F491092
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1167 | 451 | 1166 | 142 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_101303952|Ga0070699_1013039521 |
| Length | 133 |
| Sequence | MPSYDPSNIFAKILRGELPCYKVYEDDKVLAFLDIMPRAPGHTLVLPKAPARNLLDVQPDDLTAVAQAAQKFSADGITIQQFNEGAGGQVVFHLHMHVIPRKTGVAMKPPASEKEKPEVLSDHALKLAAALKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 12 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 13 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 14 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 15 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 16 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 17 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 18 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 19 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 20 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 21 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 22 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 23 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 92 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 93 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 94 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 98 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 99 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 101 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 102 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 104 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 105 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 106 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 110 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 111 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 112 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 113 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 115 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 116 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 117 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 118 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 119 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 120 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 121 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 122 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 123 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 124 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 126 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 127 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 143 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 146 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 147 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 148 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 149 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 159 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 164 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 165 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 166 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 242 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 246 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 248 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 249 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 250 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 251 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 252 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 253 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 254 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 255 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 256 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 257 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 258 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 259 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 260 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 262 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 263 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 264 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 266 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 267 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 268 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 271 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 272 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 273 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 274 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 276 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 277 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 278 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 279 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 283 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 284 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 285 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 286 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 287 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 288 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 289 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 291 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 292 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 293 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 294 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 295 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 296 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 297 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 298 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 299 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 300 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 301 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 302 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 303 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 304 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 305 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 306 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 307 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 308 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 375 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 376 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 377 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 378 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 379 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 380 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 383 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 384 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 385 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 386 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 387 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 388 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 389 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 420 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 421 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 422 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 423 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 424 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 425 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 426 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 436 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 441 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 442 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 443 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 444 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 445 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 446 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 447 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 448 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 449 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.91 |
| Metatranscriptomes | 0 |
| Isolates | 0.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.77 |
| Nodule | 0 |
| Rhizoplane | 10.54 |
| Rhizosphere | 85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1013836 | 3300001976 | Bacteria | 1052 |
| 2 | JGI24746J21847_1000923 | 3300001977 | Bacteria | 4595 |
| 3 | JGI24747J21853_1007884 | 3300001978 | Bacteria | 1032 |
| 4 | JGI24740J21852_10054506 | 3300001979 | Bacteria | 1129 |
| 5 | JGI24739J22299_10040565 | 3300001989 | Bacteria | 1553 |
| 6 | JGI24737J22298_10002170 | 3300001990 | Bacteria | 6993 |
| 7 | JGI24743J22301_10004801 | 3300001991 | Bacteria | 2223 |
| 8 | JGI24735J21928_10144302 | 3300002067 | Bacteria | 687 |
| 9 | JGI24750J21931_1001342 | 3300002070 | Bacteria | 3089 |
| 10 | JGI24745J21846_1000152 | 3300002073 | Bacteria | 5479 |
| 11 | JGI24745J21846_1043856 | 3300002073 | Bacteria | 558 |
| 12 | JGI24748J21848_1002289 | 3300002074 | Bacteria | 2149 |
| 13 | JGI24738J21930_10000909 | 3300002075 | Bacteria | 8517 |
| 14 | JGI24749J21850_1007700 | 3300002076 | Bacteria | 1501 |
| 15 | JGI24744J21845_10002614 | 3300002077 | Bacteria | 3681 |
| 16 | JGI24744J21845_10002742 | 3300002077 | Bacteria | 3596 |
| 17 | JGI24035J26624_1000140 | 3300002126 | Bacteria | 6418 |
| 18 | JGI24033J26618_1000697 | 3300002155 | Bacteria | 3216 |
| 19 | JGI24034J26672_10000370 | 3300002239 | Bacteria | 5834 |
| 20 | JGI24034J26672_10006378 | 3300002239 | Bacteria | 1701 |
| 21 | JGI24742J22300_10001841 | 3300002244 | Bacteria | 3377 |
| 22 | JGI24742J22300_10021793 | 3300002244 | Bacteria | 1095 |
| 23 | JGI24751J29686_10025837 | 3300002459 | Unclassified | 1218 |
| 24 | JGI24751J29686_10052399 | 3300002459 | Bacteria | 841 |
| 25 | rootH1_10035081 | 3300003316 | Bacteria | 4035 |
| 26 | JGI26129J50193_1004962 | 3300003349 | Unclassified | 948 |
| 27 | JGI26145J50221_1012694 | 3300003371 | Bacteria | 759 |
| 28 | Ga0065712_10069903 | 3300005290 | Bacteria | 6531 |
| 29 | Ga0065712_10084253 | 3300005290 | Bacteria | 2779 |
| 30 | Ga0065715_10090726 | 3300005293 | Bacteria | 6563 |
| 31 | Ga0065715_10193889 | 3300005293 | Bacteria | 1399 |
| 32 | Ga0065707_10356031 | 3300005295 | Bacteria | 911 |
| 33 | Ga0070676_10009404 | 3300005328 | Bacteria | 5281 |
| 34 | Ga0070683_100016231 | 3300005329 | Bacteria | 6561 |
| 35 | Ga0070683_100079030 | 3300005329 | Bacteria | 3078 |
| 36 | Ga0070690_100000972 | 3300005330 | Bacteria | 14582 |
| 37 | Ga0070690_100336286 | 3300005330 | Bacteria | 1092 |
| 38 | Ga0070670_100043184 | 3300005331 | Bacteria | 3876 |
| 39 | Ga0070670_100578111 | 3300005331 | Bacteria | 1004 |
| 40 | Ga0070677_10000624 | 3300005333 | Bacteria | 11892 |
| 41 | Ga0068869_100028165 | 3300005334 | Bacteria | 3923 |
| 42 | Ga0070680_100072254 | 3300005336 | Bacteria | 2835 |
| 43 | Ga0070680_101380952 | 3300005336 | Bacteria | 610 |
| 44 | Ga0070682_100022243 | 3300005337 | Bacteria | 3753 |
| 45 | Ga0070682_100023896 | 3300005337 | Bacteria | 3632 |
| 46 | Ga0070682_100562749 | 3300005337 | Bacteria | 894 |
| 47 | Ga0068868_100000287 | 3300005338 | Bacteria | 33828 |
| 48 | Ga0068868_100087725 | 3300005338 | Bacteria | 2502 |
| 49 | Ga0070660_100011348 | 3300005339 | Bacteria | 6325 |
| 50 | Ga0070660_100165868 | 3300005339 | Bacteria | 1782 |
| 51 | Ga0070660_100369679 | 3300005339 | Bacteria | 1183 |
| 52 | Ga0070689_100009382 | 3300005340 | Bacteria | 6935 |
| 53 | Ga0070689_100326596 | 3300005340 | Bacteria | 1282 |
| 54 | Ga0070689_100578161 | 3300005340 | Bacteria | 971 |
| 55 | Ga0070691_10007546 | 3300005341 | Bacteria | 4986 |
| 56 | Ga0070691_10050476 | 3300005341 | Bacteria | 1985 |
| 57 | Ga0070687_100006226 | 3300005343 | Bacteria | 4880 |
| 58 | Ga0070661_100014754 | 3300005344 | Bacteria | 5510 |
| 59 | Ga0070661_100211236 | 3300005344 | Bacteria | 1486 |
| 60 | Ga0070661_100282063 | 3300005344 | Bacteria | 1289 |
| 61 | Ga0070692_10003049 | 3300005345 | Bacteria | 6691 |
| 62 | Ga0070668_100038116 | 3300005347 | Bacteria | 3672 |
| 63 | Ga0070668_100155994 | 3300005347 | Bacteria | 1849 |
| 64 | Ga0070669_100005691 | 3300005353 | Bacteria | 8989 |
| 65 | Ga0070669_100141606 | 3300005353 | Bacteria | 1854 |
| 66 | Ga0070669_101212724 | 3300005353 | Bacteria | 652 |
| 67 | Ga0070675_100009027 | 3300005354 | Bacteria | 7744 |
| 68 | Ga0070675_100199475 | 3300005354 | Bacteria | 1736 |
| 69 | Ga0070675_101202319 | 3300005354 | Bacteria | 698 |
| 70 | Ga0070671_100033279 | 3300005355 | Bacteria | 4262 |
| 71 | Ga0070671_100227972 | 3300005355 | Bacteria | 1581 |
| 72 | Ga0070671_100341927 | 3300005355 | Bacteria | 1277 |
| 73 | Ga0070671_100355244 | 3300005355 | Bacteria | 1251 |
| 74 | Ga0070674_100056194 | 3300005356 | Bacteria | 2729 |
| 75 | Ga0070674_100105413 | 3300005356 | Bacteria | 2061 |
| 76 | Ga0070674_100249689 | 3300005356 | Bacteria | 1393 |
| 77 | Ga0070673_100006385 | 3300005364 | Bacteria | 7663 |
| 78 | Ga0070673_100014645 | 3300005364 | Bacteria | 5473 |
| 79 | Ga0070673_100601432 | 3300005364 | Bacteria | 1003 |
| 80 | Ga0070688_100001436 | 3300005365 | Bacteria | 11847 |
| 81 | Ga0070688_100205308 | 3300005365 | Unclassified | 1381 |
| 82 | Ga0070688_100351961 | 3300005365 | Bacteria | 1078 |
| 83 | Ga0070659_100015882 | 3300005366 | Bacteria | 5647 |
| 84 | Ga0070659_100255889 | 3300005366 | Bacteria | 1452 |
| 85 | Ga0070659_101525028 | 3300005366 | Bacteria | 596 |
| 86 | Ga0070667_100009541 | 3300005367 | Bacteria | 8047 |
| 87 | Ga0070667_100060283 | 3300005367 | Bacteria | 3211 |
| 88 | Ga0070667_100267605 | 3300005367 | Bacteria | 1532 |
| 89 | Ga0070667_100323726 | 3300005367 | Bacteria | 1391 |
| 90 | Ga0070667_100523865 | 3300005367 | Bacteria | 1088 |
| 91 | Ga0070667_100527864 | 3300005367 | Bacteria | 1083 |
| 92 | Ga0070709_10003671 | 3300005434 | Bacteria | 8246 |
| 93 | Ga0070709_10029359 | 3300005434 | Bacteria | 3289 |
| 94 | Ga0070709_10195406 | 3300005434 | Bacteria | 1430 |
| 95 | Ga0070709_10235293 | 3300005434 | Bacteria | 1313 |
| 96 | Ga0070709_10501809 | 3300005434 | Bacteria | 922 |
| 97 | Ga0070714_100103058 | 3300005435 | Bacteria | 2517 |
| 98 | Ga0070714_100619081 | 3300005435 | Bacteria | 1041 |
| 99 | Ga0070714_101983508 | 3300005435 | Bacteria | 568 |
| 100 | Ga0070713_100019221 | 3300005436 | Bacteria | 5210 |
| 101 | Ga0070713_100039180 | 3300005436 | Bacteria | 3844 |
| 102 | Ga0070713_100191291 | 3300005436 | Bacteria | 1844 |
| 103 | Ga0070713_100572504 | 3300005436 | Bacteria | 1071 |
| 104 | Ga0070710_10015364 | 3300005437 | Bacteria | 3874 |
| 105 | Ga0070710_10032037 | 3300005437 | Bacteria | 2844 |
| 106 | Ga0070710_10056697 | 3300005437 | Bacteria | 2217 |
| 107 | Ga0070710_11264920 | 3300005437 | Bacteria | 548 |
| 108 | Ga0070701_10278410 | 3300005438 | Bacteria | 1021 |
| 109 | Ga0070711_100001695 | 3300005439 | Bacteria | 12207 |
| 110 | Ga0070711_100019451 | 3300005439 | Bacteria | 4356 |
| 111 | Ga0070711_100030277 | 3300005439 | Bacteria | 3581 |
| 112 | Ga0070711_100140164 | 3300005439 | Bacteria | 1812 |
| 113 | Ga0070711_100459792 | 3300005439 | Bacteria | 1043 |
| 114 | Ga0070711_100594449 | 3300005439 | Bacteria | 922 |
| 115 | Ga0070705_100028618 | 3300005440 | Bacteria | 3054 |
| 116 | Ga0070705_100033813 | 3300005440 | Bacteria | 2853 |
| 117 | Ga0070700_100027984 | 3300005441 | Bacteria | 3349 |
| 118 | Ga0070700_100084110 | 3300005441 | Bacteria | 2061 |
| 119 | Ga0070700_100544247 | 3300005441 | Bacteria | 901 |
| 120 | Ga0070700_100907242 | 3300005441 | Bacteria | 718 |
| 121 | Ga0070700_101011923 | 3300005441 | Bacteria | 684 |
| 122 | Ga0070694_100003715 | 3300005444 | Bacteria | 9100 |
| 123 | Ga0070694_100098667 | 3300005444 | Bacteria | 2063 |
| 124 | Ga0070694_100131627 | 3300005444 | Bacteria | 1807 |
| 125 | Ga0070708_100129452 | 3300005445 | Bacteria | 2335 |
| 126 | Ga0070708_100633025 | 3300005445 | Bacteria | 1008 |
| 127 | Ga0070663_100007417 | 3300005455 | Bacteria | 6674 |
| 128 | Ga0070663_100084684 | 3300005455 | Bacteria | 2338 |
| 129 | Ga0070663_100088886 | 3300005455 | Bacteria | 2285 |
| 130 | Ga0070663_100101851 | 3300005455 | Bacteria | 2144 |
| 131 | Ga0070678_100004742 | 3300005456 | Bacteria | 7750 |
| 132 | Ga0070678_100005474 | 3300005456 | Bacteria | 7346 |
| 133 | Ga0070678_100119811 | 3300005456 | Bacteria | 2073 |
| 134 | Ga0070678_101396375 | 3300005456 | Bacteria | 654 |
| 135 | Ga0070662_100040160 | 3300005457 | Bacteria | 3330 |
| 136 | Ga0070681_10005630 | 3300005458 | Bacteria | 12103 |
| 137 | Ga0070681_10018191 | 3300005458 | Bacteria | 7026 |
| 138 | Ga0070681_10061315 | 3300005458 | Bacteria | 3736 |
| 139 | Ga0068867_100127668 | 3300005459 | Bacteria | 1972 |
| 140 | Ga0068867_101163386 | 3300005459 | Bacteria | 707 |
| 141 | Ga0068867_101170507 | 3300005459 | Bacteria | 705 |
| 142 | Ga0070685_10001963 | 3300005466 | Bacteria | 10678 |
| 143 | Ga0070685_10147789 | 3300005466 | Bacteria | 1486 |
| 144 | Ga0070685_11167658 | 3300005466 | Unclassified | 584 |
| 145 | Ga0070685_11608589 | 3300005466 | Bacteria | 503 |
| 146 | Ga0070706_102163689 | 3300005467 | Bacteria | 502 |
| 147 | Ga0070707_100210734 | 3300005468 | Bacteria | 1894 |
| 148 | Ga0070698_100524120 | 3300005471 | Bacteria | 1123 |
| 149 | Ga0070698_100594422 | 3300005471 | Bacteria | 1047 |
| 150 | Ga0070698_101557285 | 3300005471 | Bacteria | 613 |
| 151 | Ga0070699_100552611 | 3300005518 | Bacteria | 1048 |
| 152 | Ga0070699_100731683 | 3300005518 | Bacteria | 904 |
| 153 | Ga0070699_101303952 | 3300005518 | Bacteria | 666 |
| 154 | Ga0070679_100028262 | 3300005530 | Bacteria | 5528 |
| 155 | Ga0070679_100265940 | 3300005530 | Bacteria | 1670 |
| 156 | Ga0070679_100276893 | 3300005530 | Bacteria | 1631 |
| 157 | Ga0070679_101895330 | 3300005530 | Bacteria | 545 |
| 158 | Ga0070684_100054756 | 3300005535 | Bacteria | 3476 |
| 159 | Ga0070684_100075913 | 3300005535 | Bacteria | 2965 |
| 160 | Ga0070684_101036785 | 3300005535 | Bacteria | 770 |
| 161 | Ga0070697_100036768 | 3300005536 | Bacteria | 3955 |
| 162 | Ga0070697_100370943 | 3300005536 | Bacteria | 1238 |
| 163 | Ga0068853_100033477 | 3300005539 | Bacteria | 4361 |
| 164 | Ga0070672_100008973 | 3300005543 | Bacteria | 6873 |
| 165 | Ga0070686_100034178 | 3300005544 | Bacteria | 3130 |
| 166 | Ga0070686_100038220 | 3300005544 | Bacteria | 2982 |
| 167 | Ga0070686_100089466 | 3300005544 | Bacteria | 2056 |
| 168 | Ga0070686_100157183 | 3300005544 | Bacteria | 1598 |
| 169 | Ga0070686_100209318 | 3300005544 | Bacteria | 1403 |
| 170 | Ga0070695_100112555 | 3300005545 | Bacteria | 1849 |
| 171 | Ga0070695_100312777 | 3300005545 | Bacteria | 1165 |
| 172 | Ga0070696_100006672 | 3300005546 | Bacteria | 7710 |
| 173 | Ga0070696_100110438 | 3300005546 | Bacteria | 1980 |
| 174 | Ga0070693_100003566 | 3300005547 | Bacteria | 7261 |
| 175 | Ga0070693_100076865 | 3300005547 | Bacteria | 1980 |
| 176 | Ga0070665_100014185 | 3300005548 | Bacteria | 8007 |
| 177 | Ga0070665_100326964 | 3300005548 | Bacteria | 1537 |
| 178 | Ga0070665_102623200 | 3300005548 | Bacteria | 504 |
| 179 | Ga0070704_100086884 | 3300005549 | Bacteria | 2319 |
| 180 | Ga0070704_100087525 | 3300005549 | Bacteria | 2312 |
| 181 | Ga0070704_100581733 | 3300005549 | Bacteria | 982 |
| 182 | Ga0068855_100031527 | 3300005563 | Bacteria | 6330 |
| 183 | Ga0068855_101717317 | 3300005563 | Bacteria | 640 |
| 184 | Ga0070664_100071700 | 3300005564 | Bacteria | 2969 |
| 185 | Ga0070664_100188683 | 3300005564 | Bacteria | 1836 |
| 186 | Ga0070664_100649343 | 3300005564 | Bacteria | 980 |
| 187 | Ga0068857_100006630 | 3300005577 | Bacteria | 9945 |
| 188 | Ga0068857_100452281 | 3300005577 | Bacteria | 1201 |
| 189 | Ga0068854_100141093 | 3300005578 | Bacteria | 1849 |
| 190 | Ga0068856_100037685 | 3300005614 | Bacteria | 4745 |
| 191 | Ga0068856_100067110 | 3300005614 | Bacteria | 3545 |
| 192 | Ga0068856_100248672 | 3300005614 | Bacteria | 1793 |
| 193 | Ga0068856_100444794 | 3300005614 | Bacteria | 1317 |
| 194 | Ga0068856_101703675 | 3300005614 | Bacteria | 643 |
| 195 | Ga0070702_100091083 | 3300005615 | Bacteria | 1849 |
| 196 | Ga0070702_100355537 | 3300005615 | Bacteria | 1033 |
| 197 | Ga0070702_100557270 | 3300005615 | Bacteria | 852 |
| 198 | Ga0068852_100010452 | 3300005616 | Bacteria | 6939 |
| 199 | Ga0068852_100067469 | 3300005616 | Bacteria | 3127 |
| 200 | Ga0068852_100576443 | 3300005616 | Bacteria | 1128 |
| 201 | Ga0068859_100048040 | 3300005617 | Bacteria | 4287 |
| 202 | Ga0068859_100054633 | 3300005617 | Bacteria | 4017 |
| 203 | Ga0068859_100484879 | 3300005617 | Bacteria | 1332 |
| 204 | Ga0068859_100510275 | 3300005617 | Bacteria | 1297 |
| 205 | Ga0068859_100752815 | 3300005617 | Bacteria | 1063 |
| 206 | Ga0068864_100026602 | 3300005618 | Bacteria | 4879 |
| 207 | Ga0068864_100040226 | 3300005618 | Bacteria | 3999 |
| 208 | Ga0068864_100366800 | 3300005618 | Bacteria | 1362 |
| 209 | Ga0068864_100812521 | 3300005618 | Bacteria | 919 |
| 210 | Ga0068866_10007526 | 3300005718 | Bacteria | 4563 |
| 211 | Ga0068866_10546016 | 3300005718 | Bacteria | 774 |
| 212 | Ga0068861_100007303 | 3300005719 | Bacteria | 7572 |
| 213 | Ga0068861_100149423 | 3300005719 | Bacteria | 1915 |
| 214 | Ga0068851_10298156 | 3300005834 | Bacteria | 926 |
| 215 | Ga0068851_10400670 | 3300005834 | Bacteria | 807 |
| 216 | Ga0068870_10007593 | 3300005840 | Bacteria | 4846 |
| 217 | Ga0068863_100045270 | 3300005841 | Bacteria | 4176 |
| 218 | Ga0068863_100580920 | 3300005841 | Bacteria | 1108 |
| 219 | Ga0068863_101478528 | 3300005841 | Bacteria | 688 |
| 220 | Ga0068858_100064184 | 3300005842 | Bacteria | 3398 |
| 221 | Ga0068858_100265133 | 3300005842 | Bacteria | 1634 |
| 222 | Ga0068858_100273467 | 3300005842 | Bacteria | 1608 |
| 223 | Ga0068860_100015452 | 3300005843 | Bacteria | 7455 |
| 224 | Ga0068860_100047742 | 3300005843 | Bacteria | 4080 |
| 225 | Ga0068860_100320286 | 3300005843 | Bacteria | 1522 |
| 226 | Ga0068862_100015822 | 3300005844 | Bacteria | 6267 |
| 227 | Ga0068862_100275368 | 3300005844 | Bacteria | 1540 |
| 228 | Ga0068862_101558907 | 3300005844 | Bacteria | 667 |
| 229 | Ga0081455_10006976 | 3300005937 | Bacteria | 12004 |
| 230 | Ga0081455_10014661 | 3300005937 | Bacteria | 7663 |
| 231 | Ga0081455_10041818 | 3300005937 | Bacteria | 4026 |
| 232 | Ga0081455_10116763 | 3300005937 | Bacteria | 2110 |
| 233 | Ga0081455_10123738 | 3300005937 | Bacteria | 2034 |
| 234 | Ga0081455_10295044 | 3300005937 | Bacteria | 1166 |
| 235 | Ga0081538_10041292 | 3300005981 | Bacteria | 2929 |
| 236 | Ga0081540_1005655 | 3300005983 | Bacteria | 9295 |
| 237 | Ga0070717_10150167 | 3300006028 | Bacteria | 2015 |
| 238 | Ga0070717_10236827 | 3300006028 | Bacteria | 1608 |
| 239 | Ga0070717_10263454 | 3300006028 | Bacteria | 1525 |
| 240 | Ga0070717_10819301 | 3300006028 | Bacteria | 847 |
| 241 | Ga0075363_100073902 | 3300006048 | Unclassified | 1855 |
| 242 | Ga0075363_100254564 | 3300006048 | Bacteria | 1012 |
| 243 | Ga0075363_100356897 | 3300006048 | Bacteria | 854 |
| 244 | Ga0075364_10005596 | 3300006051 | Bacteria | 7323 |
| 245 | Ga0075364_10674752 | 3300006051 | Bacteria | 705 |
| 246 | Ga0075432_10106569 | 3300006058 | Bacteria | 1041 |
| 247 | Ga0070715_10014758 | 3300006163 | Bacteria | 2901 |
| 248 | Ga0070715_10691862 | 3300006163 | Bacteria | 608 |
| 249 | Ga0070716_100009019 | 3300006173 | Bacteria | 4963 |
| 250 | Ga0070712_100001893 | 3300006175 | Bacteria | 12771 |
| 251 | Ga0070712_100002927 | 3300006175 | Bacteria | 10579 |
| 252 | Ga0070712_100055457 | 3300006175 | Bacteria | 2776 |
| 253 | Ga0070712_100183986 | 3300006175 | Bacteria | 1630 |
| 254 | Ga0070712_100275385 | 3300006175 | Bacteria | 1354 |
| 255 | Ga0070712_100315604 | 3300006175 | Bacteria | 1270 |
| 256 | Ga0075362_10015622 | 3300006177 | Bacteria | 3091 |
| 257 | Ga0075362_10256205 | 3300006177 | Bacteria | 861 |
| 258 | Ga0075367_10035515 | 3300006178 | Bacteria | 2886 |
| 259 | Ga0075367_10063419 | 3300006178 | Bacteria | 2209 |
| 260 | Ga0075367_10087404 | 3300006178 | Bacteria | 1893 |
| 261 | Ga0075367_10973832 | 3300006178 | Bacteria | 541 |
| 262 | Ga0075427_10003835 | 3300006194 | Bacteria | 2098 |
| 263 | Ga0075366_10057187 | 3300006195 | Bacteria | 2318 |
| 264 | Ga0097621_100008744 | 3300006237 | Bacteria | 7316 |
| 265 | Ga0097621_100045558 | 3300006237 | Bacteria | 3543 |
| 266 | Ga0097621_100180771 | 3300006237 | Bacteria | 1822 |
| 267 | Ga0075370_10138142 | 3300006353 | Bacteria | 1424 |
| 268 | Ga0075370_10460636 | 3300006353 | Bacteria | 765 |
| 269 | Ga0075370_10676408 | 3300006353 | Bacteria | 627 |
| 270 | Ga0068871_100000922 | 3300006358 | Bacteria | 19615 |
| 271 | Ga0068871_100027615 | 3300006358 | Bacteria | 4440 |
| 272 | Ga0068871_100083567 | 3300006358 | Bacteria | 2648 |
| 273 | Ga0068871_100208014 | 3300006358 | Bacteria | 1691 |
| 274 | Ga0068871_100961362 | 3300006358 | Unclassified | 794 |
| 275 | Ga0075428_100017044 | 3300006844 | Bacteria | 8027 |
| 276 | Ga0075428_100017138 | 3300006844 | Bacteria | 8003 |
| 277 | Ga0075428_100575571 | 3300006844 | Bacteria | 1203 |
| 278 | Ga0075430_100004240 | 3300006846 | Bacteria | 12111 |
| 279 | Ga0075430_100234758 | 3300006846 | Bacteria | 1520 |
| 280 | Ga0075431_100005477 | 3300006847 | Bacteria | 12538 |
| 281 | Ga0075431_100237644 | 3300006847 | Bacteria | 1854 |
| 282 | Ga0075431_100349390 | 3300006847 | Bacteria | 1487 |
| 283 | Ga0075433_10003318 | 3300006852 | Bacteria | 12434 |
| 284 | Ga0075433_10379103 | 3300006852 | Bacteria | 1249 |
| 285 | Ga0075434_100001367 | 3300006871 | Bacteria | 20481 |
| 286 | Ga0075434_100003881 | 3300006871 | Bacteria | 13383 |
| 287 | Ga0075434_100043832 | 3300006871 | Bacteria | 4437 |
| 288 | Ga0075434_100298045 | 3300006871 | Bacteria | 1633 |
| 289 | Ga0075434_100552116 | 3300006871 | Bacteria | 1171 |
| 290 | Ga0075434_100655354 | 3300006871 | Bacteria | 1068 |
| 291 | Ga0075434_100719358 | 3300006871 | Bacteria | 1016 |
| 292 | Ga0075434_101122493 | 3300006871 | Bacteria | 799 |
| 293 | Ga0075429_100008546 | 3300006880 | Bacteria | 8907 |
| 294 | Ga0075429_101039031 | 3300006880 | Bacteria | 716 |
| 295 | Ga0068865_100020346 | 3300006881 | Bacteria | 4302 |
| 296 | Ga0068865_101291279 | 3300006881 | Bacteria | 649 |
| 297 | Ga0075436_100143142 | 3300006914 | Bacteria | 1681 |
| 298 | Ga0075436_100233885 | 3300006914 | Bacteria | 1306 |
| 299 | Ga0097620_100048041 | 3300006931 | Bacteria | 4287 |
| 300 | Ga0097620_100054629 | 3300006931 | Bacteria | 4017 |
| 301 | Ga0097620_100484892 | 3300006931 | Bacteria | 1332 |
| 302 | Ga0097620_100510258 | 3300006931 | Bacteria | 1297 |
| 303 | Ga0097620_100752860 | 3300006931 | Bacteria | 1063 |
| 304 | Ga0075435_100068616 | 3300007076 | Bacteria | 2889 |
| 305 | Ga0075435_100120318 | 3300007076 | Bacteria | 2191 |
| 306 | Ga0075435_100220222 | 3300007076 | Bacteria | 1612 |
| 307 | Ga0075435_100334541 | 3300007076 | Unclassified | 1297 |
| 308 | Ga0075435_100469057 | 3300007076 | Bacteria | 1087 |
| 309 | Ga0075435_100642636 | 3300007076 | Bacteria | 921 |
| 310 | Ga0075435_101550961 | 3300007076 | Bacteria | 581 |
| 311 | Ga0099794_10641639 | 3300007265 | Bacteria | 564 |
| 312 | Ga0105251_10044171 | 3300009011 | Bacteria | 2154 |
| 313 | Ga0105251_10112195 | 3300009011 | Bacteria | 1241 |
| 314 | Ga0105251_10355454 | 3300009011 | Bacteria | 669 |
| 315 | Ga0105251_10464508 | 3300009011 | Unclassified | 588 |
| 316 | Ga0105244_10018443 | 3300009036 | Bacteria | 3915 |
| 317 | Ga0105244_10128202 | 3300009036 | Bacteria | 1225 |
| 318 | Ga0105244_10195507 | 3300009036 | Bacteria | 955 |
| 319 | Ga0105250_10094806 | 3300009092 | Bacteria | 1216 |
| 320 | Ga0105240_10223606 | 3300009093 | Bacteria | 2192 |
| 321 | Ga0105240_11242884 | 3300009093 | Bacteria | 787 |
| 322 | Ga0111539_10002796 | 3300009094 | Bacteria | 23160 |
| 323 | Ga0111539_10053737 | 3300009094 | Bacteria | 4795 |
| 324 | Ga0111539_10072106 | 3300009094 | Bacteria | 4074 |
| 325 | Ga0111539_10215901 | 3300009094 | Bacteria | 2234 |
| 326 | Ga0111539_10330823 | 3300009094 | Bacteria | 1773 |
| 327 | Ga0111539_10429446 | 3300009094 | Bacteria | 1538 |
| 328 | Ga0111539_10583290 | 3300009094 | Bacteria | 1302 |
| 329 | Ga0111539_10603706 | 3300009094 | Bacteria | 1278 |
| 330 | Ga0111539_12263764 | 3300009094 | Bacteria | 630 |
| 331 | Ga0105245_10004252 | 3300009098 | Bacteria | 12700 |
| 332 | Ga0105245_10068509 | 3300009098 | Bacteria | 3216 |
| 333 | Ga0105245_10148592 | 3300009098 | Bacteria | 2213 |
| 334 | Ga0105245_10197571 | 3300009098 | Bacteria | 1930 |
| 335 | Ga0105245_10726667 | 3300009098 | Bacteria | 1028 |
| 336 | Ga0105245_11246174 | 3300009098 | Bacteria | 792 |
| 337 | Ga0105247_10024208 | 3300009101 | Bacteria | 3658 |
| 338 | Ga0105247_10042814 | 3300009101 | Bacteria | 2774 |
| 339 | Ga0105247_10186310 | 3300009101 | Bacteria | 1387 |
| 340 | Ga0105247_10774410 | 3300009101 | Bacteria | 729 |
| 341 | Ga0114129_10006801 | 3300009147 | Bacteria | 16237 |
| 342 | Ga0114129_10029650 | 3300009147 | Bacteria | 7749 |
| 343 | Ga0114129_10037206 | 3300009147 | Bacteria | 6872 |
| 344 | Ga0114129_10079232 | 3300009147 | Bacteria | 4568 |
| 345 | Ga0105243_10016347 | 3300009148 | Bacteria | 5614 |
| 346 | Ga0105243_10019863 | 3300009148 | Bacteria | 5096 |
| 347 | Ga0105241_10021402 | 3300009174 | Bacteria | 4780 |
| 348 | Ga0105241_10048036 | 3300009174 | Bacteria | 3246 |
| 349 | Ga0105241_11280115 | 3300009174 | Bacteria | 697 |
| 350 | Ga0105241_12461476 | 3300009174 | Bacteria | 521 |
| 351 | Ga0105242_10045458 | 3300009176 | Bacteria | 3559 |
| 352 | Ga0105242_10532664 | 3300009176 | Bacteria | 1123 |
| 353 | Ga0105242_11183727 | 3300009176 | Bacteria | 783 |
| 354 | Ga0105242_11430073 | 3300009176 | Bacteria | 720 |
| 355 | Ga0105248_10034642 | 3300009177 | Bacteria | 5648 |
| 356 | Ga0105248_10035800 | 3300009177 | Bacteria | 5553 |
| 357 | Ga0105248_10110124 | 3300009177 | Bacteria | 3105 |
| 358 | Ga0105248_11283656 | 3300009177 | Bacteria | 828 |
| 359 | Ga0105248_11828815 | 3300009177 | Bacteria | 689 |
| 360 | Ga0105248_12207883 | 3300009177 | Bacteria | 626 |
| 361 | Ga0105237_10008357 | 3300009545 | Bacteria | 11222 |
| 362 | Ga0105237_10035386 | 3300009545 | Bacteria | 5053 |
| 363 | Ga0105237_10596307 | 3300009545 | Bacteria | 1112 |
| 364 | Ga0105238_10058732 | 3300009551 | Bacteria | 3855 |
| 365 | Ga0105249_10029412 | 3300009553 | Bacteria | 4961 |
| 366 | Ga0105249_10152330 | 3300009553 | Bacteria | 2227 |
| 367 | Ga0105249_10437090 | 3300009553 | Bacteria | 1345 |
| 368 | Ga0105033_110928 | 3300009986 | Bacteria | 800 |
| 369 | Ga0105239_10025073 | 3300010375 | Bacteria | 6569 |
| 370 | Ga0105239_10059534 | 3300010375 | Bacteria | 4192 |
| 371 | Ga0105239_10519024 | 3300010375 | Bacteria | 1355 |
| 372 | Ga0105239_10834275 | 3300010375 | Bacteria | 1057 |
| 373 | Ga0105239_11545209 | 3300010375 | Bacteria | 767 |
| 374 | Ga0105239_13383082 | 3300010375 | Bacteria | 519 |
| 375 | Ga0105246_10037433 | 3300011119 | Bacteria | 3256 |
| 376 | Ga0105246_10288223 | 3300011119 | Bacteria | 1320 |
| 377 | Ga0105246_10356309 | 3300011119 | Bacteria | 1201 |
| 378 | Ga0105246_10427703 | 3300011119 | Bacteria | 1107 |
| 379 | Ga0157346_1004633 | 3300012480 | Bacteria | 821 |
| 380 | Ga0157320_1038679 | 3300012481 | Bacteria | 509 |
| 381 | Ga0157314_1003712 | 3300012500 | Bacteria | 1095 |
| 382 | Ga0157313_1004711 | 3300012503 | Bacteria | 951 |
| 383 | Ga0157373_10007606 | 3300013100 | Bacteria | 8052 |
| 384 | Ga0157373_10801133 | 3300013100 | Bacteria | 695 |
| 385 | Ga0157369_10196398 | 3300013105 | Bacteria | 2119 |
| 386 | Ga0157369_10557881 | 3300013105 | Bacteria | 1184 |
| 387 | Ga0157369_10589036 | 3300013105 | Bacteria | 1148 |
| 388 | Ga0157369_10947488 | 3300013105 | Bacteria | 882 |
| 389 | Ga0157374_10015848 | 3300013296 | Bacteria | 6621 |
| 390 | Ga0157378_10007970 | 3300013297 | Bacteria | 9246 |
| 391 | Ga0157378_10032054 | 3300013297 | Bacteria | 4642 |
| 392 | Ga0157378_10429633 | 3300013297 | Bacteria | 1307 |
| 393 | Ga0157378_10634683 | 3300013297 | Bacteria | 1082 |
| 394 | Ga0163162_10087113 | 3300013306 | Bacteria | 3201 |
| 395 | Ga0163162_10221007 | 3300013306 | Bacteria | 2024 |
| 396 | Ga0163162_10360873 | 3300013306 | Bacteria | 1586 |
| 397 | Ga0163162_11218121 | 3300013306 | Bacteria | 854 |
| 398 | Ga0157372_10016528 | 3300013307 | Bacteria | 7919 |
| 399 | Ga0157372_10160704 | 3300013307 | Bacteria | 2596 |
| 400 | Ga0157372_11529704 | 3300013307 | Bacteria | 768 |
| 401 | Ga0157375_10017624 | 3300013308 | Bacteria | 6449 |
| 402 | Ga0157375_10397256 | 3300013308 | Bacteria | 1545 |
| 403 | Ga0157375_10540822 | 3300013308 | Bacteria | 1327 |
| 404 | Ga0163163_10001820 | 3300014325 | Bacteria | 18002 |
| 405 | Ga0163163_10003639 | 3300014325 | Bacteria | 13106 |
| 406 | Ga0163163_10369436 | 3300014325 | Bacteria | 1491 |
| 407 | Ga0157380_10009315 | 3300014326 | Bacteria | 7033 |
| 408 | Ga0157380_10126169 | 3300014326 | Bacteria | 2176 |
| 409 | Ga0157380_10136692 | 3300014326 | Bacteria | 2099 |
| 410 | Ga0182008_10242839 | 3300014497 | Bacteria | 927 |
| 411 | Ga0157377_10033977 | 3300014745 | Bacteria | 2788 |
| 412 | Ga0157379_10001178 | 3300014968 | Bacteria | 21270 |
| 413 | Ga0157379_10118428 | 3300014968 | Bacteria | 2382 |
| 414 | Ga0157379_10551695 | 3300014968 | Bacteria | 1072 |
| 415 | Ga0157379_10783047 | 3300014968 | Bacteria | 899 |
| 416 | Ga0157376_10195812 | 3300014969 | Bacteria | 1856 |
| 417 | Ga0157376_10726108 | 3300014969 | Bacteria | 1001 |
| 418 | Ga0163161_10175653 | 3300017792 | Bacteria | 1640 |
| 419 | Ga0213872_10024190 | 3300021361 | Bacteria | 2793 |
| 420 | Ga0213876_10225361 | 3300021384 | Bacteria | 997 |
| 421 | Ga0228598_1024716 | 3300024227 | Bacteria | 1182 |
| 422 | Ga0207673_1000112 | 3300025290 | Bacteria | 7483 |
| 423 | Ga0207697_10000579 | 3300025315 | Bacteria | 20843 |
| 424 | Ga0207656_10286347 | 3300025321 | Bacteria | 813 |
| 425 | Ga0207656_10332443 | 3300025321 | Bacteria | 756 |
| 426 | Ga0207696_1115583 | 3300025711 | Bacteria | 725 |
| 427 | Ga0207713_1219860 | 3300025735 | Unclassified | 573 |
| 428 | Ga0207713_1237877 | 3300025735 | Bacteria | 541 |
| 429 | Ga0207682_10008278 | 3300025893 | Bacteria | 4118 |
| 430 | Ga0207692_10014928 | 3300025898 | Bacteria | 3405 |
| 431 | Ga0207692_10035418 | 3300025898 | Bacteria | 2425 |
| 432 | Ga0207692_10258580 | 3300025898 | Bacteria | 1046 |
| 433 | Ga0207692_10849651 | 3300025898 | Bacteria | 599 |
| 434 | Ga0207642_10013446 | 3300025899 | Bacteria | 2987 |
| 435 | Ga0207642_10023805 | 3300025899 | Bacteria | 2452 |
| 436 | Ga0207710_10016579 | 3300025900 | Bacteria | 3118 |
| 437 | Ga0207710_10025350 | 3300025900 | Bacteria | 2559 |
| 438 | Ga0207710_10088542 | 3300025900 | Bacteria | 1446 |
| 439 | Ga0207688_10001006 | 3300025901 | Bacteria | 14351 |
| 440 | Ga0207688_10015640 | 3300025901 | Bacteria | 4115 |
| 441 | Ga0207680_10131226 | 3300025903 | Bacteria | 1652 |
| 442 | Ga0207647_10012884 | 3300025904 | Bacteria | 5810 |
| 443 | Ga0207647_10025960 | 3300025904 | Bacteria | 3839 |
| 444 | Ga0207647_10730026 | 3300025904 | Bacteria | 538 |
| 445 | Ga0207685_10277583 | 3300025905 | Bacteria | 821 |
| 446 | Ga0207699_10023469 | 3300025906 | Bacteria | 3357 |
| 447 | Ga0207699_10078246 | 3300025906 | Bacteria | 2042 |
| 448 | Ga0207699_10705616 | 3300025906 | Bacteria | 739 |
| 449 | Ga0207645_10001020 | 3300025907 | Bacteria | 23147 |
| 450 | Ga0207645_10058013 | 3300025907 | Bacteria | 2472 |
| 451 | Ga0207643_10000523 | 3300025908 | Bacteria | 24625 |
| 452 | Ga0207643_10001208 | 3300025908 | Bacteria | 15269 |
| 453 | Ga0207684_10067383 | 3300025910 | Bacteria | 3042 |
| 454 | Ga0207684_11153643 | 3300025910 | Bacteria | 643 |
| 455 | Ga0207684_11638964 | 3300025910 | Bacteria | 520 |
| 456 | Ga0207654_10047157 | 3300025911 | Bacteria | 2461 |
| 457 | Ga0207707_10018497 | 3300025912 | Bacteria | 6073 |
| 458 | Ga0207707_10046164 | 3300025912 | Bacteria | 3793 |
| 459 | Ga0207707_10061465 | 3300025912 | Bacteria | 3268 |
| 460 | Ga0207707_10161758 | 3300025912 | Bacteria | 1957 |
| 461 | Ga0207695_10321834 | 3300025913 | Bacteria | 1436 |
| 462 | Ga0207671_10113380 | 3300025914 | Bacteria | 2065 |
| 463 | Ga0207671_10445696 | 3300025914 | Bacteria | 1031 |
| 464 | Ga0207693_10007054 | 3300025915 | Bacteria | 9272 |
| 465 | Ga0207693_10008072 | 3300025915 | Bacteria | 8632 |
| 466 | Ga0207693_10066907 | 3300025915 | Bacteria | 2813 |
| 467 | Ga0207693_10107857 | 3300025915 | Bacteria | 2185 |
| 468 | Ga0207663_10056960 | 3300025916 | Bacteria | 2461 |
| 469 | Ga0207663_10085498 | 3300025916 | Bacteria | 2077 |
| 470 | Ga0207663_10218119 | 3300025916 | Bacteria | 1386 |
| 471 | Ga0207663_10420334 | 3300025916 | Bacteria | 1026 |
| 472 | Ga0207663_10614654 | 3300025916 | Bacteria | 855 |
| 473 | Ga0207663_10632256 | 3300025916 | Bacteria | 843 |
| 474 | Ga0207660_10014892 | 3300025917 | Bacteria | 5126 |
| 475 | Ga0207660_10072595 | 3300025917 | Bacteria | 2507 |
| 476 | Ga0207660_10154346 | 3300025917 | Bacteria | 1766 |
| 477 | Ga0207660_11097233 | 3300025917 | Bacteria | 648 |
| 478 | Ga0207662_10002710 | 3300025918 | Bacteria | 8938 |
| 479 | Ga0207662_10231646 | 3300025918 | Bacteria | 1207 |
| 480 | Ga0207657_10005692 | 3300025919 | Bacteria | 13002 |
| 481 | Ga0207657_10008810 | 3300025919 | Bacteria | 10207 |
| 482 | Ga0207657_10190481 | 3300025919 | Bacteria | 1655 |
| 483 | Ga0207657_10243838 | 3300025919 | Bacteria | 1434 |
| 484 | Ga0207649_10004225 | 3300025920 | Bacteria | 7828 |
| 485 | Ga0207649_10173044 | 3300025920 | Bacteria | 1506 |
| 486 | Ga0207649_10361613 | 3300025920 | Bacteria | 1077 |
| 487 | Ga0207652_10018458 | 3300025921 | Bacteria | 5722 |
| 488 | Ga0207652_10167164 | 3300025921 | Bacteria | 1973 |
| 489 | Ga0207652_10187627 | 3300025921 | Bacteria | 1859 |
| 490 | Ga0207646_10809151 | 3300025922 | Bacteria | 834 |
| 491 | Ga0207681_10004280 | 3300025923 | Bacteria | 8810 |
| 492 | Ga0207681_10146685 | 3300025923 | Bacteria | 1764 |
| 493 | Ga0207681_10408248 | 3300025923 | Bacteria | 1098 |
| 494 | Ga0207681_10599154 | 3300025923 | Bacteria | 910 |
| 495 | Ga0207694_10280897 | 3300025924 | Bacteria | 1368 |
| 496 | Ga0207650_10003662 | 3300025925 | Bacteria | 10511 |
| 497 | Ga0207650_10107215 | 3300025925 | Bacteria | 2158 |
| 498 | Ga0207650_10219149 | 3300025925 | Bacteria | 1531 |
| 499 | Ga0207650_10834846 | 3300025925 | Bacteria | 781 |
| 500 | Ga0207659_10002130 | 3300025926 | Bacteria | 11734 |
| 501 | Ga0207659_10091451 | 3300025926 | Bacteria | 2273 |
| 502 | Ga0207687_10010078 | 3300025927 | Bacteria | 6180 |
| 503 | Ga0207687_10051449 | 3300025927 | Bacteria | 2872 |
| 504 | Ga0207687_10180844 | 3300025927 | Bacteria | 1634 |
| 505 | Ga0207687_11033971 | 3300025927 | Bacteria | 705 |
| 506 | Ga0207700_10046160 | 3300025928 | Bacteria | 3220 |
| 507 | Ga0207700_10051330 | 3300025928 | Bacteria | 3078 |
| 508 | Ga0207700_10107794 | 3300025928 | Bacteria | 2235 |
| 509 | Ga0207700_10172647 | 3300025928 | Bacteria | 1805 |
| 510 | Ga0207700_10201412 | 3300025928 | Bacteria | 1678 |
| 511 | Ga0207700_10596871 | 3300025928 | Bacteria | 982 |
| 512 | Ga0207700_10660825 | 3300025928 | Bacteria | 932 |
| 513 | Ga0207664_10256980 | 3300025929 | Bacteria | 1526 |
| 514 | Ga0207644_10006560 | 3300025931 | Bacteria | 7582 |
| 515 | Ga0207644_10046794 | 3300025931 | Bacteria | 3083 |
| 516 | Ga0207644_10417776 | 3300025931 | Bacteria | 1098 |
| 517 | Ga0207644_10759134 | 3300025931 | Bacteria | 810 |
| 518 | Ga0207690_10003881 | 3300025932 | Bacteria | 8837 |
| 519 | Ga0207690_10077141 | 3300025932 | Bacteria | 2316 |
| 520 | Ga0207690_10262440 | 3300025932 | Bacteria | 1339 |
| 521 | Ga0207706_10004561 | 3300025933 | Bacteria | 13002 |
| 522 | Ga0207706_10118814 | 3300025933 | Bacteria | 2325 |
| 523 | Ga0207706_10265898 | 3300025933 | Bacteria | 1497 |
| 524 | Ga0207686_10002841 | 3300025934 | Bacteria | 9345 |
| 525 | Ga0207686_10032302 | 3300025934 | Bacteria | 3115 |
| 526 | Ga0207686_10084799 | 3300025934 | Bacteria | 2076 |
| 527 | Ga0207709_10003952 | 3300025935 | Bacteria | 8652 |
| 528 | Ga0207670_10020819 | 3300025936 | Bacteria | 4036 |
| 529 | Ga0207670_10800954 | 3300025936 | Bacteria | 785 |
| 530 | Ga0207669_10000737 | 3300025937 | Bacteria | 14194 |
| 531 | Ga0207669_10052926 | 3300025937 | Bacteria | 2442 |
| 532 | Ga0207704_10005685 | 3300025938 | Bacteria | 5764 |
| 533 | Ga0207704_10036572 | 3300025938 | Bacteria | 2826 |
| 534 | Ga0207704_10209749 | 3300025938 | Bacteria | 1433 |
| 535 | Ga0207704_10265516 | 3300025938 | Bacteria | 1296 |
| 536 | Ga0207665_10005721 | 3300025939 | Bacteria | 8278 |
| 537 | Ga0207665_10273127 | 3300025939 | Bacteria | 1256 |
| 538 | Ga0207665_10434307 | 3300025939 | Bacteria | 1005 |
| 539 | Ga0207691_10004854 | 3300025940 | Bacteria | 13002 |
| 540 | Ga0207691_10039179 | 3300025940 | Bacteria | 4384 |
| 541 | Ga0207711_10009494 | 3300025941 | Bacteria | 8117 |
| 542 | Ga0207711_10073214 | 3300025941 | Bacteria | 2977 |
| 543 | Ga0207711_10127495 | 3300025941 | Bacteria | 2278 |
| 544 | Ga0207711_11322816 | 3300025941 | Bacteria | 663 |
| 545 | Ga0207689_10001399 | 3300025942 | Bacteria | 23007 |
| 546 | Ga0207661_10020336 | 3300025944 | Bacteria | 4961 |
| 547 | Ga0207661_10123169 | 3300025944 | Bacteria | 2210 |
| 548 | Ga0207679_10000829 | 3300025945 | Bacteria | 19882 |
| 549 | Ga0207679_10997985 | 3300025945 | Bacteria | 767 |
| 550 | Ga0207667_10057202 | 3300025949 | Bacteria | 4094 |
| 551 | Ga0207651_10006082 | 3300025960 | Bacteria | 6273 |
| 552 | Ga0207651_10044400 | 3300025960 | Bacteria | 2974 |
| 553 | Ga0207651_10147297 | 3300025960 | Bacteria | 1828 |
| 554 | Ga0207712_10062205 | 3300025961 | Bacteria | 2652 |
| 555 | Ga0207712_10180598 | 3300025961 | Bacteria | 1657 |
| 556 | Ga0207712_10391746 | 3300025961 | Bacteria | 1165 |
| 557 | Ga0207712_10458195 | 3300025961 | Bacteria | 1083 |
| 558 | Ga0207668_10002780 | 3300025972 | Bacteria | 10231 |
| 559 | Ga0207668_10619963 | 3300025972 | Bacteria | 944 |
| 560 | Ga0207640_10003641 | 3300025981 | Bacteria | 8308 |
| 561 | Ga0207658_10014267 | 3300025986 | Bacteria | 5440 |
| 562 | Ga0207658_10037047 | 3300025986 | Bacteria | 3501 |
| 563 | Ga0207658_10052210 | 3300025986 | Bacteria | 3016 |
| 564 | Ga0207658_10341638 | 3300025986 | Bacteria | 1301 |
| 565 | Ga0207677_10027035 | 3300026023 | Bacteria | 3607 |
| 566 | Ga0207677_10092877 | 3300026023 | Bacteria | 2198 |
| 567 | Ga0207703_10005080 | 3300026035 | Bacteria | 10642 |
| 568 | Ga0207703_10080054 | 3300026035 | Bacteria | 2720 |
| 569 | Ga0207703_10201956 | 3300026035 | Bacteria | 1767 |
| 570 | Ga0207639_10036135 | 3300026041 | Bacteria | 3659 |
| 571 | Ga0207639_10065082 | 3300026041 | Bacteria | 2829 |
| 572 | Ga0207639_10916842 | 3300026041 | Bacteria | 819 |
| 573 | Ga0207678_10001694 | 3300026067 | Bacteria | 20208 |
| 574 | Ga0207678_10012983 | 3300026067 | Bacteria | 7311 |
| 575 | Ga0207678_10031049 | 3300026067 | Bacteria | 4663 |
| 576 | Ga0207678_10109778 | 3300026067 | Bacteria | 2353 |
| 577 | Ga0207678_11537825 | 3300026067 | Bacteria | 587 |
| 578 | Ga0207708_10003453 | 3300026075 | Bacteria | 11648 |
| 579 | Ga0207708_10254547 | 3300026075 | Bacteria | 1416 |
| 580 | Ga0207708_10315477 | 3300026075 | Bacteria | 1274 |
| 581 | Ga0207708_10615791 | 3300026075 | Bacteria | 921 |
| 582 | Ga0207702_10010469 | 3300026078 | Bacteria | 7756 |
| 583 | Ga0207702_10038277 | 3300026078 | Bacteria | 4017 |
| 584 | Ga0207702_10113346 | 3300026078 | Bacteria | 2414 |
| 585 | Ga0207702_10310197 | 3300026078 | Bacteria | 1500 |
| 586 | Ga0207702_10613610 | 3300026078 | Bacteria | 1068 |
| 587 | Ga0207641_10165514 | 3300026088 | Bacteria | 2013 |
| 588 | Ga0207641_10616601 | 3300026088 | Bacteria | 1063 |
| 589 | Ga0207641_10835457 | 3300026088 | Bacteria | 912 |
| 590 | Ga0207648_10002393 | 3300026089 | Bacteria | 20202 |
| 591 | Ga0207648_10498149 | 3300026089 | Bacteria | 1114 |
| 592 | Ga0207676_10005110 | 3300026095 | Bacteria | 9289 |
| 593 | Ga0207676_10031240 | 3300026095 | Bacteria | 4004 |
| 594 | Ga0207676_10118340 | 3300026095 | Bacteria | 2229 |
| 595 | Ga0207676_11178009 | 3300026095 | Bacteria | 759 |
| 596 | Ga0207674_10058986 | 3300026116 | Bacteria | 3885 |
| 597 | Ga0207675_100001715 | 3300026118 | Bacteria | 21956 |
| 598 | Ga0207675_100003027 | 3300026118 | Bacteria | 16488 |
| 599 | Ga0207683_10001190 | 3300026121 | Bacteria | 23550 |
| 600 | Ga0207683_10013747 | 3300026121 | Bacteria | 6900 |
| 601 | Ga0207683_10028744 | 3300026121 | Bacteria | 4809 |
| 602 | Ga0207683_11406119 | 3300026121 | Bacteria | 645 |
| 603 | Ga0207698_10370313 | 3300026142 | Bacteria | 1359 |
| 604 | Ga0207698_10536497 | 3300026142 | Bacteria | 1144 |
| 605 | Ga0209982_1004172 | 3300027552 | Bacteria | 2066 |
| 606 | Ga0209970_1016555 | 3300027614 | Bacteria | 1230 |
| 607 | Ga0210002_1000122 | 3300027617 | Bacteria | 12125 |
| 608 | Ga0209983_1017838 | 3300027665 | Bacteria | 1471 |
| 609 | Ga0209813_10049551 | 3300027866 | Bacteria | 1308 |
| 610 | Ga0209813_10273215 | 3300027866 | Bacteria | 649 |
| 611 | Ga0209974_10000486 | 3300027876 | Bacteria | 13249 |
| 612 | Ga0207428_10000216 | 3300027907 | Bacteria | 79777 |
| 613 | Ga0207428_10019935 | 3300027907 | Bacteria | 5711 |
| 614 | Ga0207428_10447738 | 3300027907 | Bacteria | 942 |
| 615 | Ga0268266_10016607 | 3300028379 | Bacteria | 6291 |
| 616 | Ga0268266_10159361 | 3300028379 | Bacteria | 2040 |
| 617 | Ga0268265_10068406 | 3300028380 | Bacteria | 2753 |
| 618 | Ga0268265_10095849 | 3300028380 | Bacteria | 2383 |
| 619 | Ga0268265_10493627 | 3300028380 | Bacteria | 1152 |
| 620 | Ga0268265_11049010 | 3300028380 | Bacteria | 807 |
| 621 | Ga0268264_10009868 | 3300028381 | Bacteria | 7903 |
| 622 | Ga0268264_10044721 | 3300028381 | Bacteria | 3673 |
| 623 | Ga0268264_10535331 | 3300028381 | Bacteria | 1147 |
| 624 | Ga0268264_10758583 | 3300028381 | Bacteria | 967 |
| 625 | Ga0268264_10971759 | 3300028381 | Bacteria | 855 |
| 626 | Ga0265337_1003693 | 3300028556 | Bacteria | 6551 |
| 627 | Ga0265338_10134384 | 3300028800 | Bacteria | 1948 |
| 628 | Ga0265338_10239102 | 3300028800 | Bacteria | 1346 |
| 629 | Ga0265338_10361182 | 3300028800 | Bacteria | 1042 |
| 630 | Ga0265330_10020395 | 3300031235 | Bacteria | 3029 |
| 631 | Ga0265332_10058081 | 3300031238 | Bacteria | 1657 |
| 632 | Ga0265325_10000048 | 3300031241 | Bacteria | 82899 |
| 633 | Ga0265325_10001543 | 3300031241 | Bacteria | 16115 |
| 634 | Ga0265325_10006289 | 3300031241 | Bacteria | 7226 |
| 635 | Ga0265325_10042260 | 3300031241 | Bacteria | 2385 |
| 636 | Ga0265325_10056461 | 3300031241 | Bacteria | 2005 |
| 637 | Ga0265340_10241478 | 3300031247 | Bacteria | 806 |
| 638 | Ga0265340_10442588 | 3300031247 | Bacteria | 572 |
| 639 | Ga0265331_10009513 | 3300031250 | Bacteria | 5451 |
| 640 | Ga0265316_10192081 | 3300031344 | Bacteria | 1516 |
| 641 | Ga0265316_10392475 | 3300031344 | Bacteria | 1000 |
| 642 | Ga0265313_10000438 | 3300031595 | Bacteria | 44285 |
| 643 | Ga0265313_10025531 | 3300031595 | Bacteria | 3128 |
| 644 | Ga0265313_10056387 | 3300031595 | Bacteria | 1858 |
| 645 | Ga0316579_10020080 | 3300031691 | Bacteria | 2958 |
| 646 | Ga0307406_10625115 | 3300031901 | Bacteria | 891 |
| 647 | Ga0307409_101664104 | 3300031995 | Bacteria | 667 |
| 648 | Ga0307416_101271832 | 3300032002 | Bacteria | 842 |
| 649 | Ga0307416_102297468 | 3300032002 | Bacteria | 640 |
| 650 | Ga0307411_10359398 | 3300032005 | Bacteria | 1190 |
| 651 | Ga0373930_0012045 | 3300034816 | Bacteria | 1572 |
| 652 | Ga0373958_0004911 | 3300034819 | Bacteria | 2003 |
| 653 | Ga0373926_0021720 | 3300035083 | Bacteria | 2223 |
| 654 | Ga0373928_0004171 | 3300035084 | Bacteria | 2754 |
| 655 | Ga0373934_0111102 | 3300035086 | Bacteria | 1111 |
| 656 | Ga0373940_0001993 | 3300035088 | Bacteria | 3864 |
| 657 | Ga0373944_0019469 | 3300035089 | Bacteria | 1948 |
| 658 | Ga0373949_0027043 | 3300035090 | Bacteria | 1347 |
| 659 | Ga0373949_0040187 | 3300035090 | Bacteria | 1147 |
| 660 | Ga0373952_0026576 | 3300035092 | Bacteria | 1258 |
| 661 | Ga0373923_0001890 | 3300035111 | Bacteria | 6246 |
| 662 | Ga0373923_0035431 | 3300035111 | Bacteria | 2032 |
| 663 | Ga0373932_0003391 | 3300035112 | Bacteria | 3838 |
| 664 | Ga0373932_0093955 | 3300035112 | Bacteria | 967 |
| 665 | Ga0373936_0001798 | 3300035113 | Bacteria | 7886 |
| 666 | Ga0373936_0124188 | 3300035113 | Bacteria | 1105 |
| 667 | Ga0373939_0001329 | 3300035114 | Bacteria | 6003 |
| 668 | Ga0373939_0002892 | 3300035114 | Bacteria | 4035 |
| 669 | Ga0373945_0003540 | 3300035116 | Bacteria | 4917 |
| 670 | Ga0373954_0015360 | 3300035118 | Bacteria | 3423 |
| 671 | Ga0373954_0111502 | 3300035118 | Bacteria | 1323 |
| 672 | Ga0373954_0350883 | 3300035118 | Bacteria | 729 |
| 673 | Ga0373954_0532854 | 3300035118 | Bacteria | 582 |
| 674 | Ga0373956_0072775 | 3300035119 | Bacteria | 1570 |
| 675 | Ga0373956_0123625 | 3300035119 | Bacteria | 1209 |
| 676 | Ga0373957_0054574 | 3300035120 | Bacteria | 1535 |
| 677 | Ga0373960_0062962 | 3300035121 | Bacteria | 1129 |
| 678 | Ga0373960_0234755 | 3300035121 | Bacteria | 661 |
| 679 | Ga0373943_0005045 | 3300035170 | Bacteria | 5955 |
| 680 | Ga0373943_0304288 | 3300035170 | Bacteria | 906 |
| 681 | Ga0373946_0001530 | 3300035171 | Bacteria | 8040 |
| 682 | Ga0373946_0392247 | 3300035171 | Bacteria | 700 |
| 683 | Ga0373955_0036131 | 3300035172 | Bacteria | 2620 |
| 684 | Ga0373955_0095953 | 3300035172 | Bacteria | 1696 |
| 685 | Ga0373942_0015907 | 3300035207 | Bacteria | 1839 |
| 686 | Ga0373942_0026694 | 3300035207 | Bacteria | 1497 |
| 687 | Ga0373942_0066022 | 3300035207 | Bacteria | 1047 |
| 688 | Ga0373942_0372320 | 3300035207 | Bacteria | 508 |
| 689 | Ga0373961_0137393 | 3300035241 | Bacteria | 823 |
| 690 | Ga0373962_0001705 | 3300035242 | Bacteria | 5226 |
| 691 | Ga0373962_0033329 | 3300035242 | Bacteria | 1421 |
| 692 | Ga0373924_0028607 | 3300035410 | Bacteria | 2222 |
| 693 | Ga0373931_0046111 | 3300035691 | Bacteria | 2303 |
| 694 | Ga0373931_0115546 | 3300035691 | Bacteria | 1528 |
| 695 | Ga0373931_0609871 | 3300035691 | Bacteria | 714 |
| 696 | Ga0373935_0003239 | 3300035692 | Bacteria | 9407 |
| 697 | Ga0373935_0041202 | 3300035692 | Bacteria | 2901 |
| 698 | Ga0373935_0425498 | 3300035692 | Bacteria | 956 |
| 699 | Ga0373927_0008421 | 3300035695 | Bacteria | 6936 |
| 700 | Ga0373927_0032885 | 3300035695 | Bacteria | 3377 |
| 701 | Ga0373927_0289826 | 3300035695 | Bacteria | 1077 |
| 702 | Ga0373933_0113728 | 3300035724 | Bacteria | 1690 |
| 703 | Ga0373947_0008462 | 3300035725 | Bacteria | 5927 |
| 704 | Ga0373947_0011056 | 3300035725 | Bacteria | 5181 |
| 705 | Ga0373947_0047520 | 3300035725 | Bacteria | 2572 |
| 706 | Ga0373947_0133220 | 3300035725 | Bacteria | 1588 |
| 707 | Ga0373937_0048364 | 3300036401 | Bacteria | 3893 |
| 708 | Ga0373937_0272923 | 3300036401 | Bacteria | 1596 |
| 709 | Ga0316582_0316671 | 3300036647 | Bacteria | 1072 |
| 710 | Ga0373925_0002135 | 3300037068 | Bacteria | 16159 |
| 711 | Ga0373925_0095869 | 3300037068 | Bacteria | 2273 |
| 712 | Ga0373925_0108205 | 3300037068 | Bacteria | 2145 |
| 713 | Ga0373925_0708022 | 3300037068 | Bacteria | 830 |
| 714 | Ga0373925_1193336 | 3300037068 | Bacteria | 625 |
| 715 | Ga0395899_0009657 | 3300037312 | Bacteria | 7405 |
| 716 | Ga0395899_0387847 | 3300037312 | Bacteria | 927 |
| 717 | Ga0395898_0051585 | 3300037466 | Bacteria | 4022 |
| 718 | Ga0395898_1305619 | 3300037466 | Bacteria | 655 |
| 719 | Ga0316581_0153089 | 3300037588 | Bacteria | 711 |
| 720 | Ga0436364_0031906 | 3300037853 | Bacteria | 912 |
| 721 | Ga0395901_0099569 | 3300038443 | Bacteria | 3048 |
| 722 | Ga0395901_0187087 | 3300038443 | Bacteria | 2172 |
| 723 | Ga0436365_0566814 | 3300039437 | Bacteria | 956 |
| 724 | Ga0436365_1828125 | 3300039437 | Bacteria | 5509 |
| 725 | Ga0436361_0335157 | 3300039447 | Bacteria | 10389 |
| 726 | Ga0436363_1544399 | 3300039450 | Bacteria | 516 |
| 727 | Ga0436362_0568357 | 3300039453 | Bacteria | 662 |
| 728 | Ga0436362_0886180 | 3300039453 | Bacteria | 515 |
| 729 | Ga0439453_0000142 | 3300041408 | Bacteria | 6329 |
| 730 | Ga0439466_0160896 | 3300041411 | Bacteria | 687 |
| 731 | Ga0439441_017133 | 3300042001 | Bacteria | 1298 |
| 732 | Ga0439443_005846 | 3300042003 | Bacteria | 1661 |
| 733 | Ga0439462_0180204 | 3300042015 | Bacteria | 599 |
| 734 | Ga0439446_0142832 | 3300042156 | Bacteria | 783 |
| 735 | Ga0439435_0029912 | 3300042436 | Bacteria | 1473 |
| 736 | Ga0495617_027330 | 3300046452 | Bacteria | 1920 |
| 737 | Ga0495592_0001176 | 3300046454 | Bacteria | 18145 |
| 738 | Ga0495592_0018792 | 3300046454 | Bacteria | 5263 |
| 739 | Ga0495603_0426702 | 3300046455 | Bacteria | 759 |
| 740 | Ga0495629_0002326 | 3300046459 | Bacteria | 14645 |
| 741 | Ga0495629_0027088 | 3300046459 | Bacteria | 4071 |
| 742 | Ga0495629_0038860 | 3300046459 | Bacteria | 3351 |
| 743 | Ga0495629_0052288 | 3300046459 | Bacteria | 2858 |
| 744 | Ga0495641_0003224 | 3300046461 | Bacteria | 12382 |
| 745 | Ga0495651_0014804 | 3300046462 | Bacteria | 6032 |
| 746 | Ga0495651_0321825 | 3300046462 | Bacteria | 1031 |
| 747 | Ga0495653_0012022 | 3300046463 | Bacteria | 7066 |
| 748 | Ga0495653_0251071 | 3300046463 | Bacteria | 1174 |
| 749 | Ga0495653_0405216 | 3300046463 | Bacteria | 866 |
| 750 | Ga0495580_0020532 | 3300046472 | Bacteria | 4887 |
| 751 | Ga0495582_0012004 | 3300046473 | Bacteria | 4772 |
| 752 | Ga0495582_0032157 | 3300046473 | Bacteria | 2886 |
| 753 | Ga0495582_0077819 | 3300046473 | Bacteria | 1840 |
| 754 | Ga0495639_0007594 | 3300046475 | Bacteria | 4660 |
| 755 | Ga0495639_0514909 | 3300046475 | Bacteria | 611 |
| 756 | Ga0495662_0006908 | 3300046476 | Bacteria | 5637 |
| 757 | Ga0495662_0070535 | 3300046476 | Bacteria | 1693 |
| 758 | Ga0495664_0007982 | 3300046477 | Bacteria | 5893 |
| 759 | Ga0495664_0027048 | 3300046477 | Bacteria | 3343 |
| 760 | Ga0495664_0203578 | 3300046477 | Bacteria | 1199 |
| 761 | Ga0495584_0011617 | 3300046491 | Bacteria | 4511 |
| 762 | Ga0495584_0067390 | 3300046491 | Bacteria | 1799 |
| 763 | Ga0495584_0178697 | 3300046491 | Bacteria | 1079 |
| 764 | Ga0495584_0646540 | 3300046491 | Bacteria | 539 |
| 765 | Ga0495585_0038970 | 3300046492 | Bacteria | 2673 |
| 766 | Ga0495594_0031273 | 3300046499 | Bacteria | 2885 |
| 767 | Ga0495594_0065658 | 3300046499 | Bacteria | 2012 |
| 768 | Ga0495594_0169787 | 3300046499 | Bacteria | 1241 |
| 769 | Ga0495608_0702474 | 3300046511 | Bacteria | 602 |
| 770 | Ga0495616_0162135 | 3300046513 | Bacteria | 1005 |
| 771 | Ga0495618_0022415 | 3300046514 | Bacteria | 3900 |
| 772 | Ga0495618_0086239 | 3300046514 | Bacteria | 2007 |
| 773 | Ga0495628_0012601 | 3300046516 | Bacteria | 7125 |
| 774 | Ga0495628_0014768 | 3300046516 | Bacteria | 6536 |
| 775 | Ga0495631_0146871 | 3300046518 | Bacteria | 1012 |
| 776 | Ga0495637_0024298 | 3300046520 | Bacteria | 2742 |
| 777 | Ga0495637_0118637 | 3300046520 | Bacteria | 1020 |
| 778 | Ga0495644_0010451 | 3300046523 | Bacteria | 3577 |
| 779 | Ga0495663_0004223 | 3300046525 | Bacteria | 4055 |
| 780 | Ga0495666_0216948 | 3300046526 | Bacteria | 877 |
| 781 | Ga0495652_0013444 | 3300046529 | Bacteria | 7367 |
| 782 | Ga0495652_0090103 | 3300046529 | Bacteria | 2510 |
| 783 | Ga0495652_0117918 | 3300046529 | Bacteria | 2122 |
| 784 | Ga0495665_0006037 | 3300046531 | Bacteria | 6530 |
| 785 | Ga0495640_0237202 | 3300046533 | Bacteria | 1145 |
| 786 | Ga0495640_0461767 | 3300046533 | Bacteria | 775 |
| 787 | Ga0495586_0006303 | 3300046535 | Bacteria | 6337 |
| 788 | Ga0495587_0020363 | 3300046536 | Bacteria | 4096 |
| 789 | Ga0495598_0015646 | 3300046537 | Bacteria | 1919 |
| 790 | Ga0495609_0147907 | 3300046538 | Bacteria | 1000 |
| 791 | Ga0495621_0078562 | 3300046539 | Bacteria | 1227 |
| 792 | Ga0495645_0062076 | 3300046543 | Bacteria | 2707 |
| 793 | Ga0495645_0202497 | 3300046543 | Bacteria | 1345 |
| 794 | Ga0495622_0010562 | 3300046557 | Bacteria | 4262 |
| 795 | Ga0495633_0019514 | 3300046558 | Bacteria | 3428 |
| 796 | Ga0495667_0006887 | 3300046559 | Bacteria | 7719 |
| 797 | Ga0495667_0117346 | 3300046559 | Bacteria | 1719 |
| 798 | Ga0495667_0206919 | 3300046559 | Bacteria | 1255 |
| 799 | Ga0495656_0001344 | 3300046615 | Bacteria | 8020 |
| 800 | Ga0495656_0118206 | 3300046615 | Bacteria | 1248 |
| 801 | Ga0495634_0009991 | 3300046642 | Bacteria | 6971 |
| 802 | Ga0495634_0055078 | 3300046642 | Bacteria | 2660 |
| 803 | Ga0495611_0007418 | 3300046648 | Bacteria | 4658 |
| 804 | Ga0495635_0062421 | 3300046663 | Bacteria | 2559 |
| 805 | Ga0495635_0104544 | 3300046663 | Bacteria | 1935 |
| 806 | Ga0495635_0199435 | 3300046663 | Bacteria | 1357 |
| 807 | Ga0495659_0001817 | 3300046664 | Bacteria | 7080 |
| 808 | Ga0495588_0002846 | 3300046674 | Bacteria | 7447 |
| 809 | Ga0495657_0534861 | 3300046675 | Bacteria | 681 |
| 810 | Ga0495599_0010609 | 3300046678 | Bacteria | 5638 |
| 811 | Ga0495599_0020143 | 3300046678 | Bacteria | 4155 |
| 812 | Ga0495623_0050706 | 3300046679 | Bacteria | 2628 |
| 813 | Ga0495646_0009173 | 3300046680 | Bacteria | 6277 |
| 814 | Ga0495647_0001804 | 3300046681 | Bacteria | 6621 |
| 815 | Ga0495647_0082258 | 3300046681 | Bacteria | 1307 |
| 816 | Ga0495658_0006028 | 3300046683 | Bacteria | 5951 |
| 817 | Ga0495658_0086285 | 3300046683 | Bacteria | 1851 |
| 818 | Ga0495658_0092954 | 3300046683 | Bacteria | 1789 |
| 819 | Ga0495669_0073885 | 3300046684 | Bacteria | 1558 |
| 820 | Ga0495613_0093005 | 3300046689 | Bacteria | 2183 |
| 821 | Ga0495613_0300916 | 3300046689 | Bacteria | 1110 |
| 822 | Ga0495613_0425436 | 3300046689 | Bacteria | 903 |
| 823 | Ga0495624_0026834 | 3300046690 | Bacteria | 3773 |
| 824 | Ga0495624_0471941 | 3300046690 | Bacteria | 751 |
| 825 | Ga0495670_0005161 | 3300046691 | Bacteria | 6425 |
| 826 | Ga0495589_0404245 | 3300046794 | Bacteria | 627 |
| 827 | Ga0495600_0008802 | 3300046809 | Bacteria | 6216 |
| 828 | Ga0495600_0118383 | 3300046809 | Bacteria | 1723 |
| 829 | Ga0495600_0208072 | 3300046809 | Bacteria | 1254 |
| 830 | Ga0495581_0009356 | 3300047315 | Bacteria | 5669 |
| 831 | Ga0495581_0066511 | 3300047315 | Bacteria | 2084 |
| 832 | Ga0495604_0018521 | 3300047317 | Bacteria | 5578 |
| 833 | Ga0495674_0092176 | 3300047319 | Bacteria | 2587 |
| 834 | Ga0495674_0257428 | 3300047319 | Bacteria | 1435 |
| 835 | Ga0495676_0128194 | 3300047321 | Bacteria | 1835 |
| 836 | Ga0495676_0631197 | 3300047321 | Bacteria | 696 |
| 837 | Ga0495680_0008612 | 3300047322 | Bacteria | 9260 |
| 838 | Ga0495680_0026104 | 3300047322 | Bacteria | 4822 |
| 839 | Ga0495680_0082932 | 3300047322 | Bacteria | 2418 |
| 840 | Ga0495677_0252863 | 3300047445 | Bacteria | 689 |
| 841 | Ga0495684_0004924 | 3300047471 | Bacteria | 10427 |
| 842 | Ga0495684_0156524 | 3300047471 | Bacteria | 1702 |
| 843 | Ga0495684_0444221 | 3300047471 | Bacteria | 903 |
| 844 | Ga0495684_0615990 | 3300047471 | Bacteria | 730 |
| 845 | Ga0495593_0014850 | 3300047673 | Bacteria | 4424 |
| 846 | Ga0495593_0122505 | 3300047673 | Bacteria | 1323 |
| 847 | Ga0495593_0132206 | 3300047673 | Bacteria | 1266 |
| 848 | Ga0495602_0010978 | 3300048088 | Bacteria | 9383 |
| 849 | Ga0495614_0002942 | 3300048089 | Bacteria | 7587 |
| 850 | Ga0496100_0000800 | 3300048903 | Bacteria | 15030 |
| 851 | Ga0496100_0008731 | 3300048903 | Bacteria | 5661 |
| 852 | Ga0496100_0011005 | 3300048903 | Bacteria | 5132 |
| 853 | Ga0496100_0140634 | 3300048903 | Bacteria | 1710 |
| 854 | Ga0496101_0003969 | 3300048904 | Bacteria | 9257 |
| 855 | Ga0496101_0346252 | 3300048904 | Bacteria | 1167 |
| 856 | Ga0496101_0621133 | 3300048904 | Unclassified | 854 |
| 857 | Ga0496101_0669894 | 3300048904 | Bacteria | 819 |
| 858 | Ga0496101_1126837 | 3300048904 | Bacteria | 616 |
| 859 | Ga0496102_0009606 | 3300048905 | Bacteria | 8319 |
| 860 | Ga0496102_0029755 | 3300048905 | Bacteria | 4887 |
| 861 | Ga0496102_0032780 | 3300048905 | Bacteria | 4668 |
| 862 | Ga0496102_0046353 | 3300048905 | Bacteria | 3948 |
| 863 | Ga0496102_0068715 | 3300048905 | Bacteria | 3251 |
| 864 | Ga0496102_0451115 | 3300048905 | Bacteria | 1206 |
| 865 | Ga0496102_0633192 | 3300048905 | Bacteria | 993 |
| 866 | Ga0496103_0003651 | 3300048906 | Bacteria | 9370 |
| 867 | Ga0496103_0006551 | 3300048906 | Bacteria | 6947 |
| 868 | Ga0496103_0017979 | 3300048906 | Bacteria | 4237 |
| 869 | Ga0496103_0025178 | 3300048906 | Bacteria | 3595 |
| 870 | Ga0496103_0031975 | 3300048906 | Bacteria | 3209 |
| 871 | Ga0496103_0043635 | 3300048906 | Bacteria | 2761 |
| 872 | Ga0496103_0258265 | 3300048906 | Bacteria | 1121 |
| 873 | Ga0496103_0348092 | 3300048906 | Unclassified | 953 |
| 874 | Ga0496104_0000196 | 3300048907 | Bacteria | 53901 |
| 875 | Ga0496104_0000495 | 3300048907 | Bacteria | 34041 |
| 876 | Ga0496104_0001900 | 3300048907 | Bacteria | 18094 |
| 877 | Ga0496104_0003411 | 3300048907 | Bacteria | 13715 |
| 878 | Ga0496104_0061470 | 3300048907 | Bacteria | 3561 |
| 879 | Ga0496104_0069936 | 3300048907 | Bacteria | 3336 |
| 880 | Ga0496104_0145276 | 3300048907 | Bacteria | 2278 |
| 881 | Ga0496104_0149269 | 3300048907 | Bacteria | 2244 |
| 882 | Ga0496104_0178276 | 3300048907 | Bacteria | 2035 |
| 883 | Ga0496104_0345947 | 3300048907 | Bacteria | 1399 |
| 884 | Ga0496104_1805782 | 3300048907 | Bacteria | 513 |
| 885 | Ga0496105_0004873 | 3300048908 | Bacteria | 10137 |
| 886 | Ga0496105_0005167 | 3300048908 | Bacteria | 9895 |
| 887 | Ga0496105_0029068 | 3300048908 | Bacteria | 4524 |
| 888 | Ga0496105_0091794 | 3300048908 | Bacteria | 2507 |
| 889 | Ga0496105_0273851 | 3300048908 | Bacteria | 1362 |
| 890 | Ga0496105_0427997 | 3300048908 | Bacteria | 1047 |
| 891 | Ga0496105_0458298 | 3300048908 | Bacteria | 1005 |
| 892 | Ga0496106_0001635 | 3300048909 | Bacteria | 16815 |
| 893 | Ga0496106_0002852 | 3300048909 | Bacteria | 12840 |
| 894 | Ga0496106_0024841 | 3300048909 | Bacteria | 4455 |
| 895 | Ga0496106_0060488 | 3300048909 | Bacteria | 2871 |
| 896 | Ga0496106_0127514 | 3300048909 | Bacteria | 1993 |
| 897 | Ga0496106_0143308 | 3300048909 | Bacteria | 1880 |
| 898 | Ga0496106_0179026 | 3300048909 | Bacteria | 1682 |
| 899 | Ga0496106_0241091 | 3300048909 | Bacteria | 1445 |
| 900 | Ga0496107_0000869 | 3300048910 | Bacteria | 17776 |
| 901 | Ga0496107_0012844 | 3300048910 | Bacteria | 5852 |
| 902 | Ga0496107_0031992 | 3300048910 | Bacteria | 3757 |
| 903 | Ga0496107_0043706 | 3300048910 | Bacteria | 3219 |
| 904 | Ga0496107_0154684 | 3300048910 | Bacteria | 1697 |
| 905 | Ga0496107_0182237 | 3300048910 | Bacteria | 1559 |
| 906 | Ga0496108_0001103 | 3300048911 | Bacteria | 21100 |
| 907 | Ga0496108_0008566 | 3300048911 | Bacteria | 8292 |
| 908 | Ga0496108_0043798 | 3300048911 | Bacteria | 3738 |
| 909 | Ga0496108_0047169 | 3300048911 | Bacteria | 3601 |
| 910 | Ga0496108_0069289 | 3300048911 | Bacteria | 2976 |
| 911 | Ga0496108_0105275 | 3300048911 | Bacteria | 2408 |
| 912 | Ga0496108_0154898 | 3300048911 | Bacteria | 1978 |
| 913 | Ga0496108_0335043 | 3300048911 | Bacteria | 1319 |
| 914 | Ga0496108_0667827 | 3300048911 | Bacteria | 903 |
| 915 | Ga0496109_0001554 | 3300048912 | Bacteria | 19107 |
| 916 | Ga0496109_0003899 | 3300048912 | Bacteria | 12464 |
| 917 | Ga0496109_0008494 | 3300048912 | Bacteria | 8730 |
| 918 | Ga0496109_0037839 | 3300048912 | Bacteria | 4360 |
| 919 | Ga0496109_0112776 | 3300048912 | Bacteria | 2528 |
| 920 | Ga0496109_0118317 | 3300048912 | Bacteria | 2466 |
| 921 | Ga0496109_0248335 | 3300048912 | Bacteria | 1675 |
| 922 | Ga0496109_0497534 | 3300048912 | Bacteria | 1151 |
| 923 | Ga0496109_0529933 | 3300048912 | Bacteria | 1111 |
| 924 | Ga0496110_0015739 | 3300048913 | Bacteria | 6303 |
| 925 | Ga0496110_0019989 | 3300048913 | Bacteria | 5645 |
| 926 | Ga0496110_0022834 | 3300048913 | Bacteria | 5315 |
| 927 | Ga0496110_0044797 | 3300048913 | Bacteria | 3864 |
| 928 | Ga0496110_0072383 | 3300048913 | Bacteria | 3058 |
| 929 | Ga0496110_0084821 | 3300048913 | Bacteria | 2827 |
| 930 | Ga0496110_0165503 | 3300048913 | Bacteria | 2005 |
| 931 | Ga0496110_0234794 | 3300048913 | Bacteria | 1668 |
| 932 | Ga0496110_0325880 | 3300048913 | Bacteria | 1399 |
| 933 | Ga0496110_0782426 | 3300048913 | Bacteria | 858 |
| 934 | Ga0496111_0010303 | 3300048914 | Bacteria | 6264 |
| 935 | Ga0496111_0018262 | 3300048914 | Bacteria | 4856 |
| 936 | Ga0496111_0035114 | 3300048914 | Bacteria | 3582 |
| 937 | Ga0496111_0125823 | 3300048914 | Bacteria | 1894 |
| 938 | Ga0496111_0236609 | 3300048914 | Bacteria | 1356 |
| 939 | Ga0496111_0254702 | 3300048914 | Bacteria | 1302 |
| 940 | Ga0496112_0003337 | 3300048915 | Bacteria | 13247 |
| 941 | Ga0496112_0009038 | 3300048915 | Bacteria | 8948 |
| 942 | Ga0496112_0085451 | 3300048915 | Bacteria | 3121 |
| 943 | Ga0496112_0101787 | 3300048915 | Bacteria | 2842 |
| 944 | Ga0496112_0128268 | 3300048915 | Bacteria | 2507 |
| 945 | Ga0496112_0158741 | 3300048915 | Bacteria | 2228 |
| 946 | Ga0496112_0274241 | 3300048915 | Bacteria | 1634 |
| 947 | Ga0496112_0905917 | 3300048915 | Bacteria | 804 |
| 948 | Ga0496112_0942505 | 3300048915 | Bacteria | 784 |
| 949 | Ga0496112_0978126 | 3300048915 | Bacteria | 766 |
| 950 | Ga0496112_0993100 | 3300048915 | Bacteria | 759 |
| 951 | Ga0496113_0000227 | 3300048916 | Bacteria | 26407 |
| 952 | Ga0496113_0007502 | 3300048916 | Bacteria | 7027 |
| 953 | Ga0496113_0013393 | 3300048916 | Bacteria | 5554 |
| 954 | Ga0496113_0015368 | 3300048916 | Bacteria | 5259 |
| 955 | Ga0496113_0041577 | 3300048916 | Bacteria | 3392 |
| 956 | Ga0496113_0345871 | 3300048916 | Bacteria | 1193 |
| 957 | Ga0496113_0508090 | 3300048916 | Bacteria | 967 |
| 958 | Ga0496114_0001741 | 3300048917 | Bacteria | 16526 |
| 959 | Ga0496114_0012467 | 3300048917 | Bacteria | 6805 |
| 960 | Ga0496114_0049124 | 3300048917 | Bacteria | 3509 |
| 961 | Ga0496114_0085665 | 3300048917 | Bacteria | 2669 |
| 962 | Ga0496114_0091782 | 3300048917 | Bacteria | 2580 |
| 963 | Ga0496114_0519271 | 3300048917 | Bacteria | 1053 |
| 964 | Ga0496114_1065326 | 3300048917 | Bacteria | 693 |
| 965 | Ga0496115_0032793 | 3300048918 | Bacteria | 4099 |
| 966 | Ga0496115_0034046 | 3300048918 | Bacteria | 4026 |
| 967 | Ga0496115_0034934 | 3300048918 | Bacteria | 3974 |
| 968 | Ga0496115_0178224 | 3300048918 | Bacteria | 1757 |
| 969 | Ga0496115_0254693 | 3300048918 | Bacteria | 1444 |
| 970 | Ga0496115_0280790 | 3300048918 | Bacteria | 1367 |
| 971 | Ga0496115_0287719 | 3300048918 | Bacteria | 1348 |
| 972 | Ga0496115_0776740 | 3300048918 | Bacteria | 747 |
| 973 | Ga0496125_0426417 | 3300048928 | Bacteria | 767 |
| 974 | Ga0501031_0013691 | 3300049568 | Bacteria | 5285 |
| 975 | Ga0501031_0141577 | 3300049568 | Bacteria | 1572 |
| 976 | Ga0501032_0019995 | 3300049569 | Bacteria | 4671 |
| 977 | Ga0501032_0024985 | 3300049569 | Bacteria | 4121 |
| 978 | Ga0501032_0035784 | 3300049569 | Bacteria | 3393 |
| 979 | Ga0501032_0086656 | 3300049569 | Bacteria | 2081 |
| 980 | Ga0501033_0006958 | 3300049570 | Bacteria | 8831 |
| 981 | Ga0501033_0008378 | 3300049570 | Bacteria | 8007 |
| 982 | Ga0501033_0041258 | 3300049570 | Bacteria | 3444 |
| 983 | Ga0501033_0307675 | 3300049570 | Bacteria | 1115 |
| 984 | Ga0501033_0920808 | 3300049570 | Bacteria | 587 |
| 985 | Ga0501034_0001401 | 3300049571 | Bacteria | 32406 |
| 986 | Ga0501034_0056561 | 3300049571 | Bacteria | 3947 |
| 987 | Ga0501034_0085870 | 3300049571 | Bacteria | 3148 |
| 988 | Ga0501034_0089853 | 3300049571 | Bacteria | 3069 |
| 989 | Ga0501034_0190194 | 3300049571 | Bacteria | 2015 |
| 990 | Ga0501034_0210555 | 3300049571 | Bacteria | 1899 |
| 991 | Ga0501034_0373529 | 3300049571 | Bacteria | 1352 |
| 992 | Ga0501036_0000164 | 3300049572 | Bacteria | 43588 |
| 993 | Ga0501036_0018152 | 3300049572 | Bacteria | 5891 |
| 994 | Ga0501036_0041476 | 3300049572 | Bacteria | 3894 |
| 995 | Ga0501036_0565933 | 3300049572 | Bacteria | 944 |
| 996 | Ga0501037_0007497 | 3300049573 | Bacteria | 7986 |
| 997 | Ga0501037_0010040 | 3300049573 | Bacteria | 6945 |
| 998 | Ga0501037_0011305 | 3300049573 | Bacteria | 6570 |
| 999 | Ga0501037_0073874 | 3300049573 | Bacteria | 2479 |
| 1000 | Ga0501037_0235422 | 3300049573 | Bacteria | 1285 |
| 1001 | Ga0501038_0003058 | 3300049574 | Bacteria | 15602 |
| 1002 | Ga0501038_0030276 | 3300049574 | Bacteria | 4790 |
| 1003 | Ga0501038_0043390 | 3300049574 | Bacteria | 3910 |
| 1004 | Ga0501038_0113595 | 3300049574 | Bacteria | 2241 |
| 1005 | Ga0501038_0157122 | 3300049574 | Bacteria | 1851 |
| 1006 | Ga0501038_0269031 | 3300049574 | Bacteria | 1344 |
| 1007 | Ga0501038_0407011 | 3300049574 | Bacteria | 1052 |
| 1008 | Ga0501038_0562182 | 3300049574 | Bacteria | 866 |
| 1009 | Ga0501038_1060019 | 3300049574 | Bacteria | 593 |
| 1010 | Ga0501039_0022121 | 3300049575 | Bacteria | 4879 |
| 1011 | Ga0501039_0041250 | 3300049575 | Bacteria | 3564 |
| 1012 | Ga0501039_0262623 | 3300049575 | Bacteria | 1357 |
| 1013 | Ga0501040_0190468 | 3300049576 | Bacteria | 1455 |
| 1014 | Ga0501040_0381605 | 3300049576 | Bacteria | 1011 |
| 1015 | Ga0501042_0015292 | 3300049578 | Bacteria | 5253 |
| 1016 | Ga0501043_0001255 | 3300049579 | Bacteria | 22361 |
| 1017 | Ga0501043_0014567 | 3300049579 | Bacteria | 6157 |
| 1018 | Ga0501043_0050128 | 3300049579 | Bacteria | 3282 |
| 1019 | Ga0501043_0109996 | 3300049579 | Bacteria | 2164 |
| 1020 | Ga0501046_0119784 | 3300049580 | Bacteria | 2003 |
| 1021 | Ga0501046_0778727 | 3300049580 | Bacteria | 671 |
| 1022 | Ga0501046_1139079 | 3300049580 | Bacteria | 538 |
| 1023 | Ga0501047_0003578 | 3300049581 | Bacteria | 14663 |
| 1024 | Ga0501047_0062444 | 3300049581 | Bacteria | 3593 |
| 1025 | Ga0501047_0187286 | 3300049581 | Bacteria | 1934 |
| 1026 | Ga0501047_0729625 | 3300049581 | Bacteria | 807 |
| 1027 | Ga0501047_0838593 | 3300049581 | Bacteria | 733 |
| 1028 | Ga0501048_0025760 | 3300049582 | Bacteria | 4284 |
| 1029 | Ga0501048_0158606 | 3300049582 | Bacteria | 1601 |
| 1030 | Ga0501048_0341218 | 3300049582 | Bacteria | 1068 |
| 1031 | Ga0501068_0187277 | 3300049584 | Bacteria | 1310 |
| 1032 | Ga0501069_0012501 | 3300049585 | Bacteria | 4516 |
| 1033 | Ga0501069_0071517 | 3300049585 | Bacteria | 1944 |
| 1034 | Ga0501070_0012006 | 3300049586 | Bacteria | 7311 |
| 1035 | Ga0501070_0012272 | 3300049586 | Bacteria | 7231 |
| 1036 | Ga0501070_0016597 | 3300049586 | Bacteria | 6185 |
| 1037 | Ga0501070_0117666 | 3300049586 | Bacteria | 2195 |
| 1038 | Ga0501070_0146184 | 3300049586 | Bacteria | 1951 |
| 1039 | Ga0501071_0116255 | 3300049587 | Bacteria | 1980 |
| 1040 | Ga0501071_0404931 | 3300049587 | Bacteria | 1042 |
| 1041 | Ga0501072_0013044 | 3300049588 | Bacteria | 6361 |
| 1042 | Ga0501072_0061603 | 3300049588 | Bacteria | 2960 |
| 1043 | Ga0501072_0462933 | 3300049588 | Bacteria | 1004 |
| 1044 | Ga0501073_0021522 | 3300049589 | Bacteria | 4649 |
| 1045 | Ga0501073_0239645 | 3300049589 | Bacteria | 1253 |
| 1046 | Ga0501073_0379336 | 3300049589 | Bacteria | 977 |
| 1047 | Ga0501074_0019707 | 3300049590 | Bacteria | 4897 |
| 1048 | Ga0501075_0041013 | 3300049591 | Bacteria | 3469 |
| 1049 | Ga0501076_0020689 | 3300049592 | Bacteria | 5039 |
| 1050 | Ga0501076_0029728 | 3300049592 | Bacteria | 4251 |
| 1051 | Ga0501076_0135732 | 3300049592 | Bacteria | 1997 |
| 1052 | Ga0501076_0547667 | 3300049592 | Bacteria | 954 |
| 1053 | Ga0501077_0134249 | 3300049593 | Bacteria | 1569 |
| 1054 | Ga0501077_0324498 | 3300049593 | Bacteria | 981 |
| 1055 | Ga0501079_0346552 | 3300049741 | Bacteria | 1164 |
| 1056 | Ga0501079_0429266 | 3300049741 | Bacteria | 1037 |
| 1057 | Ga0501079_0438785 | 3300049741 | Bacteria | 1025 |
| 1058 | Ga0501079_0504317 | 3300049741 | Bacteria | 951 |
| 1059 | Ga0501080_0001467 | 3300049742 | Bacteria | 19851 |
| 1060 | Ga0501080_0045146 | 3300049742 | Bacteria | 4102 |
| 1061 | Ga0501080_0056160 | 3300049742 | Bacteria | 3667 |
| 1062 | Ga0501080_0137449 | 3300049742 | Bacteria | 2261 |
| 1063 | Ga0501081_0094108 | 3300049743 | Bacteria | 2111 |
| 1064 | Ga0501081_0576892 | 3300049743 | Bacteria | 841 |
| 1065 | Ga0501083_0009826 | 3300049744 | Bacteria | 6754 |
| 1066 | Ga0501083_0289722 | 3300049744 | Bacteria | 1065 |
| 1067 | Ga0501083_0642114 | 3300049744 | Bacteria | 690 |
| 1068 | Ga0501083_0797846 | 3300049744 | Bacteria | 614 |
| 1069 | Ga0501035_0000995 | 3300049822 | Bacteria | 29963 |
| 1070 | Ga0501035_0052529 | 3300049822 | Bacteria | 3646 |
| 1071 | Ga0501035_0398300 | 3300049822 | Bacteria | 1146 |
| 1072 | Ga0501035_0526792 | 3300049822 | Bacteria | 970 |
| 1073 | Ga0501044_0000822 | 3300049823 | Bacteria | 37410 |
| 1074 | Ga0501044_0002823 | 3300049823 | Bacteria | 19779 |
| 1075 | Ga0501044_0038058 | 3300049823 | Bacteria | 5023 |
| 1076 | Ga0501044_0050872 | 3300049823 | Bacteria | 4274 |
| 1077 | Ga0501044_0106489 | 3300049823 | Bacteria | 2816 |
| 1078 | Ga0501044_0158444 | 3300049823 | Bacteria | 2242 |
| 1079 | Ga0501044_0706984 | 3300049823 | Bacteria | 893 |
| 1080 | Ga0501044_0880801 | 3300049823 | Bacteria | 771 |
| 1081 | Ga0501044_1142563 | 3300049823 | Bacteria | 647 |
| 1082 | nmdc:mga03683_170518_c1 | 3300050489 | Bacteria | 989 |
| 1083 | nmdc:mga03683_222132_c1 | 3300050489 | Bacteria | 872 |
| 1084 | nmdc:mga03n38_32116_c1 | 3300050490 | Bacteria | 2221 |
| 1085 | nmdc:mga03n38_71569_c1 | 3300050490 | Bacteria | 1606 |
| 1086 | nmdc:mga00v17_186027_c1 | 3300050491 | Bacteria | 1341 |
| 1087 | nmdc:mga00v17_57550_c1 | 3300050491 | Bacteria | 2379 |
| 1088 | nmdc:mga00v17_6222_c1 | 3300050491 | Bacteria | 6329 |
| 1089 | nmdc:mga0yw44_160891_c1 | 3300050492 | Bacteria | 1470 |
| 1090 | nmdc:mga0yw44_199341_c1 | 3300050492 | Bacteria | 1322 |
| 1091 | nmdc:mga0yw44_208031_c1 | 3300050492 | Bacteria | 1294 |
| 1092 | nmdc:mga0k408_157063_c2 | 3300050493 | Bacteria | 976 |
| 1093 | nmdc:mga06z11_11724_c1 | 3300050494 | Bacteria | 3789 |
| 1094 | nmdc:mga06z11_141958_c1 | 3300050494 | Bacteria | 1358 |
| 1095 | nmdc:mga06z11_20872_c1 | 3300050494 | Bacteria | 3034 |
| 1096 | nmdc:mga06z11_238864_c1 | 3300050494 | Bacteria | 1067 |
| 1097 | nmdc:mga04h51_28289_c1 | 3300050495 | Bacteria | 1748 |
| 1098 | nmdc:mga04h51_305837_c1 | 3300050495 | Bacteria | 649 |
| 1099 | nmdc:mga05p37_109548_c1 | 3300050507 | Bacteria | 3397 |
| 1100 | nmdc:mga05p37_25723_c1 | 3300050507 | Bacteria | 7158 |
| 1101 | nmdc:mga05p37_302597_c1 | 3300050507 | Bacteria | 1899 |
| 1102 | nmdc:mga05p37_6013_c1 | 3300050507 | Bacteria | 14287 |
| 1103 | nmdc:mga09592_2783_c1 | 3300050508 | Bacteria | 14165 |
| 1104 | nmdc:mga0qj67_1876_c1 | 3300050509 | Bacteria | 14908 |
| 1105 | nmdc:mga0qj67_198406_c1 | 3300050509 | Bacteria | 1631 |
| 1106 | nmdc:mga06r32_22491_c1 | 3300050510 | Bacteria | 5829 |
| 1107 | nmdc:mga06r32_316558_c1 | 3300050510 | Bacteria | 1546 |
| 1108 | nmdc:mga06r32_377715_c1 | 3300050510 | Bacteria | 1400 |
| 1109 | nmdc:mga08y16_12040_c1 | 3300050511 | Bacteria | 9088 |
| 1110 | nmdc:mga08y16_1705303_c1 | 3300050511 | Bacteria | 585 |
| 1111 | nmdc:mga08y16_194584_c1 | 3300050511 | Bacteria | 2102 |
| 1112 | nmdc:mga08y16_245924_c1 | 3300050511 | Bacteria | 1849 |
| 1113 | nmdc:mga08y16_565194_c1 | 3300050511 | Bacteria | 1150 |
| 1114 | nmdc:mga08y16_995466_c1 | 3300050511 | Bacteria | 818 |
| 1115 | nmdc:mga0n895_1049952_c1 | 3300050512 | Bacteria | 794 |
| 1116 | nmdc:mga0n895_124072_c1 | 3300050512 | Bacteria | 2605 |
| 1117 | nmdc:mga0n895_1539_c1 | 3300050512 | Bacteria | 17321 |
| 1118 | nmdc:mga0n895_254629_c1 | 3300050512 | Bacteria | 1781 |
| 1119 | nmdc:mga0n895_436410_c1 | 3300050512 | Bacteria | 1323 |
| 1120 | nmdc:mga0n895_51388_c1 | 3300050512 | Bacteria | 4044 |
| 1121 | nmdc:mga0n895_602819_c1 | 3300050512 | Bacteria | 1100 |
| 1122 | nmdc:mga0n895_97038_c1 | 3300050512 | Bacteria | 2953 |
| 1123 | nmdc:mga0rr50_102296_c1 | 3300050513 | Bacteria | 2253 |
| 1124 | nmdc:mga0rr50_1559836_c1 | 3300050513 | Bacteria | 558 |
| 1125 | nmdc:mga0rr50_164488_c1 | 3300050513 | Bacteria | 1803 |
| 1126 | nmdc:mga0rr50_321712_c1 | 3300050513 | Unclassified | 1297 |
| 1127 | nmdc:mga0rr50_6117_c1 | 3300050513 | Bacteria | 7280 |
| 1128 | nmdc:mga0rr50_735358_c1 | 3300050513 | Bacteria | 842 |
| 1129 | nmdc:mga08x19_1035964_c1 | 3300050514 | Bacteria | 583 |
| 1130 | nmdc:mga08x19_831422_c1 | 3300050514 | Bacteria | 656 |
| 1131 | nmdc:mga0a205_34744_c1 | 3300050515 | Bacteria | 4838 |
| 1132 | nmdc:mga0sz30_456281_c1 | 3300050516 | Bacteria | 574 |
| 1133 | Ga0495601_0000456 | 3300053077 | Bacteria | 21456 |
| 1134 | Ga0495601_0009329 | 3300053077 | Bacteria | 5801 |
| 1135 | Ga0495601_0040185 | 3300053077 | Bacteria | 2929 |
| 1136 | Ga0495601_0056685 | 3300053077 | Bacteria | 2481 |
| 1137 | Ga0495612_0005524 | 3300053078 | Bacteria | 5226 |
| 1138 | Ga0495612_0007164 | 3300053078 | Bacteria | 4564 |
| 1139 | Ga0495612_0012818 | 3300053078 | Bacteria | 3379 |
| 1140 | Ga0495595_0001524 | 3300053084 | Bacteria | 9029 |
| 1141 | Ga0495595_0072824 | 3300053084 | Bacteria | 1626 |
| 1142 | Ga0495595_0086040 | 3300053084 | Bacteria | 1503 |
| 1143 | Ga0495595_0186388 | 3300053084 | Bacteria | 1030 |
| 1144 | Ga0495619_0000551 | 3300053085 | Bacteria | 24828 |
| 1145 | Ga0495619_0002087 | 3300053085 | Bacteria | 13282 |
| 1146 | Ga0495619_0016823 | 3300053085 | Bacteria | 4630 |
| 1147 | Ga0495619_0025754 | 3300053085 | Bacteria | 3780 |
| 1148 | Ga0495619_0109308 | 3300053085 | Bacteria | 1888 |
| 1149 | Ga0495619_0138522 | 3300053085 | Bacteria | 1674 |
| 1150 | Ga0495619_0343311 | 3300053085 | Bacteria | 1033 |
| 1151 | Ga0500578_0544560 | 3300053086 | Bacteria | 646 |
| 1152 | Ga0500644_0108792 | 3300053088 | Bacteria | 1064 |
| 1153 | Ga0500651_0041727 | 3300053093 | Bacteria | 2892 |
| 1154 | Ga0500566_0214035 | 3300053094 | Bacteria | 963 |
| 1155 | Ga0500641_0032101 | 3300053096 | Bacteria | 2075 |
| 1156 | Ga0500650_0055336 | 3300053098 | Bacteria | 1848 |
| 1157 | Ga0500593_243260 | 3300053117 | Bacteria | 615 |
| 1158 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1159 | Ga0500645_017683 | 3300053730 | Bacteria | 2232 |
| 1160 | Ga0501084_0251137 | 3300054114 | Bacteria | 1493 |
| 1161 | Ga0501082_0101011 | 3300060353 | Bacteria | 2495 |
| 1162 | Ga0501082_0147554 | 3300060353 | Bacteria | 2042 |
| 1163 | Ga0501082_0179635 | 3300060353 | Bacteria | 1840 |
| 1164 | Ga0501082_0286220 | 3300060353 | Bacteria | 1435 |
| 1165 | Ga0530510_0353849 | 3300061734 | Bacteria | 1103 |
| 1166 | Ga0530510_0575919 | 3300061734 | Bacteria | 856 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026095 | Ga0207676_11178009 | Ga0207676_111780092 | 126 |
| 2 | 3300035118 | Ga0373954_0532854 | Ga0373954_0532854_143_571 | 127 |
| 3 | 3300002073 | JGI24745J21846_1043856 | JGI24745J21846_10438562 | 132 |
| 4 | 3300005518 | Ga0070699_101303952 | Ga0070699_1013039521 | 133 |
| 5 | iso_pu_bacteria | 2643221547 | 2643755924 | 136 |
| 6 | 3300003316 | rootH1_10035081 | rootH1_100350814 | 137 |
| 7 | 3300039450 | Ga0436363_1544399 | Ga0436363_1544399_62_478 | 138 |
| 8 | 3300002459 | JGI24751J29686_10025837 | JGI24751J29686_100258372 | 139 |
| 9 | 3300005937 | Ga0081455_10014661 | Ga0081455_1001466110 | 139 |
| 10 | 3300005937 | Ga0081455_10295044 | Ga0081455_102950441 | 139 |
| 11 | 3300005981 | Ga0081538_10041292 | Ga0081538_100412923 | 139 |
| 12 | 3300002239 | JGI24034J26672_10006378 | JGI24034J26672_100063783 | 140 |
| 13 | 3300002244 | JGI24742J22300_10001841 | JGI24742J22300_100018414 | 140 |
| 14 | 3300005338 | Ga0068868_100087725 | Ga0068868_1000877253 | 140 |
| 15 | 3300005339 | Ga0070660_100369679 | Ga0070660_1003696792 | 140 |
| 16 | 3300005340 | Ga0070689_100578161 | Ga0070689_1005781612 | 140 |
| 17 | 3300005347 | Ga0070668_100038116 | Ga0070668_1000381164 | 140 |
| 18 | 3300005355 | Ga0070671_100227972 | Ga0070671_1002279723 | 140 |
| 19 | 3300005367 | Ga0070667_100267605 | Ga0070667_1002676052 | 140 |
| 20 | 3300005435 | Ga0070714_100103058 | Ga0070714_1001030581 | 140 |
| 21 | 3300005436 | Ga0070713_100191291 | Ga0070713_1001912913 | 140 |
| 22 | 3300005436 | Ga0070713_100572504 | Ga0070713_1005725042 | 140 |
| 23 | 3300005439 | Ga0070711_100140164 | Ga0070711_1001401642 | 140 |
| 24 | 3300005441 | Ga0070700_100027984 | Ga0070700_1000279844 | 140 |
| 25 | 3300005444 | Ga0070694_100098667 | Ga0070694_1000986673 | 140 |
| 26 | 3300005455 | Ga0070663_100101851 | Ga0070663_1001018513 | 140 |
| 27 | 3300005466 | Ga0070685_11608589 | Ga0070685_116085891 | 140 |
| 28 | 3300005471 | Ga0070698_100524120 | Ga0070698_1005241203 | 140 |
| 29 | 3300005518 | Ga0070699_100731683 | Ga0070699_1007316832 | 140 |
| 30 | 3300005530 | Ga0070679_101895330 | Ga0070679_1018953301 | 140 |
| 31 | 3300005535 | Ga0070684_100054756 | Ga0070684_1000547564 | 140 |
| 32 | 3300005536 | Ga0070697_100036768 | Ga0070697_1000367682 | 140 |
| 33 | 3300005536 | Ga0070697_100370943 | Ga0070697_1003709433 | 140 |
| 34 | 3300005544 | Ga0070686_100034178 | Ga0070686_1000341784 | 140 |
| 35 | 3300005548 | Ga0070665_100326964 | Ga0070665_1003269643 | 140 |
| 36 | 3300005549 | Ga0070704_100087525 | Ga0070704_1000875253 | 140 |
| 37 | 3300005564 | Ga0070664_100649343 | Ga0070664_1006493432 | 140 |
| 38 | 3300005614 | Ga0068856_101703675 | Ga0068856_1017036752 | 140 |
| 39 | 3300005615 | Ga0070702_100557270 | Ga0070702_1005572702 | 140 |
| 40 | 3300005616 | Ga0068852_100067469 | Ga0068852_1000674693 | 140 |
| 41 | 3300005617 | Ga0068859_100048040 | Ga0068859_1000480403 | 140 |
| 42 | 3300005617 | Ga0068859_100752815 | Ga0068859_1007528152 | 140 |
| 43 | 3300005618 | Ga0068864_100040226 | Ga0068864_1000402265 | 140 |
| 44 | 3300005618 | Ga0068864_100366800 | Ga0068864_1003668001 | 140 |
| 45 | 3300005719 | Ga0068861_100149423 | Ga0068861_1001494233 | 140 |
| 46 | 3300005834 | Ga0068851_10400670 | Ga0068851_104006701 | 140 |
| 47 | 3300005841 | Ga0068863_101478528 | Ga0068863_1014785281 | 140 |
| 48 | 3300005843 | Ga0068860_100047742 | Ga0068860_1000477424 | 140 |
| 49 | 3300005844 | Ga0068862_101558907 | Ga0068862_1015589071 | 140 |
| 50 | 3300005937 | Ga0081455_10041818 | Ga0081455_100418182 | 140 |
| 51 | 3300005937 | Ga0081455_10116763 | Ga0081455_101167633 | 140 |
| 52 | 3300006028 | Ga0070717_10150167 | Ga0070717_101501674 | 140 |
| 53 | 3300006028 | Ga0070717_10263454 | Ga0070717_102634542 | 140 |
| 54 | 3300006175 | Ga0070712_100055457 | Ga0070712_1000554572 | 140 |
| 55 | 3300006175 | Ga0070712_100275385 | Ga0070712_1002753851 | 140 |
| 56 | 3300006237 | Ga0097621_100045558 | Ga0097621_1000455584 | 140 |
| 57 | 3300006358 | Ga0068871_100083567 | Ga0068871_1000835672 | 140 |
| 58 | 3300006844 | Ga0075428_100017138 | Ga0075428_1000171389 | 140 |
| 59 | 3300006844 | Ga0075428_100575571 | Ga0075428_1005755712 | 140 |
| 60 | 3300006846 | Ga0075430_100234758 | Ga0075430_1002347582 | 140 |
| 61 | 3300006847 | Ga0075431_100005477 | Ga0075431_1000054774 | 140 |
| 62 | 3300006847 | Ga0075431_100349390 | Ga0075431_1003493902 | 140 |
| 63 | 3300006871 | Ga0075434_100043832 | Ga0075434_1000438328 | 140 |
| 64 | 3300006871 | Ga0075434_100552116 | Ga0075434_1005521162 | 140 |
| 65 | 3300006914 | Ga0075436_100233885 | Ga0075436_1002338851 | 140 |
| 66 | 3300006931 | Ga0097620_100048041 | Ga0097620_1000480413 | 140 |
| 67 | 3300006931 | Ga0097620_100752860 | Ga0097620_1007528602 | 140 |
| 68 | 3300007076 | Ga0075435_100120318 | Ga0075435_1001203181 | 140 |
| 69 | 3300007076 | Ga0075435_100642636 | Ga0075435_1006426362 | 140 |
| 70 | 3300007265 | Ga0099794_10641639 | Ga0099794_106416392 | 140 |
| 71 | 3300009011 | Ga0105251_10112195 | Ga0105251_101121952 | 140 |
| 72 | 3300009036 | Ga0105244_10195507 | Ga0105244_101955072 | 140 |
| 73 | 3300009092 | Ga0105250_10094806 | Ga0105250_100948062 | 140 |
| 74 | 3300009094 | Ga0111539_10429446 | Ga0111539_104294462 | 140 |
| 75 | 3300009101 | Ga0105247_10024208 | Ga0105247_100242085 | 140 |
| 76 | 3300009101 | Ga0105247_10186310 | Ga0105247_101863103 | 140 |
| 77 | 3300009147 | Ga0114129_10006801 | Ga0114129_100068015 | 140 |
| 78 | 3300009147 | Ga0114129_10037206 | Ga0114129_100372066 | 140 |
| 79 | 3300009174 | Ga0105241_12461476 | Ga0105241_124614761 | 140 |
| 80 | 3300009176 | Ga0105242_11183727 | Ga0105242_111837272 | 140 |
| 81 | 3300009177 | Ga0105248_11828815 | Ga0105248_118288151 | 140 |
| 82 | 3300010375 | Ga0105239_10059534 | Ga0105239_100595343 | 140 |
| 83 | 3300011119 | Ga0105246_10037433 | Ga0105246_100374334 | 140 |
| 84 | 3300011119 | Ga0105246_10427703 | Ga0105246_104277032 | 140 |
| 85 | 3300013105 | Ga0157369_10557881 | Ga0157369_105578812 | 140 |
| 86 | 3300013306 | Ga0163162_10221007 | Ga0163162_102210073 | 140 |
| 87 | 3300013306 | Ga0163162_10360873 | Ga0163162_103608733 | 140 |
| 88 | 3300013307 | Ga0157372_11529704 | Ga0157372_115297042 | 140 |
| 89 | 3300014325 | Ga0163163_10003639 | Ga0163163_100036397 | 140 |
| 90 | 3300014745 | Ga0157377_10033977 | Ga0157377_100339771 | 140 |
| 91 | 3300014968 | Ga0157379_10783047 | Ga0157379_107830472 | 140 |
| 92 | 3300021361 | Ga0213872_10024190 | Ga0213872_100241902 | 140 |
| 93 | 3300025321 | Ga0207656_10332443 | Ga0207656_103324431 | 140 |
| 94 | 3300025900 | Ga0207710_10016579 | Ga0207710_100165791 | 140 |
| 95 | 3300025901 | Ga0207688_10015640 | Ga0207688_100156404 | 140 |
| 96 | 3300025904 | Ga0207647_10012884 | Ga0207647_100128844 | 140 |
| 97 | 3300025904 | Ga0207647_10730026 | Ga0207647_107300261 | 140 |
| 98 | 3300025905 | Ga0207685_10277583 | Ga0207685_102775832 | 140 |
| 99 | 3300025908 | Ga0207643_10001208 | Ga0207643_1000120815 | 140 |
| 100 | 3300025910 | Ga0207684_10067383 | Ga0207684_100673832 | 140 |
| 101 | 3300025910 | Ga0207684_11153643 | Ga0207684_111536432 | 140 |
| 102 | 3300025915 | Ga0207693_10066907 | Ga0207693_100669073 | 140 |
| 103 | 3300025915 | Ga0207693_10107857 | Ga0207693_101078573 | 140 |
| 104 | 3300025916 | Ga0207663_10614654 | Ga0207663_106146542 | 140 |
| 105 | 3300025917 | Ga0207660_11097233 | Ga0207660_110972332 | 140 |
| 106 | 3300025919 | Ga0207657_10008810 | Ga0207657_100088107 | 140 |
| 107 | 3300025919 | Ga0207657_10190481 | Ga0207657_101904812 | 140 |
| 108 | 3300025922 | Ga0207646_10809151 | Ga0207646_108091512 | 140 |
| 109 | 3300025925 | Ga0207650_10219149 | Ga0207650_102191494 | 140 |
| 110 | 3300025928 | Ga0207700_10172647 | Ga0207700_101726472 | 140 |
| 111 | 3300025928 | Ga0207700_10201412 | Ga0207700_102014122 | 140 |
| 112 | 3300025928 | Ga0207700_10596871 | Ga0207700_105968711 | 140 |
| 113 | 3300025928 | Ga0207700_10660825 | Ga0207700_106608252 | 140 |
| 114 | 3300025931 | Ga0207644_10759134 | Ga0207644_107591341 | 140 |
| 115 | 3300025936 | Ga0207670_10800954 | Ga0207670_108009542 | 140 |
| 116 | 3300025938 | Ga0207704_10036572 | Ga0207704_100365722 | 140 |
| 117 | 3300025940 | Ga0207691_10039179 | Ga0207691_100391792 | 140 |
| 118 | 3300025945 | Ga0207679_10997985 | Ga0207679_109979852 | 140 |
| 119 | 3300025960 | Ga0207651_10044400 | Ga0207651_100444003 | 140 |
| 120 | 3300025961 | Ga0207712_10062205 | Ga0207712_100622051 | 140 |
| 121 | 3300025986 | Ga0207658_10037047 | Ga0207658_100370473 | 140 |
| 122 | 3300026023 | Ga0207677_10027035 | Ga0207677_100270353 | 140 |
| 123 | 3300026035 | Ga0207703_10080054 | Ga0207703_100800541 | 140 |
| 124 | 3300026067 | Ga0207678_10031049 | Ga0207678_100310494 | 140 |
| 125 | 3300026078 | Ga0207702_10113346 | Ga0207702_101133464 | 140 |
| 126 | 3300026095 | Ga0207676_10031240 | Ga0207676_100312404 | 140 |
| 127 | 3300026118 | Ga0207675_100003027 | Ga0207675_10000302716 | 140 |
| 128 | 3300027907 | Ga0207428_10447738 | Ga0207428_104477381 | 140 |
| 129 | 3300028380 | Ga0268265_10095849 | Ga0268265_100958492 | 140 |
| 130 | 3300028380 | Ga0268265_11049010 | Ga0268265_110490102 | 140 |
| 131 | 3300028381 | Ga0268264_10044721 | Ga0268264_100447213 | 140 |
| 132 | 3300031235 | Ga0265330_10020395 | Ga0265330_100203952 | 140 |
| 133 | 3300031241 | Ga0265325_10006289 | Ga0265325_100062897 | 140 |
| 134 | 3300031250 | Ga0265331_10009513 | Ga0265331_100095135 | 140 |
| 135 | 3300031344 | Ga0265316_10392475 | Ga0265316_103924753 | 140 |
| 136 | 3300031595 | Ga0265313_10025531 | Ga0265313_100255314 | 140 |
| 137 | 3300031901 | Ga0307406_10625115 | Ga0307406_106251152 | 140 |
| 138 | 3300035170 | Ga0373943_0304288 | Ga0373943_0304288_179_601 | 140 |
| 139 | 3300035241 | Ga0373961_0137393 | Ga0373961_0137393_390_812 | 140 |
| 140 | 3300035691 | Ga0373931_0115546 | Ga0373931_0115546_120_542 | 140 |
| 141 | 3300035725 | Ga0373947_0133220 | Ga0373947_0133220_749_1171 | 140 |
| 142 | 3300037068 | Ga0373925_0708022 | Ga0373925_0708022_159_581 | 140 |
| 143 | 3300037466 | Ga0395898_1305619 | Ga0395898_1305619_66_491 | 140 |
| 144 | 3300038443 | Ga0395901_0187087 | Ga0395901_0187087_712_1137 | 140 |
| 145 | 3300039447 | Ga0436361_0335157 | Ga0436361_0335157_9503_9925 | 140 |
| 146 | 3300039453 | Ga0436362_0568357 | Ga0436362_0568357_12_434 | 140 |
| 147 | 3300046459 | Ga0495629_0052288 | Ga0495629_0052288_1830_2252 | 140 |
| 148 | 3300046491 | Ga0495584_0011617 | Ga0495584_0011617_2481_2903 | 140 |
| 149 | 3300046559 | Ga0495667_0206919 | Ga0495667_0206919_29_451 | 140 |
| 150 | 3300046615 | Ga0495656_0118206 | Ga0495656_0118206_359_781 | 140 |
| 151 | 3300046683 | Ga0495658_0092954 | Ga0495658_0092954_882_1304 | 140 |
| 152 | 3300046689 | Ga0495613_0300916 | Ga0495613_0300916_159_581 | 140 |
| 153 | 3300047319 | Ga0495674_0257428 | Ga0495674_0257428_180_602 | 140 |
| 154 | 3300047471 | Ga0495684_0156524 | Ga0495684_0156524_911_1333 | 140 |
| 155 | 3300047673 | Ga0495593_0122505 | Ga0495593_0122505_654_1076 | 140 |
| 156 | 3300048903 | Ga0496100_0140634 | Ga0496100_0140634_48_470 | 140 |
| 157 | 3300048904 | Ga0496101_0346252 | Ga0496101_0346252_554_976 | 140 |
| 158 | 3300048905 | Ga0496102_0029755 | Ga0496102_0029755_4117_4539 | 140 |
| 159 | 3300048905 | Ga0496102_0633192 | Ga0496102_0633192_388_810 | 140 |
| 160 | 3300048906 | Ga0496103_0017979 | Ga0496103_0017979_3466_3888 | 140 |
| 161 | 3300048906 | Ga0496103_0031975 | Ga0496103_0031975_2398_2820 | 140 |
| 162 | 3300048907 | Ga0496104_0000495 | Ga0496104_0000495_1080_1502 | 140 |
| 163 | 3300048907 | Ga0496104_0001900 | Ga0496104_0001900_9708_10130 | 140 |
| 164 | 3300048907 | Ga0496104_0145276 | Ga0496104_0145276_187_609 | 140 |
| 165 | 3300048908 | Ga0496105_0005167 | Ga0496105_0005167_7529_7951 | 140 |
| 166 | 3300048908 | Ga0496105_0458298 | Ga0496105_0458298_36_458 | 140 |
| 167 | 3300048909 | Ga0496106_0002852 | Ga0496106_0002852_2406_2828 | 140 |
| 168 | 3300048909 | Ga0496106_0060488 | Ga0496106_0060488_64_486 | 140 |
| 169 | 3300048909 | Ga0496106_0179026 | Ga0496106_0179026_1105_1527 | 140 |
| 170 | 3300048910 | Ga0496107_0012844 | Ga0496107_0012844_367_789 | 140 |
| 171 | 3300048911 | Ga0496108_0001103 | Ga0496108_0001103_7105_7527 | 140 |
| 172 | 3300048911 | Ga0496108_0105275 | Ga0496108_0105275_385_807 | 140 |
| 173 | 3300048911 | Ga0496108_0667827 | Ga0496108_0667827_253_675 | 140 |
| 174 | 3300048912 | Ga0496109_0003899 | Ga0496109_0003899_5871_6293 | 140 |
| 175 | 3300048912 | Ga0496109_0248335 | Ga0496109_0248335_166_588 | 140 |
| 176 | 3300048912 | Ga0496109_0497534 | Ga0496109_0497534_591_1013 | 140 |
| 177 | 3300048913 | Ga0496110_0044797 | Ga0496110_0044797_2925_3347 | 140 |
| 178 | 3300048913 | Ga0496110_0084821 | Ga0496110_0084821_944_1366 | 140 |
| 179 | 3300048913 | Ga0496110_0165503 | Ga0496110_0165503_573_995 | 140 |
| 180 | 3300048913 | Ga0496110_0782426 | Ga0496110_0782426_20_442 | 140 |
| 181 | 3300048914 | Ga0496111_0010303 | Ga0496111_0010303_3405_3827 | 140 |
| 182 | 3300048915 | Ga0496112_0009038 | Ga0496112_0009038_2355_2777 | 140 |
| 183 | 3300048915 | Ga0496112_0101787 | Ga0496112_0101787_691_1113 | 140 |
| 184 | 3300048915 | Ga0496112_0942505 | Ga0496112_0942505_93_515 | 140 |
| 185 | 3300048916 | Ga0496113_0000227 | Ga0496113_0000227_5532_5954 | 140 |
| 186 | 3300048916 | Ga0496113_0041577 | Ga0496113_0041577_1369_1791 | 140 |
| 187 | 3300048917 | Ga0496114_0049124 | Ga0496114_0049124_691_1113 | 140 |
| 188 | 3300048917 | Ga0496114_0519271 | Ga0496114_0519271_180_602 | 140 |
| 189 | 3300048918 | Ga0496115_0254693 | Ga0496115_0254693_243_665 | 140 |
| 190 | 3300048918 | Ga0496115_0776740 | Ga0496115_0776740_131_553 | 140 |
| 191 | 3300049568 | Ga0501031_0013691 | Ga0501031_0013691_3446_3868 | 140 |
| 192 | 3300049568 | Ga0501031_0141577 | Ga0501031_0141577_1009_1431 | 140 |
| 193 | 3300049569 | Ga0501032_0024985 | Ga0501032_0024985_681_1103 | 140 |
| 194 | 3300049569 | Ga0501032_0035784 | Ga0501032_0035784_2617_3039 | 140 |
| 195 | 3300049570 | Ga0501033_0006958 | Ga0501033_0006958_5706_6128 | 140 |
| 196 | 3300049570 | Ga0501033_0041258 | Ga0501033_0041258_2732_3154 | 140 |
| 197 | 3300049571 | Ga0501034_0085870 | Ga0501034_0085870_1575_1997 | 140 |
| 198 | 3300049571 | Ga0501034_0089853 | Ga0501034_0089853_1724_2146 | 140 |
| 199 | 3300049571 | Ga0501034_0210555 | Ga0501034_0210555_309_731 | 140 |
| 200 | 3300049572 | Ga0501036_0018152 | Ga0501036_0018152_1033_1455 | 140 |
| 201 | 3300049572 | Ga0501036_0565933 | Ga0501036_0565933_421_843 | 140 |
| 202 | 3300049573 | Ga0501037_0007497 | Ga0501037_0007497_1528_1950 | 140 |
| 203 | 3300049573 | Ga0501037_0073874 | Ga0501037_0073874_1879_2301 | 140 |
| 204 | 3300049573 | Ga0501037_0235422 | Ga0501037_0235422_669_1091 | 140 |
| 205 | 3300049574 | Ga0501038_0003058 | Ga0501038_0003058_13820_14242 | 140 |
| 206 | 3300049574 | Ga0501038_0043390 | Ga0501038_0043390_3468_3890 | 140 |
| 207 | 3300049574 | Ga0501038_0113595 | Ga0501038_0113595_142_564 | 140 |
| 208 | 3300049574 | Ga0501038_0562182 | Ga0501038_0562182_328_750 | 140 |
| 209 | 3300049575 | Ga0501039_0041250 | Ga0501039_0041250_1922_2344 | 140 |
| 210 | 3300049579 | Ga0501043_0050128 | Ga0501043_0050128_1801_2223 | 140 |
| 211 | 3300049579 | Ga0501043_0109996 | Ga0501043_0109996_1047_1469 | 140 |
| 212 | 3300049580 | Ga0501046_0778727 | Ga0501046_0778727_142_564 | 140 |
| 213 | 3300049580 | Ga0501046_1139079 | Ga0501046_1139079_104_526 | 140 |
| 214 | 3300049581 | Ga0501047_0062444 | Ga0501047_0062444_2613_3035 | 140 |
| 215 | 3300049581 | Ga0501047_0187286 | Ga0501047_0187286_1169_1591 | 140 |
| 216 | 3300049581 | Ga0501047_0838593 | Ga0501047_0838593_236_658 | 140 |
| 217 | 3300049582 | Ga0501048_0341218 | Ga0501048_0341218_628_1050 | 140 |
| 218 | 3300049585 | Ga0501069_0012501 | Ga0501069_0012501_2849_3271 | 140 |
| 219 | 3300049585 | Ga0501069_0071517 | Ga0501069_0071517_311_733 | 140 |
| 220 | 3300049586 | Ga0501070_0012006 | Ga0501070_0012006_4204_4626 | 140 |
| 221 | 3300049586 | Ga0501070_0012272 | Ga0501070_0012272_2946_3368 | 140 |
| 222 | 3300049586 | Ga0501070_0117666 | Ga0501070_0117666_1145_1567 | 140 |
| 223 | 3300049586 | Ga0501070_0146184 | Ga0501070_0146184_1285_1707 | 140 |
| 224 | 3300049587 | Ga0501071_0116255 | Ga0501071_0116255_549_971 | 140 |
| 225 | 3300049588 | Ga0501072_0462933 | Ga0501072_0462933_504_926 | 140 |
| 226 | 3300049589 | Ga0501073_0021522 | Ga0501073_0021522_1265_1687 | 140 |
| 227 | 3300049589 | Ga0501073_0379336 | Ga0501073_0379336_19_441 | 140 |
| 228 | 3300049741 | Ga0501079_0346552 | Ga0501079_0346552_463_885 | 140 |
| 229 | 3300049742 | Ga0501080_0056160 | Ga0501080_0056160_3137_3559 | 140 |
| 230 | 3300049742 | Ga0501080_0137449 | Ga0501080_0137449_1272_1694 | 140 |
| 231 | 3300049744 | Ga0501083_0642114 | Ga0501083_0642114_11_433 | 140 |
| 232 | 3300049822 | Ga0501035_0000995 | Ga0501035_0000995_2793_3215 | 140 |
| 233 | 3300049822 | Ga0501035_0052529 | Ga0501035_0052529_2666_3088 | 140 |
| 234 | 3300049822 | Ga0501035_0526792 | Ga0501035_0526792_426_848 | 140 |
| 235 | 3300049823 | Ga0501044_0038058 | Ga0501044_0038058_3574_3996 | 140 |
| 236 | 3300049823 | Ga0501044_0050872 | Ga0501044_0050872_2272_2694 | 140 |
| 237 | 3300049823 | Ga0501044_0706984 | Ga0501044_0706984_432_854 | 140 |
| 238 | 3300049823 | Ga0501044_1142563 | Ga0501044_1142563_154_576 | 140 |
| 239 | 3300050507 | nmdc:mga05p37_109548_c1 | nmdc:mga05p37_109548_c1_652_1074 | 140 |
| 240 | 3300050507 | nmdc:mga05p37_25723_c1 | nmdc:mga05p37_25723_c1_1431_1853 | 140 |
| 241 | 3300050509 | nmdc:mga0qj67_198406_c1 | nmdc:mga0qj67_198406_c1_1175_1597 | 140 |
| 242 | 3300050510 | nmdc:mga06r32_316558_c1 | nmdc:mga06r32_316558_c1_900_1322 | 140 |
| 243 | 3300050512 | nmdc:mga0n895_124072_c1 | nmdc:mga0n895_124072_c1_1009_1431 | 140 |
| 244 | 3300050512 | nmdc:mga0n895_254629_c1 | nmdc:mga0n895_254629_c1_1019_1441 | 140 |
| 245 | 3300050513 | nmdc:mga0rr50_102296_c1 | nmdc:mga0rr50_102296_c1_489_911 | 140 |
| 246 | 3300050513 | nmdc:mga0rr50_735358_c1 | nmdc:mga0rr50_735358_c1_78_500 | 140 |
| 247 | 3300050514 | nmdc:mga08x19_1035964_c1 | nmdc:mga08x19_1035964_c1_99_521 | 140 |
| 248 | 3300053085 | Ga0495619_0016823 | Ga0495619_0016823_4164_4586 | 140 |
| 249 | 3300053085 | Ga0495619_0343311 | Ga0495619_0343311_538_960 | 140 |
| 250 | 3300053093 | Ga0500651_0041727 | Ga0500651_0041727_547_969 | 140 |
| 251 | 3300060353 | Ga0501082_0101011 | Ga0501082_0101011_263_685 | 140 |
| 252 | 3300060353 | Ga0501082_0179635 | Ga0501082_0179635_407_829 | 140 |
| 253 | 3300005337 | Ga0070682_100562749 | Ga0070682_1005627492 | 141 |
| 254 | 3300005341 | Ga0070691_10050476 | Ga0070691_100504762 | 141 |
| 255 | 3300005344 | Ga0070661_100282063 | Ga0070661_1002820632 | 141 |
| 256 | 3300005353 | Ga0070669_100141606 | Ga0070669_1001416063 | 141 |
| 257 | 3300005353 | Ga0070669_101212724 | Ga0070669_1012127242 | 141 |
| 258 | 3300005354 | Ga0070675_100199475 | Ga0070675_1001994752 | 141 |
| 259 | 3300005355 | Ga0070671_100341927 | Ga0070671_1003419272 | 141 |
| 260 | 3300005356 | Ga0070674_100056194 | Ga0070674_1000561943 | 141 |
| 261 | 3300005364 | Ga0070673_100014645 | Ga0070673_1000146452 | 141 |
| 262 | 3300005366 | Ga0070659_100255889 | Ga0070659_1002558892 | 141 |
| 263 | 3300005366 | Ga0070659_101525028 | Ga0070659_1015250281 | 141 |
| 264 | 3300005367 | Ga0070667_100323726 | Ga0070667_1003237262 | 141 |
| 265 | 3300005367 | Ga0070667_100523865 | Ga0070667_1005238651 | 141 |
| 266 | 3300005434 | Ga0070709_10003671 | Ga0070709_100036712 | 141 |
| 267 | 3300005434 | Ga0070709_10501809 | Ga0070709_105018091 | 141 |
| 268 | 3300005435 | Ga0070714_101983508 | Ga0070714_1019835081 | 141 |
| 269 | 3300005436 | Ga0070713_100019221 | Ga0070713_1000192211 | 141 |
| 270 | 3300005437 | Ga0070710_10015364 | Ga0070710_100153646 | 141 |
| 271 | 3300005437 | Ga0070710_10032037 | Ga0070710_100320373 | 141 |
| 272 | 3300005437 | Ga0070710_11264920 | Ga0070710_112649201 | 141 |
| 273 | 3300005439 | Ga0070711_100001695 | Ga0070711_1000016957 | 141 |
| 274 | 3300005439 | Ga0070711_100019451 | Ga0070711_1000194514 | 141 |
| 275 | 3300005439 | Ga0070711_100594449 | Ga0070711_1005944492 | 141 |
| 276 | 3300005441 | Ga0070700_100544247 | Ga0070700_1005442471 | 141 |
| 277 | 3300005441 | Ga0070700_100907242 | Ga0070700_1009072421 | 141 |
| 278 | 3300005441 | Ga0070700_101011923 | Ga0070700_1010119232 | 141 |
| 279 | 3300005444 | Ga0070694_100131627 | Ga0070694_1001316273 | 141 |
| 280 | 3300005445 | Ga0070708_100633025 | Ga0070708_1006330251 | 141 |
| 281 | 3300005455 | Ga0070663_100084684 | Ga0070663_1000846844 | 141 |
| 282 | 3300005456 | Ga0070678_100119811 | Ga0070678_1001198112 | 141 |
| 283 | 3300005456 | Ga0070678_101396375 | Ga0070678_1013963752 | 141 |
| 284 | 3300005457 | Ga0070662_100040160 | Ga0070662_1000401602 | 141 |
| 285 | 3300005458 | Ga0070681_10061315 | Ga0070681_100613153 | 141 |
| 286 | 3300005459 | Ga0068867_101170507 | Ga0068867_1011705071 | 141 |
| 287 | 3300005467 | Ga0070706_102163689 | Ga0070706_1021636891 | 141 |
| 288 | 3300005468 | Ga0070707_100210734 | Ga0070707_1002107341 | 141 |
| 289 | 3300005530 | Ga0070679_100276893 | Ga0070679_1002768932 | 141 |
| 290 | 3300005544 | Ga0070686_100209318 | Ga0070686_1002093182 | 141 |
| 291 | 3300005545 | Ga0070695_100312777 | Ga0070695_1003127772 | 141 |
| 292 | 3300005546 | Ga0070696_100110438 | Ga0070696_1001104384 | 141 |
| 293 | 3300005547 | Ga0070693_100076865 | Ga0070693_1000768652 | 141 |
| 294 | 3300005549 | Ga0070704_100581733 | Ga0070704_1005817332 | 141 |
| 295 | 3300005564 | Ga0070664_100188683 | Ga0070664_1001886831 | 141 |
| 296 | 3300005614 | Ga0068856_100067110 | Ga0068856_1000671104 | 141 |
| 297 | 3300005618 | Ga0068864_100812521 | Ga0068864_1008125212 | 141 |
| 298 | 3300005842 | Ga0068858_100273467 | Ga0068858_1002734672 | 141 |
| 299 | 3300006028 | Ga0070717_10819301 | Ga0070717_108193012 | 141 |
| 300 | 3300006048 | Ga0075363_100254564 | Ga0075363_1002545642 | 141 |
| 301 | 3300006051 | Ga0075364_10005596 | Ga0075364_100055963 | 141 |
| 302 | 3300006051 | Ga0075364_10674752 | Ga0075364_106747522 | 141 |
| 303 | 3300006175 | Ga0070712_100001893 | Ga0070712_1000018935 | 141 |
| 304 | 3300006175 | Ga0070712_100002927 | Ga0070712_10000292711 | 141 |
| 305 | 3300006177 | Ga0075362_10015622 | Ga0075362_100156222 | 141 |
| 306 | 3300006177 | Ga0075362_10256205 | Ga0075362_102562052 | 141 |
| 307 | 3300006178 | Ga0075367_10035515 | Ga0075367_100355152 | 141 |
| 308 | 3300006178 | Ga0075367_10087404 | Ga0075367_100874044 | 141 |
| 309 | 3300006195 | Ga0075366_10057187 | Ga0075366_100571872 | 141 |
| 310 | 3300006237 | Ga0097621_100008744 | Ga0097621_1000087442 | 141 |
| 311 | 3300006353 | Ga0075370_10460636 | Ga0075370_104606362 | 141 |
| 312 | 3300006353 | Ga0075370_10676408 | Ga0075370_106764082 | 141 |
| 313 | 3300006358 | Ga0068871_100027615 | Ga0068871_1000276154 | 141 |
| 314 | 3300006871 | Ga0075434_100655354 | Ga0075434_1006553542 | 141 |
| 315 | 3300006880 | Ga0075429_101039031 | Ga0075429_1010390312 | 141 |
| 316 | 3300006881 | Ga0068865_101291279 | Ga0068865_1012912792 | 141 |
| 317 | 3300006914 | Ga0075436_100143142 | Ga0075436_1001431422 | 141 |
| 318 | 3300007076 | Ga0075435_100334541 | Ga0075435_1003345412 | 141 |
| 319 | 3300009094 | Ga0111539_10215901 | Ga0111539_102159012 | 141 |
| 320 | 3300009094 | Ga0111539_10330823 | Ga0111539_103308232 | 141 |
| 321 | 3300009094 | Ga0111539_10583290 | Ga0111539_105832902 | 141 |
| 322 | 3300009098 | Ga0105245_10148592 | Ga0105245_101485922 | 141 |
| 323 | 3300009098 | Ga0105245_10197571 | Ga0105245_101975713 | 141 |
| 324 | 3300009098 | Ga0105245_10726667 | Ga0105245_107266673 | 141 |
| 325 | 3300009174 | Ga0105241_11280115 | Ga0105241_112801152 | 141 |
| 326 | 3300009176 | Ga0105242_11430073 | Ga0105242_114300732 | 141 |
| 327 | 3300009177 | Ga0105248_10035800 | Ga0105248_100358006 | 141 |
| 328 | 3300009177 | Ga0105248_12207883 | Ga0105248_122078832 | 141 |
| 329 | 3300009545 | Ga0105237_10035386 | Ga0105237_100353864 | 141 |
| 330 | 3300009553 | Ga0105249_10437090 | Ga0105249_104370902 | 141 |
| 331 | 3300009986 | Ga0105033_110928 | Ga0105033_1109282 | 141 |
| 332 | 3300010375 | Ga0105239_11545209 | Ga0105239_115452092 | 141 |
| 333 | 3300010375 | Ga0105239_13383082 | Ga0105239_133830821 | 141 |
| 334 | 3300011119 | Ga0105246_10288223 | Ga0105246_102882232 | 141 |
| 335 | 3300013100 | Ga0157373_10801133 | Ga0157373_108011332 | 141 |
| 336 | 3300013105 | Ga0157369_10947488 | Ga0157369_109474881 | 141 |
| 337 | 3300013297 | Ga0157378_10429633 | Ga0157378_104296332 | 141 |
| 338 | 3300013297 | Ga0157378_10634683 | Ga0157378_106346832 | 141 |
| 339 | 3300013306 | Ga0163162_10087113 | Ga0163162_100871134 | 141 |
| 340 | 3300013307 | Ga0157372_10160704 | Ga0157372_101607043 | 141 |
| 341 | 3300013308 | Ga0157375_10540822 | Ga0157375_105408221 | 141 |
| 342 | 3300014326 | Ga0157380_10126169 | Ga0157380_101261693 | 141 |
| 343 | 3300014497 | Ga0182008_10242839 | Ga0182008_102428392 | 141 |
| 344 | 3300014968 | Ga0157379_10118428 | Ga0157379_101184283 | 141 |
| 345 | 3300014968 | Ga0157379_10551695 | Ga0157379_105516952 | 141 |
| 346 | 3300014969 | Ga0157376_10726108 | Ga0157376_107261082 | 141 |
| 347 | 3300021384 | Ga0213876_10225361 | Ga0213876_102253612 | 141 |
| 348 | 3300024227 | Ga0228598_1024716 | Ga0228598_10247162 | 141 |
| 349 | 3300025898 | Ga0207692_10014928 | Ga0207692_100149283 | 141 |
| 350 | 3300025898 | Ga0207692_10035418 | Ga0207692_100354182 | 141 |
| 351 | 3300025898 | Ga0207692_10849651 | Ga0207692_108496511 | 141 |
| 352 | 3300025906 | Ga0207699_10023469 | Ga0207699_100234694 | 141 |
| 353 | 3300025906 | Ga0207699_10078246 | Ga0207699_100782462 | 141 |
| 354 | 3300025910 | Ga0207684_11638964 | Ga0207684_116389641 | 141 |
| 355 | 3300025912 | Ga0207707_10061465 | Ga0207707_100614653 | 141 |
| 356 | 3300025915 | Ga0207693_10007054 | Ga0207693_100070543 | 141 |
| 357 | 3300025916 | Ga0207663_10085498 | Ga0207663_100854982 | 141 |
| 358 | 3300025916 | Ga0207663_10218119 | Ga0207663_102181191 | 141 |
| 359 | 3300025918 | Ga0207662_10231646 | Ga0207662_102316462 | 141 |
| 360 | 3300025920 | Ga0207649_10173044 | Ga0207649_101730442 | 141 |
| 361 | 3300025920 | Ga0207649_10361613 | Ga0207649_103616132 | 141 |
| 362 | 3300025921 | Ga0207652_10187627 | Ga0207652_101876273 | 141 |
| 363 | 3300025923 | Ga0207681_10146685 | Ga0207681_101466852 | 141 |
| 364 | 3300025923 | Ga0207681_10408248 | Ga0207681_104082482 | 141 |
| 365 | 3300025923 | Ga0207681_10599154 | Ga0207681_105991541 | 141 |
| 366 | 3300025926 | Ga0207659_10091451 | Ga0207659_100914512 | 141 |
| 367 | 3300025927 | Ga0207687_10051449 | Ga0207687_100514494 | 141 |
| 368 | 3300025927 | Ga0207687_10180844 | Ga0207687_101808442 | 141 |
| 369 | 3300025928 | Ga0207700_10046160 | Ga0207700_100461605 | 141 |
| 370 | 3300025928 | Ga0207700_10107794 | Ga0207700_101077943 | 141 |
| 371 | 3300025931 | Ga0207644_10417776 | Ga0207644_104177762 | 141 |
| 372 | 3300025932 | Ga0207690_10077141 | Ga0207690_100771412 | 141 |
| 373 | 3300025933 | Ga0207706_10118814 | Ga0207706_101188144 | 141 |
| 374 | 3300025933 | Ga0207706_10265898 | Ga0207706_102658983 | 141 |
| 375 | 3300025934 | Ga0207686_10032302 | Ga0207686_100323024 | 141 |
| 376 | 3300025937 | Ga0207669_10052926 | Ga0207669_100529262 | 141 |
| 377 | 3300025938 | Ga0207704_10209749 | Ga0207704_102097493 | 141 |
| 378 | 3300025939 | Ga0207665_10273127 | Ga0207665_102731272 | 141 |
| 379 | 3300025941 | Ga0207711_11322816 | Ga0207711_113228161 | 141 |
| 380 | 3300025960 | Ga0207651_10147297 | Ga0207651_101472971 | 141 |
| 381 | 3300025961 | Ga0207712_10391746 | Ga0207712_103917462 | 141 |
| 382 | 3300025972 | Ga0207668_10619963 | Ga0207668_106199632 | 141 |
| 383 | 3300026041 | Ga0207639_10065082 | Ga0207639_100650824 | 141 |
| 384 | 3300026067 | Ga0207678_10109778 | Ga0207678_101097784 | 141 |
| 385 | 3300026067 | Ga0207678_11537825 | Ga0207678_115378251 | 141 |
| 386 | 3300026075 | Ga0207708_10254547 | Ga0207708_102545472 | 141 |
| 387 | 3300026075 | Ga0207708_10615791 | Ga0207708_106157912 | 141 |
| 388 | 3300026078 | Ga0207702_10613610 | Ga0207702_106136102 | 141 |
| 389 | 3300026089 | Ga0207648_10498149 | Ga0207648_104981492 | 141 |
| 390 | 3300026121 | Ga0207683_10013747 | Ga0207683_100137479 | 141 |
| 391 | 3300026121 | Ga0207683_11406119 | Ga0207683_114061192 | 141 |
| 392 | 3300027866 | Ga0209813_10273215 | Ga0209813_102732151 | 141 |
| 393 | 3300028380 | Ga0268265_10493627 | Ga0268265_104936273 | 141 |
| 394 | 3300028381 | Ga0268264_10535331 | Ga0268264_105353312 | 141 |
| 395 | 3300028381 | Ga0268264_10971759 | Ga0268264_109717592 | 141 |
| 396 | 3300031238 | Ga0265332_10058081 | Ga0265332_100580812 | 141 |
| 397 | 3300031241 | Ga0265325_10001543 | Ga0265325_100015439 | 141 |
| 398 | 3300031241 | Ga0265325_10042260 | Ga0265325_100422603 | 141 |
| 399 | 3300031241 | Ga0265325_10056461 | Ga0265325_100564612 | 141 |
| 400 | 3300031995 | Ga0307409_101664104 | Ga0307409_1016641042 | 141 |
| 401 | 3300032002 | Ga0307416_101271832 | Ga0307416_1012718321 | 141 |
| 402 | 3300032005 | Ga0307411_10359398 | Ga0307411_103593982 | 141 |
| 403 | 3300035089 | Ga0373944_0019469 | Ga0373944_0019469_165_590 | 141 |
| 404 | 3300035111 | Ga0373923_0035431 | Ga0373923_0035431_1369_1794 | 141 |
| 405 | 3300035113 | Ga0373936_0124188 | Ga0373936_0124188_142_567 | 141 |
| 406 | 3300035119 | Ga0373956_0072775 | Ga0373956_0072775_498_923 | 141 |
| 407 | 3300035171 | Ga0373946_0392247 | Ga0373946_0392247_246_671 | 141 |
| 408 | 3300035207 | Ga0373942_0066022 | Ga0373942_0066022_267_692 | 141 |
| 409 | 3300035691 | Ga0373931_0609871 | Ga0373931_0609871_178_603 | 141 |
| 410 | 3300035692 | Ga0373935_0425498 | Ga0373935_0425498_308_733 | 141 |
| 411 | 3300035695 | Ga0373927_0032885 | Ga0373927_0032885_1224_1649 | 141 |
| 412 | 3300035725 | Ga0373947_0047520 | Ga0373947_0047520_1689_2114 | 141 |
| 413 | 3300037068 | Ga0373925_0108205 | Ga0373925_0108205_264_689 | 141 |
| 414 | 3300037312 | Ga0395899_0009657 | Ga0395899_0009657_1420_1845 | 141 |
| 415 | 3300037312 | Ga0395899_0387847 | Ga0395899_0387847_439_864 | 141 |
| 416 | 3300037466 | Ga0395898_0051585 | Ga0395898_0051585_1894_2319 | 141 |
| 417 | 3300038443 | Ga0395901_0099569 | Ga0395901_0099569_1372_1797 | 141 |
| 418 | 3300039437 | Ga0436365_0566814 | Ga0436365_0566814_145_570 | 141 |
| 419 | 3300039437 | Ga0436365_1828125 | Ga0436365_1828125_2343_2768 | 141 |
| 420 | 3300041408 | Ga0439453_0000142 | Ga0439453_0000142_3869_4294 | 141 |
| 421 | 3300041411 | Ga0439466_0160896 | Ga0439466_0160896_228_653 | 141 |
| 422 | 3300042001 | Ga0439441_017133 | Ga0439441_017133_746_1171 | 141 |
| 423 | 3300042003 | Ga0439443_005846 | Ga0439443_005846_1089_1514 | 141 |
| 424 | 3300042156 | Ga0439446_0142832 | Ga0439446_0142832_146_571 | 141 |
| 425 | 3300042436 | Ga0439435_0029912 | Ga0439435_0029912_121_546 | 141 |
| 426 | 3300046459 | Ga0495629_0038860 | Ga0495629_0038860_1422_1847 | 141 |
| 427 | 3300046473 | Ga0495582_0077819 | Ga0495582_0077819_969_1394 | 141 |
| 428 | 3300046475 | Ga0495639_0514909 | Ga0495639_0514909_165_590 | 141 |
| 429 | 3300046476 | Ga0495662_0070535 | Ga0495662_0070535_314_739 | 141 |
| 430 | 3300046477 | Ga0495664_0027048 | Ga0495664_0027048_2085_2510 | 141 |
| 431 | 3300046491 | Ga0495584_0646540 | Ga0495584_0646540_17_442 | 141 |
| 432 | 3300046499 | Ga0495594_0169787 | Ga0495594_0169787_452_877 | 141 |
| 433 | 3300046514 | Ga0495618_0086239 | Ga0495618_0086239_314_739 | 141 |
| 434 | 3300046518 | Ga0495631_0146871 | Ga0495631_0146871_545_970 | 141 |
| 435 | 3300046526 | Ga0495666_0216948 | Ga0495666_0216948_380_805 | 141 |
| 436 | 3300046529 | Ga0495652_0117918 | Ga0495652_0117918_1558_1983 | 141 |
| 437 | 3300046533 | Ga0495640_0237202 | Ga0495640_0237202_530_955 | 141 |
| 438 | 3300046533 | Ga0495640_0461767 | Ga0495640_0461767_273_698 | 141 |
| 439 | 3300046543 | Ga0495645_0202497 | Ga0495645_0202497_21_446 | 141 |
| 440 | 3300046642 | Ga0495634_0055078 | Ga0495634_0055078_1182_1607 | 141 |
| 441 | 3300046663 | Ga0495635_0104544 | Ga0495635_0104544_760_1185 | 141 |
| 442 | 3300046681 | Ga0495647_0082258 | Ga0495647_0082258_865_1290 | 141 |
| 443 | 3300046683 | Ga0495658_0086285 | Ga0495658_0086285_68_493 | 141 |
| 444 | 3300046689 | Ga0495613_0425436 | Ga0495613_0425436_239_664 | 141 |
| 445 | 3300046690 | Ga0495624_0471941 | Ga0495624_0471941_203_628 | 141 |
| 446 | 3300047315 | Ga0495581_0066511 | Ga0495581_0066511_162_587 | 141 |
| 447 | 3300047319 | Ga0495674_0092176 | Ga0495674_0092176_1805_2230 | 141 |
| 448 | 3300047322 | Ga0495680_0082932 | Ga0495680_0082932_301_726 | 141 |
| 449 | 3300047471 | Ga0495684_0615990 | Ga0495684_0615990_158_583 | 141 |
| 450 | 3300047673 | Ga0495593_0132206 | Ga0495593_0132206_19_444 | 141 |
| 451 | 3300048903 | Ga0496100_0008731 | Ga0496100_0008731_729_1154 | 141 |
| 452 | 3300048904 | Ga0496101_1126837 | Ga0496101_1126837_79_504 | 141 |
| 453 | 3300048905 | Ga0496102_0009606 | Ga0496102_0009606_4496_4921 | 141 |
| 454 | 3300048905 | Ga0496102_0068715 | Ga0496102_0068715_2337_2762 | 141 |
| 455 | 3300048906 | Ga0496103_0043635 | Ga0496103_0043635_1654_2079 | 141 |
| 456 | 3300048906 | Ga0496103_0258265 | Ga0496103_0258265_604_1029 | 141 |
| 457 | 3300048907 | Ga0496104_0003411 | Ga0496104_0003411_2360_2785 | 141 |
| 458 | 3300048908 | Ga0496105_0004873 | Ga0496105_0004873_9533_9958 | 141 |
| 459 | 3300048909 | Ga0496106_0024841 | Ga0496106_0024841_1891_2316 | 141 |
| 460 | 3300048910 | Ga0496107_0043706 | Ga0496107_0043706_612_1037 | 141 |
| 461 | 3300048910 | Ga0496107_0182237 | Ga0496107_0182237_330_755 | 141 |
| 462 | 3300048913 | Ga0496110_0325880 | Ga0496110_0325880_554_979 | 141 |
| 463 | 3300048914 | Ga0496111_0236609 | Ga0496111_0236609_415_840 | 141 |
| 464 | 3300048915 | Ga0496112_0993100 | Ga0496112_0993100_259_684 | 141 |
| 465 | 3300048917 | Ga0496114_0001741 | Ga0496114_0001741_1447_1872 | 141 |
| 466 | 3300048917 | Ga0496114_1065326 | Ga0496114_1065326_77_502 | 141 |
| 467 | 3300048918 | Ga0496115_0032793 | Ga0496115_0032793_3065_3490 | 141 |
| 468 | 3300048918 | Ga0496115_0034934 | Ga0496115_0034934_1527_1952 | 141 |
| 469 | 3300048918 | Ga0496115_0178224 | Ga0496115_0178224_1173_1598 | 141 |
| 470 | 3300049569 | Ga0501032_0019995 | Ga0501032_0019995_2136_2561 | 141 |
| 471 | 3300049570 | Ga0501033_0008378 | Ga0501033_0008378_1659_2084 | 141 |
| 472 | 3300049570 | Ga0501033_0920808 | Ga0501033_0920808_144_569 | 141 |
| 473 | 3300049571 | Ga0501034_0373529 | Ga0501034_0373529_496_921 | 141 |
| 474 | 3300049572 | Ga0501036_0041476 | Ga0501036_0041476_1460_1885 | 141 |
| 475 | 3300049573 | Ga0501037_0011305 | Ga0501037_0011305_2969_3394 | 141 |
| 476 | 3300049574 | Ga0501038_0030276 | Ga0501038_0030276_2136_2561 | 141 |
| 477 | 3300049574 | Ga0501038_0407011 | Ga0501038_0407011_98_523 | 141 |
| 478 | 3300049575 | Ga0501039_0022121 | Ga0501039_0022121_14_439 | 141 |
| 479 | 3300049575 | Ga0501039_0262623 | Ga0501039_0262623_616_1041 | 141 |
| 480 | 3300049576 | Ga0501040_0190468 | Ga0501040_0190468_342_767 | 141 |
| 481 | 3300049576 | Ga0501040_0381605 | Ga0501040_0381605_236_661 | 141 |
| 482 | 3300049578 | Ga0501042_0015292 | Ga0501042_0015292_4723_5157 | 141 |
| 483 | 3300049579 | Ga0501043_0014567 | Ga0501043_0014567_5170_5595 | 141 |
| 484 | 3300049580 | Ga0501046_0119784 | Ga0501046_0119784_902_1327 | 141 |
| 485 | 3300049582 | Ga0501048_0158606 | Ga0501048_0158606_596_1021 | 141 |
| 486 | 3300049584 | Ga0501068_0187277 | Ga0501068_0187277_208_633 | 141 |
| 487 | 3300049587 | Ga0501071_0404931 | Ga0501071_0404931_236_661 | 141 |
| 488 | 3300049588 | Ga0501072_0061603 | Ga0501072_0061603_2379_2804 | 141 |
| 489 | 3300049591 | Ga0501075_0041013 | Ga0501075_0041013_2047_2472 | 141 |
| 490 | 3300049592 | Ga0501076_0029728 | Ga0501076_0029728_620_1045 | 141 |
| 491 | 3300049592 | Ga0501076_0135732 | Ga0501076_0135732_121_546 | 141 |
| 492 | 3300049592 | Ga0501076_0547667 | Ga0501076_0547667_144_569 | 141 |
| 493 | 3300049593 | Ga0501077_0324498 | Ga0501077_0324498_522_947 | 141 |
| 494 | 3300049741 | Ga0501079_0429266 | Ga0501079_0429266_153_578 | 141 |
| 495 | 3300049741 | Ga0501079_0438785 | Ga0501079_0438785_206_631 | 141 |
| 496 | 3300049741 | Ga0501079_0504317 | Ga0501079_0504317_94_519 | 141 |
| 497 | 3300049742 | Ga0501080_0045146 | Ga0501080_0045146_645_1070 | 141 |
| 498 | 3300049743 | Ga0501081_0094108 | Ga0501081_0094108_1095_1520 | 141 |
| 499 | 3300049744 | Ga0501083_0797846 | Ga0501083_0797846_111_536 | 141 |
| 500 | 3300049823 | Ga0501044_0158444 | Ga0501044_0158444_1220_1645 | 141 |
| 501 | 3300049823 | Ga0501044_0880801 | Ga0501044_0880801_209_634 | 141 |
| 502 | 3300050489 | nmdc:mga03683_222132_c1 | nmdc:mga03683_222132_c1_433_858 | 141 |
| 503 | 3300050490 | nmdc:mga03n38_32116_c1 | nmdc:mga03n38_32116_c1_1372_1797 | 141 |
| 504 | 3300050491 | nmdc:mga00v17_186027_c1 | nmdc:mga00v17_186027_c1_322_747 | 141 |
| 505 | 3300050491 | nmdc:mga00v17_6222_c1 | nmdc:mga00v17_6222_c1_3754_4179 | 141 |
| 506 | 3300050492 | nmdc:mga0yw44_199341_c1 | nmdc:mga0yw44_199341_c1_394_819 | 141 |
| 507 | 3300050492 | nmdc:mga0yw44_208031_c1 | nmdc:mga0yw44_208031_c1_188_613 | 141 |
| 508 | 3300050493 | nmdc:mga0k408_157063_c2 | nmdc:mga0k408_157063_c2_194_619 | 141 |
| 509 | 3300050494 | nmdc:mga06z11_11724_c1 | nmdc:mga06z11_11724_c1_3054_3479 | 141 |
| 510 | 3300050494 | nmdc:mga06z11_141958_c1 | nmdc:mga06z11_141958_c1_631_1056 | 141 |
| 511 | 3300050495 | nmdc:mga04h51_305837_c1 | nmdc:mga04h51_305837_c1_90_515 | 141 |
| 512 | 3300050510 | nmdc:mga06r32_377715_c1 | nmdc:mga06r32_377715_c1_511_936 | 141 |
| 513 | 3300050511 | nmdc:mga08y16_194584_c1 | nmdc:mga08y16_194584_c1_701_1126 | 141 |
| 514 | 3300050513 | nmdc:mga0rr50_321712_c1 | nmdc:mga0rr50_321712_c1_669_1094 | 141 |
| 515 | 3300050516 | nmdc:mga0sz30_456281_c1 | nmdc:mga0sz30_456281_c1_39_464 | 141 |
| 516 | 3300053077 | Ga0495601_0009329 | Ga0495601_0009329_3981_4406 | 141 |
| 517 | 3300053077 | Ga0495601_0056685 | Ga0495601_0056685_592_1017 | 141 |
| 518 | 3300053078 | Ga0495612_0005524 | Ga0495612_0005524_1068_1493 | 141 |
| 519 | 3300053084 | Ga0495595_0186388 | Ga0495595_0186388_366_791 | 141 |
| 520 | 3300053085 | Ga0495619_0002087 | Ga0495619_0002087_9669_10094 | 141 |
| 521 | 3300053086 | Ga0500578_0544560 | Ga0500578_0544560_21_446 | 141 |
| 522 | 3300053088 | Ga0500644_0108792 | Ga0500644_0108792_385_810 | 141 |
| 523 | 3300053096 | Ga0500641_0032101 | Ga0500641_0032101_1024_1449 | 141 |
| 524 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_443667_444092 | 141 |
| 525 | 3300053730 | Ga0500645_017683 | Ga0500645_017683_1394_1819 | 141 |
| 526 | 3300060353 | Ga0501082_0147554 | Ga0501082_0147554_64_489 | 141 |
| 527 | 3300060353 | Ga0501082_0286220 | Ga0501082_0286220_993_1418 | 141 |
| 528 | 3300061734 | Ga0530510_0353849 | Ga0530510_0353849_42_467 | 141 |
| 529 | 3300001976 | JGI24752J21851_1013836 | JGI24752J21851_10138362 | 142 |
| 530 | 3300001977 | JGI24746J21847_1000923 | JGI24746J21847_10009235 | 142 |
| 531 | 3300001978 | JGI24747J21853_1007884 | JGI24747J21853_10078842 | 142 |
| 532 | 3300001979 | JGI24740J21852_10054506 | JGI24740J21852_100545062 | 142 |
| 533 | 3300001989 | JGI24739J22299_10040565 | JGI24739J22299_100405652 | 142 |
| 534 | 3300001990 | JGI24737J22298_10002170 | JGI24737J22298_100021707 | 142 |
| 535 | 3300001991 | JGI24743J22301_10004801 | JGI24743J22301_100048012 | 142 |
| 536 | 3300002067 | JGI24735J21928_10144302 | JGI24735J21928_101443022 | 142 |
| 537 | 3300002070 | JGI24750J21931_1001342 | JGI24750J21931_10013423 | 142 |
| 538 | 3300002073 | JGI24745J21846_1000152 | JGI24745J21846_10001523 | 142 |
| 539 | 3300002074 | JGI24748J21848_1002289 | JGI24748J21848_10022892 | 142 |
| 540 | 3300002075 | JGI24738J21930_10000909 | JGI24738J21930_100009096 | 142 |
| 541 | 3300002076 | JGI24749J21850_1007700 | JGI24749J21850_10077002 | 142 |
| 542 | 3300002077 | JGI24744J21845_10002614 | JGI24744J21845_100026142 | 142 |
| 543 | 3300002077 | JGI24744J21845_10002742 | JGI24744J21845_100027424 | 142 |
| 544 | 3300002126 | JGI24035J26624_1000140 | JGI24035J26624_10001404 | 142 |
| 545 | 3300002155 | JGI24033J26618_1000697 | JGI24033J26618_10006974 | 142 |
| 546 | 3300002239 | JGI24034J26672_10000370 | JGI24034J26672_100003706 | 142 |
| 547 | 3300002244 | JGI24742J22300_10021793 | JGI24742J22300_100217933 | 142 |
| 548 | 3300002459 | JGI24751J29686_10052399 | JGI24751J29686_100523992 | 142 |
| 549 | 3300003349 | JGI26129J50193_1004962 | JGI26129J50193_10049622 | 142 |
| 550 | 3300003371 | JGI26145J50221_1012694 | JGI26145J50221_10126941 | 142 |
| 551 | 3300005290 | Ga0065712_10069903 | Ga0065712_100699034 | 142 |
| 552 | 3300005290 | Ga0065712_10084253 | Ga0065712_100842533 | 142 |
| 553 | 3300005293 | Ga0065715_10090726 | Ga0065715_100907263 | 142 |
| 554 | 3300005293 | Ga0065715_10193889 | Ga0065715_101938892 | 142 |
| 555 | 3300005295 | Ga0065707_10356031 | Ga0065707_103560312 | 142 |
| 556 | 3300005328 | Ga0070676_10009404 | Ga0070676_100094046 | 142 |
| 557 | 3300005329 | Ga0070683_100016231 | Ga0070683_1000162316 | 142 |
| 558 | 3300005329 | Ga0070683_100079030 | Ga0070683_1000790304 | 142 |
| 559 | 3300005330 | Ga0070690_100000972 | Ga0070690_10000097215 | 142 |
| 560 | 3300005330 | Ga0070690_100336286 | Ga0070690_1003362861 | 142 |
| 561 | 3300005331 | Ga0070670_100043184 | Ga0070670_1000431842 | 142 |
| 562 | 3300005331 | Ga0070670_100578111 | Ga0070670_1005781112 | 142 |
| 563 | 3300005333 | Ga0070677_10000624 | Ga0070677_1000062416 | 142 |
| 564 | 3300005334 | Ga0068869_100028165 | Ga0068869_1000281654 | 142 |
| 565 | 3300005336 | Ga0070680_100072254 | Ga0070680_1000722542 | 142 |
| 566 | 3300005336 | Ga0070680_101380952 | Ga0070680_1013809522 | 142 |
| 567 | 3300005337 | Ga0070682_100022243 | Ga0070682_1000222433 | 142 |
| 568 | 3300005337 | Ga0070682_100023896 | Ga0070682_1000238962 | 142 |
| 569 | 3300005338 | Ga0068868_100000287 | Ga0068868_10000028714 | 142 |
| 570 | 3300005339 | Ga0070660_100011348 | Ga0070660_1000113486 | 142 |
| 571 | 3300005339 | Ga0070660_100165868 | Ga0070660_1001658683 | 142 |
| 572 | 3300005340 | Ga0070689_100009382 | Ga0070689_1000093826 | 142 |
| 573 | 3300005340 | Ga0070689_100326596 | Ga0070689_1003265962 | 142 |
| 574 | 3300005341 | Ga0070691_10007546 | Ga0070691_100075465 | 142 |
| 575 | 3300005343 | Ga0070687_100006226 | Ga0070687_1000062264 | 142 |
| 576 | 3300005344 | Ga0070661_100014754 | Ga0070661_1000147544 | 142 |
| 577 | 3300005344 | Ga0070661_100211236 | Ga0070661_1002112361 | 142 |
| 578 | 3300005345 | Ga0070692_10003049 | Ga0070692_100030494 | 142 |
| 579 | 3300005347 | Ga0070668_100155994 | Ga0070668_1001559941 | 142 |
| 580 | 3300005353 | Ga0070669_100005691 | Ga0070669_10000569110 | 142 |
| 581 | 3300005354 | Ga0070675_100009027 | Ga0070675_1000090271 | 142 |
| 582 | 3300005354 | Ga0070675_101202319 | Ga0070675_1012023191 | 142 |
| 583 | 3300005355 | Ga0070671_100033279 | Ga0070671_1000332794 | 142 |
| 584 | 3300005355 | Ga0070671_100355244 | Ga0070671_1003552442 | 142 |
| 585 | 3300005356 | Ga0070674_100105413 | Ga0070674_1001054131 | 142 |
| 586 | 3300005356 | Ga0070674_100249689 | Ga0070674_1002496892 | 142 |
| 587 | 3300005364 | Ga0070673_100006385 | Ga0070673_1000063851 | 142 |
| 588 | 3300005364 | Ga0070673_100601432 | Ga0070673_1006014322 | 142 |
| 589 | 3300005365 | Ga0070688_100001436 | Ga0070688_1000014365 | 142 |
| 590 | 3300005365 | Ga0070688_100205308 | Ga0070688_1002053083 | 142 |
| 591 | 3300005365 | Ga0070688_100351961 | Ga0070688_1003519612 | 142 |
| 592 | 3300005366 | Ga0070659_100015882 | Ga0070659_1000158823 | 142 |
| 593 | 3300005367 | Ga0070667_100009541 | Ga0070667_1000095414 | 142 |
| 594 | 3300005367 | Ga0070667_100060283 | Ga0070667_1000602833 | 142 |
| 595 | 3300005367 | Ga0070667_100527864 | Ga0070667_1005278641 | 142 |
| 596 | 3300005434 | Ga0070709_10029359 | Ga0070709_100293592 | 142 |
| 597 | 3300005434 | Ga0070709_10195406 | Ga0070709_101954063 | 142 |
| 598 | 3300005434 | Ga0070709_10235293 | Ga0070709_102352932 | 142 |
| 599 | 3300005435 | Ga0070714_100619081 | Ga0070714_1006190811 | 142 |
| 600 | 3300005436 | Ga0070713_100039180 | Ga0070713_1000391802 | 142 |
| 601 | 3300005437 | Ga0070710_10056697 | Ga0070710_100566974 | 142 |
| 602 | 3300005438 | Ga0070701_10278410 | Ga0070701_102784102 | 142 |
| 603 | 3300005439 | Ga0070711_100030277 | Ga0070711_1000302774 | 142 |
| 604 | 3300005439 | Ga0070711_100459792 | Ga0070711_1004597922 | 142 |
| 605 | 3300005440 | Ga0070705_100028618 | Ga0070705_1000286184 | 142 |
| 606 | 3300005440 | Ga0070705_100033813 | Ga0070705_1000338134 | 142 |
| 607 | 3300005441 | Ga0070700_100084110 | Ga0070700_1000841101 | 142 |
| 608 | 3300005444 | Ga0070694_100003715 | Ga0070694_1000037156 | 142 |
| 609 | 3300005445 | Ga0070708_100129452 | Ga0070708_1001294524 | 142 |
| 610 | 3300005455 | Ga0070663_100007417 | Ga0070663_1000074177 | 142 |
| 611 | 3300005455 | Ga0070663_100088886 | Ga0070663_1000888862 | 142 |
| 612 | 3300005456 | Ga0070678_100004742 | Ga0070678_1000047426 | 142 |
| 613 | 3300005456 | Ga0070678_100005474 | Ga0070678_1000054743 | 142 |
| 614 | 3300005458 | Ga0070681_10005630 | Ga0070681_1000563011 | 142 |
| 615 | 3300005458 | Ga0070681_10018191 | Ga0070681_100181917 | 142 |
| 616 | 3300005459 | Ga0068867_100127668 | Ga0068867_1001276681 | 142 |
| 617 | 3300005459 | Ga0068867_101163386 | Ga0068867_1011633862 | 142 |
| 618 | 3300005466 | Ga0070685_10001963 | Ga0070685_100019634 | 142 |
| 619 | 3300005466 | Ga0070685_10147789 | Ga0070685_101477892 | 142 |
| 620 | 3300005466 | Ga0070685_11167658 | Ga0070685_111676581 | 142 |
| 621 | 3300005471 | Ga0070698_100594422 | Ga0070698_1005944223 | 142 |
| 622 | 3300005471 | Ga0070698_101557285 | Ga0070698_1015572851 | 142 |
| 623 | 3300005518 | Ga0070699_100552611 | Ga0070699_1005526112 | 142 |
| 624 | 3300005530 | Ga0070679_100028262 | Ga0070679_1000282621 | 142 |
| 625 | 3300005530 | Ga0070679_100265940 | Ga0070679_1002659402 | 142 |
| 626 | 3300005535 | Ga0070684_100075913 | Ga0070684_1000759133 | 142 |
| 627 | 3300005535 | Ga0070684_101036785 | Ga0070684_1010367851 | 142 |
| 628 | 3300005539 | Ga0068853_100033477 | Ga0068853_1000334774 | 142 |
| 629 | 3300005543 | Ga0070672_100008973 | Ga0070672_1000089738 | 142 |
| 630 | 3300005544 | Ga0070686_100038220 | Ga0070686_1000382203 | 142 |
| 631 | 3300005544 | Ga0070686_100089466 | Ga0070686_1000894663 | 142 |
| 632 | 3300005544 | Ga0070686_100157183 | Ga0070686_1001571832 | 142 |
| 633 | 3300005545 | Ga0070695_100112555 | Ga0070695_1001125551 | 142 |
| 634 | 3300005546 | Ga0070696_100006672 | Ga0070696_1000066724 | 142 |
| 635 | 3300005547 | Ga0070693_100003566 | Ga0070693_1000035664 | 142 |
| 636 | 3300005548 | Ga0070665_100014185 | Ga0070665_1000141856 | 142 |
| 637 | 3300005548 | Ga0070665_102623200 | Ga0070665_1026232001 | 142 |
| 638 | 3300005549 | Ga0070704_100086884 | Ga0070704_1000868841 | 142 |
| 639 | 3300005563 | Ga0068855_100031527 | Ga0068855_1000315274 | 142 |
| 640 | 3300005563 | Ga0068855_101717317 | Ga0068855_1017173172 | 142 |
| 641 | 3300005564 | Ga0070664_100071700 | Ga0070664_1000717003 | 142 |
| 642 | 3300005577 | Ga0068857_100006630 | Ga0068857_1000066305 | 142 |
| 643 | 3300005577 | Ga0068857_100452281 | Ga0068857_1004522812 | 142 |
| 644 | 3300005578 | Ga0068854_100141093 | Ga0068854_1001410931 | 142 |
| 645 | 3300005614 | Ga0068856_100037685 | Ga0068856_1000376854 | 142 |
| 646 | 3300005614 | Ga0068856_100248672 | Ga0068856_1002486722 | 142 |
| 647 | 3300005614 | Ga0068856_100444794 | Ga0068856_1004447942 | 142 |
| 648 | 3300005615 | Ga0070702_100091083 | Ga0070702_1000910831 | 142 |
| 649 | 3300005615 | Ga0070702_100355537 | Ga0070702_1003555372 | 142 |
| 650 | 3300005616 | Ga0068852_100010452 | Ga0068852_1000104525 | 142 |
| 651 | 3300005616 | Ga0068852_100576443 | Ga0068852_1005764432 | 142 |
| 652 | 3300005617 | Ga0068859_100054633 | Ga0068859_1000546334 | 142 |
| 653 | 3300005617 | Ga0068859_100484879 | Ga0068859_1004848792 | 142 |
| 654 | 3300005617 | Ga0068859_100510275 | Ga0068859_1005102752 | 142 |
| 655 | 3300005618 | Ga0068864_100026602 | Ga0068864_1000266023 | 142 |
| 656 | 3300005718 | Ga0068866_10007526 | Ga0068866_100075263 | 142 |
| 657 | 3300005718 | Ga0068866_10546016 | Ga0068866_105460162 | 142 |
| 658 | 3300005719 | Ga0068861_100007303 | Ga0068861_1000073035 | 142 |
| 659 | 3300005834 | Ga0068851_10298156 | Ga0068851_102981562 | 142 |
| 660 | 3300005840 | Ga0068870_10007593 | Ga0068870_100075933 | 142 |
| 661 | 3300005841 | Ga0068863_100045270 | Ga0068863_1000452701 | 142 |
| 662 | 3300005841 | Ga0068863_100580920 | Ga0068863_1005809202 | 142 |
| 663 | 3300005842 | Ga0068858_100064184 | Ga0068858_1000641843 | 142 |
| 664 | 3300005842 | Ga0068858_100265133 | Ga0068858_1002651332 | 142 |
| 665 | 3300005843 | Ga0068860_100015452 | Ga0068860_1000154524 | 142 |
| 666 | 3300005843 | Ga0068860_100320286 | Ga0068860_1003202862 | 142 |
| 667 | 3300005844 | Ga0068862_100015822 | Ga0068862_1000158226 | 142 |
| 668 | 3300005844 | Ga0068862_100275368 | Ga0068862_1002753683 | 142 |
| 669 | 3300005937 | Ga0081455_10006976 | Ga0081455_100069767 | 142 |
| 670 | 3300005937 | Ga0081455_10123738 | Ga0081455_101237382 | 142 |
| 671 | 3300005983 | Ga0081540_1005655 | Ga0081540_10056552 | 142 |
| 672 | 3300006028 | Ga0070717_10236827 | Ga0070717_102368272 | 142 |
| 673 | 3300006048 | Ga0075363_100073902 | Ga0075363_1000739023 | 142 |
| 674 | 3300006048 | Ga0075363_100356897 | Ga0075363_1003568972 | 142 |
| 675 | 3300006058 | Ga0075432_10106569 | Ga0075432_101065692 | 142 |
| 676 | 3300006163 | Ga0070715_10014758 | Ga0070715_100147583 | 142 |
| 677 | 3300006163 | Ga0070715_10691862 | Ga0070715_106918622 | 142 |
| 678 | 3300006173 | Ga0070716_100009019 | Ga0070716_1000090192 | 142 |
| 679 | 3300006175 | Ga0070712_100183986 | Ga0070712_1001839862 | 142 |
| 680 | 3300006175 | Ga0070712_100315604 | Ga0070712_1003156042 | 142 |
| 681 | 3300006178 | Ga0075367_10063419 | Ga0075367_100634194 | 142 |
| 682 | 3300006178 | Ga0075367_10973832 | Ga0075367_109738321 | 142 |
| 683 | 3300006194 | Ga0075427_10003835 | Ga0075427_100038353 | 142 |
| 684 | 3300006237 | Ga0097621_100180771 | Ga0097621_1001807713 | 142 |
| 685 | 3300006353 | Ga0075370_10138142 | Ga0075370_101381422 | 142 |
| 686 | 3300006358 | Ga0068871_100000922 | Ga0068871_10000092218 | 142 |
| 687 | 3300006358 | Ga0068871_100208014 | Ga0068871_1002080142 | 142 |
| 688 | 3300006358 | Ga0068871_100961362 | Ga0068871_1009613622 | 142 |
| 689 | 3300006844 | Ga0075428_100017044 | Ga0075428_1000170443 | 142 |
| 690 | 3300006846 | Ga0075430_100004240 | Ga0075430_1000042409 | 142 |
| 691 | 3300006847 | Ga0075431_100237644 | Ga0075431_1002376443 | 142 |
| 692 | 3300006852 | Ga0075433_10003318 | Ga0075433_100033189 | 142 |
| 693 | 3300006852 | Ga0075433_10379103 | Ga0075433_103791032 | 142 |
| 694 | 3300006871 | Ga0075434_100001367 | Ga0075434_10000136718 | 142 |
| 695 | 3300006871 | Ga0075434_100003881 | Ga0075434_1000038819 | 142 |
| 696 | 3300006871 | Ga0075434_100298045 | Ga0075434_1002980452 | 142 |
| 697 | 3300006871 | Ga0075434_100719358 | Ga0075434_1007193581 | 142 |
| 698 | 3300006871 | Ga0075434_101122493 | Ga0075434_1011224931 | 142 |
| 699 | 3300006880 | Ga0075429_100008546 | Ga0075429_1000085469 | 142 |
| 700 | 3300006881 | Ga0068865_100020346 | Ga0068865_1000203462 | 142 |
| 701 | 3300006931 | Ga0097620_100054629 | Ga0097620_1000546294 | 142 |
| 702 | 3300006931 | Ga0097620_100484892 | Ga0097620_1004848922 | 142 |
| 703 | 3300006931 | Ga0097620_100510258 | Ga0097620_1005102582 | 142 |
| 704 | 3300007076 | Ga0075435_100068616 | Ga0075435_1000686163 | 142 |
| 705 | 3300007076 | Ga0075435_100220222 | Ga0075435_1002202222 | 142 |
| 706 | 3300007076 | Ga0075435_100469057 | Ga0075435_1004690572 | 142 |
| 707 | 3300007076 | Ga0075435_101550961 | Ga0075435_1015509611 | 142 |
| 708 | 3300009011 | Ga0105251_10044171 | Ga0105251_100441712 | 142 |
| 709 | 3300009011 | Ga0105251_10355454 | Ga0105251_103554541 | 142 |
| 710 | 3300009011 | Ga0105251_10464508 | Ga0105251_104645081 | 142 |
| 711 | 3300009036 | Ga0105244_10018443 | Ga0105244_100184434 | 142 |
| 712 | 3300009036 | Ga0105244_10128202 | Ga0105244_101282022 | 142 |
| 713 | 3300009093 | Ga0105240_10223606 | Ga0105240_102236064 | 142 |
| 714 | 3300009093 | Ga0105240_11242884 | Ga0105240_112428842 | 142 |
| 715 | 3300009094 | Ga0111539_10002796 | Ga0111539_100027962 | 142 |
| 716 | 3300009094 | Ga0111539_10053737 | Ga0111539_100537374 | 142 |
| 717 | 3300009094 | Ga0111539_10072106 | Ga0111539_100721066 | 142 |
| 718 | 3300009094 | Ga0111539_10603706 | Ga0111539_106037062 | 142 |
| 719 | 3300009094 | Ga0111539_12263764 | Ga0111539_122637641 | 142 |
| 720 | 3300009098 | Ga0105245_10004252 | Ga0105245_1000425212 | 142 |
| 721 | 3300009098 | Ga0105245_10068509 | Ga0105245_100685092 | 142 |
| 722 | 3300009098 | Ga0105245_11246174 | Ga0105245_112461742 | 142 |
| 723 | 3300009101 | Ga0105247_10042814 | Ga0105247_100428142 | 142 |
| 724 | 3300009101 | Ga0105247_10774410 | Ga0105247_107744102 | 142 |
| 725 | 3300009147 | Ga0114129_10029650 | Ga0114129_100296509 | 142 |
| 726 | 3300009147 | Ga0114129_10079232 | Ga0114129_100792324 | 142 |
| 727 | 3300009148 | Ga0105243_10016347 | Ga0105243_100163474 | 142 |
| 728 | 3300009148 | Ga0105243_10019863 | Ga0105243_100198635 | 142 |
| 729 | 3300009174 | Ga0105241_10021402 | Ga0105241_100214024 | 142 |
| 730 | 3300009174 | Ga0105241_10048036 | Ga0105241_100480362 | 142 |
| 731 | 3300009176 | Ga0105242_10045458 | Ga0105242_100454583 | 142 |
| 732 | 3300009176 | Ga0105242_10532664 | Ga0105242_105326642 | 142 |
| 733 | 3300009177 | Ga0105248_10034642 | Ga0105248_100346424 | 142 |
| 734 | 3300009177 | Ga0105248_10110124 | Ga0105248_101101243 | 142 |
| 735 | 3300009177 | Ga0105248_11283656 | Ga0105248_112836562 | 142 |
| 736 | 3300009545 | Ga0105237_10008357 | Ga0105237_1000835713 | 142 |
| 737 | 3300009545 | Ga0105237_10596307 | Ga0105237_105963073 | 142 |
| 738 | 3300009551 | Ga0105238_10058732 | Ga0105238_100587324 | 142 |
| 739 | 3300009553 | Ga0105249_10029412 | Ga0105249_100294122 | 142 |
| 740 | 3300009553 | Ga0105249_10152330 | Ga0105249_101523302 | 142 |
| 741 | 3300010375 | Ga0105239_10025073 | Ga0105239_100250734 | 142 |
| 742 | 3300010375 | Ga0105239_10519024 | Ga0105239_105190243 | 142 |
| 743 | 3300010375 | Ga0105239_10834275 | Ga0105239_108342752 | 142 |
| 744 | 3300011119 | Ga0105246_10356309 | Ga0105246_103563091 | 142 |
| 745 | 3300012480 | Ga0157346_1004633 | Ga0157346_10046332 | 142 |
| 746 | 3300012481 | Ga0157320_1038679 | Ga0157320_10386791 | 142 |
| 747 | 3300012500 | Ga0157314_1003712 | Ga0157314_10037122 | 142 |
| 748 | 3300012503 | Ga0157313_1004711 | Ga0157313_10047112 | 142 |
| 749 | 3300013100 | Ga0157373_10007606 | Ga0157373_100076064 | 142 |
| 750 | 3300013105 | Ga0157369_10196398 | Ga0157369_101963983 | 142 |
| 751 | 3300013105 | Ga0157369_10589036 | Ga0157369_105890362 | 142 |
| 752 | 3300013296 | Ga0157374_10015848 | Ga0157374_100158487 | 142 |
| 753 | 3300013297 | Ga0157378_10007970 | Ga0157378_100079704 | 142 |
| 754 | 3300013297 | Ga0157378_10032054 | Ga0157378_100320545 | 142 |
| 755 | 3300013306 | Ga0163162_11218121 | Ga0163162_112181212 | 142 |
| 756 | 3300013307 | Ga0157372_10016528 | Ga0157372_100165289 | 142 |
| 757 | 3300013308 | Ga0157375_10017624 | Ga0157375_100176246 | 142 |
| 758 | 3300013308 | Ga0157375_10397256 | Ga0157375_103972562 | 142 |
| 759 | 3300014325 | Ga0163163_10001820 | Ga0163163_100018205 | 142 |
| 760 | 3300014325 | Ga0163163_10369436 | Ga0163163_103694363 | 142 |
| 761 | 3300014326 | Ga0157380_10009315 | Ga0157380_100093157 | 142 |
| 762 | 3300014326 | Ga0157380_10136692 | Ga0157380_101366921 | 142 |
| 763 | 3300014968 | Ga0157379_10001178 | Ga0157379_100011784 | 142 |
| 764 | 3300014969 | Ga0157376_10195812 | Ga0157376_101958122 | 142 |
| 765 | 3300017792 | Ga0163161_10175653 | Ga0163161_101756532 | 142 |
| 766 | 3300025290 | Ga0207673_1000112 | Ga0207673_10001123 | 142 |
| 767 | 3300025315 | Ga0207697_10000579 | Ga0207697_1000057920 | 142 |
| 768 | 3300025321 | Ga0207656_10286347 | Ga0207656_102863472 | 142 |
| 769 | 3300025711 | Ga0207696_1115583 | Ga0207696_11155831 | 142 |
| 770 | 3300025735 | Ga0207713_1219860 | Ga0207713_12198602 | 142 |
| 771 | 3300025735 | Ga0207713_1237877 | Ga0207713_12378771 | 142 |
| 772 | 3300025893 | Ga0207682_10008278 | Ga0207682_100082782 | 142 |
| 773 | 3300025898 | Ga0207692_10258580 | Ga0207692_102585802 | 142 |
| 774 | 3300025899 | Ga0207642_10013446 | Ga0207642_100134464 | 142 |
| 775 | 3300025899 | Ga0207642_10023805 | Ga0207642_100238051 | 142 |
| 776 | 3300025900 | Ga0207710_10025350 | Ga0207710_100253503 | 142 |
| 777 | 3300025900 | Ga0207710_10088542 | Ga0207710_100885422 | 142 |
| 778 | 3300025901 | Ga0207688_10001006 | Ga0207688_100010065 | 142 |
| 779 | 3300025903 | Ga0207680_10131226 | Ga0207680_101312263 | 142 |
| 780 | 3300025904 | Ga0207647_10025960 | Ga0207647_100259604 | 142 |
| 781 | 3300025906 | Ga0207699_10705616 | Ga0207699_107056162 | 142 |
| 782 | 3300025907 | Ga0207645_10001020 | Ga0207645_1000102022 | 142 |
| 783 | 3300025907 | Ga0207645_10058013 | Ga0207645_100580132 | 142 |
| 784 | 3300025908 | Ga0207643_10000523 | Ga0207643_1000052322 | 142 |
| 785 | 3300025911 | Ga0207654_10047157 | Ga0207654_100471574 | 142 |
| 786 | 3300025912 | Ga0207707_10018497 | Ga0207707_100184972 | 142 |
| 787 | 3300025912 | Ga0207707_10046164 | Ga0207707_100461643 | 142 |
| 788 | 3300025912 | Ga0207707_10161758 | Ga0207707_101617582 | 142 |
| 789 | 3300025913 | Ga0207695_10321834 | Ga0207695_103218342 | 142 |
| 790 | 3300025914 | Ga0207671_10113380 | Ga0207671_101133804 | 142 |
| 791 | 3300025914 | Ga0207671_10445696 | Ga0207671_104456962 | 142 |
| 792 | 3300025915 | Ga0207693_10008072 | Ga0207693_100080725 | 142 |
| 793 | 3300025916 | Ga0207663_10056960 | Ga0207663_100569602 | 142 |
| 794 | 3300025916 | Ga0207663_10420334 | Ga0207663_104203342 | 142 |
| 795 | 3300025916 | Ga0207663_10632256 | Ga0207663_106322562 | 142 |
| 796 | 3300025917 | Ga0207660_10014892 | Ga0207660_100148925 | 142 |
| 797 | 3300025917 | Ga0207660_10072595 | Ga0207660_100725952 | 142 |
| 798 | 3300025917 | Ga0207660_10154346 | Ga0207660_101543463 | 142 |
| 799 | 3300025918 | Ga0207662_10002710 | Ga0207662_100027106 | 142 |
| 800 | 3300025919 | Ga0207657_10005692 | Ga0207657_100056924 | 142 |
| 801 | 3300025919 | Ga0207657_10243838 | Ga0207657_102438382 | 142 |
| 802 | 3300025920 | Ga0207649_10004225 | Ga0207649_100042253 | 142 |
| 803 | 3300025921 | Ga0207652_10018458 | Ga0207652_100184584 | 142 |
| 804 | 3300025921 | Ga0207652_10167164 | Ga0207652_101671642 | 142 |
| 805 | 3300025923 | Ga0207681_10004280 | Ga0207681_100042805 | 142 |
| 806 | 3300025924 | Ga0207694_10280897 | Ga0207694_102808972 | 142 |
| 807 | 3300025925 | Ga0207650_10003662 | Ga0207650_100036628 | 142 |
| 808 | 3300025925 | Ga0207650_10107215 | Ga0207650_101072153 | 142 |
| 809 | 3300025925 | Ga0207650_10834846 | Ga0207650_108348461 | 142 |
| 810 | 3300025926 | Ga0207659_10002130 | Ga0207659_100021309 | 142 |
| 811 | 3300025927 | Ga0207687_10010078 | Ga0207687_100100784 | 142 |
| 812 | 3300025927 | Ga0207687_11033971 | Ga0207687_110339711 | 142 |
| 813 | 3300025928 | Ga0207700_10051330 | Ga0207700_100513302 | 142 |
| 814 | 3300025929 | Ga0207664_10256980 | Ga0207664_102569803 | 142 |
| 815 | 3300025931 | Ga0207644_10006560 | Ga0207644_100065604 | 142 |
| 816 | 3300025931 | Ga0207644_10046794 | Ga0207644_100467942 | 142 |
| 817 | 3300025932 | Ga0207690_10003881 | Ga0207690_100038817 | 142 |
| 818 | 3300025932 | Ga0207690_10262440 | Ga0207690_102624403 | 142 |
| 819 | 3300025933 | Ga0207706_10004561 | Ga0207706_1000456115 | 142 |
| 820 | 3300025934 | Ga0207686_10002841 | Ga0207686_100028416 | 142 |
| 821 | 3300025934 | Ga0207686_10084799 | Ga0207686_100847992 | 142 |
| 822 | 3300025935 | Ga0207709_10003952 | Ga0207709_100039524 | 142 |
| 823 | 3300025936 | Ga0207670_10020819 | Ga0207670_100208194 | 142 |
| 824 | 3300025937 | Ga0207669_10000737 | Ga0207669_100007373 | 142 |
| 825 | 3300025938 | Ga0207704_10005685 | Ga0207704_100056856 | 142 |
| 826 | 3300025938 | Ga0207704_10265516 | Ga0207704_102655161 | 142 |
| 827 | 3300025939 | Ga0207665_10005721 | Ga0207665_100057213 | 142 |
| 828 | 3300025939 | Ga0207665_10434307 | Ga0207665_104343073 | 142 |
| 829 | 3300025940 | Ga0207691_10004854 | Ga0207691_1000485415 | 142 |
| 830 | 3300025941 | Ga0207711_10009494 | Ga0207711_100094947 | 142 |
| 831 | 3300025941 | Ga0207711_10073214 | Ga0207711_100732144 | 142 |
| 832 | 3300025941 | Ga0207711_10127495 | Ga0207711_101274952 | 142 |
| 833 | 3300025942 | Ga0207689_10001399 | Ga0207689_1000139923 | 142 |
| 834 | 3300025944 | Ga0207661_10020336 | Ga0207661_100203363 | 142 |
| 835 | 3300025944 | Ga0207661_10123169 | Ga0207661_101231692 | 142 |
| 836 | 3300025945 | Ga0207679_10000829 | Ga0207679_1000082918 | 142 |
| 837 | 3300025949 | Ga0207667_10057202 | Ga0207667_100572024 | 142 |
| 838 | 3300025960 | Ga0207651_10006082 | Ga0207651_100060823 | 142 |
| 839 | 3300025961 | Ga0207712_10180598 | Ga0207712_101805983 | 142 |
| 840 | 3300025961 | Ga0207712_10458195 | Ga0207712_104581952 | 142 |
| 841 | 3300025972 | Ga0207668_10002780 | Ga0207668_100027809 | 142 |
| 842 | 3300025981 | Ga0207640_10003641 | Ga0207640_100036414 | 142 |
| 843 | 3300025986 | Ga0207658_10014267 | Ga0207658_100142674 | 142 |
| 844 | 3300025986 | Ga0207658_10052210 | Ga0207658_100522103 | 142 |
| 845 | 3300025986 | Ga0207658_10341638 | Ga0207658_103416382 | 142 |
| 846 | 3300026023 | Ga0207677_10092877 | Ga0207677_100928773 | 142 |
| 847 | 3300026035 | Ga0207703_10005080 | Ga0207703_100050808 | 142 |
| 848 | 3300026035 | Ga0207703_10201956 | Ga0207703_102019562 | 142 |
| 849 | 3300026041 | Ga0207639_10036135 | Ga0207639_100361353 | 142 |
| 850 | 3300026041 | Ga0207639_10916842 | Ga0207639_109168421 | 142 |
| 851 | 3300026067 | Ga0207678_10001694 | Ga0207678_1000169419 | 142 |
| 852 | 3300026067 | Ga0207678_10012983 | Ga0207678_100129839 | 142 |
| 853 | 3300026075 | Ga0207708_10003453 | Ga0207708_100034534 | 142 |
| 854 | 3300026075 | Ga0207708_10315477 | Ga0207708_103154772 | 142 |
| 855 | 3300026078 | Ga0207702_10010469 | Ga0207702_100104695 | 142 |
| 856 | 3300026078 | Ga0207702_10038277 | Ga0207702_100382772 | 142 |
| 857 | 3300026078 | Ga0207702_10310197 | Ga0207702_103101972 | 142 |
| 858 | 3300026088 | Ga0207641_10165514 | Ga0207641_101655142 | 142 |
| 859 | 3300026088 | Ga0207641_10616601 | Ga0207641_106166012 | 142 |
| 860 | 3300026088 | Ga0207641_10835457 | Ga0207641_108354572 | 142 |
| 861 | 3300026089 | Ga0207648_10002393 | Ga0207648_100023934 | 142 |
| 862 | 3300026095 | Ga0207676_10005110 | Ga0207676_100051106 | 142 |
| 863 | 3300026095 | Ga0207676_10118340 | Ga0207676_101183402 | 142 |
| 864 | 3300026116 | Ga0207674_10058986 | Ga0207674_100589864 | 142 |
| 865 | 3300026118 | Ga0207675_100001715 | Ga0207675_10000171519 | 142 |
| 866 | 3300026121 | Ga0207683_10001190 | Ga0207683_1000119019 | 142 |
| 867 | 3300026121 | Ga0207683_10028744 | Ga0207683_100287444 | 142 |
| 868 | 3300026142 | Ga0207698_10370313 | Ga0207698_103703133 | 142 |
| 869 | 3300026142 | Ga0207698_10536497 | Ga0207698_105364972 | 142 |
| 870 | 3300027552 | Ga0209982_1004172 | Ga0209982_10041724 | 142 |
| 871 | 3300027614 | Ga0209970_1016555 | Ga0209970_10165552 | 142 |
| 872 | 3300027617 | Ga0210002_1000122 | Ga0210002_10001223 | 142 |
| 873 | 3300027665 | Ga0209983_1017838 | Ga0209983_10178383 | 142 |
| 874 | 3300027866 | Ga0209813_10049551 | Ga0209813_100495512 | 142 |
| 875 | 3300027876 | Ga0209974_10000486 | Ga0209974_1000048613 | 142 |
| 876 | 3300027907 | Ga0207428_10000216 | Ga0207428_1000021635 | 142 |
| 877 | 3300027907 | Ga0207428_10019935 | Ga0207428_100199355 | 142 |
| 878 | 3300028379 | Ga0268266_10016607 | Ga0268266_100166075 | 142 |
| 879 | 3300028379 | Ga0268266_10159361 | Ga0268266_101593611 | 142 |
| 880 | 3300028380 | Ga0268265_10068406 | Ga0268265_100684063 | 142 |
| 881 | 3300028381 | Ga0268264_10009868 | Ga0268264_100098683 | 142 |
| 882 | 3300028381 | Ga0268264_10758583 | Ga0268264_107585832 | 142 |
| 883 | 3300028556 | Ga0265337_1003693 | Ga0265337_10036934 | 142 |
| 884 | 3300028800 | Ga0265338_10134384 | Ga0265338_101343844 | 142 |
| 885 | 3300028800 | Ga0265338_10239102 | Ga0265338_102391022 | 142 |
| 886 | 3300028800 | Ga0265338_10361182 | Ga0265338_103611822 | 142 |
| 887 | 3300031241 | Ga0265325_10000048 | Ga0265325_1000004886 | 142 |
| 888 | 3300031247 | Ga0265340_10241478 | Ga0265340_102414782 | 142 |
| 889 | 3300031247 | Ga0265340_10442588 | Ga0265340_104425881 | 142 |
| 890 | 3300031344 | Ga0265316_10192081 | Ga0265316_101920812 | 142 |
| 891 | 3300031595 | Ga0265313_10000438 | Ga0265313_1000043816 | 142 |
| 892 | 3300031595 | Ga0265313_10056387 | Ga0265313_100563872 | 142 |
| 893 | 3300031691 | Ga0316579_10020080 | Ga0316579_100200803 | 142 |
| 894 | 3300032002 | Ga0307416_102297468 | Ga0307416_1022974681 | 142 |
| 895 | 3300034816 | Ga0373930_0012045 | Ga0373930_0012045_1119_1547 | 142 |
| 896 | 3300034819 | Ga0373958_0004911 | Ga0373958_0004911_1466_1894 | 142 |
| 897 | 3300035083 | Ga0373926_0021720 | Ga0373926_0021720_1064_1492 | 142 |
| 898 | 3300035084 | Ga0373928_0004171 | Ga0373928_0004171_1912_2340 | 142 |
| 899 | 3300035086 | Ga0373934_0111102 | Ga0373934_0111102_362_790 | 142 |
| 900 | 3300035088 | Ga0373940_0001993 | Ga0373940_0001993_1289_1717 | 142 |
| 901 | 3300035090 | Ga0373949_0027043 | Ga0373949_0027043_57_485 | 142 |
| 902 | 3300035090 | Ga0373949_0040187 | Ga0373949_0040187_577_1005 | 142 |
| 903 | 3300035092 | Ga0373952_0026576 | Ga0373952_0026576_436_864 | 142 |
| 904 | 3300035111 | Ga0373923_0001890 | Ga0373923_0001890_807_1235 | 142 |
| 905 | 3300035112 | Ga0373932_0003391 | Ga0373932_0003391_1470_1898 | 142 |
| 906 | 3300035112 | Ga0373932_0093955 | Ga0373932_0093955_282_770 | 142 |
| 907 | 3300035113 | Ga0373936_0001798 | Ga0373936_0001798_3730_4158 | 142 |
| 908 | 3300035114 | Ga0373939_0001329 | Ga0373939_0001329_3156_3584 | 142 |
| 909 | 3300035114 | Ga0373939_0002892 | Ga0373939_0002892_826_1257 | 142 |
| 910 | 3300035116 | Ga0373945_0003540 | Ga0373945_0003540_1457_1885 | 142 |
| 911 | 3300035118 | Ga0373954_0015360 | Ga0373954_0015360_2939_3367 | 142 |
| 912 | 3300035118 | Ga0373954_0111502 | Ga0373954_0111502_313_741 | 142 |
| 913 | 3300035118 | Ga0373954_0350883 | Ga0373954_0350883_197_625 | 142 |
| 914 | 3300035119 | Ga0373956_0123625 | Ga0373956_0123625_600_1028 | 142 |
| 915 | 3300035120 | Ga0373957_0054574 | Ga0373957_0054574_805_1233 | 142 |
| 916 | 3300035121 | Ga0373960_0062962 | Ga0373960_0062962_577_1005 | 142 |
| 917 | 3300035121 | Ga0373960_0234755 | Ga0373960_0234755_67_495 | 142 |
| 918 | 3300035170 | Ga0373943_0005045 | Ga0373943_0005045_4226_4654 | 142 |
| 919 | 3300035171 | Ga0373946_0001530 | Ga0373946_0001530_2242_2670 | 142 |
| 920 | 3300035172 | Ga0373955_0036131 | Ga0373955_0036131_1500_1928 | 142 |
| 921 | 3300035172 | Ga0373955_0095953 | Ga0373955_0095953_921_1349 | 142 |
| 922 | 3300035207 | Ga0373942_0015907 | Ga0373942_0015907_1180_1608 | 142 |
| 923 | 3300035207 | Ga0373942_0026694 | Ga0373942_0026694_110_538 | 142 |
| 924 | 3300035207 | Ga0373942_0372320 | Ga0373942_0372320_62_490 | 142 |
| 925 | 3300035242 | Ga0373962_0001705 | Ga0373962_0001705_577_1005 | 142 |
| 926 | 3300035242 | Ga0373962_0033329 | Ga0373962_0033329_385_813 | 142 |
| 927 | 3300035410 | Ga0373924_0028607 | Ga0373924_0028607_1085_1513 | 142 |
| 928 | 3300035691 | Ga0373931_0046111 | Ga0373931_0046111_931_1359 | 142 |
| 929 | 3300035692 | Ga0373935_0003239 | Ga0373935_0003239_3175_3603 | 142 |
| 930 | 3300035692 | Ga0373935_0041202 | Ga0373935_0041202_139_567 | 142 |
| 931 | 3300035695 | Ga0373927_0008421 | Ga0373927_0008421_2905_3333 | 142 |
| 932 | 3300035695 | Ga0373927_0289826 | Ga0373927_0289826_455_883 | 142 |
| 933 | 3300035724 | Ga0373933_0113728 | Ga0373933_0113728_342_770 | 142 |
| 934 | 3300035725 | Ga0373947_0008462 | Ga0373947_0008462_3367_3795 | 142 |
| 935 | 3300035725 | Ga0373947_0011056 | Ga0373947_0011056_2717_3145 | 142 |
| 936 | 3300036401 | Ga0373937_0048364 | Ga0373937_0048364_2044_2472 | 142 |
| 937 | 3300036401 | Ga0373937_0272923 | Ga0373937_0272923_159_587 | 142 |
| 938 | 3300036647 | Ga0316582_0316671 | Ga0316582_0316671_512_940 | 142 |
| 939 | 3300037068 | Ga0373925_0002135 | Ga0373925_0002135_4426_4854 | 142 |
| 940 | 3300037068 | Ga0373925_0095869 | Ga0373925_0095869_953_1381 | 142 |
| 941 | 3300037068 | Ga0373925_1193336 | Ga0373925_1193336_112_540 | 142 |
| 942 | 3300037588 | Ga0316581_0153089 | Ga0316581_0153089_246_674 | 142 |
| 943 | 3300037853 | Ga0436364_0031906 | Ga0436364_0031906_225_653 | 142 |
| 944 | 3300039453 | Ga0436362_0886180 | Ga0436362_0886180_28_456 | 142 |
| 945 | 3300042015 | Ga0439462_0180204 | Ga0439462_0180204_148_576 | 142 |
| 946 | 3300046452 | Ga0495617_027330 | Ga0495617_027330_581_1009 | 142 |
| 947 | 3300046454 | Ga0495592_0001176 | Ga0495592_0001176_2302_2730 | 142 |
| 948 | 3300046454 | Ga0495592_0018792 | Ga0495592_0018792_1105_1533 | 142 |
| 949 | 3300046455 | Ga0495603_0426702 | Ga0495603_0426702_207_635 | 142 |
| 950 | 3300046459 | Ga0495629_0002326 | Ga0495629_0002326_9580_10008 | 142 |
| 951 | 3300046459 | Ga0495629_0027088 | Ga0495629_0027088_1416_1844 | 142 |
| 952 | 3300046461 | Ga0495641_0003224 | Ga0495641_0003224_10367_10795 | 142 |
| 953 | 3300046462 | Ga0495651_0014804 | Ga0495651_0014804_3632_4060 | 142 |
| 954 | 3300046462 | Ga0495651_0321825 | Ga0495651_0321825_391_819 | 142 |
| 955 | 3300046463 | Ga0495653_0012022 | Ga0495653_0012022_1781_2209 | 142 |
| 956 | 3300046463 | Ga0495653_0251071 | Ga0495653_0251071_113_541 | 142 |
| 957 | 3300046463 | Ga0495653_0405216 | Ga0495653_0405216_262_690 | 142 |
| 958 | 3300046472 | Ga0495580_0020532 | Ga0495580_0020532_3666_4094 | 142 |
| 959 | 3300046473 | Ga0495582_0012004 | Ga0495582_0012004_1556_1984 | 142 |
| 960 | 3300046473 | Ga0495582_0032157 | Ga0495582_0032157_997_1425 | 142 |
| 961 | 3300046475 | Ga0495639_0007594 | Ga0495639_0007594_3165_3593 | 142 |
| 962 | 3300046476 | Ga0495662_0006908 | Ga0495662_0006908_614_1042 | 142 |
| 963 | 3300046477 | Ga0495664_0007982 | Ga0495664_0007982_1178_1606 | 142 |
| 964 | 3300046477 | Ga0495664_0203578 | Ga0495664_0203578_563_991 | 142 |
| 965 | 3300046491 | Ga0495584_0067390 | Ga0495584_0067390_581_1009 | 142 |
| 966 | 3300046491 | Ga0495584_0178697 | Ga0495584_0178697_353_781 | 142 |
| 967 | 3300046492 | Ga0495585_0038970 | Ga0495585_0038970_648_1076 | 142 |
| 968 | 3300046499 | Ga0495594_0031273 | Ga0495594_0031273_509_937 | 142 |
| 969 | 3300046499 | Ga0495594_0065658 | Ga0495594_0065658_180_608 | 142 |
| 970 | 3300046511 | Ga0495608_0702474 | Ga0495608_0702474_66_494 | 142 |
| 971 | 3300046513 | Ga0495616_0162135 | Ga0495616_0162135_463_891 | 142 |
| 972 | 3300046514 | Ga0495618_0022415 | Ga0495618_0022415_1340_1768 | 142 |
| 973 | 3300046516 | Ga0495628_0012601 | Ga0495628_0012601_3832_4260 | 142 |
| 974 | 3300046516 | Ga0495628_0014768 | Ga0495628_0014768_1584_2012 | 142 |
| 975 | 3300046520 | Ga0495637_0024298 | Ga0495637_0024298_1143_1571 | 142 |
| 976 | 3300046520 | Ga0495637_0118637 | Ga0495637_0118637_479_916 | 142 |
| 977 | 3300046523 | Ga0495644_0010451 | Ga0495644_0010451_1009_1437 | 142 |
| 978 | 3300046525 | Ga0495663_0004223 | Ga0495663_0004223_2068_2496 | 142 |
| 979 | 3300046529 | Ga0495652_0013444 | Ga0495652_0013444_3050_3478 | 142 |
| 980 | 3300046529 | Ga0495652_0090103 | Ga0495652_0090103_266_694 | 142 |
| 981 | 3300046531 | Ga0495665_0006037 | Ga0495665_0006037_2227_2655 | 142 |
| 982 | 3300046535 | Ga0495586_0006303 | Ga0495586_0006303_4310_4738 | 142 |
| 983 | 3300046536 | Ga0495587_0020363 | Ga0495587_0020363_2046_2474 | 142 |
| 984 | 3300046537 | Ga0495598_0015646 | Ga0495598_0015646_1126_1554 | 142 |
| 985 | 3300046538 | Ga0495609_0147907 | Ga0495609_0147907_464_892 | 142 |
| 986 | 3300046539 | Ga0495621_0078562 | Ga0495621_0078562_147_575 | 142 |
| 987 | 3300046543 | Ga0495645_0062076 | Ga0495645_0062076_515_943 | 142 |
| 988 | 3300046557 | Ga0495622_0010562 | Ga0495622_0010562_2932_3360 | 142 |
| 989 | 3300046558 | Ga0495633_0019514 | Ga0495633_0019514_2106_2534 | 142 |
| 990 | 3300046559 | Ga0495667_0006887 | Ga0495667_0006887_5383_5811 | 142 |
| 991 | 3300046559 | Ga0495667_0117346 | Ga0495667_0117346_640_1068 | 142 |
| 992 | 3300046615 | Ga0495656_0001344 | Ga0495656_0001344_3828_4256 | 142 |
| 993 | 3300046642 | Ga0495634_0009991 | Ga0495634_0009991_5647_6075 | 142 |
| 994 | 3300046648 | Ga0495611_0007418 | Ga0495611_0007418_3725_4153 | 142 |
| 995 | 3300046663 | Ga0495635_0062421 | Ga0495635_0062421_1336_1764 | 142 |
| 996 | 3300046663 | Ga0495635_0199435 | Ga0495635_0199435_135_563 | 142 |
| 997 | 3300046664 | Ga0495659_0001817 | Ga0495659_0001817_2409_2837 | 142 |
| 998 | 3300046674 | Ga0495588_0002846 | Ga0495588_0002846_1722_2150 | 142 |
| 999 | 3300046675 | Ga0495657_0534861 | Ga0495657_0534861_73_501 | 142 |
| 1000 | 3300046678 | Ga0495599_0010609 | Ga0495599_0010609_3984_4412 | 142 |
| 1001 | 3300046678 | Ga0495599_0020143 | Ga0495599_0020143_1714_2142 | 142 |
| 1002 | 3300046679 | Ga0495623_0050706 | Ga0495623_0050706_774_1202 | 142 |
| 1003 | 3300046680 | Ga0495646_0009173 | Ga0495646_0009173_1831_2259 | 142 |
| 1004 | 3300046681 | Ga0495647_0001804 | Ga0495647_0001804_922_1350 | 142 |
| 1005 | 3300046683 | Ga0495658_0006028 | Ga0495658_0006028_1186_1614 | 142 |
| 1006 | 3300046684 | Ga0495669_0073885 | Ga0495669_0073885_680_1108 | 142 |
| 1007 | 3300046689 | Ga0495613_0093005 | Ga0495613_0093005_1665_2093 | 142 |
| 1008 | 3300046690 | Ga0495624_0026834 | Ga0495624_0026834_1708_2136 | 142 |
| 1009 | 3300046691 | Ga0495670_0005161 | Ga0495670_0005161_2252_2680 | 142 |
| 1010 | 3300046794 | Ga0495589_0404245 | Ga0495589_0404245_117_545 | 142 |
| 1011 | 3300046809 | Ga0495600_0008802 | Ga0495600_0008802_4706_5134 | 142 |
| 1012 | 3300046809 | Ga0495600_0118383 | Ga0495600_0118383_766_1194 | 142 |
| 1013 | 3300046809 | Ga0495600_0208072 | Ga0495600_0208072_262_690 | 142 |
| 1014 | 3300047315 | Ga0495581_0009356 | Ga0495581_0009356_5062_5490 | 142 |
| 1015 | 3300047317 | Ga0495604_0018521 | Ga0495604_0018521_137_565 | 142 |
| 1016 | 3300047321 | Ga0495676_0128194 | Ga0495676_0128194_794_1222 | 142 |
| 1017 | 3300047321 | Ga0495676_0631197 | Ga0495676_0631197_72_500 | 142 |
| 1018 | 3300047322 | Ga0495680_0008612 | Ga0495680_0008612_1590_2018 | 142 |
| 1019 | 3300047322 | Ga0495680_0026104 | Ga0495680_0026104_3486_3914 | 142 |
| 1020 | 3300047445 | Ga0495677_0252863 | Ga0495677_0252863_88_516 | 142 |
| 1021 | 3300047471 | Ga0495684_0004924 | Ga0495684_0004924_179_607 | 142 |
| 1022 | 3300047471 | Ga0495684_0444221 | Ga0495684_0444221_275_703 | 142 |
| 1023 | 3300047673 | Ga0495593_0014850 | Ga0495593_0014850_3640_4068 | 142 |
| 1024 | 3300048088 | Ga0495602_0010978 | Ga0495602_0010978_7474_7902 | 142 |
| 1025 | 3300048089 | Ga0495614_0002942 | Ga0495614_0002942_741_1169 | 142 |
| 1026 | 3300048903 | Ga0496100_0000800 | Ga0496100_0000800_6469_6915 | 142 |
| 1027 | 3300048903 | Ga0496100_0011005 | Ga0496100_0011005_2037_2465 | 142 |
| 1028 | 3300048904 | Ga0496101_0003969 | Ga0496101_0003969_1655_2101 | 142 |
| 1029 | 3300048904 | Ga0496101_0621133 | Ga0496101_0621133_368_814 | 142 |
| 1030 | 3300048904 | Ga0496101_0669894 | Ga0496101_0669894_207_695 | 142 |
| 1031 | 3300048905 | Ga0496102_0032780 | Ga0496102_0032780_2890_3378 | 142 |
| 1032 | 3300048905 | Ga0496102_0046353 | Ga0496102_0046353_3161_3616 | 142 |
| 1033 | 3300048905 | Ga0496102_0451115 | Ga0496102_0451115_517_945 | 142 |
| 1034 | 3300048906 | Ga0496103_0003651 | Ga0496103_0003651_3889_4377 | 142 |
| 1035 | 3300048906 | Ga0496103_0006551 | Ga0496103_0006551_2297_2725 | 142 |
| 1036 | 3300048906 | Ga0496103_0025178 | Ga0496103_0025178_1013_1441 | 142 |
| 1037 | 3300048906 | Ga0496103_0348092 | Ga0496103_0348092_343_771 | 142 |
| 1038 | 3300048907 | Ga0496104_0000196 | Ga0496104_0000196_26854_27282 | 142 |
| 1039 | 3300048907 | Ga0496104_0061470 | Ga0496104_0061470_1882_2337 | 142 |
| 1040 | 3300048907 | Ga0496104_0069936 | Ga0496104_0069936_2573_3001 | 142 |
| 1041 | 3300048907 | Ga0496104_0149269 | Ga0496104_0149269_1076_1522 | 142 |
| 1042 | 3300048907 | Ga0496104_0178276 | Ga0496104_0178276_21_449 | 142 |
| 1043 | 3300048907 | Ga0496104_0345947 | Ga0496104_0345947_791_1279 | 142 |
| 1044 | 3300048907 | Ga0496104_1805782 | Ga0496104_1805782_10_438 | 142 |
| 1045 | 3300048908 | Ga0496105_0029068 | Ga0496105_0029068_379_807 | 142 |
| 1046 | 3300048908 | Ga0496105_0091794 | Ga0496105_0091794_74_562 | 142 |
| 1047 | 3300048908 | Ga0496105_0273851 | Ga0496105_0273851_300_728 | 142 |
| 1048 | 3300048908 | Ga0496105_0427997 | Ga0496105_0427997_326_772 | 142 |
| 1049 | 3300048909 | Ga0496106_0001635 | Ga0496106_0001635_9474_9920 | 142 |
| 1050 | 3300048909 | Ga0496106_0127514 | Ga0496106_0127514_309_737 | 142 |
| 1051 | 3300048909 | Ga0496106_0143308 | Ga0496106_0143308_875_1303 | 142 |
| 1052 | 3300048909 | Ga0496106_0241091 | Ga0496106_0241091_846_1334 | 142 |
| 1053 | 3300048910 | Ga0496107_0000869 | Ga0496107_0000869_4233_4661 | 142 |
| 1054 | 3300048910 | Ga0496107_0031992 | Ga0496107_0031992_2379_2807 | 142 |
| 1055 | 3300048910 | Ga0496107_0154684 | Ga0496107_0154684_234_662 | 142 |
| 1056 | 3300048911 | Ga0496108_0008566 | Ga0496108_0008566_2772_3200 | 142 |
| 1057 | 3300048911 | Ga0496108_0043798 | Ga0496108_0043798_406_852 | 142 |
| 1058 | 3300048911 | Ga0496108_0047169 | Ga0496108_0047169_1213_1668 | 142 |
| 1059 | 3300048911 | Ga0496108_0069289 | Ga0496108_0069289_2469_2897 | 142 |
| 1060 | 3300048911 | Ga0496108_0154898 | Ga0496108_0154898_485_973 | 142 |
| 1061 | 3300048911 | Ga0496108_0335043 | Ga0496108_0335043_669_1097 | 142 |
| 1062 | 3300048912 | Ga0496109_0001554 | Ga0496109_0001554_3062_3490 | 142 |
| 1063 | 3300048912 | Ga0496109_0008494 | Ga0496109_0008494_2356_2802 | 142 |
| 1064 | 3300048912 | Ga0496109_0037839 | Ga0496109_0037839_3147_3575 | 142 |
| 1065 | 3300048912 | Ga0496109_0112776 | Ga0496109_0112776_1946_2374 | 142 |
| 1066 | 3300048912 | Ga0496109_0118317 | Ga0496109_0118317_851_1279 | 142 |
| 1067 | 3300048912 | Ga0496109_0529933 | Ga0496109_0529933_436_882 | 142 |
| 1068 | 3300048913 | Ga0496110_0015739 | Ga0496110_0015739_2087_2533 | 142 |
| 1069 | 3300048913 | Ga0496110_0019989 | Ga0496110_0019989_2545_3033 | 142 |
| 1070 | 3300048913 | Ga0496110_0022834 | Ga0496110_0022834_2384_2839 | 142 |
| 1071 | 3300048913 | Ga0496110_0072383 | Ga0496110_0072383_867_1295 | 142 |
| 1072 | 3300048913 | Ga0496110_0234794 | Ga0496110_0234794_955_1383 | 142 |
| 1073 | 3300048914 | Ga0496111_0018262 | Ga0496111_0018262_2123_2578 | 142 |
| 1074 | 3300048914 | Ga0496111_0035114 | Ga0496111_0035114_2504_2932 | 142 |
| 1075 | 3300048914 | Ga0496111_0125823 | Ga0496111_0125823_1363_1809 | 142 |
| 1076 | 3300048914 | Ga0496111_0254702 | Ga0496111_0254702_848_1276 | 142 |
| 1077 | 3300048915 | Ga0496112_0003337 | Ga0496112_0003337_5350_5778 | 142 |
| 1078 | 3300048915 | Ga0496112_0085451 | Ga0496112_0085451_2443_2889 | 142 |
| 1079 | 3300048915 | Ga0496112_0128268 | Ga0496112_0128268_1407_1895 | 142 |
| 1080 | 3300048915 | Ga0496112_0158741 | Ga0496112_0158741_736_1164 | 142 |
| 1081 | 3300048915 | Ga0496112_0274241 | Ga0496112_0274241_85_513 | 142 |
| 1082 | 3300048915 | Ga0496112_0905917 | Ga0496112_0905917_107_535 | 142 |
| 1083 | 3300048915 | Ga0496112_0978126 | Ga0496112_0978126_328_756 | 142 |
| 1084 | 3300048916 | Ga0496113_0007502 | Ga0496113_0007502_1229_1657 | 142 |
| 1085 | 3300048916 | Ga0496113_0013393 | Ga0496113_0013393_519_974 | 142 |
| 1086 | 3300048916 | Ga0496113_0015368 | Ga0496113_0015368_1179_1607 | 142 |
| 1087 | 3300048916 | Ga0496113_0345871 | Ga0496113_0345871_391_879 | 142 |
| 1088 | 3300048916 | Ga0496113_0508090 | Ga0496113_0508090_356_784 | 142 |
| 1089 | 3300048917 | Ga0496114_0012467 | Ga0496114_0012467_3923_4351 | 142 |
| 1090 | 3300048917 | Ga0496114_0085665 | Ga0496114_0085665_230_676 | 142 |
| 1091 | 3300048917 | Ga0496114_0091782 | Ga0496114_0091782_1202_1630 | 142 |
| 1092 | 3300048918 | Ga0496115_0034046 | Ga0496115_0034046_2382_2828 | 142 |
| 1093 | 3300048918 | Ga0496115_0280790 | Ga0496115_0280790_181_609 | 142 |
| 1094 | 3300048918 | Ga0496115_0287719 | Ga0496115_0287719_40_468 | 142 |
| 1095 | 3300048928 | Ga0496125_0426417 | Ga0496125_0426417_97_585 | 142 |
| 1096 | 3300049569 | Ga0501032_0086656 | Ga0501032_0086656_428_859 | 142 |
| 1097 | 3300049570 | Ga0501033_0307675 | Ga0501033_0307675_569_997 | 142 |
| 1098 | 3300049571 | Ga0501034_0001401 | Ga0501034_0001401_17934_18365 | 142 |
| 1099 | 3300049571 | Ga0501034_0056561 | Ga0501034_0056561_644_1072 | 142 |
| 1100 | 3300049571 | Ga0501034_0190194 | Ga0501034_0190194_807_1238 | 142 |
| 1101 | 3300049572 | Ga0501036_0000164 | Ga0501036_0000164_26117_26548 | 142 |
| 1102 | 3300049573 | Ga0501037_0010040 | Ga0501037_0010040_4478_4909 | 142 |
| 1103 | 3300049574 | Ga0501038_0157122 | Ga0501038_0157122_931_1359 | 142 |
| 1104 | 3300049574 | Ga0501038_0269031 | Ga0501038_0269031_785_1216 | 142 |
| 1105 | 3300049574 | Ga0501038_1060019 | Ga0501038_1060019_41_472 | 142 |
| 1106 | 3300049579 | Ga0501043_0001255 | Ga0501043_0001255_4590_5021 | 142 |
| 1107 | 3300049581 | Ga0501047_0003578 | Ga0501047_0003578_2009_2440 | 142 |
| 1108 | 3300049581 | Ga0501047_0729625 | Ga0501047_0729625_218_646 | 142 |
| 1109 | 3300049582 | Ga0501048_0025760 | Ga0501048_0025760_1845_2276 | 142 |
| 1110 | 3300049586 | Ga0501070_0016597 | Ga0501070_0016597_3791_4222 | 142 |
| 1111 | 3300049588 | Ga0501072_0013044 | Ga0501072_0013044_442_870 | 142 |
| 1112 | 3300049589 | Ga0501073_0239645 | Ga0501073_0239645_212_640 | 142 |
| 1113 | 3300049590 | Ga0501074_0019707 | Ga0501074_0019707_2582_3013 | 142 |
| 1114 | 3300049592 | Ga0501076_0020689 | Ga0501076_0020689_1235_1663 | 142 |
| 1115 | 3300049593 | Ga0501077_0134249 | Ga0501077_0134249_1128_1556 | 142 |
| 1116 | 3300049742 | Ga0501080_0001467 | Ga0501080_0001467_2009_2440 | 142 |
| 1117 | 3300049743 | Ga0501081_0576892 | Ga0501081_0576892_46_474 | 142 |
| 1118 | 3300049744 | Ga0501083_0009826 | Ga0501083_0009826_1981_2412 | 142 |
| 1119 | 3300049744 | Ga0501083_0289722 | Ga0501083_0289722_357_785 | 142 |
| 1120 | 3300049822 | Ga0501035_0398300 | Ga0501035_0398300_690_1118 | 142 |
| 1121 | 3300049823 | Ga0501044_0000822 | Ga0501044_0000822_574_1002 | 142 |
| 1122 | 3300049823 | Ga0501044_0002823 | Ga0501044_0002823_1938_2369 | 142 |
| 1123 | 3300049823 | Ga0501044_0106489 | Ga0501044_0106489_2000_2428 | 142 |
| 1124 | 3300050489 | nmdc:mga03683_170518_c1 | nmdc:mga03683_170518_c1_52_480 | 142 |
| 1125 | 3300050490 | nmdc:mga03n38_71569_c1 | nmdc:mga03n38_71569_c1_800_1228 | 142 |
| 1126 | 3300050491 | nmdc:mga00v17_57550_c1 | nmdc:mga00v17_57550_c1_999_1427 | 142 |
| 1127 | 3300050492 | nmdc:mga0yw44_160891_c1 | nmdc:mga0yw44_160891_c1_392_820 | 142 |
| 1128 | 3300050494 | nmdc:mga06z11_20872_c1 | nmdc:mga06z11_20872_c1_453_881 | 142 |
| 1129 | 3300050494 | nmdc:mga06z11_238864_c1 | nmdc:mga06z11_238864_c1_261_689 | 142 |
| 1130 | 3300050495 | nmdc:mga04h51_28289_c1 | nmdc:mga04h51_28289_c1_850_1278 | 142 |
| 1131 | 3300050507 | nmdc:mga05p37_302597_c1 | nmdc:mga05p37_302597_c1_784_1212 | 142 |
| 1132 | 3300050507 | nmdc:mga05p37_6013_c1 | nmdc:mga05p37_6013_c1_7535_7963 | 142 |
| 1133 | 3300050508 | nmdc:mga09592_2783_c1 | nmdc:mga09592_2783_c1_1366_1794 | 142 |
| 1134 | 3300050509 | nmdc:mga0qj67_1876_c1 | nmdc:mga0qj67_1876_c1_12633_13061 | 142 |
| 1135 | 3300050510 | nmdc:mga06r32_22491_c1 | nmdc:mga06r32_22491_c1_3642_4070 | 142 |
| 1136 | 3300050511 | nmdc:mga08y16_12040_c1 | nmdc:mga08y16_12040_c1_1524_1952 | 142 |
| 1137 | 3300050511 | nmdc:mga08y16_1705303_c1 | nmdc:mga08y16_1705303_c1_65_493 | 142 |
| 1138 | 3300050511 | nmdc:mga08y16_245924_c1 | nmdc:mga08y16_245924_c1_1358_1786 | 142 |
| 1139 | 3300050511 | nmdc:mga08y16_565194_c1 | nmdc:mga08y16_565194_c1_567_995 | 142 |
| 1140 | 3300050511 | nmdc:mga08y16_995466_c1 | nmdc:mga08y16_995466_c1_313_741 | 142 |
| 1141 | 3300050512 | nmdc:mga0n895_1049952_c1 | nmdc:mga0n895_1049952_c1_56_484 | 142 |
| 1142 | 3300050512 | nmdc:mga0n895_1539_c1 | nmdc:mga0n895_1539_c1_9760_10188 | 142 |
| 1143 | 3300050512 | nmdc:mga0n895_436410_c1 | nmdc:mga0n895_436410_c1_169_597 | 142 |
| 1144 | 3300050512 | nmdc:mga0n895_51388_c1 | nmdc:mga0n895_51388_c1_1496_1924 | 142 |
| 1145 | 3300050512 | nmdc:mga0n895_602819_c1 | nmdc:mga0n895_602819_c1_640_1086 | 142 |
| 1146 | 3300050512 | nmdc:mga0n895_97038_c1 | nmdc:mga0n895_97038_c1_1220_1648 | 142 |
| 1147 | 3300050513 | nmdc:mga0rr50_1559836_c1 | nmdc:mga0rr50_1559836_c1_105_533 | 142 |
| 1148 | 3300050513 | nmdc:mga0rr50_164488_c1 | nmdc:mga0rr50_164488_c1_299_727 | 142 |
| 1149 | 3300050513 | nmdc:mga0rr50_6117_c1 | nmdc:mga0rr50_6117_c1_6565_6993 | 142 |
| 1150 | 3300050514 | nmdc:mga08x19_831422_c1 | nmdc:mga08x19_831422_c1_20_448 | 142 |
| 1151 | 3300050515 | nmdc:mga0a205_34744_c1 | nmdc:mga0a205_34744_c1_2887_3315 | 142 |
| 1152 | 3300053077 | Ga0495601_0000456 | Ga0495601_0000456_15784_16212 | 142 |
| 1153 | 3300053077 | Ga0495601_0040185 | Ga0495601_0040185_794_1222 | 142 |
| 1154 | 3300053078 | Ga0495612_0007164 | Ga0495612_0007164_1428_1856 | 142 |
| 1155 | 3300053078 | Ga0495612_0012818 | Ga0495612_0012818_1125_1553 | 142 |
| 1156 | 3300053084 | Ga0495595_0001524 | Ga0495595_0001524_2308_2736 | 142 |
| 1157 | 3300053084 | Ga0495595_0072824 | Ga0495595_0072824_1023_1451 | 142 |
| 1158 | 3300053084 | Ga0495595_0086040 | Ga0495595_0086040_179_607 | 142 |
| 1159 | 3300053085 | Ga0495619_0000551 | Ga0495619_0000551_4152_4580 | 142 |
| 1160 | 3300053085 | Ga0495619_0025754 | Ga0495619_0025754_1499_1927 | 142 |
| 1161 | 3300053085 | Ga0495619_0109308 | Ga0495619_0109308_759_1187 | 142 |
| 1162 | 3300053085 | Ga0495619_0138522 | Ga0495619_0138522_1068_1496 | 142 |
| 1163 | 3300053094 | Ga0500566_0214035 | Ga0500566_0214035_266_694 | 142 |
| 1164 | 3300053098 | Ga0500650_0055336 | Ga0500650_0055336_116_544 | 142 |
| 1165 | 3300053117 | Ga0500593_243260 | Ga0500593_243260_158_586 | 142 |
| 1166 | 3300054114 | Ga0501084_0251137 | Ga0501084_0251137_248_676 | 142 |
| 1167 | 3300061734 | Ga0530510_0575919 | Ga0530510_0575919_283_711 | 142 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lb5-assembly1.cif.gz_A | crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand | 0.9423 | 4 | 138 |
| 3lb5-assembly2.cif.gz_C | crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand | 0.9371 | 2 | 138 |
| 3lb5-assembly1.cif.gz_B | crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand | 0.9313 | 2 | 138 |
| 3lb5-assembly2.cif.gz_C | crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand | 0.9238 | 2 | 138 |
| 3lb5-assembly2.cif.gz_D | crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand | 0.9224 | 4 | 138 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lb5A00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9423 | 4 | 138 | 3.30.428.10 |
| 3lb5A00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9214 | 4 | 138 | 3.30.428.10 |
| 1y23D01 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.908 | 7 | 112 | 3.30.428.10 |
| af_A0A140LH01_2_105_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.8847 | 21 | 109 | 3.30.428.10 |
| af_P9WML3_1_133_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.882 | 8 | 141 | 3.30.428.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A508U1P9-F1-model_v4 | Putative HIT-like protein | 0.9598 | 1 | 139 |
GO:0003824
GO:0009117 |
| AF-A0A4Q0RIZ6-F1-model_v4 | deleted | 0.959 | 1 | 140 |
|
| AF-A0A120FM26-F1-model_v4 | HIT family hydrolase | 0.9579 | 1 | 140 |
GO:0009117
GO:0016787 |
| AF-A0A1W9HVN2-F1-model_v4 | HIT family hydrolase | 0.9572 | 1 | 142 |
GO:0009117
GO:0016787 |
| AF-A0A090MML9-F1-model_v4 | HIT-like protein | 0.9572 | 1 | 140 |
GO:0003824
GO:0009117 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar