 3300048917 Bacteria 6805
960 Ga0496114_0049124 3300048917 Bacteria 3509
961 Ga0496114_0085665 3300048917 Bacteria 2669
962 Ga0496114_0091782 3300048917 Bacteria 2580
963 Ga0496114_0519271 3300048917 Bacteria 1053
964 Ga0496114_1065326 3300048917 Bacteria 693
965 Ga0496115_0032793 3300048918 Bacteria 4099
966 Ga0496115_0034046 3300048918 Bacteria 4026
967 Ga0496115_0034934 3300048918 Bacteria 3974
968 Ga0496115_0178224 3300048918 Bacteria 1757
969 Ga0496115_0254693 3300048918 Bacteria 1444
970 Ga0496115_0280790 3300048918 Bacteria 1367
971 Ga0496115_0287719 3300048918 Bacteria 1348
972 Ga0496115_0776740 3300048918 Bacteria 747
973 Ga0496125_0426417 3300048928 Bacteria 767
974 Ga0501031_0013691 3300049568 Bacteria 5285
975 Ga0501031_0141577 3300049568 Bacteria 1572
976 Ga0501032_0019995 3300049569 Bacteria 4671
977 Ga0501032_0024985 3300049569 Bacteria 4121
978 Ga0501032_0035784 3300049569 Bacteria 3393
979 Ga0501032_0086656 3300049569 Bacteria 2081
980 Ga0501033_0006958 3300049570 Bacteria 8831
981 Ga0501033_0008378 3300049570 Bacteria 8007
982 Ga0501033_0041258 3300049570 Bacteria 3444
983 Ga0501033_0307675 3300049570 Bacteria 1115
984 Ga0501033_0920808 3300049570 Bacteria 587
985 Ga0501034_0001401 3300049571 Bacteria 32406
986 Ga0501034_0056561 3300049571 Bacteria 3947
987 Ga0501034_0085870 3300049571 Bacteria 3148
988 Ga0501034_0089853 3300049571 Bacteria 3069
989 Ga0501034_0190194 3300049571 Bacteria 2015
990 Ga0501034_0210555 3300049571 Bacteria 1899
991 Ga0501034_0373529 3300049571 Bacteria 1352
992 Ga0501036_0000164 3300049572 Bacteria 43588
993 Ga0501036_0018152 3300049572 Bacteria 5891
994 Ga0501036_0041476 3300049572 Bacteria 3894
995 Ga0501036_0565933 3300049572 Bacteria 944
996 Ga0501037_0007497 3300049573 Bacteria 7986
997 Ga0501037_0010040 3300049573 Bacteria 6945
998 Ga0501037_0011305 3300049573 Bacteria 6570
999 Ga0501037_0073874 3300049573 Bacteria 2479
1000 Ga0501037_0235422 3300049573 Bacteria 1285
1001 Ga0501038_0003058 3300049574 Bacteria 15602
1002 Ga0501038_0030276 3300049574 Bacteria 4790
1003 Ga0501038_0043390 3300049574 Bacteria 3910
1004 Ga0501038_0113595 3300049574 Bacteria 2241
1005 Ga0501038_0157122 3300049574 Bacteria 1851
1006 Ga0501038_0269031 3300049574 Bacteria 1344
1007 Ga0501038_0407011 3300049574 Bacteria 1052
1008 Ga0501038_0562182 3300049574 Bacteria 866
1009 Ga0501038_1060019 3300049574 Bacteria 593
1010 Ga0501039_0022121 3300049575 Bacteria 4879
1011 Ga0501039_0041250 3300049575 Bacteria 3564
1012 Ga0501039_0262623 3300049575 Bacteria 1357
1013 Ga0501040_0190468 3300049576 Bacteria 1455
1014 Ga0501040_0381605 3300049576 Bacteria 1011
1015 Ga0501042_0015292 3300049578 Bacteria 5253
1016 Ga0501043_0001255 3300049579 Bacteria 22361
1017 Ga0501043_0014567 3300049579 Bacteria 6157
1018 Ga0501043_0050128 3300049579 Bacteria 3282
1019 Ga0501043_0109996 3300049579 Bacteria 2164
1020 Ga0501046_0119784 3300049580 Bacteria 2003
1021 Ga0501046_0778727 3300049580 Bacteria 671
1022 Ga0501046_1139079 3300049580 Bacteria 538
1023 Ga0501047_0003578 3300049581 Bacteria 14663
1024 Ga0501047_0062444 3300049581 Bacteria 3593
1025 Ga0501047_0187286 3300049581 Bacteria 1934
1026 Ga0501047_0729625 3300049581 Bacteria 807
1027 Ga0501047_0838593 3300049581 Bacteria 733
1028 Ga0501048_0025760 3300049582 Bacteria 4284
1029 Ga0501048_0158606 3300049582 Bacteria 1601
1030 Ga0501048_0341218 3300049582 Bacteria 1068
1031 Ga0501068_0187277 3300049584 Bacteria 1310
1032 Ga0501069_0012501 3300049585 Bacteria 4516
1033 Ga0501069_0071517 3300049585 Bacteria 1944
1034 Ga0501070_0012006 3300049586 Bacteria 7311
1035 Ga0501070_0012272 3300049586 Bacteria 7231
1036 Ga0501070_0016597 3300049586 Bacteria 6185
1037 Ga0501070_0117666 3300049586 Bacteria 2195
1038 Ga0501070_0146184 3300049586 Bacteria 1951
1039 Ga0501071_0116255 3300049587 Bacteria 1980
1040 Ga0501071_0404931 3300049587 Bacteria 1042
1041 Ga0501072_0013044 3300049588 Bacteria 6361
1042 Ga0501072_0061603 3300049588 Bacteria 2960
1043 Ga0501072_0462933 3300049588 Bacteria 1004
1044 Ga0501073_0021522 3300049589 Bacteria 4649
1045 Ga0501073_0239645 3300049589 Bacteria 1253
1046 Ga0501073_0379336 3300049589 Bacteria 977
1047 Ga0501074_0019707 3300049590 Bacteria 4897
1048 Ga0501075_0041013 3300049591 Bacteria 3469
1049 Ga0501076_0020689 3300049592 Bacteria 5039
1050 Ga0501076_0029728 3300049592 Bacteria 4251
1051 Ga0501076_0135732 3300049592 Bacteria 1997
1052 Ga0501076_0547667 3300049592 Bacteria 954
1053 Ga0501077_0134249 3300049593 Bacteria 1569
1054 Ga0501077_0324498 3300049593 Bacteria 981
1055 Ga0501079_0346552 3300049741 Bacteria 1164
1056 Ga0501079_0429266 3300049741 Bacteria 1037
1057 Ga0501079_0438785 3300049741 Bacteria 1025
1058 Ga0501079_0504317 3300049741 Bacteria 951
1059 Ga0501080_0001467 3300049742 Bacteria 19851
1060 Ga0501080_0045146 3300049742 Bacteria 4102
1061 Ga0501080_0056160 3300049742 Bacteria 3667
1062 Ga0501080_0137449 3300049742 Bacteria 2261
1063 Ga0501081_0094108 3300049743 Bacteria 2111
1064 Ga0501081_0576892 3300049743 Bacteria 841
1065 Ga0501083_0009826 3300049744 Bacteria 6754
1066 Ga0501083_0289722 3300049744 Bacteria 1065
1067 Ga0501083_0642114 3300049744 Bacteria 690
1068 Ga0501083_0797846 3300049744 Bacteria 614
1069 Ga0501035_0000995 3300049822 Bacteria 29963
1070 Ga0501035_0052529 3300049822 Bacteria 3646
1071 Ga0501035_0398300 3300049822 Bacteria 1146
1072 Ga0501035_0526792 3300049822 Bacteria 970
1073 Ga0501044_0000822 3300049823 Bacteria 37410
1074 Ga0501044_0002823 3300049823 Bacteria 19779
1075 Ga0501044_0038058 3300049823 Bacteria 5023
1076 Ga0501044_0050872 3300049823 Bacteria 4274
1077 Ga0501044_0106489 3300049823 Bacteria 2816
1078 Ga0501044_0158444 3300049823 Bacteria 2242
1079 Ga0501044_0706984 3300049823 Bacteria 893
1080 Ga0501044_0880801 3300049823 Bacteria 771
1081 Ga0501044_1142563 3300049823 Bacteria 647
1082 nmdc:mga03683_170518_c1 3300050489 Bacteria 989
1083 nmdc:mga03683_222132_c1 3300050489 Bacteria 872
1084 nmdc:mga03n38_32116_c1 3300050490 Bacteria 2221
1085 nmdc:mga03n38_71569_c1 3300050490 Bacteria 1606
1086 nmdc:mga00v17_186027_c1 3300050491 Bacteria 1341
1087 nmdc:mga00v17_57550_c1 3300050491 Bacteria 2379
1088 nmdc:mga00v17_6222_c1 3300050491 Bacteria 6329
1089 nmdc:mga0yw44_160891_c1 3300050492 Bacteria 1470
1090 nmdc:mga0yw44_199341_c1 3300050492 Bacteria 1322
1091 nmdc:mga0yw44_208031_c1 3300050492 Bacteria 1294
1092 nmdc:mga0k408_157063_c2 3300050493 Bacteria 976
1093 nmdc:mga06z11_11724_c1 3300050494 Bacteria 3789
1094 nmdc:mga06z11_141958_c1 3300050494 Bacteria 1358
1095 nmdc:mga06z11_20872_c1 3300050494 Bacteria 3034
1096 nmdc:mga06z11_238864_c1 3300050494 Bacteria 1067
1097 nmdc:mga04h51_28289_c1 3300050495 Bacteria 1748
1098 nmdc:mga04h51_305837_c1 3300050495 Bacteria 649
1099 nmdc:mga05p37_109548_c1 3300050507 Bacteria 3397
1100 nmdc:mga05p37_25723_c1 3300050507 Bacteria 7158
1101 nmdc:mga05p37_302597_c1 3300050507 Bacteria 1899
1102 nmdc:mga05p37_6013_c1 3300050507 Bacteria 14287
1103 nmdc:mga09592_2783_c1 3300050508 Bacteria 14165
1104 nmdc:mga0qj67_1876_c1 3300050509 Bacteria 14908
1105 nmdc:mga0qj67_198406_c1 3300050509 Bacteria 1631
1106 nmdc:mga06r32_22491_c1 3300050510 Bacteria 5829
1107 nmdc:mga06r32_316558_c1 3300050510 Bacteria 1546
1108 nmdc:mga06r32_377715_c1 3300050510 Bacteria 1400
1109 nmdc:mga08y16_12040_c1 3300050511 Bacteria 9088
1110 nmdc:mga08y16_1705303_c1 3300050511 Bacteria 585
1111 nmdc:mga08y16_194584_c1 3300050511 Bacteria 2102
1112 nmdc:mga08y16_245924_c1 3300050511 Bacteria 1849
1113 nmdc:mga08y16_565194_c1 3300050511 Bacteria 1150
1114 nmdc:mga08y16_995466_c1 3300050511 Bacteria 818
1115 nmdc:mga0n895_1049952_c1 3300050512 Bacteria 794
1116 nmdc:mga0n895_124072_c1 3300050512 Bacteria 2605
1117 nmdc:mga0n895_1539_c1 3300050512 Bacteria 17321
1118 nmdc:mga0n895_254629_c1 3300050512 Bacteria 1781
1119 nmdc:mga0n895_436410_c1 3300050512 Bacteria 1323
1120 nmdc:mga0n895_51388_c1 3300050512 Bacteria 4044
1121 nmdc:mga0n895_602819_c1 3300050512 Bacteria 1100
1122 nmdc:mga0n895_97038_c1 3300050512 Bacteria 2953
1123 nmdc:mga0rr50_102296_c1 3300050513 Bacteria 2253
1124 nmdc:mga0rr50_1559836_c1 3300050513 Bacteria 558
1125 nmdc:mga0rr50_164488_c1 3300050513 Bacteria 1803
1126 nmdc:mga0rr50_321712_c1 3300050513 Unclassified 1297
1127 nmdc:mga0rr50_6117_c1 3300050513 Bacteria 7280
1128 nmdc:mga0rr50_735358_c1 3300050513 Bacteria 842
1129 nmdc:mga08x19_1035964_c1 3300050514 Bacteria 583
1130 nmdc:mga08x19_831422_c1 3300050514 Bacteria 656
1131 nmdc:mga0a205_34744_c1 3300050515 Bacteria 4838
1132 nmdc:mga0sz30_456281_c1 3300050516 Bacteria 574
1133 Ga0495601_0000456 3300053077 Bacteria 21456
1134 Ga0495601_0009329 3300053077 Bacteria 5801
1135 Ga0495601_0040185 3300053077 Bacteria 2929
1136 Ga0495601_0056685 3300053077 Bacteria 2481
1137 Ga0495612_0005524 3300053078 Bacteria 5226
1138 Ga0495612_0007164 3300053078 Bacteria 4564
1139 Ga0495612_0012818 3300053078 Bacteria 3379
1140 Ga0495595_0001524 3300053084 Bacteria 9029
1141 Ga0495595_0072824 3300053084 Bacteria 1626
1142 Ga0495595_0086040 3300053084 Bacteria 1503
1143 Ga0495595_0186388 3300053084 Bacteria 1030
1144 Ga0495619_0000551 3300053085 Bacteria 24828
1145 Ga0495619_0002087 3300053085 Bacteria 13282
1146 Ga0495619_0016823 3300053085 Bacteria 4630
1147 Ga0495619_0025754 3300053085 Bacteria 3780
1148 Ga0495619_0109308 3300053085 Bacteria 1888
1149 Ga0495619_0138522 3300053085 Bacteria 1674
1150 Ga0495619_0343311 3300053085 Bacteria 1033
1151 Ga0500578_0544560 3300053086 Bacteria 646
1152 Ga0500644_0108792 3300053088 Bacteria 1064
1153 Ga0500651_0041727 3300053093 Bacteria 2892
1154 Ga0500566_0214035 3300053094 Bacteria 963
1155 Ga0500641_0032101 3300053096 Bacteria 2075
1156 Ga0500650_0055336 3300053098 Bacteria 1848
1157 Ga0500593_243260 3300053117 Bacteria 615
1158 Ga0500616_0000002 3300053153 Bacteria 1611257
1159 Ga0500645_017683 3300053730 Bacteria 2232
1160 Ga0501084_0251137 3300054114 Bacteria 1493
1161 Ga0501082_0101011 3300060353 Bacteria 2495
1162 Ga0501082_0147554 3300060353 Bacteria 2042
1163 Ga0501082_0179635 3300060353 Bacteria 1840
1164 Ga0501082_0286220 3300060353 Bacteria 1435
1165 Ga0530510_0353849 3300061734 Bacteria 1103
1166 Ga0530510_0575919 3300061734 Bacteria 856

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026095 Ga0207676_11178009 Ga0207676_111780092 126
2 3300035118 Ga0373954_0532854 Ga0373954_0532854_143_571 127
3 3300002073 JGI24745J21846_1043856 JGI24745J21846_10438562 132
4 3300005518 Ga0070699_101303952 Ga0070699_1013039521 133
5 iso_pu_bacteria 2643221547 2643755924 136
6 3300003316 rootH1_10035081 rootH1_100350814 137
7 3300039450 Ga0436363_1544399 Ga0436363_1544399_62_478 138
8 3300002459 JGI24751J29686_10025837 JGI24751J29686_100258372 139
9 3300005937 Ga0081455_10014661 Ga0081455_1001466110 139
10 3300005937 Ga0081455_10295044 Ga0081455_102950441 139
11 3300005981 Ga0081538_10041292 Ga0081538_100412923 139
12 3300002239 JGI24034J26672_10006378 JGI24034J26672_100063783 140
13 3300002244 JGI24742J22300_10001841 JGI24742J22300_100018414 140
14 3300005338 Ga0068868_100087725 Ga0068868_1000877253 140
15 3300005339 Ga0070660_100369679 Ga0070660_1003696792 140
16 3300005340 Ga0070689_100578161 Ga0070689_1005781612 140
17 3300005347 Ga0070668_100038116 Ga0070668_1000381164 140
18 3300005355 Ga0070671_100227972 Ga0070671_1002279723 140
19 3300005367 Ga0070667_100267605 Ga0070667_1002676052 140
20 3300005435 Ga0070714_100103058 Ga0070714_1001030581 140
21 3300005436 Ga0070713_100191291 Ga0070713_1001912913 140
22 3300005436 Ga0070713_100572504 Ga0070713_1005725042 140
23 3300005439 Ga0070711_100140164 Ga0070711_1001401642 140
24 3300005441 Ga0070700_100027984 Ga0070700_1000279844 140
25 3300005444 Ga0070694_100098667 Ga0070694_1000986673 140
26 3300005455 Ga0070663_100101851 Ga0070663_1001018513 140
27 3300005466 Ga0070685_11608589 Ga0070685_116085891 140
28 3300005471 Ga0070698_100524120 Ga0070698_1005241203 140
29 3300005518 Ga0070699_100731683 Ga0070699_1007316832 140
30 3300005530 Ga0070679_101895330 Ga0070679_1018953301 140
31 3300005535 Ga0070684_100054756 Ga0070684_1000547564 140
32 3300005536 Ga0070697_100036768 Ga0070697_1000367682 140
33 3300005536 Ga0070697_100370943 Ga0070697_1003709433 140
34 3300005544 Ga0070686_100034178 Ga0070686_1000341784 140
35 3300005548 Ga0070665_100326964 Ga0070665_1003269643 140
36 3300005549 Ga0070704_100087525 Ga0070704_1000875253 140
37 3300005564 Ga0070664_100649343 Ga0070664_1006493432 140
38 3300005614 Ga0068856_101703675 Ga0068856_1017036752 140
39 3300005615 Ga0070702_100557270 Ga0070702_1005572702 140
40 3300005616 Ga0068852_100067469 Ga0068852_1000674693 140
41 3300005617 Ga0068859_100048040 Ga0068859_1000480403 140
42 3300005617 Ga0068859_100752815 Ga0068859_1007528152 140
43 3300005618 Ga0068864_100040226 Ga0068864_1000402265 140
44 3300005618 Ga0068864_100366800 Ga0068864_1003668001 140
45 3300005719 Ga0068861_100149423 Ga0068861_1001494233 140
46 3300005834 Ga0068851_10400670 Ga0068851_104006701 140
47 3300005841 Ga0068863_101478528 Ga0068863_1014785281 140
48 3300005843 Ga0068860_100047742 Ga0068860_1000477424 140
49 3300005844 Ga0068862_101558907 Ga0068862_1015589071 140
50 3300005937 Ga0081455_10041818 Ga0081455_100418182 140
51 3300005937 Ga0081455_10116763 Ga0081455_101167633 140
52 3300006028 Ga0070717_10150167 Ga0070717_101501674 140
53 3300006028 Ga0070717_10263454 Ga0070717_102634542 140
54 3300006175 Ga0070712_100055457 Ga0070712_1000554572 140
55 3300006175 Ga0070712_100275385 Ga0070712_1002753851 140
56 3300006237 Ga0097621_100045558 Ga0097621_1000455584 140
57 3300006358 Ga0068871_100083567 Ga0068871_1000835672 140
58 3300006844 Ga0075428_100017138 Ga0075428_1000171389 140
59 3300006844 Ga0075428_100575571 Ga0075428_1005755712 140
60 3300006846 Ga0075430_100234758 Ga0075430_1002347582 140
61 3300006847 Ga0075431_100005477 Ga0075431_1000054774 140
62 3300006847 Ga0075431_100349390 Ga0075431_1003493902 140
63 3300006871 Ga0075434_100043832 Ga0075434_1000438328 140
64 3300006871 Ga0075434_100552116 Ga0075434_1005521162 140
65 3300006914 Ga0075436_100233885 Ga0075436_1002338851 140
66 3300006931 Ga0097620_100048041 Ga0097620_1000480413 140
67 3300006931 Ga0097620_100752860 Ga0097620_1007528602 140
68 3300007076 Ga0075435_100120318 Ga0075435_1001203181 140
69 3300007076 Ga0075435_100642636 Ga0075435_1006426362 140
70 3300007265 Ga0099794_10641639 Ga0099794_106416392 140
71 3300009011 Ga0105251_10112195 Ga0105251_101121952 140
72 3300009036 Ga0105244_10195507 Ga0105244_101955072 140
73 3300009092 Ga0105250_10094806 Ga0105250_100948062 140
74 3300009094 Ga0111539_10429446 Ga0111539_104294462 140
75 3300009101 Ga0105247_10024208 Ga0105247_100242085 140
76 3300009101 Ga0105247_10186310 Ga0105247_101863103 140
77 3300009147 Ga0114129_10006801 Ga0114129_100068015 140
78 3300009147 Ga0114129_10037206 Ga0114129_100372066 140
79 3300009174 Ga0105241_12461476 Ga0105241_124614761 140
80 3300009176 Ga0105242_11183727 Ga0105242_111837272 140
81 3300009177 Ga0105248_11828815 Ga0105248_118288151 140
82 3300010375 Ga0105239_10059534 Ga0105239_100595343 140
83 3300011119 Ga0105246_10037433 Ga0105246_100374334 140
84 3300011119 Ga0105246_10427703 Ga0105246_104277032 140
85 3300013105 Ga0157369_10557881 Ga0157369_105578812 140
86 3300013306 Ga0163162_10221007 Ga0163162_102210073 140
87 3300013306 Ga0163162_10360873 Ga0163162_103608733 140
88 3300013307 Ga0157372_11529704 Ga0157372_115297042 140
89 3300014325 Ga0163163_10003639 Ga0163163_100036397 140
90 3300014745 Ga0157377_10033977 Ga0157377_100339771 140
91 3300014968 Ga0157379_10783047 Ga0157379_107830472 140
92 3300021361 Ga0213872_10024190 Ga0213872_100241902 140
93 3300025321 Ga0207656_10332443 Ga0207656_103324431 140
94 3300025900 Ga0207710_10016579 Ga0207710_100165791 140
95 3300025901 Ga0207688_10015640 Ga0207688_100156404 140
96 3300025904 Ga0207647_10012884 Ga0207647_100128844 140
97 3300025904 Ga0207647_10730026 Ga0207647_107300261 140
98 3300025905 Ga0207685_10277583 Ga0207685_102775832 140
99 3300025908 Ga0207643_10001208 Ga0207643_1000120815 140
100 3300025910 Ga0207684_10067383 Ga0207684_100673832 140
101 3300025910 Ga0207684_11153643 Ga0207684_111536432 140
102 3300025915 Ga0207693_10066907 Ga0207693_100669073 140
103 3300025915 Ga0207693_10107857 Ga0207693_101078573 140
104 3300025916 Ga0207663_10614654 Ga0207663_106146542 140
105 3300025917 Ga0207660_11097233 Ga0207660_110972332 140
106 3300025919 Ga0207657_10008810 Ga0207657_100088107 140
107 3300025919 Ga0207657_10190481 Ga0207657_101904812 140
108 3300025922 Ga0207646_10809151 Ga0207646_108091512 140
109 3300025925 Ga0207650_10219149 Ga0207650_102191494 140
110 3300025928 Ga0207700_10172647 Ga0207700_101726472 140
111 3300025928 Ga0207700_10201412 Ga0207700_102014122 140
112 3300025928 Ga0207700_10596871 Ga0207700_105968711 140
113 3300025928 Ga0207700_10660825 Ga0207700_106608252 140
114 3300025931 Ga0207644_10759134 Ga0207644_107591341 140
115 3300025936 Ga0207670_10800954 Ga0207670_108009542 140
116 3300025938 Ga0207704_10036572 Ga0207704_100365722 140
117 3300025940 Ga0207691_10039179 Ga0207691_100391792 140
118 3300025945 Ga0207679_10997985 Ga0207679_109979852 140
119 3300025960 Ga0207651_10044400 Ga0207651_100444003 140
120 3300025961 Ga0207712_10062205 Ga0207712_100622051 140
121 3300025986 Ga0207658_10037047 Ga0207658_100370473 140
122 3300026023 Ga0207677_10027035 Ga0207677_100270353 140
123 3300026035 Ga0207703_10080054 Ga0207703_100800541 140
124 3300026067 Ga0207678_10031049 Ga0207678_100310494 140
125 3300026078 Ga0207702_10113346 Ga0207702_101133464 140
126 3300026095 Ga0207676_10031240 Ga0207676_100312404 140
127 3300026118 Ga0207675_100003027 Ga0207675_10000302716 140
128 3300027907 Ga0207428_10447738 Ga0207428_104477381 140
129 3300028380 Ga0268265_10095849 Ga0268265_100958492 140
130 3300028380 Ga0268265_11049010 Ga0268265_110490102 140
131 3300028381 Ga0268264_10044721 Ga0268264_100447213 140
132 3300031235 Ga0265330_10020395 Ga0265330_100203952 140
133 3300031241 Ga0265325_10006289 Ga0265325_100062897 140
134 3300031250 Ga0265331_10009513 Ga0265331_100095135 140
135 3300031344 Ga0265316_10392475 Ga0265316_103924753 140
136 3300031595 Ga0265313_10025531 Ga0265313_100255314 140
137 3300031901 Ga0307406_10625115 Ga0307406_106251152 140
138 3300035170 Ga0373943_0304288 Ga0373943_0304288_179_601 140
139 3300035241 Ga0373961_0137393 Ga0373961_0137393_390_812 140
140 3300035691 Ga0373931_0115546 Ga0373931_0115546_120_542 140
141 3300035725 Ga0373947_0133220 Ga0373947_0133220_749_1171 140
142 3300037068 Ga0373925_0708022 Ga0373925_0708022_159_581 140
143 3300037466 Ga0395898_1305619 Ga0395898_1305619_66_491 140
144 3300038443 Ga0395901_0187087 Ga0395901_0187087_712_1137 140
145 3300039447 Ga0436361_0335157 Ga0436361_0335157_9503_9925 140
146 3300039453 Ga0436362_0568357 Ga0436362_0568357_12_434 140
147 3300046459 Ga0495629_0052288 Ga0495629_0052288_1830_2252 140
148 3300046491 Ga0495584_0011617 Ga0495584_0011617_2481_2903 140
149 3300046559 Ga0495667_0206919 Ga0495667_0206919_29_451 140
150 3300046615 Ga0495656_0118206 Ga0495656_0118206_359_781 140
151 3300046683 Ga0495658_0092954 Ga0495658_0092954_882_1304 140
152 3300046689 Ga0495613_0300916 Ga0495613_0300916_159_581 140
153 3300047319 Ga0495674_0257428 Ga0495674_0257428_180_602 140
154 3300047471 Ga0495684_0156524 Ga0495684_0156524_911_1333 140
155 3300047673 Ga0495593_0122505 Ga0495593_0122505_654_1076 140
156 3300048903 Ga0496100_0140634 Ga0496100_0140634_48_470 140
157 3300048904 Ga0496101_0346252 Ga0496101_0346252_554_976 140
158 3300048905 Ga0496102_0029755 Ga0496102_0029755_4117_4539 140
159 3300048905 Ga0496102_0633192 Ga0496102_0633192_388_810 140
160 3300048906 Ga0496103_0017979 Ga0496103_0017979_3466_3888 140
161 3300048906 Ga0496103_0031975 Ga0496103_0031975_2398_2820 140
162 3300048907 Ga0496104_0000495 Ga0496104_0000495_1080_1502 140
163 3300048907 Ga0496104_0001900 Ga0496104_0001900_9708_10130 140
164 3300048907 Ga0496104_0145276 Ga0496104_0145276_187_609 140
165 3300048908 Ga0496105_0005167 Ga0496105_0005167_7529_7951 140
166 3300048908 Ga0496105_0458298 Ga0496105_0458298_36_458 140
167 3300048909 Ga0496106_0002852 Ga0496106_0002852_2406_2828 140
168 3300048909 Ga0496106_0060488 Ga0496106_0060488_64_486 140
169 3300048909 Ga0496106_0179026 Ga0496106_0179026_1105_1527 140
170 3300048910 Ga0496107_0012844 Ga0496107_0012844_367_789 140
171 3300048911 Ga0496108_0001103 Ga0496108_0001103_7105_7527 140
172 3300048911 Ga0496108_0105275 Ga0496108_0105275_385_807 140
173 3300048911 Ga0496108_0667827 Ga0496108_0667827_253_675 140
174 3300048912 Ga0496109_0003899 Ga0496109_0003899_5871_6293 140
175 3300048912 Ga0496109_0248335 Ga0496109_0248335_166_588 140
176 3300048912 Ga0496109_0497534 Ga0496109_0497534_591_1013 140
177 3300048913 Ga0496110_0044797 Ga0496110_0044797_2925_3347 140
178 3300048913 Ga0496110_0084821 Ga0496110_0084821_944_1366 140
179 3300048913 Ga0496110_0165503 Ga0496110_0165503_573_995 140
180 3300048913 Ga0496110_0782426 Ga0496110_0782426_20_442 140
181 3300048914 Ga0496111_0010303 Ga0496111_0010303_3405_3827 140
182 3300048915 Ga0496112_0009038 Ga0496112_0009038_2355_2777 140
183 3300048915 Ga0496112_0101787 Ga0496112_0101787_691_1113 140
184 3300048915 Ga0496112_0942505 Ga0496112_0942505_93_515 140
185 3300048916 Ga0496113_0000227 Ga0496113_0000227_5532_5954 140
186 3300048916 Ga0496113_0041577 Ga0496113_0041577_1369_1791 140
187 3300048917 Ga0496114_0049124 Ga0496114_0049124_691_1113 140
188 3300048917 Ga0496114_0519271 Ga0496114_0519271_180_602 140
189 3300048918 Ga0496115_0254693 Ga0496115_0254693_243_665 140
190 3300048918 Ga0496115_0776740 Ga0496115_0776740_131_553 140
191 3300049568 Ga0501031_0013691 Ga0501031_0013691_3446_3868 140
192 3300049568 Ga0501031_0141577 Ga0501031_0141577_1009_1431 140
193 3300049569 Ga0501032_0024985 Ga0501032_0024985_681_1103 140
194 3300049569 Ga0501032_0035784 Ga0501032_0035784_2617_3039 140
195 3300049570 Ga0501033_0006958 Ga0501033_0006958_5706_6128 140
196 3300049570 Ga0501033_0041258 Ga0501033_0041258_2732_3154 140
197 3300049571 Ga0501034_0085870 Ga0501034_0085870_1575_1997 140
198 3300049571 Ga0501034_0089853 Ga0501034_0089853_1724_2146 140
199 3300049571 Ga0501034_0210555 Ga0501034_0210555_309_731 140
200 3300049572 Ga0501036_0018152 Ga0501036_0018152_1033_1455 140
201 3300049572 Ga0501036_0565933 Ga0501036_0565933_421_843 140
202 3300049573 Ga0501037_0007497 Ga0501037_0007497_1528_1950 140
203 3300049573 Ga0501037_0073874 Ga0501037_0073874_1879_2301 140
204 3300049573 Ga0501037_0235422 Ga0501037_0235422_669_1091 140
205 3300049574 Ga0501038_0003058 Ga0501038_0003058_13820_14242 140
206 3300049574 Ga0501038_0043390 Ga0501038_0043390_3468_3890 140
207 3300049574 Ga0501038_0113595 Ga0501038_0113595_142_564 140
208 3300049574 Ga0501038_0562182 Ga0501038_0562182_328_750 140
209 3300049575 Ga0501039_0041250 Ga0501039_0041250_1922_2344 140
210 3300049579 Ga0501043_0050128 Ga0501043_0050128_1801_2223 140
211 3300049579 Ga0501043_0109996 Ga0501043_0109996_1047_1469 140
212 3300049580 Ga0501046_0778727 Ga0501046_0778727_142_564 140
213 3300049580 Ga0501046_1139079 Ga0501046_1139079_104_526 140
214 3300049581 Ga0501047_0062444 Ga0501047_0062444_2613_3035 140
215 3300049581 Ga0501047_0187286 Ga0501047_0187286_1169_1591 140
216 3300049581 Ga0501047_0838593 Ga0501047_0838593_236_658 140
217 3300049582 Ga0501048_0341218 Ga0501048_0341218_628_1050 140
218 3300049585 Ga0501069_0012501 Ga0501069_0012501_2849_3271 140
219 3300049585 Ga0501069_0071517 Ga0501069_0071517_311_733 140
220 3300049586 Ga0501070_0012006 Ga0501070_0012006_4204_4626 140
221 3300049586 Ga0501070_0012272 Ga0501070_0012272_2946_3368 140
222 3300049586 Ga0501070_0117666 Ga0501070_0117666_1145_1567 140
223 3300049586 Ga0501070_0146184 Ga0501070_0146184_1285_1707 140
224 3300049587 Ga0501071_0116255 Ga0501071_0116255_549_971 140
225 3300049588 Ga0501072_0462933 Ga0501072_0462933_504_926 140
226 3300049589 Ga0501073_0021522 Ga0501073_0021522_1265_1687 140
227 3300049589 Ga0501073_0379336 Ga0501073_0379336_19_441 140
228 3300049741 Ga0501079_0346552 Ga0501079_0346552_463_885 140
229 3300049742 Ga0501080_0056160 Ga0501080_0056160_3137_3559 140
230 3300049742 Ga0501080_0137449 Ga0501080_0137449_1272_1694 140
231 3300049744 Ga0501083_0642114 Ga0501083_0642114_11_433 140
232 3300049822 Ga0501035_0000995 Ga0501035_0000995_2793_3215 140
233 3300049822 Ga0501035_0052529 Ga0501035_0052529_2666_3088 140
234 3300049822 Ga0501035_0526792 Ga0501035_0526792_426_848 140
235 3300049823 Ga0501044_0038058 Ga0501044_0038058_3574_3996 140
236 3300049823 Ga0501044_0050872 Ga0501044_0050872_2272_2694 140
237 3300049823 Ga0501044_0706984 Ga0501044_0706984_432_854 140
238 3300049823 Ga0501044_1142563 Ga0501044_1142563_154_576 140
239 3300050507 nmdc:mga05p37_109548_c1 nmdc:mga05p37_109548_c1_652_1074 140
240 3300050507 nmdc:mga05p37_25723_c1 nmdc:mga05p37_25723_c1_1431_1853 140
241 3300050509 nmdc:mga0qj67_198406_c1 nmdc:mga0qj67_198406_c1_1175_1597 140
242 3300050510 nmdc:mga06r32_316558_c1 nmdc:mga06r32_316558_c1_900_1322 140
243 3300050512 nmdc:mga0n895_124072_c1 nmdc:mga0n895_124072_c1_1009_1431 140
244 3300050512 nmdc:mga0n895_254629_c1 nmdc:mga0n895_254629_c1_1019_1441 140
245 3300050513 nmdc:mga0rr50_102296_c1 nmdc:mga0rr50_102296_c1_489_911 140
246 3300050513 nmdc:mga0rr50_735358_c1 nmdc:mga0rr50_735358_c1_78_500 140
247 3300050514 nmdc:mga08x19_1035964_c1 nmdc:mga08x19_1035964_c1_99_521 140
248 3300053085 Ga0495619_0016823 Ga0495619_0016823_4164_4586 140
249 3300053085 Ga0495619_0343311 Ga0495619_0343311_538_960 140
250 3300053093 Ga0500651_0041727 Ga0500651_0041727_547_969 140
251 3300060353 Ga0501082_0101011 Ga0501082_0101011_263_685 140
252 3300060353 Ga0501082_0179635 Ga0501082_0179635_407_829 140
253 3300005337 Ga0070682_100562749 Ga0070682_1005627492 141
254 3300005341 Ga0070691_10050476 Ga0070691_100504762 141
255 3300005344 Ga0070661_100282063 Ga0070661_1002820632 141
256 3300005353 Ga0070669_100141606 Ga0070669_1001416063 141
257 3300005353 Ga0070669_101212724 Ga0070669_1012127242 141
258 3300005354 Ga0070675_100199475 Ga0070675_1001994752 141
259 3300005355 Ga0070671_100341927 Ga0070671_1003419272 141
260 3300005356 Ga0070674_100056194 Ga0070674_1000561943 141
261 3300005364 Ga0070673_100014645 Ga0070673_1000146452 141
262 3300005366 Ga0070659_100255889 Ga0070659_1002558892 141
263 3300005366 Ga0070659_101525028 Ga0070659_1015250281 141
264 3300005367 Ga0070667_100323726 Ga0070667_1003237262 141
265 3300005367 Ga0070667_100523865 Ga0070667_1005238651 141
266 3300005434 Ga0070709_10003671 Ga0070709_100036712 141
267 3300005434 Ga0070709_10501809 Ga0070709_105018091 141
268 3300005435 Ga0070714_101983508 Ga0070714_1019835081 141
269 3300005436 Ga0070713_100019221 Ga0070713_1000192211 141
270 3300005437 Ga0070710_10015364 Ga0070710_100153646 141
271 3300005437 Ga0070710_10032037 Ga0070710_100320373 141
272 3300005437 Ga0070710_11264920 Ga0070710_112649201 141
273 3300005439 Ga0070711_100001695 Ga0070711_1000016957 141
274 3300005439 Ga0070711_100019451 Ga0070711_1000194514 141
275 3300005439 Ga0070711_100594449 Ga0070711_1005944492 141
276 3300005441 Ga0070700_100544247 Ga0070700_1005442471 141
277 3300005441 Ga0070700_100907242 Ga0070700_1009072421 141
278 3300005441 Ga0070700_101011923 Ga0070700_1010119232 141
279 3300005444 Ga0070694_100131627 Ga0070694_1001316273 141
280 3300005445 Ga0070708_100633025 Ga0070708_1006330251 141
281 3300005455 Ga0070663_100084684 Ga0070663_1000846844 141
282 3300005456 Ga0070678_100119811 Ga0070678_1001198112 141
283 3300005456 Ga0070678_101396375 Ga0070678_1013963752 141
284 3300005457 Ga0070662_100040160 Ga0070662_1000401602 141
285 3300005458 Ga0070681_10061315 Ga0070681_100613153 141
286 3300005459 Ga0068867_101170507 Ga0068867_1011705071 141
287 3300005467 Ga0070706_102163689 Ga0070706_1021636891 141
288 3300005468 Ga0070707_100210734 Ga0070707_1002107341 141
289 3300005530 Ga0070679_100276893 Ga0070679_1002768932 141
290 3300005544 Ga0070686_100209318 Ga0070686_1002093182 141
291 3300005545 Ga0070695_100312777 Ga0070695_1003127772 141
292 3300005546 Ga0070696_100110438 Ga0070696_1001104384 141
293 3300005547 Ga0070693_100076865 Ga0070693_1000768652 141
294 3300005549 Ga0070704_100581733 Ga0070704_1005817332 141
295 3300005564 Ga0070664_100188683 Ga0070664_1001886831 141
296 3300005614 Ga0068856_100067110 Ga0068856_1000671104 141
297 3300005618 Ga0068864_100812521 Ga0068864_1008125212 141
298 3300005842 Ga0068858_100273467 Ga0068858_1002734672 141
299 3300006028 Ga0070717_10819301 Ga0070717_108193012 141
300 3300006048 Ga0075363_100254564 Ga0075363_1002545642 141
301 3300006051 Ga0075364_10005596 Ga0075364_100055963 141
302 3300006051 Ga0075364_10674752 Ga0075364_106747522 141
303 3300006175 Ga0070712_100001893 Ga0070712_1000018935 141
304 3300006175 Ga0070712_100002927 Ga0070712_10000292711 141
305 3300006177 Ga0075362_10015622 Ga0075362_100156222 141
306 3300006177 Ga0075362_10256205 Ga0075362_102562052 141
307 3300006178 Ga0075367_10035515 Ga0075367_100355152 141
308 3300006178 Ga0075367_10087404 Ga0075367_100874044 141
309 3300006195 Ga0075366_10057187 Ga0075366_100571872 141
310 3300006237 Ga0097621_100008744 Ga0097621_1000087442 141
311 3300006353 Ga0075370_10460636 Ga0075370_104606362 141
312 3300006353 Ga0075370_10676408 Ga0075370_106764082 141
313 3300006358 Ga0068871_100027615 Ga0068871_1000276154 141
314 3300006871 Ga0075434_100655354 Ga0075434_1006553542 141
315 3300006880 Ga0075429_101039031 Ga0075429_1010390312 141
316 3300006881 Ga0068865_101291279 Ga0068865_1012912792 141
317 3300006914 Ga0075436_100143142 Ga0075436_1001431422 141
318 3300007076 Ga0075435_100334541 Ga0075435_1003345412 141
319 3300009094 Ga0111539_10215901 Ga0111539_102159012 141
320 3300009094 Ga0111539_10330823 Ga0111539_103308232 141
321 3300009094 Ga0111539_10583290 Ga0111539_105832902 141
322 3300009098 Ga0105245_10148592 Ga0105245_101485922 141
323 3300009098 Ga0105245_10197571 Ga0105245_101975713 141
324 3300009098 Ga0105245_10726667 Ga0105245_107266673 141
325 3300009174 Ga0105241_11280115 Ga0105241_112801152 141
326 3300009176 Ga0105242_11430073 Ga0105242_114300732 141
327 3300009177 Ga0105248_10035800 Ga0105248_100358006 141
328 3300009177 Ga0105248_12207883 Ga0105248_122078832 141
329 3300009545 Ga0105237_10035386 Ga0105237_100353864 141
330 3300009553 Ga0105249_10437090 Ga0105249_104370902 141
331 3300009986 Ga0105033_110928 Ga0105033_1109282 141
332 3300010375 Ga0105239_11545209 Ga0105239_115452092 141
333 3300010375 Ga0105239_13383082 Ga0105239_133830821 141
334 3300011119 Ga0105246_10288223 Ga0105246_102882232 141
335 3300013100 Ga0157373_10801133 Ga0157373_108011332 141
336 3300013105 Ga0157369_10947488 Ga0157369_109474881 141
337 3300013297 Ga0157378_10429633 Ga0157378_104296332 141
338 3300013297 Ga0157378_10634683 Ga0157378_106346832 141
339 3300013306 Ga0163162_10087113 Ga0163162_100871134 141
340 3300013307 Ga0157372_10160704 Ga0157372_101607043 141
341 3300013308 Ga0157375_10540822 Ga0157375_105408221 141
342 3300014326 Ga0157380_10126169 Ga0157380_101261693 141
343 3300014497 Ga0182008_10242839 Ga0182008_102428392 141
344 3300014968 Ga0157379_10118428 Ga0157379_101184283 141
345 3300014968 Ga0157379_10551695 Ga0157379_105516952 141
346 3300014969 Ga0157376_10726108 Ga0157376_107261082 141
347 3300021384 Ga0213876_10225361 Ga0213876_102253612 141
348 3300024227 Ga0228598_1024716 Ga0228598_10247162 141
349 3300025898 Ga0207692_10014928 Ga0207692_100149283 141
350 3300025898 Ga0207692_10035418 Ga0207692_100354182 141
351 3300025898 Ga0207692_10849651 Ga0207692_108496511 141
352 3300025906 Ga0207699_10023469 Ga0207699_100234694 141
353 3300025906 Ga0207699_10078246 Ga0207699_100782462 141
354 3300025910 Ga0207684_11638964 Ga0207684_116389641 141
355 3300025912 Ga0207707_10061465 Ga0207707_100614653 141
356 3300025915 Ga0207693_10007054 Ga0207693_100070543 141
357 3300025916 Ga0207663_10085498 Ga0207663_100854982 141
358 3300025916 Ga0207663_10218119 Ga0207663_102181191 141
359 3300025918 Ga0207662_10231646 Ga0207662_102316462 141
360 3300025920 Ga0207649_10173044 Ga0207649_101730442 141
361 3300025920 Ga0207649_10361613 Ga0207649_103616132 141
362 3300025921 Ga0207652_10187627 Ga0207652_101876273 141
363 3300025923 Ga0207681_10146685 Ga0207681_101466852 141
364 3300025923 Ga0207681_10408248 Ga0207681_104082482 141
365 3300025923 Ga0207681_10599154 Ga0207681_105991541 141
366 3300025926 Ga0207659_10091451 Ga0207659_100914512 141
367 3300025927 Ga0207687_10051449 Ga0207687_100514494 141
368 3300025927 Ga0207687_10180844 Ga0207687_101808442 141
369 3300025928 Ga0207700_10046160 Ga0207700_100461605 141
370 3300025928 Ga0207700_10107794 Ga0207700_101077943 141
371 3300025931 Ga0207644_10417776 Ga0207644_104177762 141
372 3300025932 Ga0207690_10077141 Ga0207690_100771412 141
373 3300025933 Ga0207706_10118814 Ga0207706_101188144 141
374 3300025933 Ga0207706_10265898 Ga0207706_102658983 141
375 3300025934 Ga0207686_10032302 Ga0207686_100323024 141
376 3300025937 Ga0207669_10052926 Ga0207669_100529262 141
377 3300025938 Ga0207704_10209749 Ga0207704_102097493 141
378 3300025939 Ga0207665_10273127 Ga0207665_102731272 141
379 3300025941 Ga0207711_11322816 Ga0207711_113228161 141
380 3300025960 Ga0207651_10147297 Ga0207651_101472971 141
381 3300025961 Ga0207712_10391746 Ga0207712_103917462 141
382 3300025972 Ga0207668_10619963 Ga0207668_106199632 141
383 3300026041 Ga0207639_10065082 Ga0207639_100650824 141
384 3300026067 Ga0207678_10109778 Ga0207678_101097784 141
385 3300026067 Ga0207678_11537825 Ga0207678_115378251 141
386 3300026075 Ga0207708_10254547 Ga0207708_102545472 141
387 3300026075 Ga0207708_10615791 Ga0207708_106157912 141
388 3300026078 Ga0207702_10613610 Ga0207702_106136102 141
389 3300026089 Ga0207648_10498149 Ga0207648_104981492 141
390 3300026121 Ga0207683_10013747 Ga0207683_100137479 141
391 3300026121 Ga0207683_11406119 Ga0207683_114061192 141
392 3300027866 Ga0209813_10273215 Ga0209813_102732151 141
393 3300028380 Ga0268265_10493627 Ga0268265_104936273 141
394 3300028381 Ga0268264_10535331 Ga0268264_105353312 141
395 3300028381 Ga0268264_10971759 Ga0268264_109717592 141
396 3300031238 Ga0265332_10058081 Ga0265332_100580812 141
397 3300031241 Ga0265325_10001543 Ga0265325_100015439 141
398 3300031241 Ga0265325_10042260 Ga0265325_100422603 141
399 3300031241 Ga0265325_10056461 Ga0265325_100564612 141
400 3300031995 Ga0307409_101664104 Ga0307409_1016641042 141
401 3300032002 Ga0307416_101271832 Ga0307416_1012718321 141
402 3300032005 Ga0307411_10359398 Ga0307411_103593982 141
403 3300035089 Ga0373944_0019469 Ga0373944_0019469_165_590 141
404 3300035111 Ga0373923_0035431 Ga0373923_0035431_1369_1794 141
405 3300035113 Ga0373936_0124188 Ga0373936_0124188_142_567 141
406 3300035119 Ga0373956_0072775 Ga0373956_0072775_498_923 141
407 3300035171 Ga0373946_0392247 Ga0373946_0392247_246_671 141
408 3300035207 Ga0373942_0066022 Ga0373942_0066022_267_692 141
409 3300035691 Ga0373931_0609871 Ga0373931_0609871_178_603 141
410 3300035692 Ga0373935_0425498 Ga0373935_0425498_308_733 141
411 3300035695 Ga0373927_0032885 Ga0373927_0032885_1224_1649 141
412 3300035725 Ga0373947_0047520 Ga0373947_0047520_1689_2114 141
413 3300037068 Ga0373925_0108205 Ga0373925_0108205_264_689 141
414 3300037312 Ga0395899_0009657 Ga0395899_0009657_1420_1845 141
415 3300037312 Ga0395899_0387847 Ga0395899_0387847_439_864 141
416 3300037466 Ga0395898_0051585 Ga0395898_0051585_1894_2319 141
417 3300038443 Ga0395901_0099569 Ga0395901_0099569_1372_1797 141
418 3300039437 Ga0436365_0566814 Ga0436365_0566814_145_570 141
419 3300039437 Ga0436365_1828125 Ga0436365_1828125_2343_2768 141
420 3300041408 Ga0439453_0000142 Ga0439453_0000142_3869_4294 141
421 3300041411 Ga0439466_0160896 Ga0439466_0160896_228_653 141
422 3300042001 Ga0439441_017133 Ga0439441_017133_746_1171 141
423 3300042003 Ga0439443_005846 Ga0439443_005846_1089_1514 141
424 3300042156 Ga0439446_0142832 Ga0439446_0142832_146_571 141
425 3300042436 Ga0439435_0029912 Ga0439435_0029912_121_546 141
426 3300046459 Ga0495629_0038860 Ga0495629_0038860_1422_1847 141
427 3300046473 Ga0495582_0077819 Ga0495582_0077819_969_1394 141
428 3300046475 Ga0495639_0514909 Ga0495639_0514909_165_590 141
429 3300046476 Ga0495662_0070535 Ga0495662_0070535_314_739 141
430 3300046477 Ga0495664_0027048 Ga0495664_0027048_2085_2510 141
431 3300046491 Ga0495584_0646540 Ga0495584_0646540_17_442 141
432 3300046499 Ga0495594_0169787 Ga0495594_0169787_452_877 141
433 3300046514 Ga0495618_0086239 Ga0495618_0086239_314_739 141
434 3300046518 Ga0495631_0146871 Ga0495631_0146871_545_970 141
435 3300046526 Ga0495666_0216948 Ga0495666_0216948_380_805 141
436 3300046529 Ga0495652_0117918 Ga0495652_0117918_1558_1983 141
437 3300046533 Ga0495640_0237202 Ga0495640_0237202_530_955 141
438 3300046533 Ga0495640_0461767 Ga0495640_0461767_273_698 141
439 3300046543 Ga0495645_0202497 Ga0495645_0202497_21_446 141
440 3300046642 Ga0495634_0055078 Ga0495634_0055078_1182_1607 141
441 3300046663 Ga0495635_0104544 Ga0495635_0104544_760_1185 141
442 3300046681 Ga0495647_0082258 Ga0495647_0082258_865_1290 141
443 3300046683 Ga0495658_0086285 Ga0495658_0086285_68_493 141
444 3300046689 Ga0495613_0425436 Ga0495613_0425436_239_664 141
445 3300046690 Ga0495624_0471941 Ga0495624_0471941_203_628 141
446 3300047315 Ga0495581_0066511 Ga0495581_0066511_162_587 141
447 3300047319 Ga0495674_0092176 Ga0495674_0092176_1805_2230 141
448 3300047322 Ga0495680_0082932 Ga0495680_0082932_301_726 141
449 3300047471 Ga0495684_0615990 Ga0495684_0615990_158_583 141
450 3300047673 Ga0495593_0132206 Ga0495593_0132206_19_444 141
451 3300048903 Ga0496100_0008731 Ga0496100_0008731_729_1154 141
452 3300048904 Ga0496101_1126837 Ga0496101_1126837_79_504 141
453 3300048905 Ga0496102_0009606 Ga0496102_0009606_4496_4921 141
454 3300048905 Ga0496102_0068715 Ga0496102_0068715_2337_2762 141
455 3300048906 Ga0496103_0043635 Ga0496103_0043635_1654_2079 141
456 3300048906 Ga0496103_0258265 Ga0496103_0258265_604_1029 141
457 3300048907 Ga0496104_0003411 Ga0496104_0003411_2360_2785 141
458 3300048908 Ga0496105_0004873 Ga0496105_0004873_9533_9958 141
459 3300048909 Ga0496106_0024841 Ga0496106_0024841_1891_2316 141
460 3300048910 Ga0496107_0043706 Ga0496107_0043706_612_1037 141
461 3300048910 Ga0496107_0182237 Ga0496107_0182237_330_755 141
462 3300048913 Ga0496110_0325880 Ga0496110_0325880_554_979 141
463 3300048914 Ga0496111_0236609 Ga0496111_0236609_415_840 141
464 3300048915 Ga0496112_0993100 Ga0496112_0993100_259_684 141
465 3300048917 Ga0496114_0001741 Ga0496114_0001741_1447_1872 141
466 3300048917 Ga0496114_1065326 Ga0496114_1065326_77_502 141
467 3300048918 Ga0496115_0032793 Ga0496115_0032793_3065_3490 141
468 3300048918 Ga0496115_0034934 Ga0496115_0034934_1527_1952 141
469 3300048918 Ga0496115_0178224 Ga0496115_0178224_1173_1598 141
470 3300049569 Ga0501032_0019995 Ga0501032_0019995_2136_2561 141
471 3300049570 Ga0501033_0008378 Ga0501033_0008378_1659_2084 141
472 3300049570 Ga0501033_0920808 Ga0501033_0920808_144_569 141
473 3300049571 Ga0501034_0373529 Ga0501034_0373529_496_921 141
474 3300049572 Ga0501036_0041476 Ga0501036_0041476_1460_1885 141
475 3300049573 Ga0501037_0011305 Ga0501037_0011305_2969_3394 141
476 3300049574 Ga0501038_0030276 Ga0501038_0030276_2136_2561 141
477 3300049574 Ga0501038_0407011 Ga0501038_0407011_98_523 141
478 3300049575 Ga0501039_0022121 Ga0501039_0022121_14_439 141
479 3300049575 Ga0501039_0262623 Ga0501039_0262623_616_1041 141
480 3300049576 Ga0501040_0190468 Ga0501040_0190468_342_767 141
481 3300049576 Ga0501040_0381605 Ga0501040_0381605_236_661 141
482 3300049578 Ga0501042_0015292 Ga0501042_0015292_4723_5157 141
483 3300049579 Ga0501043_0014567 Ga0501043_0014567_5170_5595 141
484 3300049580 Ga0501046_0119784 Ga0501046_0119784_902_1327 141
485 3300049582 Ga0501048_0158606 Ga0501048_0158606_596_1021 141
486 3300049584 Ga0501068_0187277 Ga0501068_0187277_208_633 141
487 3300049587 Ga0501071_0404931 Ga0501071_0404931_236_661 141
488 3300049588 Ga0501072_0061603 Ga0501072_0061603_2379_2804 141
489 3300049591 Ga0501075_0041013 Ga0501075_0041013_2047_2472 141
490 3300049592 Ga0501076_0029728 Ga0501076_0029728_620_1045 141
491 3300049592 Ga0501076_0135732 Ga0501076_0135732_121_546 141
492 3300049592 Ga0501076_0547667 Ga0501076_0547667_144_569 141
493 3300049593 Ga0501077_0324498 Ga0501077_0324498_522_947 141
494 3300049741 Ga0501079_0429266 Ga0501079_0429266_153_578 141
495 3300049741 Ga0501079_0438785 Ga0501079_0438785_206_631 141
496 3300049741 Ga0501079_0504317 Ga0501079_0504317_94_519 141
497 3300049742 Ga0501080_0045146 Ga0501080_0045146_645_1070 141
498 3300049743 Ga0501081_0094108 Ga0501081_0094108_1095_1520 141
499 3300049744 Ga0501083_0797846 Ga0501083_0797846_111_536 141
500 3300049823 Ga0501044_0158444 Ga0501044_0158444_1220_1645 141
501 3300049823 Ga0501044_0880801 Ga0501044_0880801_209_634 141
502 3300050489 nmdc:mga03683_222132_c1 nmdc:mga03683_222132_c1_433_858 141
503 3300050490 nmdc:mga03n38_32116_c1 nmdc:mga03n38_32116_c1_1372_1797 141
504 3300050491 nmdc:mga00v17_186027_c1 nmdc:mga00v17_186027_c1_322_747 141
505 3300050491 nmdc:mga00v17_6222_c1 nmdc:mga00v17_6222_c1_3754_4179 141
506 3300050492 nmdc:mga0yw44_199341_c1 nmdc:mga0yw44_199341_c1_394_819 141
507 3300050492 nmdc:mga0yw44_208031_c1 nmdc:mga0yw44_208031_c1_188_613 141
508 3300050493 nmdc:mga0k408_157063_c2 nmdc:mga0k408_157063_c2_194_619 141
509 3300050494 nmdc:mga06z11_11724_c1 nmdc:mga06z11_11724_c1_3054_3479 141
510 3300050494 nmdc:mga06z11_141958_c1 nmdc:mga06z11_141958_c1_631_1056 141
511 3300050495 nmdc:mga04h51_305837_c1 nmdc:mga04h51_305837_c1_90_515 141
512 3300050510 nmdc:mga06r32_377715_c1 nmdc:mga06r32_377715_c1_511_936 141
513 3300050511 nmdc:mga08y16_194584_c1 nmdc:mga08y16_194584_c1_701_1126 141
514 3300050513 nmdc:mga0rr50_321712_c1 nmdc:mga0rr50_321712_c1_669_1094 141
515 3300050516 nmdc:mga0sz30_456281_c1 nmdc:mga0sz30_456281_c1_39_464 141
516 3300053077 Ga0495601_0009329 Ga0495601_0009329_3981_4406 141
517 3300053077 Ga0495601_0056685 Ga0495601_0056685_592_1017 141
518 3300053078 Ga0495612_0005524 Ga0495612_0005524_1068_1493 141
519 3300053084 Ga0495595_0186388 Ga0495595_0186388_366_791 141
520 3300053085 Ga0495619_0002087 Ga0495619_0002087_9669_10094 141
521 3300053086 Ga0500578_0544560 Ga0500578_0544560_21_446 141
522 3300053088 Ga0500644_0108792 Ga0500644_0108792_385_810 141
523 3300053096 Ga0500641_0032101 Ga0500641_0032101_1024_1449 141
524 3300053153 Ga0500616_0000002 Ga0500616_0000002_443667_444092 141
525 3300053730 Ga0500645_017683 Ga0500645_017683_1394_1819 141
526 3300060353 Ga0501082_0147554 Ga0501082_0147554_64_489 141
527 3300060353 Ga0501082_0286220 Ga0501082_0286220_993_1418 141
528 3300061734 Ga0530510_0353849 Ga0530510_0353849_42_467 141
529 3300001976 JGI24752J21851_1013836 JGI24752J21851_10138362 142
530 3300001977 JGI24746J21847_1000923 JGI24746J21847_10009235 142
531 3300001978 JGI24747J21853_1007884 JGI24747J21853_10078842 142
532 3300001979 JGI24740J21852_10054506 JGI24740J21852_100545062 142
533 3300001989 JGI24739J22299_10040565 JGI24739J22299_100405652 142
534 3300001990 JGI24737J22298_10002170 JGI24737J22298_100021707 142
535 3300001991 JGI24743J22301_10004801 JGI24743J22301_100048012 142
536 3300002067 JGI24735J21928_10144302 JGI24735J21928_101443022 142
537 3300002070 JGI24750J21931_1001342 JGI24750J21931_10013423 142
538 3300002073 JGI24745J21846_1000152 JGI24745J21846_10001523 142
539 3300002074 JGI24748J21848_1002289 JGI24748J21848_10022892 142
540 3300002075 JGI24738J21930_10000909 JGI24738J21930_100009096 142
541 3300002076 JGI24749J21850_1007700 JGI24749J21850_10077002 142
542 3300002077 JGI24744J21845_10002614 JGI24744J21845_100026142 142
543 3300002077 JGI24744J21845_10002742 JGI24744J21845_100027424 142
544 3300002126 JGI24035J26624_1000140 JGI24035J26624_10001404 142
545 3300002155 JGI24033J26618_1000697 JGI24033J26618_10006974 142
546 3300002239 JGI24034J26672_10000370 JGI24034J26672_100003706 142
547 3300002244 JGI24742J22300_10021793 JGI24742J22300_100217933 142
548 3300002459 JGI24751J29686_10052399 JGI24751J29686_100523992 142
549 3300003349 JGI26129J50193_1004962 JGI26129J50193_10049622 142
550 3300003371 JGI26145J50221_1012694 JGI26145J50221_10126941 142
551 3300005290 Ga0065712_10069903 Ga0065712_100699034 142
552 3300005290 Ga0065712_10084253 Ga0065712_100842533 142
553 3300005293 Ga0065715_10090726 Ga0065715_100907263 142
554 3300005293 Ga0065715_10193889 Ga0065715_101938892 142
555 3300005295 Ga0065707_10356031 Ga0065707_103560312 142
556 3300005328 Ga0070676_10009404 Ga0070676_100094046 142
557 3300005329 Ga0070683_100016231 Ga0070683_1000162316 142
558 3300005329 Ga0070683_100079030 Ga0070683_1000790304 142
559 3300005330 Ga0070690_100000972 Ga0070690_10000097215 142
560 3300005330 Ga0070690_100336286 Ga0070690_1003362861 142
561 3300005331 Ga0070670_100043184 Ga0070670_1000431842 142
562 3300005331 Ga0070670_100578111 Ga0070670_1005781112 142
563 3300005333 Ga0070677_10000624 Ga0070677_1000062416 142
564 3300005334 Ga0068869_100028165 Ga0068869_1000281654 142
565 3300005336 Ga0070680_100072254 Ga0070680_1000722542 142
566 3300005336 Ga0070680_101380952 Ga0070680_1013809522 142
567 3300005337 Ga0070682_100022243 Ga0070682_1000222433 142
568 3300005337 Ga0070682_100023896 Ga0070682_1000238962 142
569 3300005338 Ga0068868_100000287 Ga0068868_10000028714 142
570 3300005339 Ga0070660_100011348 Ga0070660_1000113486 142
571 3300005339 Ga0070660_100165868 Ga0070660_1001658683 142
572 3300005340 Ga0070689_100009382 Ga0070689_1000093826 142
573 3300005340 Ga0070689_100326596 Ga0070689_1003265962 142
574 3300005341 Ga0070691_10007546 Ga0070691_100075465 142
575 3300005343 Ga0070687_100006226 Ga0070687_1000062264 142
576 3300005344 Ga0070661_100014754 Ga0070661_1000147544 142
577 3300005344 Ga0070661_100211236 Ga0070661_1002112361 142
578 3300005345 Ga0070692_10003049 Ga0070692_100030494 142
579 3300005347 Ga0070668_100155994 Ga0070668_1001559941 142
580 3300005353 Ga0070669_100005691 Ga0070669_10000569110 142
581 3300005354 Ga0070675_100009027 Ga0070675_1000090271 142
582 3300005354 Ga0070675_101202319 Ga0070675_1012023191 142
583 3300005355 Ga0070671_100033279 Ga0070671_1000332794 142
584 3300005355 Ga0070671_100355244 Ga0070671_1003552442 142
585 3300005356 Ga0070674_100105413 Ga0070674_1001054131 142
586 3300005356 Ga0070674_100249689 Ga0070674_1002496892 142
587 3300005364 Ga0070673_100006385 Ga0070673_1000063851 142
588 3300005364 Ga0070673_100601432 Ga0070673_1006014322 142
589 3300005365 Ga0070688_100001436 Ga0070688_1000014365 142
590 3300005365 Ga0070688_100205308 Ga0070688_1002053083 142
591 3300005365 Ga0070688_100351961 Ga0070688_1003519612 142
592 3300005366 Ga0070659_100015882 Ga0070659_1000158823 142
593 3300005367 Ga0070667_100009541 Ga0070667_1000095414 142
594 3300005367 Ga0070667_100060283 Ga0070667_1000602833 142
595 3300005367 Ga0070667_100527864 Ga0070667_1005278641 142
596 3300005434 Ga0070709_10029359 Ga0070709_100293592 142
597 3300005434 Ga0070709_10195406 Ga0070709_101954063 142
598 3300005434 Ga0070709_10235293 Ga0070709_102352932 142
599 3300005435 Ga0070714_100619081 Ga0070714_1006190811 142
600 3300005436 Ga0070713_100039180 Ga0070713_1000391802 142
601 3300005437 Ga0070710_10056697 Ga0070710_100566974 142
602 3300005438 Ga0070701_10278410 Ga0070701_102784102 142
603 3300005439 Ga0070711_100030277 Ga0070711_1000302774 142
604 3300005439 Ga0070711_100459792 Ga0070711_1004597922 142
605 3300005440 Ga0070705_100028618 Ga0070705_1000286184 142
606 3300005440 Ga0070705_100033813 Ga0070705_1000338134 142
607 3300005441 Ga0070700_100084110 Ga0070700_1000841101 142
608 3300005444 Ga0070694_100003715 Ga0070694_1000037156 142
609 3300005445 Ga0070708_100129452 Ga0070708_1001294524 142
610 3300005455 Ga0070663_100007417 Ga0070663_1000074177 142
611 3300005455 Ga0070663_100088886 Ga0070663_1000888862 142
612 3300005456 Ga0070678_100004742 Ga0070678_1000047426 142
613 3300005456 Ga0070678_100005474 Ga0070678_1000054743 142
614 3300005458 Ga0070681_10005630 Ga0070681_1000563011 142
615 3300005458 Ga0070681_10018191 Ga0070681_100181917 142
616 3300005459 Ga0068867_100127668 Ga0068867_1001276681 142
617 3300005459 Ga0068867_101163386 Ga0068867_1011633862 142
618 3300005466 Ga0070685_10001963 Ga0070685_100019634 142
619 3300005466 Ga0070685_10147789 Ga0070685_101477892 142
620 3300005466 Ga0070685_11167658 Ga0070685_111676581 142
621 3300005471 Ga0070698_100594422 Ga0070698_1005944223 142
622 3300005471 Ga0070698_101557285 Ga0070698_1015572851 142
623 3300005518 Ga0070699_100552611 Ga0070699_1005526112 142
624 3300005530 Ga0070679_100028262 Ga0070679_1000282621 142
625 3300005530 Ga0070679_100265940 Ga0070679_1002659402 142
626 3300005535 Ga0070684_100075913 Ga0070684_1000759133 142
627 3300005535 Ga0070684_101036785 Ga0070684_1010367851 142
628 3300005539 Ga0068853_100033477 Ga0068853_1000334774 142
629 3300005543 Ga0070672_100008973 Ga0070672_1000089738 142
630 3300005544 Ga0070686_100038220 Ga0070686_1000382203 142
631 3300005544 Ga0070686_100089466 Ga0070686_1000894663 142
632 3300005544 Ga0070686_100157183 Ga0070686_1001571832 142
633 3300005545 Ga0070695_100112555 Ga0070695_1001125551 142
634 3300005546 Ga0070696_100006672 Ga0070696_1000066724 142
635 3300005547 Ga0070693_100003566 Ga0070693_1000035664 142
636 3300005548 Ga0070665_100014185 Ga0070665_1000141856 142
637 3300005548 Ga0070665_102623200 Ga0070665_1026232001 142
638 3300005549 Ga0070704_100086884 Ga0070704_1000868841 142
639 3300005563 Ga0068855_100031527 Ga0068855_1000315274 142
640 3300005563 Ga0068855_101717317 Ga0068855_1017173172 142
641 3300005564 Ga0070664_100071700 Ga0070664_1000717003 142
642 3300005577 Ga0068857_100006630 Ga0068857_1000066305 142
643 3300005577 Ga0068857_100452281 Ga0068857_1004522812 142
644 3300005578 Ga0068854_100141093 Ga0068854_1001410931 142
645 3300005614 Ga0068856_100037685 Ga0068856_1000376854 142
646 3300005614 Ga0068856_100248672 Ga0068856_1002486722 142
647 3300005614 Ga0068856_100444794 Ga0068856_1004447942 142
648 3300005615 Ga0070702_100091083 Ga0070702_1000910831 142
649 3300005615 Ga0070702_100355537 Ga0070702_1003555372 142
650 3300005616 Ga0068852_100010452 Ga0068852_1000104525 142
651 3300005616 Ga0068852_100576443 Ga0068852_1005764432 142
652 3300005617 Ga0068859_100054633 Ga0068859_1000546334 142
653 3300005617 Ga0068859_100484879 Ga0068859_1004848792 142
654 3300005617 Ga0068859_100510275 Ga0068859_1005102752 142
655 3300005618 Ga0068864_100026602 Ga0068864_1000266023 142
656 3300005718 Ga0068866_10007526 Ga0068866_100075263 142
657 3300005718 Ga0068866_10546016 Ga0068866_105460162 142
658 3300005719 Ga0068861_100007303 Ga0068861_1000073035 142
659 3300005834 Ga0068851_10298156 Ga0068851_102981562 142
660 3300005840 Ga0068870_10007593 Ga0068870_100075933 142
661 3300005841 Ga0068863_100045270 Ga0068863_1000452701 142
662 3300005841 Ga0068863_100580920 Ga0068863_1005809202 142
663 3300005842 Ga0068858_100064184 Ga0068858_1000641843 142
664 3300005842 Ga0068858_100265133 Ga0068858_1002651332 142
665 3300005843 Ga0068860_100015452 Ga0068860_1000154524 142
666 3300005843 Ga0068860_100320286 Ga0068860_1003202862 142
667 3300005844 Ga0068862_100015822 Ga0068862_1000158226 142
668 3300005844 Ga0068862_100275368 Ga0068862_1002753683 142
669 3300005937 Ga0081455_10006976 Ga0081455_100069767 142
670 3300005937 Ga0081455_10123738 Ga0081455_101237382 142
671 3300005983 Ga0081540_1005655 Ga0081540_10056552 142
672 3300006028 Ga0070717_10236827 Ga0070717_102368272 142
673 3300006048 Ga0075363_100073902 Ga0075363_1000739023 142
674 3300006048 Ga0075363_100356897 Ga0075363_1003568972 142
675 3300006058 Ga0075432_10106569 Ga0075432_101065692 142
676 3300006163 Ga0070715_10014758 Ga0070715_100147583 142
677 3300006163 Ga0070715_10691862 Ga0070715_106918622 142
678 3300006173 Ga0070716_100009019 Ga0070716_1000090192 142
679 3300006175 Ga0070712_100183986 Ga0070712_1001839862 142
680 3300006175 Ga0070712_100315604 Ga0070712_1003156042 142
681 3300006178 Ga0075367_10063419 Ga0075367_100634194 142
682 3300006178 Ga0075367_10973832 Ga0075367_109738321 142
683 3300006194 Ga0075427_10003835 Ga0075427_100038353 142
684 3300006237 Ga0097621_100180771 Ga0097621_1001807713 142
685 3300006353 Ga0075370_10138142 Ga0075370_101381422 142
686 3300006358 Ga0068871_100000922 Ga0068871_10000092218 142
687 3300006358 Ga0068871_100208014 Ga0068871_1002080142 142
688 3300006358 Ga0068871_100961362 Ga0068871_1009613622 142
689 3300006844 Ga0075428_100017044 Ga0075428_1000170443 142
690 3300006846 Ga0075430_100004240 Ga0075430_1000042409 142
691 3300006847 Ga0075431_100237644 Ga0075431_1002376443 142
692 3300006852 Ga0075433_10003318 Ga0075433_100033189 142
693 3300006852 Ga0075433_10379103 Ga0075433_103791032 142
694 3300006871 Ga0075434_100001367 Ga0075434_10000136718 142
695 3300006871 Ga0075434_100003881 Ga0075434_1000038819 142
696 3300006871 Ga0075434_100298045 Ga0075434_1002980452 142
697 3300006871 Ga0075434_100719358 Ga0075434_1007193581 142
698 3300006871 Ga0075434_101122493 Ga0075434_1011224931 142
699 3300006880 Ga0075429_100008546 Ga0075429_1000085469 142
700 3300006881 Ga0068865_100020346 Ga0068865_1000203462 142
701 3300006931 Ga0097620_100054629 Ga0097620_1000546294 142
702 3300006931 Ga0097620_100484892 Ga0097620_1004848922 142
703 3300006931 Ga0097620_100510258 Ga0097620_1005102582 142
704 3300007076 Ga0075435_100068616 Ga0075435_1000686163 142
705 3300007076 Ga0075435_100220222 Ga0075435_1002202222 142
706 3300007076 Ga0075435_100469057 Ga0075435_1004690572 142
707 3300007076 Ga0075435_101550961 Ga0075435_1015509611 142
708 3300009011 Ga0105251_10044171 Ga0105251_100441712 142
709 3300009011 Ga0105251_10355454 Ga0105251_103554541 142
710 3300009011 Ga0105251_10464508 Ga0105251_104645081 142
711 3300009036 Ga0105244_10018443 Ga0105244_100184434 142
712 3300009036 Ga0105244_10128202 Ga0105244_101282022 142
713 3300009093 Ga0105240_10223606 Ga0105240_102236064 142
714 3300009093 Ga0105240_11242884 Ga0105240_112428842 142
715 3300009094 Ga0111539_10002796 Ga0111539_100027962 142
716 3300009094 Ga0111539_10053737 Ga0111539_100537374 142
717 3300009094 Ga0111539_10072106 Ga0111539_100721066 142
718 3300009094 Ga0111539_10603706 Ga0111539_106037062 142
719 3300009094 Ga0111539_12263764 Ga0111539_122637641 142
720 3300009098 Ga0105245_10004252 Ga0105245_1000425212 142
721 3300009098 Ga0105245_10068509 Ga0105245_100685092 142
722 3300009098 Ga0105245_11246174 Ga0105245_112461742 142
723 3300009101 Ga0105247_10042814 Ga0105247_100428142 142
724 3300009101 Ga0105247_10774410 Ga0105247_107744102 142
725 3300009147 Ga0114129_10029650 Ga0114129_100296509 142
726 3300009147 Ga0114129_10079232 Ga0114129_100792324 142
727 3300009148 Ga0105243_10016347 Ga0105243_100163474 142
728 3300009148 Ga0105243_10019863 Ga0105243_100198635 142
729 3300009174 Ga0105241_10021402 Ga0105241_100214024 142
730 3300009174 Ga0105241_10048036 Ga0105241_100480362 142
731 3300009176 Ga0105242_10045458 Ga0105242_100454583 142
732 3300009176 Ga0105242_10532664 Ga0105242_105326642 142
733 3300009177 Ga0105248_10034642 Ga0105248_100346424 142
734 3300009177 Ga0105248_10110124 Ga0105248_101101243 142
735 3300009177 Ga0105248_11283656 Ga0105248_112836562 142
736 3300009545 Ga0105237_10008357 Ga0105237_1000835713 142
737 3300009545 Ga0105237_10596307 Ga0105237_105963073 142
738 3300009551 Ga0105238_10058732 Ga0105238_100587324 142
739 3300009553 Ga0105249_10029412 Ga0105249_100294122 142
740 3300009553 Ga0105249_10152330 Ga0105249_101523302 142
741 3300010375 Ga0105239_10025073 Ga0105239_100250734 142
742 3300010375 Ga0105239_10519024 Ga0105239_105190243 142
743 3300010375 Ga0105239_10834275 Ga0105239_108342752 142
744 3300011119 Ga0105246_10356309 Ga0105246_103563091 142
745 3300012480 Ga0157346_1004633 Ga0157346_10046332 142
746 3300012481 Ga0157320_1038679 Ga0157320_10386791 142
747 3300012500 Ga0157314_1003712 Ga0157314_10037122 142
748 3300012503 Ga0157313_1004711 Ga0157313_10047112 142
749 3300013100 Ga0157373_10007606 Ga0157373_100076064 142
750 3300013105 Ga0157369_10196398 Ga0157369_101963983 142
751 3300013105 Ga0157369_10589036 Ga0157369_105890362 142
752 3300013296 Ga0157374_10015848 Ga0157374_100158487 142
753 3300013297 Ga0157378_10007970 Ga0157378_100079704 142
754 3300013297 Ga0157378_10032054 Ga0157378_100320545 142
755 3300013306 Ga0163162_11218121 Ga0163162_112181212 142
756 3300013307 Ga0157372_10016528 Ga0157372_100165289 142
757 3300013308 Ga0157375_10017624 Ga0157375_100176246 142
758 3300013308 Ga0157375_10397256 Ga0157375_103972562 142
759 3300014325 Ga0163163_10001820 Ga0163163_100018205 142
760 3300014325 Ga0163163_10369436 Ga0163163_103694363 142
761 3300014326 Ga0157380_10009315 Ga0157380_100093157 142
762 3300014326 Ga0157380_10136692 Ga0157380_101366921 142
763 3300014968 Ga0157379_10001178 Ga0157379_100011784 142
764 3300014969 Ga0157376_10195812 Ga0157376_101958122 142
765 3300017792 Ga0163161_10175653 Ga0163161_101756532 142
766 3300025290 Ga0207673_1000112 Ga0207673_10001123 142
767 3300025315 Ga0207697_10000579 Ga0207697_1000057920 142
768 3300025321 Ga0207656_10286347 Ga0207656_102863472 142
769 3300025711 Ga0207696_1115583 Ga0207696_11155831 142
770 3300025735 Ga0207713_1219860 Ga0207713_12198602 142
771 3300025735 Ga0207713_1237877 Ga0207713_12378771 142
772 3300025893 Ga0207682_10008278 Ga0207682_100082782 142
773 3300025898 Ga0207692_10258580 Ga0207692_102585802 142
774 3300025899 Ga0207642_10013446 Ga0207642_100134464 142
775 3300025899 Ga0207642_10023805 Ga0207642_100238051 142
776 3300025900 Ga0207710_10025350 Ga0207710_100253503 142
777 3300025900 Ga0207710_10088542 Ga0207710_100885422 142
778 3300025901 Ga0207688_10001006 Ga0207688_100010065 142
779 3300025903 Ga0207680_10131226 Ga0207680_101312263 142
780 3300025904 Ga0207647_10025960 Ga0207647_100259604 142
781 3300025906 Ga0207699_10705616 Ga0207699_107056162 142
782 3300025907 Ga0207645_10001020 Ga0207645_1000102022 142
783 3300025907 Ga0207645_10058013 Ga0207645_100580132 142
784 3300025908 Ga0207643_10000523 Ga0207643_1000052322 142
785 3300025911 Ga0207654_10047157 Ga0207654_100471574 142
786 3300025912 Ga0207707_10018497 Ga0207707_100184972 142
787 3300025912 Ga0207707_10046164 Ga0207707_100461643 142
788 3300025912 Ga0207707_10161758 Ga0207707_101617582 142
789 3300025913 Ga0207695_10321834 Ga0207695_103218342 142
790 3300025914 Ga0207671_10113380 Ga0207671_101133804 142
791 3300025914 Ga0207671_10445696 Ga0207671_104456962 142
792 3300025915 Ga0207693_10008072 Ga0207693_100080725 142
793 3300025916 Ga0207663_10056960 Ga0207663_100569602 142
794 3300025916 Ga0207663_10420334 Ga0207663_104203342 142
795 3300025916 Ga0207663_10632256 Ga0207663_106322562 142
796 3300025917 Ga0207660_10014892 Ga0207660_100148925 142
797 3300025917 Ga0207660_10072595 Ga0207660_100725952 142
798 3300025917 Ga0207660_10154346 Ga0207660_101543463 142
799 3300025918 Ga0207662_10002710 Ga0207662_100027106 142
800 3300025919 Ga0207657_10005692 Ga0207657_100056924 142
801 3300025919 Ga0207657_10243838 Ga0207657_102438382 142
802 3300025920 Ga0207649_10004225 Ga0207649_100042253 142
803 3300025921 Ga0207652_10018458 Ga0207652_100184584 142
804 3300025921 Ga0207652_10167164 Ga0207652_101671642 142
805 3300025923 Ga0207681_10004280 Ga0207681_100042805 142
806 3300025924 Ga0207694_10280897 Ga0207694_102808972 142
807 3300025925 Ga0207650_10003662 Ga0207650_100036628 142
808 3300025925 Ga0207650_10107215 Ga0207650_101072153 142
809 3300025925 Ga0207650_10834846 Ga0207650_108348461 142
810 3300025926 Ga0207659_10002130 Ga0207659_100021309 142
811 3300025927 Ga0207687_10010078 Ga0207687_100100784 142
812 3300025927 Ga0207687_11033971 Ga0207687_110339711 142
813 3300025928 Ga0207700_10051330 Ga0207700_100513302 142
814 3300025929 Ga0207664_10256980 Ga0207664_102569803 142
815 3300025931 Ga0207644_10006560 Ga0207644_100065604 142
816 3300025931 Ga0207644_10046794 Ga0207644_100467942 142
817 3300025932 Ga0207690_10003881 Ga0207690_100038817 142
818 3300025932 Ga0207690_10262440 Ga0207690_102624403 142
819 3300025933 Ga0207706_10004561 Ga0207706_1000456115 142
820 3300025934 Ga0207686_10002841 Ga0207686_100028416 142
821 3300025934 Ga0207686_10084799 Ga0207686_100847992 142
822 3300025935 Ga0207709_10003952 Ga0207709_100039524 142
823 3300025936 Ga0207670_10020819 Ga0207670_100208194 142
824 3300025937 Ga0207669_10000737 Ga0207669_100007373 142
825 3300025938 Ga0207704_10005685 Ga0207704_100056856 142
826 3300025938 Ga0207704_10265516 Ga0207704_102655161 142
827 3300025939 Ga0207665_10005721 Ga0207665_100057213 142
828 3300025939 Ga0207665_10434307 Ga0207665_104343073 142
829 3300025940 Ga0207691_10004854 Ga0207691_1000485415 142
830 3300025941 Ga0207711_10009494 Ga0207711_100094947 142
831 3300025941 Ga0207711_10073214 Ga0207711_100732144 142
832 3300025941 Ga0207711_10127495 Ga0207711_101274952 142
833 3300025942 Ga0207689_10001399 Ga0207689_1000139923 142
834 3300025944 Ga0207661_10020336 Ga0207661_100203363 142
835 3300025944 Ga0207661_10123169 Ga0207661_101231692 142
836 3300025945 Ga0207679_10000829 Ga0207679_1000082918 142
837 3300025949 Ga0207667_10057202 Ga0207667_100572024 142
838 3300025960 Ga0207651_10006082 Ga0207651_100060823 142
839 3300025961 Ga0207712_10180598 Ga0207712_101805983 142
840 3300025961 Ga0207712_10458195 Ga0207712_104581952 142
841 3300025972 Ga0207668_10002780 Ga0207668_100027809 142
842 3300025981 Ga0207640_10003641 Ga0207640_100036414 142
843 3300025986 Ga0207658_10014267 Ga0207658_100142674 142
844 3300025986 Ga0207658_10052210 Ga0207658_100522103 142
845 3300025986 Ga0207658_10341638 Ga0207658_103416382 142
846 3300026023 Ga0207677_10092877 Ga0207677_100928773 142
847 3300026035 Ga0207703_10005080 Ga0207703_100050808 142
848 3300026035 Ga0207703_10201956 Ga0207703_102019562 142
849 3300026041 Ga0207639_10036135 Ga0207639_100361353 142
850 3300026041 Ga0207639_10916842 Ga0207639_109168421 142
851 3300026067 Ga0207678_10001694 Ga0207678_1000169419 142
852 3300026067 Ga0207678_10012983 Ga0207678_100129839 142
853 3300026075 Ga0207708_10003453 Ga0207708_100034534 142
854 3300026075 Ga0207708_10315477 Ga0207708_103154772 142
855 3300026078 Ga0207702_10010469 Ga0207702_100104695 142
856 3300026078 Ga0207702_10038277 Ga0207702_100382772 142
857 3300026078 Ga0207702_10310197 Ga0207702_103101972 142
858 3300026088 Ga0207641_10165514 Ga0207641_101655142 142
859 3300026088 Ga0207641_10616601 Ga0207641_106166012 142
860 3300026088 Ga0207641_10835457 Ga0207641_108354572 142
861 3300026089 Ga0207648_10002393 Ga0207648_100023934 142
862 3300026095 Ga0207676_10005110 Ga0207676_100051106 142
863 3300026095 Ga0207676_10118340 Ga0207676_101183402 142
864 3300026116 Ga0207674_10058986 Ga0207674_100589864 142
865 3300026118 Ga0207675_100001715 Ga0207675_10000171519 142
866 3300026121 Ga0207683_10001190 Ga0207683_1000119019 142
867 3300026121 Ga0207683_10028744 Ga0207683_100287444 142
868 3300026142 Ga0207698_10370313 Ga0207698_103703133 142
869 3300026142 Ga0207698_10536497 Ga0207698_105364972 142
870 3300027552 Ga0209982_1004172 Ga0209982_10041724 142
871 3300027614 Ga0209970_1016555 Ga0209970_10165552 142
872 3300027617 Ga0210002_1000122 Ga0210002_10001223 142
873 3300027665 Ga0209983_1017838 Ga0209983_10178383 142
874 3300027866 Ga0209813_10049551 Ga0209813_100495512 142
875 3300027876 Ga0209974_10000486 Ga0209974_1000048613 142
876 3300027907 Ga0207428_10000216 Ga0207428_1000021635 142
877 3300027907 Ga0207428_10019935 Ga0207428_100199355 142
878 3300028379 Ga0268266_10016607 Ga0268266_100166075 142
879 3300028379 Ga0268266_10159361 Ga0268266_101593611 142
880 3300028380 Ga0268265_10068406 Ga0268265_100684063 142
881 3300028381 Ga0268264_10009868 Ga0268264_100098683 142
882 3300028381 Ga0268264_10758583 Ga0268264_107585832 142
883 3300028556 Ga0265337_1003693 Ga0265337_10036934 142
884 3300028800 Ga0265338_10134384 Ga0265338_101343844 142
885 3300028800 Ga0265338_10239102 Ga0265338_102391022 142
886 3300028800 Ga0265338_10361182 Ga0265338_103611822 142
887 3300031241 Ga0265325_10000048 Ga0265325_1000004886 142
888 3300031247 Ga0265340_10241478 Ga0265340_102414782 142
889 3300031247 Ga0265340_10442588 Ga0265340_104425881 142
890 3300031344 Ga0265316_10192081 Ga0265316_101920812 142
891 3300031595 Ga0265313_10000438 Ga0265313_1000043816 142
892 3300031595 Ga0265313_10056387 Ga0265313_100563872 142
893 3300031691 Ga0316579_10020080 Ga0316579_100200803 142
894 3300032002 Ga0307416_102297468 Ga0307416_1022974681 142
895 3300034816 Ga0373930_0012045 Ga0373930_0012045_1119_1547 142
896 3300034819 Ga0373958_0004911 Ga0373958_0004911_1466_1894 142
897 3300035083 Ga0373926_0021720 Ga0373926_0021720_1064_1492 142
898 3300035084 Ga0373928_0004171 Ga0373928_0004171_1912_2340 142
899 3300035086 Ga0373934_0111102 Ga0373934_0111102_362_790 142
900 3300035088 Ga0373940_0001993 Ga0373940_0001993_1289_1717 142
901 3300035090 Ga0373949_0027043 Ga0373949_0027043_57_485 142
902 3300035090 Ga0373949_0040187 Ga0373949_0040187_577_1005 142
903 3300035092 Ga0373952_0026576 Ga0373952_0026576_436_864 142
904 3300035111 Ga0373923_0001890 Ga0373923_0001890_807_1235 142
905 3300035112 Ga0373932_0003391 Ga0373932_0003391_1470_1898 142
906 3300035112 Ga0373932_0093955 Ga0373932_0093955_282_770 142
907 3300035113 Ga0373936_0001798 Ga0373936_0001798_3730_4158 142
908 3300035114 Ga0373939_0001329 Ga0373939_0001329_3156_3584 142
909 3300035114 Ga0373939_0002892 Ga0373939_0002892_826_1257 142
910 3300035116 Ga0373945_0003540 Ga0373945_0003540_1457_1885 142
911 3300035118 Ga0373954_0015360 Ga0373954_0015360_2939_3367 142
912 3300035118 Ga0373954_0111502 Ga0373954_0111502_313_741 142
913 3300035118 Ga0373954_0350883 Ga0373954_0350883_197_625 142
914 3300035119 Ga0373956_0123625 Ga0373956_0123625_600_1028 142
915 3300035120 Ga0373957_0054574 Ga0373957_0054574_805_1233 142
916 3300035121 Ga0373960_0062962 Ga0373960_0062962_577_1005 142
917 3300035121 Ga0373960_0234755 Ga0373960_0234755_67_495 142
918 3300035170 Ga0373943_0005045 Ga0373943_0005045_4226_4654 142
919 3300035171 Ga0373946_0001530 Ga0373946_0001530_2242_2670 142
920 3300035172 Ga0373955_0036131 Ga0373955_0036131_1500_1928 142
921 3300035172 Ga0373955_0095953 Ga0373955_0095953_921_1349 142
922 3300035207 Ga0373942_0015907 Ga0373942_0015907_1180_1608 142
923 3300035207 Ga0373942_0026694 Ga0373942_0026694_110_538 142
924 3300035207 Ga0373942_0372320 Ga0373942_0372320_62_490 142
925 3300035242 Ga0373962_0001705 Ga0373962_0001705_577_1005 142
926 3300035242 Ga0373962_0033329 Ga0373962_0033329_385_813 142
927 3300035410 Ga0373924_0028607 Ga0373924_0028607_1085_1513 142
928 3300035691 Ga0373931_0046111 Ga0373931_0046111_931_1359 142
929 3300035692 Ga0373935_0003239 Ga0373935_0003239_3175_3603 142
930 3300035692 Ga0373935_0041202 Ga0373935_0041202_139_567 142
931 3300035695 Ga0373927_0008421 Ga0373927_0008421_2905_3333 142
932 3300035695 Ga0373927_0289826 Ga0373927_0289826_455_883 142
933 3300035724 Ga0373933_0113728 Ga0373933_0113728_342_770 142
934 3300035725 Ga0373947_0008462 Ga0373947_0008462_3367_3795 142
935 3300035725 Ga0373947_0011056 Ga0373947_0011056_2717_3145 142
936 3300036401 Ga0373937_0048364 Ga0373937_0048364_2044_2472 142
937 3300036401 Ga0373937_0272923 Ga0373937_0272923_159_587 142
938 3300036647 Ga0316582_0316671 Ga0316582_0316671_512_940 142
939 3300037068 Ga0373925_0002135 Ga0373925_0002135_4426_4854 142
940 3300037068 Ga0373925_0095869 Ga0373925_0095869_953_1381 142
941 3300037068 Ga0373925_1193336 Ga0373925_1193336_112_540 142
942 3300037588 Ga0316581_0153089 Ga0316581_0153089_246_674 142
943 3300037853 Ga0436364_0031906 Ga0436364_0031906_225_653 142
944 3300039453 Ga0436362_0886180 Ga0436362_0886180_28_456 142
945 3300042015 Ga0439462_0180204 Ga0439462_0180204_148_576 142
946 3300046452 Ga0495617_027330 Ga0495617_027330_581_1009 142
947 3300046454 Ga0495592_0001176 Ga0495592_0001176_2302_2730 142
948 3300046454 Ga0495592_0018792 Ga0495592_0018792_1105_1533 142
949 3300046455 Ga0495603_0426702 Ga0495603_0426702_207_635 142
950 3300046459 Ga0495629_0002326 Ga0495629_0002326_9580_10008 142
951 3300046459 Ga0495629_0027088 Ga0495629_0027088_1416_1844 142
952 3300046461 Ga0495641_0003224 Ga0495641_0003224_10367_10795 142
953 3300046462 Ga0495651_0014804 Ga0495651_0014804_3632_4060 142
954 3300046462 Ga0495651_0321825 Ga0495651_0321825_391_819 142
955 3300046463 Ga0495653_0012022 Ga0495653_0012022_1781_2209 142
956 3300046463 Ga0495653_0251071 Ga0495653_0251071_113_541 142
957 3300046463 Ga0495653_0405216 Ga0495653_0405216_262_690 142
958 3300046472 Ga0495580_0020532 Ga0495580_0020532_3666_4094 142
959 3300046473 Ga0495582_0012004 Ga0495582_0012004_1556_1984 142
960 3300046473 Ga0495582_0032157 Ga0495582_0032157_997_1425 142
961 3300046475 Ga0495639_0007594 Ga0495639_0007594_3165_3593 142
962 3300046476 Ga0495662_0006908 Ga0495662_0006908_614_1042 142
963 3300046477 Ga0495664_0007982 Ga0495664_0007982_1178_1606 142
964 3300046477 Ga0495664_0203578 Ga0495664_0203578_563_991 142
965 3300046491 Ga0495584_0067390 Ga0495584_0067390_581_1009 142
966 3300046491 Ga0495584_0178697 Ga0495584_0178697_353_781 142
967 3300046492 Ga0495585_0038970 Ga0495585_0038970_648_1076 142
968 3300046499 Ga0495594_0031273 Ga0495594_0031273_509_937 142
969 3300046499 Ga0495594_0065658 Ga0495594_0065658_180_608 142
970 3300046511 Ga0495608_0702474 Ga0495608_0702474_66_494 142
971 3300046513 Ga0495616_0162135 Ga0495616_0162135_463_891 142
972 3300046514 Ga0495618_0022415 Ga0495618_0022415_1340_1768 142
973 3300046516 Ga0495628_0012601 Ga0495628_0012601_3832_4260 142
974 3300046516 Ga0495628_0014768 Ga0495628_0014768_1584_2012 142
975 3300046520 Ga0495637_0024298 Ga0495637_0024298_1143_1571 142
976 3300046520 Ga0495637_0118637 Ga0495637_0118637_479_916 142
977 3300046523 Ga0495644_0010451 Ga0495644_0010451_1009_1437 142
978 3300046525 Ga0495663_0004223 Ga0495663_0004223_2068_2496 142
979 3300046529 Ga0495652_0013444 Ga0495652_0013444_3050_3478 142
980 3300046529 Ga0495652_0090103 Ga0495652_0090103_266_694 142
981 3300046531 Ga0495665_0006037 Ga0495665_0006037_2227_2655 142
982 3300046535 Ga0495586_0006303 Ga0495586_0006303_4310_4738 142
983 3300046536 Ga0495587_0020363 Ga0495587_0020363_2046_2474 142
984 3300046537 Ga0495598_0015646 Ga0495598_0015646_1126_1554 142
985 3300046538 Ga0495609_0147907 Ga0495609_0147907_464_892 142
986 3300046539 Ga0495621_0078562 Ga0495621_0078562_147_575 142
987 3300046543 Ga0495645_0062076 Ga0495645_0062076_515_943 142
988 3300046557 Ga0495622_0010562 Ga0495622_0010562_2932_3360 142
989 3300046558 Ga0495633_0019514 Ga0495633_0019514_2106_2534 142
990 3300046559 Ga0495667_0006887 Ga0495667_0006887_5383_5811 142
991 3300046559 Ga0495667_0117346 Ga0495667_0117346_640_1068 142
992 3300046615 Ga0495656_0001344 Ga0495656_0001344_3828_4256 142
993 3300046642 Ga0495634_0009991 Ga0495634_0009991_5647_6075 142
994 3300046648 Ga0495611_0007418 Ga0495611_0007418_3725_4153 142
995 3300046663 Ga0495635_0062421 Ga0495635_0062421_1336_1764 142
996 3300046663 Ga0495635_0199435 Ga0495635_0199435_135_563 142
997 3300046664 Ga0495659_0001817 Ga0495659_0001817_2409_2837 142
998 3300046674 Ga0495588_0002846 Ga0495588_0002846_1722_2150 142
999 3300046675 Ga0495657_0534861 Ga0495657_0534861_73_501 142
1000 3300046678 Ga0495599_0010609 Ga0495599_0010609_3984_4412 142
1001 3300046678 Ga0495599_0020143 Ga0495599_0020143_1714_2142 142
1002 3300046679 Ga0495623_0050706 Ga0495623_0050706_774_1202 142
1003 3300046680 Ga0495646_0009173 Ga0495646_0009173_1831_2259 142
1004 3300046681 Ga0495647_0001804 Ga0495647_0001804_922_1350 142
1005 3300046683 Ga0495658_0006028 Ga0495658_0006028_1186_1614 142
1006 3300046684 Ga0495669_0073885 Ga0495669_0073885_680_1108 142
1007 3300046689 Ga0495613_0093005 Ga0495613_0093005_1665_2093 142
1008 3300046690 Ga0495624_0026834 Ga0495624_0026834_1708_2136 142
1009 3300046691 Ga0495670_0005161 Ga0495670_0005161_2252_2680 142
1010 3300046794 Ga0495589_0404245 Ga0495589_0404245_117_545 142
1011 3300046809 Ga0495600_0008802 Ga0495600_0008802_4706_5134 142
1012 3300046809 Ga0495600_0118383 Ga0495600_0118383_766_1194 142
1013 3300046809 Ga0495600_0208072 Ga0495600_0208072_262_690 142
1014 3300047315 Ga0495581_0009356 Ga0495581_0009356_5062_5490 142
1015 3300047317 Ga0495604_0018521 Ga0495604_0018521_137_565 142
1016 3300047321 Ga0495676_0128194 Ga0495676_0128194_794_1222 142
1017 3300047321 Ga0495676_0631197 Ga0495676_0631197_72_500 142
1018 3300047322 Ga0495680_0008612 Ga0495680_0008612_1590_2018 142
1019 3300047322 Ga0495680_0026104 Ga0495680_0026104_3486_3914 142
1020 3300047445 Ga0495677_0252863 Ga0495677_0252863_88_516 142
1021 3300047471 Ga0495684_0004924 Ga0495684_0004924_179_607 142
1022 3300047471 Ga0495684_0444221 Ga0495684_0444221_275_703 142
1023 3300047673 Ga0495593_0014850 Ga0495593_0014850_3640_4068 142
1024 3300048088 Ga0495602_0010978 Ga0495602_0010978_7474_7902 142
1025 3300048089 Ga0495614_0002942 Ga0495614_0002942_741_1169 142
1026 3300048903 Ga0496100_0000800 Ga0496100_0000800_6469_6915 142
1027 3300048903 Ga0496100_0011005 Ga0496100_0011005_2037_2465 142
1028 3300048904 Ga0496101_0003969 Ga0496101_0003969_1655_2101 142
1029 3300048904 Ga0496101_0621133 Ga0496101_0621133_368_814 142
1030 3300048904 Ga0496101_0669894 Ga0496101_0669894_207_695 142
1031 3300048905 Ga0496102_0032780 Ga0496102_0032780_2890_3378 142
1032 3300048905 Ga0496102_0046353 Ga0496102_0046353_3161_3616 142
1033 3300048905 Ga0496102_0451115 Ga0496102_0451115_517_945 142
1034 3300048906 Ga0496103_0003651 Ga0496103_0003651_3889_4377 142
1035 3300048906 Ga0496103_0006551 Ga0496103_0006551_2297_2725 142
1036 3300048906 Ga0496103_0025178 Ga0496103_0025178_1013_1441 142
1037 3300048906 Ga0496103_0348092 Ga0496103_0348092_343_771 142
1038 3300048907 Ga0496104_0000196 Ga0496104_0000196_26854_27282 142
1039 3300048907 Ga0496104_0061470 Ga0496104_0061470_1882_2337 142
1040 3300048907 Ga0496104_0069936 Ga0496104_0069936_2573_3001 142
1041 3300048907 Ga0496104_0149269 Ga0496104_0149269_1076_1522 142
1042 3300048907 Ga0496104_0178276 Ga0496104_0178276_21_449 142
1043 3300048907 Ga0496104_0345947 Ga0496104_0345947_791_1279 142
1044 3300048907 Ga0496104_1805782 Ga0496104_1805782_10_438 142
1045 3300048908 Ga0496105_0029068 Ga0496105_0029068_379_807 142
1046 3300048908 Ga0496105_0091794 Ga0496105_0091794_74_562 142
1047 3300048908 Ga0496105_0273851 Ga0496105_0273851_300_728 142
1048 3300048908 Ga0496105_0427997 Ga0496105_0427997_326_772 142
1049 3300048909 Ga0496106_0001635 Ga0496106_0001635_9474_9920 142
1050 3300048909 Ga0496106_0127514 Ga0496106_0127514_309_737 142
1051 3300048909 Ga0496106_0143308 Ga0496106_0143308_875_1303 142
1052 3300048909 Ga0496106_0241091 Ga0496106_0241091_846_1334 142
1053 3300048910 Ga0496107_0000869 Ga0496107_0000869_4233_4661 142
1054 3300048910 Ga0496107_0031992 Ga0496107_0031992_2379_2807 142
1055 3300048910 Ga0496107_0154684 Ga0496107_0154684_234_662 142
1056 3300048911 Ga0496108_0008566 Ga0496108_0008566_2772_3200 142
1057 3300048911 Ga0496108_0043798 Ga0496108_0043798_406_852 142
1058 3300048911 Ga0496108_0047169 Ga0496108_0047169_1213_1668 142
1059 3300048911 Ga0496108_0069289 Ga0496108_0069289_2469_2897 142
1060 3300048911 Ga0496108_0154898 Ga0496108_0154898_485_973 142
1061 3300048911 Ga0496108_0335043 Ga0496108_0335043_669_1097 142
1062 3300048912 Ga0496109_0001554 Ga0496109_0001554_3062_3490 142
1063 3300048912 Ga0496109_0008494 Ga0496109_0008494_2356_2802 142
1064 3300048912 Ga0496109_0037839 Ga0496109_0037839_3147_3575 142
1065 3300048912 Ga0496109_0112776 Ga0496109_0112776_1946_2374 142
1066 3300048912 Ga0496109_0118317 Ga0496109_0118317_851_1279 142
1067 3300048912 Ga0496109_0529933 Ga0496109_0529933_436_882 142
1068 3300048913 Ga0496110_0015739 Ga0496110_0015739_2087_2533 142
1069 3300048913 Ga0496110_0019989 Ga0496110_0019989_2545_3033 142
1070 3300048913 Ga0496110_0022834 Ga0496110_0022834_2384_2839 142
1071 3300048913 Ga0496110_0072383 Ga0496110_0072383_867_1295 142
1072 3300048913 Ga0496110_0234794 Ga0496110_0234794_955_1383 142
1073 3300048914 Ga0496111_0018262 Ga0496111_0018262_2123_2578 142
1074 3300048914 Ga0496111_0035114 Ga0496111_0035114_2504_2932 142
1075 3300048914 Ga0496111_0125823 Ga0496111_0125823_1363_1809 142
1076 3300048914 Ga0496111_0254702 Ga0496111_0254702_848_1276 142
1077 3300048915 Ga0496112_0003337 Ga0496112_0003337_5350_5778 142
1078 3300048915 Ga0496112_0085451 Ga0496112_0085451_2443_2889 142
1079 3300048915 Ga0496112_0128268 Ga0496112_0128268_1407_1895 142
1080 3300048915 Ga0496112_0158741 Ga0496112_0158741_736_1164 142
1081 3300048915 Ga0496112_0274241 Ga0496112_0274241_85_513 142
1082 3300048915 Ga0496112_0905917 Ga0496112_0905917_107_535 142
1083 3300048915 Ga0496112_0978126 Ga0496112_0978126_328_756 142
1084 3300048916 Ga0496113_0007502 Ga0496113_0007502_1229_1657 142
1085 3300048916 Ga0496113_0013393 Ga0496113_0013393_519_974 142
1086 3300048916 Ga0496113_0015368 Ga0496113_0015368_1179_1607 142
1087 3300048916 Ga0496113_0345871 Ga0496113_0345871_391_879 142
1088 3300048916 Ga0496113_0508090 Ga0496113_0508090_356_784 142
1089 3300048917 Ga0496114_0012467 Ga0496114_0012467_3923_4351 142
1090 3300048917 Ga0496114_0085665 Ga0496114_0085665_230_676 142
1091 3300048917 Ga0496114_0091782 Ga0496114_0091782_1202_1630 142
1092 3300048918 Ga0496115_0034046 Ga0496115_0034046_2382_2828 142
1093 3300048918 Ga0496115_0280790 Ga0496115_0280790_181_609 142
1094 3300048918 Ga0496115_0287719 Ga0496115_0287719_40_468 142
1095 3300048928 Ga0496125_0426417 Ga0496125_0426417_97_585 142
1096 3300049569 Ga0501032_0086656 Ga0501032_0086656_428_859 142
1097 3300049570 Ga0501033_0307675 Ga0501033_0307675_569_997 142
1098 3300049571 Ga0501034_0001401 Ga0501034_0001401_17934_18365 142
1099 3300049571 Ga0501034_0056561 Ga0501034_0056561_644_1072 142
1100 3300049571 Ga0501034_0190194 Ga0501034_0190194_807_1238 142
1101 3300049572 Ga0501036_0000164 Ga0501036_0000164_26117_26548 142
1102 3300049573 Ga0501037_0010040 Ga0501037_0010040_4478_4909 142
1103 3300049574 Ga0501038_0157122 Ga0501038_0157122_931_1359 142
1104 3300049574 Ga0501038_0269031 Ga0501038_0269031_785_1216 142
1105 3300049574 Ga0501038_1060019 Ga0501038_1060019_41_472 142
1106 3300049579 Ga0501043_0001255 Ga0501043_0001255_4590_5021 142
1107 3300049581 Ga0501047_0003578 Ga0501047_0003578_2009_2440 142
1108 3300049581 Ga0501047_0729625 Ga0501047_0729625_218_646 142
1109 3300049582 Ga0501048_0025760 Ga0501048_0025760_1845_2276 142
1110 3300049586 Ga0501070_0016597 Ga0501070_0016597_3791_4222 142
1111 3300049588 Ga0501072_0013044 Ga0501072_0013044_442_870 142
1112 3300049589 Ga0501073_0239645 Ga0501073_0239645_212_640 142
1113 3300049590 Ga0501074_0019707 Ga0501074_0019707_2582_3013 142
1114 3300049592 Ga0501076_0020689 Ga0501076_0020689_1235_1663 142
1115 3300049593 Ga0501077_0134249 Ga0501077_0134249_1128_1556 142
1116 3300049742 Ga0501080_0001467 Ga0501080_0001467_2009_2440 142
1117 3300049743 Ga0501081_0576892 Ga0501081_0576892_46_474 142
1118 3300049744 Ga0501083_0009826 Ga0501083_0009826_1981_2412 142
1119 3300049744 Ga0501083_0289722 Ga0501083_0289722_357_785 142
1120 3300049822 Ga0501035_0398300 Ga0501035_0398300_690_1118 142
1121 3300049823 Ga0501044_0000822 Ga0501044_0000822_574_1002 142
1122 3300049823 Ga0501044_0002823 Ga0501044_0002823_1938_2369 142
1123 3300049823 Ga0501044_0106489 Ga0501044_0106489_2000_2428 142
1124 3300050489 nmdc:mga03683_170518_c1 nmdc:mga03683_170518_c1_52_480 142
1125 3300050490 nmdc:mga03n38_71569_c1 nmdc:mga03n38_71569_c1_800_1228 142
1126 3300050491 nmdc:mga00v17_57550_c1 nmdc:mga00v17_57550_c1_999_1427 142
1127 3300050492 nmdc:mga0yw44_160891_c1 nmdc:mga0yw44_160891_c1_392_820 142
1128 3300050494 nmdc:mga06z11_20872_c1 nmdc:mga06z11_20872_c1_453_881 142
1129 3300050494 nmdc:mga06z11_238864_c1 nmdc:mga06z11_238864_c1_261_689 142
1130 3300050495 nmdc:mga04h51_28289_c1 nmdc:mga04h51_28289_c1_850_1278 142
1131 3300050507 nmdc:mga05p37_302597_c1 nmdc:mga05p37_302597_c1_784_1212 142
1132 3300050507 nmdc:mga05p37_6013_c1 nmdc:mga05p37_6013_c1_7535_7963 142
1133 3300050508 nmdc:mga09592_2783_c1 nmdc:mga09592_2783_c1_1366_1794 142
1134 3300050509 nmdc:mga0qj67_1876_c1 nmdc:mga0qj67_1876_c1_12633_13061 142
1135 3300050510 nmdc:mga06r32_22491_c1 nmdc:mga06r32_22491_c1_3642_4070 142
1136 3300050511 nmdc:mga08y16_12040_c1 nmdc:mga08y16_12040_c1_1524_1952 142
1137 3300050511 nmdc:mga08y16_1705303_c1 nmdc:mga08y16_1705303_c1_65_493 142
1138 3300050511 nmdc:mga08y16_245924_c1 nmdc:mga08y16_245924_c1_1358_1786 142
1139 3300050511 nmdc:mga08y16_565194_c1 nmdc:mga08y16_565194_c1_567_995 142
1140 3300050511 nmdc:mga08y16_995466_c1 nmdc:mga08y16_995466_c1_313_741 142
1141 3300050512 nmdc:mga0n895_1049952_c1 nmdc:mga0n895_1049952_c1_56_484 142
1142 3300050512 nmdc:mga0n895_1539_c1 nmdc:mga0n895_1539_c1_9760_10188 142
1143 3300050512 nmdc:mga0n895_436410_c1 nmdc:mga0n895_436410_c1_169_597 142
1144 3300050512 nmdc:mga0n895_51388_c1 nmdc:mga0n895_51388_c1_1496_1924 142
1145 3300050512 nmdc:mga0n895_602819_c1 nmdc:mga0n895_602819_c1_640_1086 142
1146 3300050512 nmdc:mga0n895_97038_c1 nmdc:mga0n895_97038_c1_1220_1648 142
1147 3300050513 nmdc:mga0rr50_1559836_c1 nmdc:mga0rr50_1559836_c1_105_533 142
1148 3300050513 nmdc:mga0rr50_164488_c1 nmdc:mga0rr50_164488_c1_299_727 142
1149 3300050513 nmdc:mga0rr50_6117_c1 nmdc:mga0rr50_6117_c1_6565_6993 142
1150 3300050514 nmdc:mga08x19_831422_c1 nmdc:mga08x19_831422_c1_20_448 142
1151 3300050515 nmdc:mga0a205_34744_c1 nmdc:mga0a205_34744_c1_2887_3315 142
1152 3300053077 Ga0495601_0000456 Ga0495601_0000456_15784_16212 142
1153 3300053077 Ga0495601_0040185 Ga0495601_0040185_794_1222 142
1154 3300053078 Ga0495612_0007164 Ga0495612_0007164_1428_1856 142
1155 3300053078 Ga0495612_0012818 Ga0495612_0012818_1125_1553 142
1156 3300053084 Ga0495595_0001524 Ga0495595_0001524_2308_2736 142
1157 3300053084 Ga0495595_0072824 Ga0495595_0072824_1023_1451 142
1158 3300053084 Ga0495595_0086040 Ga0495595_0086040_179_607 142
1159 3300053085 Ga0495619_0000551 Ga0495619_0000551_4152_4580 142
1160 3300053085 Ga0495619_0025754 Ga0495619_0025754_1499_1927 142
1161 3300053085 Ga0495619_0109308 Ga0495619_0109308_759_1187 142
1162 3300053085 Ga0495619_0138522 Ga0495619_0138522_1068_1496 142
1163 3300053094 Ga0500566_0214035 Ga0500566_0214035_266_694 142
1164 3300053098 Ga0500650_0055336 Ga0500650_0055336_116_544 142
1165 3300053117 Ga0500593_243260 Ga0500593_243260_158_586 142
1166 3300054114 Ga0501084_0251137 Ga0501084_0251137_248_676 142
1167 3300061734 Ga0530510_0575919 Ga0530510_0575919_283_711 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

15

104

0.92

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

7

108

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lb5-assembly1.cif.gz_A crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9423 4 138
3lb5-assembly2.cif.gz_C crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9371 2 138
3lb5-assembly1.cif.gz_B crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9313 2 138
3lb5-assembly2.cif.gz_C crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9238 2 138
3lb5-assembly2.cif.gz_D crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9224 4 138
ID Description Score Start End Superfamily
3lb5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9423 4 138 3.30.428.10
3lb5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9214 4 138 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.908 7 112 3.30.428.10
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8847 21 109 3.30.428.10
af_P9WML3_1_133_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.882 8 141 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A508U1P9-F1-model_v4 Putative HIT-like protein 0.9598 1 139 GO:0003824
GO:0009117
AF-A0A4Q0RIZ6-F1-model_v4 deleted 0.959 1 140
AF-A0A120FM26-F1-model_v4 HIT family hydrolase 0.9579 1 140 GO:0009117
GO:0016787
AF-A0A1W9HVN2-F1-model_v4 HIT family hydrolase 0.9572 1 142 GO:0009117
GO:0016787
AF-A0A090MML9-F1-model_v4 HIT-like protein 0.9572 1 140 GO:0003824
GO:0009117

Feature Viewer

pLDDT pTM Quality
91.74 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map