F491082

General Info

Members Datasets Scaffolds Average Seq Length
1166 632 2222 269

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1021473|Ga0081540_10214736
Length 312
Sequence MPSDTRYVKVHRPEQALGTGAVPWKDRVPFSAIPSSEPLMQTLRVNGYDMAYLEVGQGSPGAPPLVCVHGSLCDFRIWSAVLGPLTAKHRVIAVSLRHFFPDHWDGVGDTYSIAQHVDDVIAFIEQVEPRPVDLMGHSRGGHICFRVAQRRPDLLRRLILAEPGGELDGTLDSNYKPGPSPLAARIAASAAVIAKGDIDGGLQIFMDALEGPGAWKRLPATPKQQLRDNATTLIGQMRDQRPPFSKADAEAISTPTLFIGGASTKGVLPLVLHALAAHVKGSRTEMISGATHPMFEQQPQKYCEIVTAFLAG

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
69 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
70 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
99 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
100 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
101 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
163 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
164 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
165 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
166 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
172 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
175 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
178 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
179 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
180 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
198 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
199 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
200 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
219 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
222 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
223 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
224 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
225 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
226 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
231 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
232 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
233 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
241 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
251 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
252 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
253 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
257 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
258 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
259 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
260 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
264 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
265 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
270 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
273 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
274 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
275 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
276 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
277 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
278 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
279 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
280 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
281 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
282 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
283 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
284 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
285 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
286 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
287 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
288 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
289 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
290 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
291 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
292 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
293 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
296 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
297 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
298 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
301 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
302 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
306 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
310 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
313 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
314 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
317 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
318 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
319 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
323 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
324 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
327 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
332 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
346 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
347 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
350 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
351 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
352 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
353 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
357 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
358 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
359 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
360 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
361 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
362 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
363 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
364 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
365 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
366 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
367 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
368 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
369 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
370 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
371 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
372 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
373 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
374 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
375 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
376 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
377 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
378 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
379 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
380 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
381 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
382 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
383 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
384 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
385 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
386 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
387 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
388 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
389 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
390 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
391 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
392 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
393 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
394 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
395 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
396 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
397 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
398 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
399 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
400 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
401 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
402 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
403 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
404 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
405 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
406 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
407 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
408 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
409 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
410 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
411 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
412 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
413 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
414 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
415 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
416 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
417 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
418 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
419 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
420 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
421 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
422 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
423 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
424 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
425 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
426 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
427 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
428 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
429 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
430 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
431 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
432 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
433 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
434 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
435 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
436 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
437 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
438 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
439 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
440 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
441 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
442 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
443 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
444 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
445 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
446 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
447 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
448 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
449 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
450 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
451 2791355199
452 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
453 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
454 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
455 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
456 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
457 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
458 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
459 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
460 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
461 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
462 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
463 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
464 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
465 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
466 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
467 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
468 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
469 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
470 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
471 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
472 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
473 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
474 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
475 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
476 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
477 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
478 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
479 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
480 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
481 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
482 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
483 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
484 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
485 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
486 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
487 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
488 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
489 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
490 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
491 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
492 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
493 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
494 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
495 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
496 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
497 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
498 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
499 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
500 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
501 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
502 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
503 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
504 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
505 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
506 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
507 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
508 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
509 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
510 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
511 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
512 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
513 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
514 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
515 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
516 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
517 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
518 2906610324
519 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
520 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
521 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
522 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
523 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
524 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
525 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
526 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
527 2922368715
528 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
529 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
530 2922425934
531 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
532 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
533 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
534 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
535 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
536 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
537 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
538 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
539 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
540 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
541 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
542 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
543 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
544 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
545 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
546 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
547 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
548 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
549 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
550 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
551 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
552 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
553 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
554 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
555 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
556 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
557 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
558 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
559 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
560 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
561 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
562 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
563 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
564 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
565 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
566 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
567 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
568 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
569 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
570 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
571 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
572 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
573 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
574 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
575 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
576 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
577 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
578 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
579 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
580 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
581 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
582 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
583 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
584 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
585 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
586 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
587 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
588 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
589 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
590 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
591 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
592 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
593 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
594 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
595 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
596 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
597 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
598 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
599 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
600 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
601 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
602 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
603 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
604 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
605 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
606 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
607 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
608 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
609 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
610 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
611 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
612 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
613 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
614 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
615 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
616 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
617 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
618 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
619 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
620 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
621 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
622 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
623 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
624 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
625 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
626 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
627 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
628 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
629 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
630 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
631 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
632 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.01
Metatranscriptomes 0.09
Isolates 17.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.32
Nodule 14.32
Rhizoplane 5.15
Rhizosphere 56.35
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1021473 3300005983 Bacteria 3842
2 JGI24735J21928_10024186 3300002067 Bacteria 1840
3 JGI25406J46586_10005201 3300003203 Bacteria 6033
4 JGI25153J46596_10005814 3300003215 Bacteria 6411
5 rootL2_10017863 3300003322 Bacteria 1938
6 rootH1_10149220 3300003323 Bacteria 1406
7 JGI25160J50197_1019598 3300003354 Bacteria 2069
8 JGI25160J50197_1019601 3300003354 Bacteria 2069
9 JGI25404J52841_10003242 3300003659 Bacteria 3191
10 JGI25404J52841_10007484 3300003659 Bacteria 2310
11 JGI25404J52841_10012840 3300003659 Bacteria 1817
12 Ga0055531_10006499 3300003794 Bacteria 6626
13 Ga0055531_10018955 3300003794 Bacteria 2812
14 Ga0065165_1001465 3300005262 Bacteria 25288
15 Ga0065165_1003494 3300005262 Bacteria 10960
16 Ga0065165_1007016 3300005262 Bacteria 5679
17 Ga0065165_1021815 3300005262 Bacteria 2213
18 Ga0068869_100121166 3300005334 Bacteria 2001
19 Ga0068869_100344888 3300005334 Bacteria 1213
20 Ga0070680_100003569 3300005336 Bacteria 11609
21 Ga0070680_100281547 3300005336 Bacteria 1409
22 Ga0070680_100415309 3300005336 Bacteria 1148
23 Ga0070682_100063668 3300005337 Bacteria 2339
24 Ga0070682_100400263 3300005337 Bacteria 1038
25 Ga0068868_100017752 3300005338 Bacteria 5306
26 Ga0068868_100145011 3300005338 Bacteria 1952
27 Ga0070660_100031186 3300005339 Bacteria 4002
28 Ga0070660_100068615 3300005339 Bacteria 2764
29 Ga0070660_100297090 3300005339 Bacteria 1324
30 Ga0070668_100047596 3300005347 Bacteria 3297
31 Ga0070668_100115123 3300005347 Bacteria 2143
32 Ga0070668_100254836 3300005347 Bacteria 1458
33 Ga0070673_100140477 3300005364 Bacteria 2036
34 Ga0070673_100220019 3300005364 Bacteria 1643
35 Ga0070673_100228968 3300005364 Bacteria 1612
36 Ga0070659_100198207 3300005366 Bacteria 1652
37 Ga0070659_100402578 3300005366 Bacteria 1156
38 Ga0070659_100608300 3300005366 Bacteria 940
39 Ga0070667_100212524 3300005367 Bacteria 1720
40 Ga0070667_100420239 3300005367 Bacteria 1219
41 Ga0070709_10001461 3300005434 Bacteria 12746
42 Ga0070714_100003988 3300005435 Bacteria 11098
43 Ga0070713_100004627 3300005436 Bacteria 9277
44 Ga0070713_100324844 3300005436 Bacteria 1422
45 Ga0070713_100348944 3300005436 Bacteria 1373
46 Ga0070713_100659331 3300005436 Bacteria 997
47 Ga0070710_10001981 3300005437 Bacteria 9708
48 Ga0070710_10003702 3300005437 Bacteria 7230
49 Ga0070710_10100719 3300005437 Bacteria 1720
50 Ga0070711_100010613 3300005439 Bacteria 5706
51 Ga0070711_100081392 3300005439 Bacteria 2308
52 Ga0070708_100672681 3300005445 Bacteria 975
53 Ga0070663_100059739 3300005455 Bacteria 2740
54 Ga0070663_100077803 3300005455 Bacteria 2430
55 Ga0070663_100172651 3300005455 Bacteria 1672
56 Ga0070663_100199397 3300005455 Bacteria 1561
57 Ga0070663_100557482 3300005455 Bacteria 959
58 Ga0070678_100005458 3300005456 Bacteria 7353
59 Ga0070678_100185492 3300005456 Bacteria 1707
60 Ga0070662_100076746 3300005457 Bacteria 2477
61 Ga0070662_100103839 3300005457 Bacteria 2156
62 Ga0070681_10015034 3300005458 Bacteria 7699
63 Ga0070706_100463842 3300005467 Bacteria 1178
64 Ga0070698_100133500 3300005471 Bacteria 2437
65 Ga0070679_100132475 3300005530 Bacteria 2474
66 Ga0070679_100433843 3300005530 Bacteria 1259
67 Ga0070684_100106220 3300005535 Bacteria 2513
68 Ga0070684_100473399 3300005535 Bacteria 1159
69 Ga0070697_100103553 3300005536 Bacteria 2366
70 Ga0068853_100019769 3300005539 Bacteria 5592
71 Ga0068853_100204925 3300005539 Bacteria 1796
72 Ga0068853_100371777 3300005539 Bacteria 1334
73 Ga0068853_100624733 3300005539 Bacteria 1024
74 Ga0070693_100101737 3300005547 Bacteria 1752
75 Ga0070665_100020723 3300005548 Bacteria 6606
76 Ga0070665_100070010 3300005548 Bacteria 3515
77 Ga0070665_100133651 3300005548 Bacteria 2483
78 Ga0070665_100155002 3300005548 Bacteria 2292
79 Ga0070665_100156385 3300005548 Bacteria 2281
80 Ga0070665_100241352 3300005548 Bacteria 1807
81 Ga0070665_100297112 3300005548 Bacteria 1618
82 Ga0070665_100665183 3300005548 Bacteria 1054
83 Ga0068855_100029909 3300005563 Bacteria 6513
84 Ga0068855_100051047 3300005563 Bacteria 4872
85 Ga0068855_100060591 3300005563 Bacteria 4425
86 Ga0068855_100110634 3300005563 Bacteria 3153
87 Ga0068855_100121318 3300005563 Bacteria 2991
88 Ga0068855_100483473 3300005563 Bacteria 1348
89 Ga0068855_100598929 3300005563 Bacteria 1189
90 Ga0068855_100625499 3300005563 Bacteria 1159
91 Ga0070664_100151355 3300005564 Bacteria 2048
92 Ga0070664_100223336 3300005564 Bacteria 1686
93 Ga0070664_100387422 3300005564 Bacteria 1277
94 Ga0068857_100005639 3300005577 Bacteria 10702
95 Ga0068857_100069443 3300005577 Bacteria 3137
96 Ga0068857_100101360 3300005577 Bacteria 2584
97 Ga0068857_100171744 3300005577 Bacteria 1971
98 Ga0068854_100005923 3300005578 Bacteria 7744
99 Ga0068854_100096642 3300005578 Bacteria 2207
100 Ga0068854_100102096 3300005578 Bacteria 2151
101 Ga0068856_100000476 3300005614 Bacteria 44310
102 Ga0068856_100093882 3300005614 Bacteria 2986
103 Ga0068856_100162354 3300005614 Bacteria 2245
104 Ga0068856_100202844 3300005614 Bacteria 1998
105 Ga0068856_100234557 3300005614 Bacteria 1850
106 Ga0068856_100285932 3300005614 Bacteria 1666
107 Ga0068852_100180576 3300005616 Bacteria 1984
108 Ga0068852_100453482 3300005616 Bacteria 1270
109 Ga0068859_100172189 3300005617 Bacteria 2246
110 Ga0068859_100606990 3300005617 Bacteria 1187
111 Ga0068864_100064794 3300005618 Bacteria 3170
112 Ga0068864_100433369 3300005618 Bacteria 1254
113 Ga0068861_100428100 3300005719 Bacteria 1181
114 Ga0068851_10003823 3300005834 Bacteria 6739
115 Ga0068851_10020573 3300005834 Bacteria 3196
116 Ga0068851_10070129 3300005834 Bacteria 1812
117 Ga0068851_10100743 3300005834 Bacteria 1533
118 Ga0068870_10086555 3300005840 Bacteria 1744
119 Ga0068870_10100319 3300005840 Bacteria 1635
120 Ga0068863_100159012 3300005841 Bacteria 2164
121 Ga0068863_100285090 3300005841 Bacteria 1601
122 Ga0068858_100078638 3300005842 Bacteria 3065
123 Ga0068858_100496633 3300005842 Bacteria 1179
124 Ga0068862_100076660 3300005844 Bacteria 2894
125 Ga0068862_100508564 3300005844 Bacteria 1144
126 Ga0081455_10011371 3300005937 Bacteria 8946
127 Ga0081455_10076987 3300005937 Bacteria 2746
128 Ga0081455_10111202 3300005937 Bacteria 2177
129 Ga0081540_1004386 3300005983 Bacteria 10787
130 Ga0081540_1005329 3300005983 Bacteria 9623
131 Ga0081540_1007078 3300005983 Bacteria 8062
132 Ga0081540_1007475 3300005983 Bacteria 7780
133 Ga0081540_1013507 3300005983 Bacteria 5304
134 Ga0081540_1016353 3300005983 Bacteria 4646
135 Ga0081540_1018434 3300005983 Bacteria 4281
136 Ga0081540_1048885 3300005983 Bacteria 2115
137 Ga0081540_1053054 3300005983 Bacteria 1991
138 Ga0081540_1111692 3300005983 Bacteria 1154
139 Ga0081539_10001098 3300005985 Bacteria 49182
140 Ga0070717_10001915 3300006028 Bacteria 14544
141 Ga0070717_10009625 3300006028 Bacteria 7272
142 Ga0070717_10034975 3300006028 Bacteria 4064
143 Ga0070717_10101140 3300006028 Bacteria 2448
144 Ga0070717_10240349 3300006028 Bacteria 1597
145 Ga0075365_10037480 3300006038 Bacteria 3148
146 Ga0075365_10137418 3300006038 Bacteria 1695
147 Ga0075365_10300178 3300006038 Bacteria 1130
148 Ga0075365_10309879 3300006038 Bacteria 1111
149 Ga0075363_100000795 3300006048 Bacteria 10907
150 Ga0075364_10060459 3300006051 Bacteria 2485
151 Ga0075364_10198710 3300006051 Bacteria 1359
152 Ga0070715_10003656 3300006163 Bacteria 4939
153 Ga0070716_100009999 3300006173 Bacteria 4744
154 Ga0070716_100017312 3300006173 Bacteria 3733
155 Ga0070716_100194790 3300006173 Bacteria 1342
156 Ga0075367_10086232 3300006178 Bacteria 1905
157 Ga0075367_10115869 3300006178 Bacteria 1648
158 Ga0075369_10023467 3300006186 Bacteria 2550
159 Ga0075369_10028142 3300006186 Bacteria 2354
160 Ga0075369_10032740 3300006186 Bacteria 2200
161 Ga0075369_10124553 3300006186 Bacteria 1168
162 Ga0075366_10090110 3300006195 Bacteria 1837
163 Ga0075366_10152688 3300006195 Bacteria 1399
164 Ga0075366_10171511 3300006195 Bacteria 1316
165 Ga0097621_100034637 3300006237 Bacteria 4029
166 Ga0097621_100109329 3300006237 Bacteria 2335
167 Ga0097621_100304885 3300006237 Bacteria 1407
168 Ga0075370_10178773 3300006353 Bacteria 1248
169 Ga0068871_100044285 3300006358 Bacteria 3578
170 Ga0068865_100167092 3300006881 Bacteria 1683
171 Ga0097620_100172180 3300006931 Bacteria 2246
172 Ga0097620_100416370 3300006931 Bacteria 1440
173 Ga0097620_100606905 3300006931 Bacteria 1187
174 Ga0099824_1007622 3300006942 Bacteria 14251
175 Ga0099824_1030093 3300006942 Bacteria 2220
176 Ga0099822_1024573 3300006943 Bacteria 5376
177 Ga0099823_1025861 3300006944 Bacteria 5226
178 Ga0099794_10004947 3300007265 Bacteria 5300
179 Ga0099794_10035717 3300007265 Bacteria 2346
180 Ga0099794_10199251 3300007265 Bacteria 1025
181 Ga0099795_10045988 3300007788 Bacteria 1571
182 Ga0105240_10013609 3300009093 Bacteria 11162
183 Ga0105240_10128230 3300009093 Bacteria 3046
184 Ga0105240_10217619 3300009093 Bacteria 2227
185 Ga0105240_11035930 3300009093 Bacteria 876
186 Ga0111539_10268381 3300009094 Bacteria 1987
187 Ga0105245_10030466 3300009098 Bacteria 4770
188 Ga0105245_10339887 3300009098 Bacteria 1484
189 Ga0114129_10043623 3300009147 Bacteria 6310
190 Ga0105243_10179770 3300009148 Bacteria 1839
191 Ga0105243_10335919 3300009148 Bacteria 1382
192 Ga0105241_10043812 3300009174 Bacteria 3389
193 Ga0105241_10060066 3300009174 Bacteria 2924
194 Ga0105241_10112909 3300009174 Bacteria 2177
195 Ga0105241_10252735 3300009174 Bacteria 1495
196 Ga0105241_10262108 3300009174 Bacteria 1469
197 Ga0105248_10545891 3300009177 Bacteria 1307
198 Ga0105237_10009561 3300009545 Bacteria 10380
199 Ga0105237_10045175 3300009545 Bacteria 4434
200 Ga0105237_10048901 3300009545 Bacteria 4251
201 Ga0105237_10061469 3300009545 Bacteria 3755
202 Ga0105237_10103750 3300009545 Bacteria 2835
203 Ga0105237_10186478 3300009545 Bacteria 2074
204 Ga0105237_10243637 3300009545 Bacteria 1799
205 Ga0105237_10579715 3300009545 Bacteria 1129
206 Ga0105238_10157658 3300009551 Bacteria 2245
207 Ga0105238_10194558 3300009551 Bacteria 2004
208 Ga0105238_10262622 3300009551 Bacteria 1706
209 Ga0105249_10798089 3300009553 Bacteria 1008
210 Ga0105239_10013308 3300010375 Bacteria 9143
211 Ga0105239_10128536 3300010375 Bacteria 2817
212 Ga0105239_10128753 3300010375 Bacteria 2814
213 Ga0105239_10199213 3300010375 Bacteria 2243
214 Ga0105239_10393280 3300010375 Bacteria 1568
215 Ga0105239_10426864 3300010375 Bacteria 1502
216 Ga0105239_10492456 3300010375 Bacteria 1393
217 Ga0105246_10019037 3300011119 Bacteria 4380
218 Ga0105246_10024007 3300011119 Bacteria 3954
219 Ga0105246_10187269 3300011119 Bacteria 1599
220 Ga0157370_10079869 3300013104 Bacteria 3080
221 Ga0157370_10193297 3300013104 Bacteria 1889
222 Ga0157369_10012327 3300013105 Bacteria 9710
223 Ga0157369_10490429 3300013105 Bacteria 1271
224 Ga0157374_10155057 3300013296 Bacteria 2228
225 Ga0157374_10447706 3300013296 Bacteria 1292
226 Ga0157378_10006449 3300013297 Bacteria 10260
227 Ga0157378_10243912 3300013297 Bacteria 1717
228 Ga0163162_10186346 3300013306 Bacteria 2202
229 Ga0163162_10267283 3300013306 Bacteria 1842
230 Ga0163162_10291181 3300013306 Bacteria 1765
231 Ga0163162_10743548 3300013306 Bacteria 1100
232 Ga0157372_10096808 3300013307 Bacteria 3364
233 Ga0157372_10444064 3300013307 Bacteria 1512
234 Ga0157375_10018315 3300013308 Bacteria 6349
235 Ga0157375_10133453 3300013308 Bacteria 2604
236 Ga0157375_10286649 3300013308 Bacteria 1810
237 Ga0157375_10583229 3300013308 Bacteria 1278
238 Ga0163163_10044739 3300014325 Bacteria 4344
239 Ga0163163_10066420 3300014325 Bacteria 3582
240 Ga0163163_10073045 3300014325 Bacteria 3420
241 Ga0163163_10879805 3300014325 Bacteria 959
242 Ga0157380_10090556 3300014326 Bacteria 2523
243 Ga0157377_10159835 3300014745 Bacteria 1400
244 Ga0157379_10067447 3300014968 Bacteria 3198
245 Ga0157379_10321013 3300014968 Bacteria 1414
246 Ga0157379_10490667 3300014968 Bacteria 1137
247 Ga0157379_10717134 3300014968 Bacteria 940
248 Ga0157376_10031939 3300014969 Bacteria 4223
249 Ga0157376_10134588 3300014969 Bacteria 2210
250 Ga0157376_10455346 3300014969 Bacteria 1249
251 Ga0163161_10401145 3300017792 Bacteria 1100
252 Ga0214542_1000003 3300021321 Bacteria 435700
253 Ga0214545_1000004 3300021324 Bacteria 453352
254 Ga0214543_1009591 3300021327 Bacteria 14941
255 Ga0213873_10004591 3300021358 Bacteria 2591
256 Ga0213872_10094460 3300021361 Bacteria 1336
257 Ga0213876_10001391 3300021384 Bacteria 15091
258 Ga0213871_10000490 3300021441 Bacteria 5411
259 Ga0209148_1000490 3300025254 Bacteria 40827
260 Ga0209233_1010343 3300025261 Bacteria 2798
261 Ga0209233_1019818 3300025261 Bacteria 1778
262 Ga0209233_1030468 3300025261 Bacteria 1271
263 Ga0209455_1004977 3300025272 Bacteria 4213
264 Ga0209564_1027292 3300025295 Bacteria 1858
265 Ga0209758_1000106 3300025297 Bacteria 218450
266 Ga0209758_1000982 3300025297 Bacteria 38353
267 Ga0209758_1002038 3300025297 Bacteria 21691
268 Ga0209758_1003538 3300025297 Bacteria 14070
269 Ga0209758_1010528 3300025297 Bacteria 5516
270 Ga0209758_1025853 3300025297 Bacteria 2562
271 Ga0209050_1029906 3300025298 Bacteria 1729
272 Ga0209256_1007012 3300025299 Bacteria 5721
273 Ga0209256_1018839 3300025299 Bacteria 2224
274 Ga0207426_1000337 3300025302 Bacteria 88200
275 Ga0207426_1001470 3300025302 Bacteria 19401
276 Ga0207426_1042794 3300025302 Bacteria 1396
277 Ga0207426_1064572 3300025302 Bacteria 1041
278 Ga0209257_1000348 3300025304 Bacteria 95101
279 Ga0209257_1001773 3300025304 Bacteria 23881
280 Ga0209257_1010363 3300025304 Bacteria 4735
281 Ga0209257_1038474 3300025304 Bacteria 1448
282 Ga0207656_10032711 3300025321 Bacteria 2161
283 Ga0207692_10002972 3300025898 Bacteria 6568
284 Ga0207692_10030002 3300025898 Bacteria 2589
285 Ga0207642_10089793 3300025899 Bacteria 1515
286 Ga0207647_10000908 3300025904 Bacteria 22882
287 Ga0207647_10076385 3300025904 Bacteria 2015
288 Ga0207699_10004093 3300025906 Bacteria 6981
289 Ga0207699_10176623 3300025906 Bacteria 1433
290 Ga0207643_10130130 3300025908 Bacteria 1497
291 Ga0207705_10242644 3300025909 Bacteria 1373
292 Ga0207654_10004509 3300025911 Bacteria 7032
293 Ga0207654_10019456 3300025911 Bacteria 3584
294 Ga0207654_10156768 3300025911 Bacteria 1467
295 Ga0207707_10002162 3300025912 Bacteria 17780
296 Ga0207707_10005294 3300025912 Bacteria 11286
297 Ga0207707_10201928 3300025912 Bacteria 1733
298 Ga0207695_10001591 3300025913 Bacteria 36866
299 Ga0207695_10017338 3300025913 Bacteria 8383
300 Ga0207671_10018136 3300025914 Bacteria 5408
301 Ga0207671_10031051 3300025914 Bacteria 3983
302 Ga0207671_10060866 3300025914 Bacteria 2801
303 Ga0207671_10077354 3300025914 Bacteria 2491
304 Ga0207671_10078410 3300025914 Bacteria 2474
305 Ga0207671_10103392 3300025914 Bacteria 2160
306 Ga0207671_10391024 3300025914 Bacteria 1105
307 Ga0207693_10009468 3300025915 Bacteria 7934
308 Ga0207693_10009993 3300025915 Bacteria 7715
309 Ga0207693_10208668 3300025915 Bacteria 1536
310 Ga0207660_10030146 3300025917 Bacteria 3727
311 Ga0207660_10185538 3300025917 Bacteria 1617
312 Ga0207657_10167068 3300025919 Bacteria 1784
313 Ga0207657_10196225 3300025919 Bacteria 1626
314 Ga0207657_10554633 3300025919 Bacteria 898
315 Ga0207649_10119309 3300025920 Bacteria 1776
316 Ga0207652_10106404 3300025921 Bacteria 2483
317 Ga0207652_10140411 3300025921 Bacteria 2160
318 Ga0207694_10022056 3300025924 Bacteria 4829
319 Ga0207694_10031537 3300025924 Bacteria 4049
320 Ga0207694_10048565 3300025924 Bacteria 3284
321 Ga0207694_10097786 3300025924 Bacteria 2323
322 Ga0207694_10119947 3300025924 Bacteria 2099
323 Ga0207650_10244482 3300025925 Bacteria 1451
324 Ga0207687_10013836 3300025927 Bacteria 5270
325 Ga0207687_10131919 3300025927 Bacteria 1884
326 Ga0207700_10008050 3300025928 Bacteria 6500
327 Ga0207700_10057211 3300025928 Bacteria 2939
328 Ga0207700_10162873 3300025928 Bacteria 1854
329 Ga0207700_10294456 3300025928 Bacteria 1400
330 Ga0207700_10588770 3300025928 Bacteria 989
331 Ga0207664_10010392 3300025929 Bacteria 6574
332 Ga0207664_10079512 3300025929 Bacteria 2662
333 Ga0207690_10039021 3300025932 Bacteria 3096
334 Ga0207706_10034466 3300025933 Bacteria 4503
335 Ga0207706_10123613 3300025933 Bacteria 2276
336 Ga0207709_10085086 3300025935 Bacteria 2049
337 Ga0207709_10116401 3300025935 Bacteria 1797
338 Ga0207669_10135393 3300025937 Bacteria 1700
339 Ga0207704_10125140 3300025938 Bacteria 1768
340 Ga0207665_10006342 3300025939 Bacteria 7841
341 Ga0207691_10216166 3300025940 Bacteria 1663
342 Ga0207691_10367613 3300025940 Bacteria 1229
343 Ga0207689_10081964 3300025942 Bacteria 2652
344 Ga0207689_10122888 3300025942 Bacteria 2135
345 Ga0207689_10456766 3300025942 Bacteria 1068
346 Ga0207661_10094227 3300025944 Bacteria 2501
347 Ga0207679_10127513 3300025945 Bacteria 2036
348 Ga0207667_10029690 3300025949 Bacteria 5925
349 Ga0207667_10044947 3300025949 Bacteria 4678
350 Ga0207667_10098667 3300025949 Bacteria 3014
351 Ga0207667_10411218 3300025949 Bacteria 1377
352 Ga0207651_10153326 3300025960 Bacteria 1797
353 Ga0207712_10042423 3300025961 Bacteria 3132
354 Ga0207712_10072956 3300025961 Bacteria 2474
355 Ga0207668_10100984 3300025972 Bacteria 2143
356 Ga0207640_10016570 3300025981 Bacteria 4290
357 Ga0207640_10083922 3300025981 Bacteria 2186
358 Ga0207640_10266517 3300025981 Bacteria 1338
359 Ga0207677_10012673 3300026023 Bacteria 4857
360 Ga0207677_10067541 3300026023 Bacteria 2505
361 Ga0207677_10184163 3300026023 Bacteria 1645
362 Ga0207703_10022563 3300026035 Bacteria 4938
363 Ga0207703_10095909 3300026035 Bacteria 2503
364 Ga0207703_10210388 3300026035 Bacteria 1734
365 Ga0207639_10388199 3300026041 Bacteria 1255
366 Ga0207639_10537754 3300026041 Bacteria 1072
367 Ga0207678_10045772 3300026067 Bacteria 3783
368 Ga0207678_10050255 3300026067 Bacteria 3603
369 Ga0207678_10053837 3300026067 Bacteria 3467
370 Ga0207678_10070679 3300026067 Bacteria 2993
371 Ga0207702_10000003 3300026078 Bacteria 434196
372 Ga0207702_10000514 3300026078 Bacteria 43618
373 Ga0207641_10256946 3300026088 Bacteria 1634
374 Ga0207641_10406020 3300026088 Bacteria 1309
375 Ga0207648_10049340 3300026089 Bacteria 3683
376 Ga0207648_10064924 3300026089 Bacteria 3182
377 Ga0207676_10019625 3300026095 Bacteria 4934
378 Ga0207676_10150888 3300026095 Bacteria 2001
379 Ga0207674_10048184 3300026116 Bacteria 4362
380 Ga0207674_10096974 3300026116 Bacteria 2933
381 Ga0207674_10188004 3300026116 Bacteria 2015
382 Ga0207674_10234568 3300026116 Bacteria 1782
383 Ga0207674_10504816 3300026116 Bacteria 1168
384 Ga0207675_100064906 3300026118 Bacteria 3412
385 Ga0207675_100070222 3300026118 Bacteria 3273
386 Ga0207675_100149277 3300026118 Bacteria 2224
387 Ga0207675_100344132 3300026118 Bacteria 1460
388 Ga0207683_10019949 3300026121 Bacteria 5728
389 Ga0207698_10057798 3300026142 Bacteria 3003
390 Ga0207698_10389198 3300026142 Bacteria 1329
391 Ga0207698_10480663 3300026142 Bacteria 1205
392 Ga0209389_1000016 3300027296 Bacteria 184844
393 Ga0209389_1000027 3300027296 Bacteria 146917
394 Ga0209589_1000005 3300027357 Bacteria 530958
395 Ga0209589_1013736 3300027357 Bacteria 10448
396 Ga0209489_100005 3300027361 Bacteria 530958
397 Ga0209489_102237 3300027361 Bacteria 39491
398 Ga0209489_110753 3300027361 Bacteria 10002
399 Ga0209700_100006 3300027363 Bacteria 530958
400 Ga0209700_100012 3300027363 Bacteria 357892
401 Ga0209179_1000570 3300027512 Bacteria 3866
402 Ga0209813_10052679 3300027866 Bacteria 1277
403 Ga0268266_10005838 3300028379 Bacteria 11389
404 Ga0268266_10051358 3300028379 Bacteria 3539
405 Ga0268266_10071200 3300028379 Bacteria 3013
406 Ga0268266_10192118 3300028379 Bacteria 1864
407 Ga0268266_10241188 3300028379 Bacteria 1668
408 Ga0268266_10389125 3300028379 Bacteria 1316
409 Ga0268266_10461065 3300028379 Bacteria 1209
410 Ga0268266_10517614 3300028379 Bacteria 1140
411 Ga0268265_10373474 3300028380 Bacteria 1309
412 Ga0268265_10581463 3300028380 Bacteria 1067
413 Ga0268264_10131146 3300028381 Bacteria 2222
414 Ga0268264_10351696 3300028381 Bacteria 1403
415 Ga0268264_10406861 3300028381 Bacteria 1309
416 Ga0268264_10508567 3300028381 Bacteria 1176
417 Ga0265334_10016514 3300028573 Bacteria 3053
418 Ga0307517_10018365 3300028786 Bacteria 9051
419 Ga0307515_10278812 3300028794 Bacteria 1382
420 Ga0307511_10029041 3300030521 Bacteria 5004
421 Ga0307511_10084295 3300030521 Bacteria 2207
422 Ga0265330_10013428 3300031235 Bacteria 3817
423 Ga0265330_10021180 3300031235 Bacteria 2969
424 Ga0265330_10026032 3300031235 Bacteria 2650
425 Ga0265332_10008158 3300031238 Bacteria 4710
426 Ga0265332_10028166 3300031238 Bacteria 2460
427 Ga0265332_10069519 3300031238 Bacteria 1500
428 Ga0265328_10029632 3300031239 Bacteria 2042
429 Ga0265328_10094481 3300031239 Bacteria 1105
430 Ga0265325_10023540 3300031241 Bacteria 3360
431 Ga0265340_10018482 3300031247 Bacteria 3594
432 Ga0265339_10018617 3300031249 Bacteria 4091
433 Ga0265331_10021097 3300031250 Bacteria 3337
434 Ga0265316_10028897 3300031344 Bacteria 4567
435 Ga0307509_10004649 3300031507 Bacteria 19608
436 Ga0307509_10012663 3300031507 Bacteria 10066
437 Ga0307509_10175879 3300031507 Bacteria 2013
438 Ga0265313_10043303 3300031595 Bacteria 2205
439 Ga0307508_10003178 3300031616 Bacteria 16796
440 Ga0307508_10045726 3300031616 Bacteria 3910
441 Ga0265314_10113147 3300031711 Bacteria 1721
442 Ga0307516_10072595 3300031730 Bacteria 3300
443 Ga0307516_10106814 3300031730 Bacteria 2609
444 Ga0307516_10207372 3300031730 Bacteria 1676
445 Ga0307406_10341044 3300031901 Bacteria 1167
446 Ga0307412_10396788 3300031911 Bacteria 1122
447 Ga0307409_100422305 3300031995 Bacteria 1279
448 Ga0307510_10005379 3300033180 Bacteria 15241
449 Ga0307510_10083698 3300033180 Bacteria 3078
450 Ga0373934_0059952 3300035086 Bacteria 1515
451 Ga0373951_0050524 3300035091 Bacteria 1022
452 Ga0373923_0058208 3300035111 Bacteria 1636
453 Ga0373923_0166737 3300035111 Bacteria 1007
454 Ga0373936_0025118 3300035113 Bacteria 2328
455 Ga0373945_0007763 3300035116 Bacteria 3481
456 Ga0373953_0026940 3300035117 Bacteria 2205
457 Ga0373954_0003254 3300035118 Bacteria 6857
458 Ga0373956_0004124 3300035119 Bacteria 5831
459 Ga0373957_0017874 3300035120 Bacteria 2476
460 Ga0373957_0177653 3300035120 Bacteria 881
461 Ga0373943_0102189 3300035170 Bacteria 1501
462 Ga0373955_0128359 3300035172 Bacteria 1478
463 Ga0373955_0264780 3300035172 Bacteria 1032
464 Ga0373924_0080488 3300035410 Bacteria 1385
465 Ga0373924_0088153 3300035410 Bacteria 1325
466 Ga0373931_0075136 3300035691 Bacteria 1853
467 Ga0373931_0080264 3300035691 Bacteria 1799
468 Ga0373935_0012074 3300035692 Bacteria 5192
469 Ga0373935_0242112 3300035692 Bacteria 1260
470 Ga0373935_0360795 3300035692 Bacteria 1037
471 Ga0373935_0449956 3300035692 Bacteria 930
472 Ga0373927_0012034 3300035695 Bacteria 5755
473 Ga0373927_0033415 3300035695 Bacteria 3349
474 Ga0373927_0476852 3300035695 Bacteria 824
475 Ga0373933_0000784 3300035724 Bacteria 19397
476 Ga0373933_0009468 3300035724 Bacteria 5320
477 Ga0373933_0080016 3300035724 Bacteria 2002
478 Ga0373947_0027815 3300035725 Bacteria 3311
479 Ga0373937_0026313 3300036401 Bacteria 5256
480 Ga0373937_0206960 3300036401 Bacteria 1845
481 Ga0373937_0519020 3300036401 Bacteria 1132
482 Ga0373937_0538195 3300036401 Bacteria 1109
483 Ga0372808_011667 3300036459 Bacteria 1244
484 Ga0373925_0062447 3300037068 Bacteria 2801
485 Ga0373925_0361964 3300037068 Bacteria 1179
486 Ga0395899_0144236 3300037312 Bacteria 1692
487 Ga0395900_0016672 3300037418 Bacteria 7493
488 Ga0395900_0164314 3300037418 Bacteria 2263
489 Ga0395900_0620377 3300037418 Bacteria 1020
490 Ga0395898_0104561 3300037466 Bacteria 2715
491 Ga0395905_0096770 3300037471 Bacteria 2771
492 Ga0395905_0202187 3300037471 Bacteria 1862
493 Ga0395905_0372345 3300037471 Bacteria 1322
494 Ga0395901_0019475 3300038443 Bacteria 6939
495 Ga0395901_0872784 3300038443 Bacteria 883
496 Ga0436365_0328255 3300039437 Bacteria 67874
497 Ga0436365_1493072 3300039437 Bacteria 8985
498 Ga0436360_1256499 3300039438 Bacteria 5819
499 Ga0436361_0385472 3300039447 Bacteria 2237
500 Ga0436361_0964292 3300039447 Bacteria 1654
501 Ga0436362_0953067 3300039453 Bacteria 5962
502 Ga0439465_0020470 3300041413 Bacteria 2073
503 Ga0451789_0661496 3300041443 Bacteria 942
504 Ga0439455_0015584 3300042012 Bacteria 1749
505 Ga0466969_0070134 3300044656 Bacteria 1686
506 Ga0466969_0162768 3300044656 Bacteria 1025
507 Ga0466972_0000449 3300044658 Bacteria 21167
508 Ga0466972_0072783 3300044658 Bacteria 1638
509 Ga0466965_0109412 3300044683 Bacteria 1419
510 Ga0466966_0000455 3300044684 Bacteria 26381
511 Ga0466961_0000603 3300044693 Bacteria 22634
512 Ga0466963_0066822 3300044694 Bacteria 2412
513 Ga0466963_0236276 3300044694 Bacteria 1281
514 Ga0466964_0129046 3300044706 Bacteria 1149
515 Ga0466968_0012673 3300044735 Bacteria 3306
516 Ga0466968_0084211 3300044735 Bacteria 1401
517 Ga0466970_0030813 3300044765 Bacteria 2830
518 Ga0466970_0065716 3300044765 Bacteria 1947
519 Ga0466970_0222753 3300044765 Bacteria 1053
520 Ga0466960_0014996 3300044901 Bacteria 3332
521 Ga0466960_0091010 3300044901 Bacteria 1555
522 Ga0466959_0051667 3300045049 Bacteria 3013
523 Ga0466959_0142548 3300045049 Bacteria 1692
524 Ga0466958_0253883 3300045836 Bacteria 1125
525 Ga0495592_0030678 3300046454 Bacteria 4066
526 Ga0495592_0035165 3300046454 Bacteria 3775
527 Ga0495603_0005606 3300046455 Bacteria 7501
528 Ga0495603_0126526 3300046455 Bacteria 1489
529 Ga0495590_0090407 3300046457 Bacteria 1083
530 Ga0495629_0002984 3300046459 Bacteria 12864
531 Ga0495629_0134775 3300046459 Bacteria 1720
532 Ga0495629_0145729 3300046459 Bacteria 1647
533 Ga0495638_0005250 3300046460 Bacteria 9673
534 Ga0495638_0198660 3300046460 Bacteria 1133
535 Ga0495641_0018784 3300046461 Bacteria 3558
536 Ga0495651_0050286 3300046462 Bacteria 3216
537 Ga0495651_0061975 3300046462 Bacteria 2862
538 Ga0495651_0123223 3300046462 Bacteria 1901
539 Ga0495651_0245177 3300046462 Bacteria 1226
540 Ga0495653_0023442 3300046463 Bacteria 4985
541 Ga0495653_0077004 3300046463 Bacteria 2478
542 Ga0495650_0043671 3300046471 Bacteria 1900
543 Ga0495650_0106592 3300046471 Bacteria 1046
544 Ga0495582_0111674 3300046473 Bacteria 1535
545 Ga0495639_0007837 3300046475 Bacteria 4591
546 Ga0495664_0169530 3300046477 Bacteria 1324
547 Ga0495585_0045665 3300046492 Bacteria 2444
548 Ga0495594_0020690 3300046499 Bacteria 3506
549 Ga0495594_0311417 3300046499 Bacteria 897
550 Ga0495596_0022344 3300046500 Bacteria 2576
551 Ga0495596_0111725 3300046500 Bacteria 1061
552 Ga0495606_0066222 3300046507 Bacteria 2292
553 Ga0495608_0023069 3300046511 Bacteria 4266
554 Ga0495608_0113898 3300046511 Bacteria 1737
555 Ga0495618_0157659 3300046514 Bacteria 1448
556 Ga0495618_0167097 3300046514 Bacteria 1401
557 Ga0495628_0018851 3300046516 Bacteria 5712
558 Ga0495628_0076373 3300046516 Bacteria 2607
559 Ga0495628_0136147 3300046516 Bacteria 1877
560 Ga0495630_0059721 3300046517 Bacteria 2861
561 Ga0495630_0514848 3300046517 Bacteria 917
562 Ga0495632_0035870 3300046519 Bacteria 2526
563 Ga0495643_0172918 3300046522 Bacteria 1055
564 Ga0495644_0051474 3300046523 Bacteria 1546
565 Ga0495644_0060952 3300046523 Bacteria 1418
566 Ga0495648_0012715 3300046524 Bacteria 6256
567 Ga0495648_0118314 3300046524 Bacteria 1429
568 Ga0495666_0098329 3300046526 Bacteria 1380
569 Ga0495652_0078081 3300046529 Bacteria 2742
570 Ga0495652_0101934 3300046529 Bacteria 2326
571 Ga0495652_0122685 3300046529 Bacteria 2069
572 Ga0495640_0043124 3300046533 Bacteria 3143
573 Ga0495640_0045764 3300046533 Bacteria 3036
574 Ga0495640_0160091 3300046533 Bacteria 1443
575 Ga0495587_0015723 3300046536 Bacteria 4719
576 Ga0495587_0033800 3300046536 Bacteria 3085
577 Ga0495609_0099114 3300046538 Bacteria 1263
578 Ga0495621_0060160 3300046539 Bacteria 1377
579 Ga0495645_0088815 3300046543 Bacteria 2210
580 Ga0495622_0015653 3300046557 Bacteria 3526
581 Ga0495622_0016701 3300046557 Bacteria 3418
582 Ga0495622_0035408 3300046557 Bacteria 2328
583 Ga0495622_0036243 3300046557 Bacteria 2300
584 Ga0495667_0030518 3300046559 Bacteria 3621
585 Ga0495667_0035702 3300046559 Bacteria 3321
586 Ga0495667_0139165 3300046559 Bacteria 1564
587 Ga0495656_0001017 3300046615 Bacteria 9073
588 Ga0495668_0052216 3300046616 Bacteria 2262
589 Ga0495634_0005863 3300046642 Bacteria 9385
590 Ga0495634_0033851 3300046642 Bacteria 3509
591 Ga0495634_0038694 3300046642 Bacteria 3251
592 Ga0495611_0040347 3300046648 Bacteria 2081
593 Ga0495625_0082968 3300046660 Bacteria 2228
594 Ga0495635_0002996 3300046663 Bacteria 11592
595 Ga0495635_0024568 3300046663 Bacteria 4199
596 Ga0495635_0041945 3300046663 Bacteria 3161
597 Ga0495635_0058430 3300046663 Bacteria 2653
598 Ga0495659_0008839 3300046664 Bacteria 3208
599 Ga0495661_0164586 3300046665 Bacteria 1188
600 Ga0495588_0002975 3300046674 Bacteria 7320
601 Ga0495588_0136041 3300046674 Bacteria 1297
602 Ga0495657_0025879 3300046675 Bacteria 4162
603 Ga0495657_0033612 3300046675 Bacteria 3569
604 Ga0495657_0086881 3300046675 Bacteria 2013
605 Ga0495599_0018837 3300046678 Bacteria 4302
606 Ga0495599_0032531 3300046678 Bacteria 3274
607 Ga0495623_0005568 3300046679 Bacteria 8224
608 Ga0495623_0006324 3300046679 Bacteria 7698
609 Ga0495646_0033218 3300046680 Bacteria 3209
610 Ga0495646_0046764 3300046680 Bacteria 2636
611 Ga0495647_0013604 3300046681 Bacteria 2823
612 Ga0495658_0182753 3300046683 Bacteria 1301
613 Ga0495658_0325741 3300046683 Bacteria 974
614 Ga0495658_0367751 3300046683 Bacteria 915
615 Ga0495669_0006974 3300046684 Bacteria 4731
616 Ga0495669_0049594 3300046684 Bacteria 1880
617 Ga0495669_0072437 3300046684 Bacteria 1572
618 Ga0495613_0043701 3300046689 Bacteria 3315
619 Ga0495613_0044858 3300046689 Bacteria 3270
620 Ga0495624_0025788 3300046690 Bacteria 3856
621 Ga0495670_0077455 3300046691 Bacteria 1690
622 Ga0495671_0070273 3300046692 Bacteria 1720
623 Ga0495671_0125644 3300046692 Bacteria 1251
624 Ga0495671_0139991 3300046692 Bacteria 1179
625 Ga0495649_0233896 3300046694 Bacteria 948
626 Ga0495589_0148222 3300046794 Bacteria 1121
627 Ga0495589_0160790 3300046794 Bacteria 1070
628 Ga0495600_0004662 3300046809 Bacteria 8215
629 Ga0495600_0035570 3300046809 Bacteria 3235
630 Ga0495600_0056757 3300046809 Bacteria 2559
631 Ga0495581_0039231 3300047315 Bacteria 2741
632 Ga0495604_0007789 3300047317 Bacteria 8484
633 Ga0495604_0018421 3300047317 Bacteria 5591
634 Ga0495604_0077985 3300047317 Bacteria 2488
635 Ga0495604_0366374 3300047317 Bacteria 954
636 Ga0495674_0066189 3300047319 Bacteria 3136
637 Ga0495674_0087507 3300047319 Bacteria 2666
638 Ga0495674_0119336 3300047319 Bacteria 2229
639 Ga0495674_0123414 3300047319 Bacteria 2187
640 Ga0495676_0048116 3300047321 Bacteria 3441
641 Ga0495676_0050003 3300047321 Bacteria 3356
642 Ga0495676_0191337 3300047321 Bacteria 1427
643 Ga0495680_0035746 3300047322 Bacteria 3997
644 Ga0495683_0060361 3300047323 Bacteria 1880
645 Ga0495683_0186214 3300047323 Bacteria 945
646 Ga0495687_046799 3300047443 Bacteria 1865
647 Ga0495675_0037487 3300047444 Bacteria 3087
648 Ga0495673_0089210 3300047469 Bacteria 1263
649 Ga0495684_0019268 3300047471 Bacteria 5253
650 Ga0495684_0087037 3300047471 Bacteria 2368
651 Ga0495686_0057913 3300047472 Bacteria 2417
652 Ga0495593_0032879 3300047673 Bacteria 2826
653 Ga0495593_0071237 3300047673 Bacteria 1805
654 Ga0495602_0013480 3300048088 Bacteria 8354
655 Ga0495602_0061833 3300048088 Bacteria 3252
656 Ga0495602_0075890 3300048088 Bacteria 2851
657 Ga0495602_0316208 3300048088 Bacteria 1137
658 Ga0495614_0112115 3300048089 Bacteria 1198
659 Ga0496100_0004243 3300048903 Bacteria 7576
660 Ga0496100_0522017 3300048903 Bacteria 917
661 Ga0496101_0013036 3300048904 Bacteria 5562
662 Ga0496102_0002815 3300048905 Bacteria 14815
663 Ga0496102_0077227 3300048905 Bacteria 3065
664 Ga0496102_0084967 3300048905 Bacteria 2922
665 Ga0496102_0095338 3300048905 Bacteria 2758
666 Ga0496103_0030000 3300048906 Bacteria 3307
667 Ga0496104_0006611 3300048907 Bacteria 10198
668 Ga0496104_0024816 3300048907 Bacteria 5519
669 Ga0496104_0033645 3300048907 Bacteria 4777
670 Ga0496105_0009154 3300048908 Bacteria 7726
671 Ga0496105_0032947 3300048908 Bacteria 4253
672 Ga0496105_0107061 3300048908 Bacteria 2308
673 Ga0496105_0220523 3300048908 Bacteria 1544
674 Ga0496105_0228544 3300048908 Bacteria 1512
675 Ga0496106_0005419 3300048909 Bacteria 9436
676 Ga0496106_0042125 3300048909 Bacteria 3423
677 Ga0496106_0057561 3300048909 Bacteria 2940
678 Ga0496106_0330762 3300048909 Bacteria 1223
679 Ga0496107_0014935 3300048910 Bacteria 5438
680 Ga0496107_0127578 3300048910 Bacteria 1877
681 Ga0496108_0046662 3300048911 Bacteria 3620
682 Ga0496108_0052073 3300048911 Bacteria 3429
683 Ga0496109_0021949 3300048912 Bacteria 5653
684 Ga0496109_0035699 3300048912 Bacteria 4486
685 Ga0496109_0231547 3300048912 Bacteria 1738
686 Ga0496109_0426575 3300048912 Bacteria 1253
687 Ga0496110_0023683 3300048913 Bacteria 5223
688 Ga0496110_0275222 3300048913 Bacteria 1533
689 Ga0496110_0307890 3300048913 Bacteria 1443
690 Ga0496111_0138209 3300048914 Bacteria 1805
691 Ga0496111_0275631 3300048914 Bacteria 1248
692 Ga0496112_0111037 3300048915 Bacteria 2712
693 Ga0496112_0119972 3300048915 Bacteria 2600
694 Ga0496112_0241122 3300048915 Bacteria 1760
695 Ga0496112_0733093 3300048915 Bacteria 915
696 Ga0496113_0024350 3300048916 Bacteria 4301
697 Ga0496113_0035208 3300048916 Bacteria 3661
698 Ga0496113_0157985 3300048916 Bacteria 1791
699 Ga0496114_0102760 3300048917 Bacteria 2442
700 Ga0496114_0165612 3300048917 Bacteria 1924
701 Ga0496114_0604349 3300048917 Bacteria 967
702 Ga0496115_0009460 3300048918 Bacteria 7239
703 Ga0496115_0013575 3300048918 Bacteria 6164
704 Ga0496115_0279250 3300048918 Bacteria 1371
705 Ga0496115_0327366 3300048918 Bacteria 1252
706 Ga0496115_0395224 3300048918 Bacteria 1122
707 Ga0496115_0453047 3300048918 Bacteria 1036
708 Ga0496117_0039426 3300048920 Bacteria 3487
709 Ga0496119_0032422 3300048922 Bacteria 3482
710 Ga0496119_0065095 3300048922 Bacteria 2161
711 Ga0496119_0108621 3300048922 Bacteria 1544
712 Ga0496120_0011992 3300048923 Bacteria 5925
713 Ga0496121_0000146 3300048924 Bacteria 154459
714 Ga0496121_0002453 3300048924 Bacteria 28353
715 Ga0496121_0003864 3300048924 Bacteria 20824
716 Ga0496121_0003891 3300048924 Bacteria 20749
717 Ga0496121_0042243 3300048924 Bacteria 3970
718 Ga0496121_0180611 3300048924 Bacteria 1523
719 Ga0496121_0180804 3300048924 Bacteria 1522
720 Ga0496121_0186048 3300048924 Bacteria 1494
721 Ga0496121_0207091 3300048924 Bacteria 1393
722 Ga0496121_0242884 3300048924 Bacteria 1253
723 Ga0496121_0277988 3300048924 Bacteria 1147
724 Ga0496122_0011039 3300048925 Bacteria 9221
725 Ga0496122_0027250 3300048925 Bacteria 4891
726 Ga0496122_0124478 3300048925 Bacteria 1654
727 Ga0496123_0007911 3300048926 Bacteria 9874
728 Ga0496124_0001997 3300048927 Bacteria 27793
729 Ga0496124_0160713 3300048927 Bacteria 1751
730 Ga0496125_0034974 3300048928 Bacteria 4419
731 Ga0496125_0035461 3300048928 Bacteria 4374
732 Ga0496126_0006544 3300048929 Bacteria 12970
733 Ga0496126_0010063 3300048929 Bacteria 9977
734 Ga0496126_0017240 3300048929 Bacteria 7197
735 Ga0496126_0035606 3300048929 Bacteria 4664
736 Ga0496126_0056121 3300048929 Bacteria 3561
737 Ga0496126_0095415 3300048929 Bacteria 2609
738 Ga0496126_0123694 3300048929 Bacteria 2241
739 Ga0496126_0124200 3300048929 Bacteria 2235
740 Ga0496126_0141204 3300048929 Bacteria 2073
741 Ga0495682_0026585 3300049460 Bacteria 2147
742 Ga0501031_0066881 3300049568 Bacteria 2341
743 Ga0501032_0000196 3300049569 Bacteria 50261
744 Ga0501033_0003209 3300049570 Bacteria 13536
745 Ga0501034_0001151 3300049571 Bacteria 36663
746 Ga0501036_0000323 3300049572 Bacteria 33256
747 Ga0501037_0001377 3300049573 Bacteria 17808
748 Ga0501038_0001622 3300049574 Bacteria 20925
749 Ga0501039_0001302 3300049575 Bacteria 18240
750 Ga0501042_0046374 3300049578 Bacteria 3098
751 Ga0501043_0000409 3300049579 Bacteria 38657
752 Ga0501046_0000181 3300049580 Bacteria 64035
753 Ga0501047_0002426 3300049581 Bacteria 17808
754 Ga0501047_0062965 3300049581 Bacteria 3578
755 Ga0501047_0600438 3300049581 Bacteria 922
756 Ga0501048_0003595 3300049582 Bacteria 11806
757 Ga0501067_0000145 3300049583 Bacteria 39277
758 Ga0501068_0002577 3300049584 Bacteria 9611
759 Ga0501069_0071630 3300049585 Bacteria 1943
760 Ga0501070_0003510 3300049586 Bacteria 13565
761 Ga0501070_0052660 3300049586 Bacteria 3378
762 Ga0501072_0017020 3300049588 Bacteria 5585
763 Ga0501072_0265402 3300049588 Bacteria 1366
764 Ga0501073_0000027 3300049589 Bacteria 121860
765 Ga0501073_0039562 3300049589 Bacteria 3340
766 Ga0501074_0001347 3300049590 Bacteria 16291
767 Ga0501074_0146411 3300049590 Bacteria 1689
768 Ga0501079_0048138 3300049741 Bacteria 3290
769 Ga0501080_0002621 3300049742 Bacteria 15752
770 Ga0501080_0052129 3300049742 Bacteria 3808
771 Ga0501083_0002123 3300049744 Bacteria 13604
772 Ga0501035_0001852 3300049822 Bacteria 21281
773 Ga0501035_0310990 3300049822 Bacteria 1326
774 Ga0501044_0003498 3300049823 Bacteria 17680
775 Ga0501044_0722639 3300049823 Bacteria 880
776 nmdc:mga03683_46899_c1 3300050489 Bacteria 1792
777 nmdc:mga03n38_98_c1 3300050490 Bacteria 19203
778 nmdc:mga00v17_121059_c1 3300050491 Bacteria 1666
779 nmdc:mga00v17_32131_c1 3300050491 Bacteria 3101
780 nmdc:mga00v17_58540_c1 3300050491 Bacteria 2361
781 nmdc:mga0yw44_118730_c1 3300050492 Bacteria 1702
782 nmdc:mga0yw44_12674_c1 3300050492 Bacteria 4405
783 nmdc:mga0yw44_160309_c1 3300050492 Bacteria 1472
784 nmdc:mga0yw44_161818_c1 3300050492 Bacteria 1466
785 nmdc:mga0yw44_191706_c1 3300050492 Bacteria 1348
786 nmdc:mga0yw44_197218_c1 3300050492 Bacteria 1329
787 nmdc:mga0yw44_6672_c1 3300050492 Bacteria 5602
788 nmdc:mga0k408_100725_c1 3300050493 Bacteria 1703
789 nmdc:mga0k408_203983_c1 3300050493 Bacteria 1180
790 nmdc:mga0k408_67583_c1 3300050493 Bacteria 2083
791 nmdc:mga06z11_137921_c1 3300050494 Bacteria 1376
792 nmdc:mga06z11_179874_c1 3300050494 Bacteria 1219
793 nmdc:mga06z11_45740_c1 3300050494 Bacteria 2214
794 nmdc:mga04h51_18851_c1 3300050495 Bacteria 2038
795 nmdc:mga04h51_42826_c1 3300050495 Bacteria 1486
796 nmdc:mga07m45_110601_c1 3300050496 Bacteria 1582
797 nmdc:mga07m45_41962_c1 3300050496 Bacteria 2563
798 nmdc:mga07m45_87961_c1 3300050496 Bacteria 1778
799 nmdc:mga09592_277164_c1 3300050508 Bacteria 1454
800 nmdc:mga0n895_179818_c1 3300050512 Bacteria 2146
801 nmdc:mga0n895_262239_c1 3300050512 Bacteria 1753
802 nmdc:mga0sz30_11679_c1 3300050516 Bacteria 3398
803 nmdc:mga0sz30_175701_c1 3300050516 Bacteria 950
804 nmdc:mga0sz30_60927_c1 3300050516 Bacteria 1612
805 Ga0495601_0023042 3300053077 Bacteria 3826
806 Ga0495601_0045290 3300053077 Bacteria 2766
807 Ga0495601_0209366 3300053077 Bacteria 1274
808 Ga0500635_0003192 3300053080 Bacteria 4104
809 Ga0500635_0141457 3300053080 Bacteria 913
810 Ga0495655_0031289 3300053083 Bacteria 1294
811 Ga0495595_0058978 3300053084 Bacteria 1793
812 Ga0495595_0153870 3300053084 Bacteria 1132
813 Ga0495619_0052867 3300053085 Bacteria 2685
814 Ga0500643_000052 3300053087 Bacteria 144656
815 Ga0500647_0036476 3300053091 Bacteria 2351
816 Ga0500647_0063760 3300053091 Bacteria 1772
817 Ga0500647_0092965 3300053091 Bacteria 1443
818 Ga0500583_0138135 3300053092 Bacteria 1210
819 Ga0500583_0189653 3300053092 Bacteria 1023
820 Ga0500651_0074272 3300053093 Bacteria 2112
821 Ga0500566_0000207 3300053094 Bacteria 31105
822 Ga0500566_0002388 3300053094 Bacteria 11108
823 Ga0500566_0006524 3300053094 Bacteria 6914
824 Ga0500640_003553 3300053095 Bacteria 5477
825 Ga0500640_058687 3300053095 Bacteria 1671
826 Ga0500641_0001497 3300053096 Bacteria 8343
827 Ga0500650_0232835 3300053098 Bacteria 831
828 Ga0500554_000856 3300053102 Bacteria 5978
829 Ga0500554_001256 3300053102 Bacteria 4908
830 Ga0500556_0008721 3300053104 Bacteria 2930
831 Ga0500556_0017680 3300053104 Bacteria 2238
832 Ga0500557_000148 3300053105 Bacteria 16266
833 Ga0500562_004186 3300053108 Bacteria 3642
834 Ga0500569_000873 3300053109 Bacteria 5363
835 Ga0500572_000676 3300053111 Bacteria 11214
836 Ga0500591_081761 3300053115 Bacteria 1433
837 Ga0500591_091052 3300053115 Bacteria 1331
838 Ga0500592_007602 3300053116 Bacteria 1722
839 Ga0500594_0077242 3300053118 Bacteria 990
840 Ga0500595_000299 3300053119 Bacteria 32634
841 Ga0500595_003982 3300053119 Bacteria 6751
842 Ga0500595_004108 3300053119 Bacteria 6601
843 Ga0500595_011382 3300053119 Bacteria 3487
844 Ga0500595_012032 3300053119 Bacteria 3358
845 Ga0500595_027476 3300053119 Bacteria 1948
846 Ga0500608_051325 3300053122 Bacteria 1981
847 Ga0500608_107335 3300053122 Bacteria 1284
848 Ga0500614_000572 3300053123 Bacteria 9506
849 Ga0500614_005280 3300053123 Bacteria 2713
850 Ga0500614_014221 3300053123 Bacteria 1759
851 Ga0500642_0000083 3300053130 Bacteria 50718
852 Ga0500642_0009622 3300053130 Bacteria 3365
853 Ga0500652_017701 3300053131 Bacteria 2617
854 Ga0500658_0108552 3300053134 Bacteria 1219
855 Ga0500559_0003255 3300053136 Bacteria 8063
856 Ga0500559_0019756 3300053136 Bacteria 2847
857 Ga0500559_0036777 3300053136 Bacteria 2119
858 Ga0500559_0156993 3300053136 Bacteria 1068
859 Ga0500559_0194700 3300053136 Bacteria 955
860 Ga0500564_077793 3300053138 Bacteria 1490
861 Ga0500568_0008381 3300053139 Bacteria 4985
862 Ga0500568_0013248 3300053139 Bacteria 3761
863 Ga0500573_0077562 3300053140 Bacteria 1890
864 Ga0500577_0044289 3300053142 Bacteria 1639
865 Ga0500588_0026259 3300053146 Bacteria 1627
866 Ga0500590_056787 3300053148 Bacteria 1977
867 Ga0500590_133090 3300053148 Bacteria 1148
868 Ga0500590_175827 3300053148 Bacteria 936
869 Ga0500603_000313 3300053150 Bacteria 12755
870 Ga0500603_000691 3300053150 Bacteria 8222
871 Ga0500603_016677 3300053150 Bacteria 1746
872 Ga0500604_0016364 3300053151 Bacteria 2042
873 Ga0500622_0106390 3300053156 Bacteria 1375
874 Ga0500630_001066 3300053159 Bacteria 12827
875 Ga0500638_002777 3300053162 Bacteria 6250
876 Ga0500638_003145 3300053162 Bacteria 6024
877 Ga0500638_101633 3300053162 Bacteria 1340
878 Ga0500639_000072 3300053163 Bacteria 46512
879 Ga0500636_0000314 3300053177 Bacteria 26665
880 Ga0500636_0039800 3300053177 Bacteria 2781
881 Ga0500636_0064281 3300053177 Bacteria 2137
882 Ga0500636_0079580 3300053177 Bacteria 1890
883 Ga0500636_0119234 3300053177 Bacteria 1481
884 Ga0500637_0000065 3300053178 Bacteria 37771
885 Ga0500637_0002631 3300053178 Bacteria 8033
886 Ga0500637_0059209 3300053178 Bacteria 2192
887 Ga0500625_062812 3300053729 Bacteria 1679
888 Ga0500645_023607 3300053730 Bacteria 1885
889 Ga0500609_018174 3300053731 Bacteria 956
890 Ga0500596_002009 3300053735 Bacteria 4064
891 Ga0500596_002393 3300053735 Bacteria 3699
892 Ga0500596_008884 3300053735 Bacteria 1587
893 Ga0500599_000695 3300053736 Bacteria 3634
894 Ga0500601_000099 3300053737 Bacteria 18048
895 Ga0500601_003567 3300053737 Bacteria 1687
896 Ga0501084_0003235 3300054114 Bacteria 13188
897 Ga0500661_001927 3300055283 Bacteria 3916
898 Ga0501082_0005376 3300060353 Bacteria 11113
899 Ga0530510_0107924 3300061734 Bacteria 2038
900 2507504396 2507262055 Bacteria 8048963
901 2508545828 2508501009 Bacteria 7784016
902 2509146427 2508501128 Bacteria 8613869
903 2511396438 2511231028 Bacteria 8046582
904 2513624206 2513237092 Bacteria 8341956
905 2513638701 2513237094 Bacteria 8789602
906 2513649903 2513237095 Bacteria 8976980
907 2513656191 2513237096 Bacteria 8722461
908 2513679749 2513237098 Bacteria 9902361
909 2513702592 2513237102 Bacteria 7703324
910 2513716731 2513237104 Bacteria 10034502
911 2513860706 2513237137 Bacteria 9558895
912 2513892473 2513237141 Bacteria 8496279
913 2513917629 2513237145 Bacteria 8979722
914 2514010031 2513237161 Bacteria 8871253
915 2515624421 2515154112 Bacteria 8294334
916 2517108171 2517093001 Bacteria 9002274
917 2517887711 2517572143 Bacteria 9484767
918 2524442735 2524023205 Bacteria 8918781
919 2524466636 2524023210 Bacteria 9029266
920 2524535377 2524023228 Bacteria 10118060
921 2528850463 2528768022 Bacteria 10457665
922 2617353829 2617270735 Bacteria 9163226
923 2617374421 2617270741 Bacteria 8201522
924 2671120777 2667528175 Bacteria 7532676
925 2723842482 2721755755 Bacteria 8322773
926 2728748280 2728368998 Bacteria 8720350
927 2745074552 2744054633 Bacteria 8678936
928 2793059334 2791355196 Bacteria 7323613
929 2793072903 2791355197 Bacteria 8420563
930 2793078666
931 2805922093 2802429603 Bacteria 8777136
932 2818240903 2816332527 Bacteria 8933356
933 2824604658 2824600985 Bacteria 8488197
934 2824616134 2824609381 Bacteria 8672835
935 2824618875 2824617872 Bacteria 8814715
936 2824632891 2824626560 Bacteria 8813858
937 2824641000 2824635225 Bacteria 8785348
938 2824648206 2824644064 Bacteria 8743947
939 2824658407 2824653114 Bacteria 8493680
940 2824667418 2824661429 Bacteria 9877870
941 2824675505 2824671348 Bacteria 8369588
942 2824685974 2824679649 Bacteria 8248951
943 2824691728 2824687955 Bacteria 8360029
944 2824698955 2824696289 Bacteria 8335049
945 2824709901 2824704595 Bacteria 9667483
946 2824718018 2824714736 Bacteria 8717648
947 2824728326 2824723954 Bacteria 8758240
948 2824734967 2824732956 Bacteria 7810675
949 2824748114 2824746037 Bacteria 7911610
950 2824759707 2824753945 Bacteria 9787441
951 2824769912 2824763712 Bacteria 9792355
952 2824779722 2824773399 Bacteria 8360218
953 2838126063 2838122688 Bacteria 8803140
954 2841942544 2841941048 Bacteria 8688029
955 2841953106 2841949485 Bacteria 8680857
956 2841960610 2841957949 Bacteria 8652217
957 2841970869 2841966195 Bacteria 8673214
958 2841977871 2841974524 Bacteria 8931498
959 2841984564 2841983080 Bacteria 8395090
960 2842041714 2842038055 Bacteria 8002051
961 2842049756 2842045827 Bacteria 8006841
962 2844321401 2844315083 Bacteria 8138177
963 2847932007 2847930680 Bacteria 9342022
964 2847943248 2847939898 Bacteria 8606328
965 2849076975 2849076700 Bacteria 7039503
966 2857514750 2857509624 Bacteria 7472071
967 2874595650 2874590934 Bacteria 8299676
968 2874620351 2874612657 Bacteria 8252029
969 2874621842 2874620515 Bacteria 8290088
970 2874630236 2874628541 Bacteria 8630250
971 2874651717 2874645413 Bacteria 8214782
972 2876766441 2876761206 Bacteria 10111113
973 2876775845 2876771140 Bacteria 8287509
974 2876821612 2876818435 Bacteria 8274608
975 2879079936 2879074833 Bacteria 8279565
976 2879085686 2879083081 Bacteria 8587928
977 2879104529 2879099564 Bacteria 10442239
978 2879134020 2879127579 Bacteria 8294491
979 2879148505 2879142872 Bacteria 8267021
980 2881370400 2881364244 Bacteria 7710352
981 2881666458 2881665667 Bacteria 8175609
982 2885374419 2885366525 Bacteria 8326213
983 2885382552 2885374607 Bacteria 8927485
984 2885384907 2885383462 Bacteria 9473874
985 2885411551 2885409591 Bacteria 9235467
986 2888387706 2888378607 Bacteria 9652610
987 2888391464 2888388044 Bacteria 7304136
988 2888426915 2888419890 Bacteria 7857137
989 2889034246 2889033259 Bacteria 9099371
990 2903734582 2903727486 Bacteria 8281579
991 2903753644 2903748898 Bacteria 9972761
992 2903773488 2903768456 Bacteria 9749579
993 2904669565 2904666416 Bacteria 8226587
994 2904691841 2904690495 Bacteria 9412302
995 2904713623 2904711408 Bacteria 9771557
996 2906608015 2906602504 Bacteria 8295279
997 2906612721
998 2906629413 2906626472 Bacteria 8826946
999 2906640553 2906635258 Bacteria 8601019
1000 2906647219 2906643746 Bacteria 8722424
1001 2906663223 2906660503 Bacteria 8595048
1002 2908745917 2908739725 Bacteria 8628932
1003 2908763946 2908756301 Bacteria 8864324
1004 2908776902 2908775508 Bacteria 8092255
1005 2922367632 2922361189 Bacteria 7436256
1006 2922376692
1007 2922391607 2922386360 Bacteria 7017218
1008 2922393292 2922393267 Bacteria 8285685
1009 2922433201
1010 2929619767 2929615660 Bacteria 9193770
1011 2929629078 2929624759 Bacteria 9339455
1012 2932789747 2932784394 Bacteria 9704911
1013 2932796585 2932794094 Bacteria 7915132
1014 2932817740 2932809354 Bacteria 9135765
1015 2932827148 2932818245 Bacteria 9955613
1016 2932835752 2932828146 Bacteria 9745859
1017 2933581686 2933577622 Bacteria 9116884
1018 2935613191 2935608549 Bacteria 8203142
1019 2935624554 2935616580 Bacteria 9032984
1020 2935630602 2935630451 Bacteria 8169952
1021 2935647219 2935638405 Bacteria 10015038
1022 2935655637 2935648319 Bacteria 8801166
1023 2935664459 2935656913 Bacteria 8965014
1024 2935674318 2935665750 Bacteria 9571747
1025 2935684198 2935675223 Bacteria 9928132
1026 2935694230 2935684952 Bacteria 9590419
1027 2935697671 2935694250 Bacteria 9291695
1028 2935711307 2935703347 Bacteria 10242284
1029 2935720015 2935713505 Bacteria 9608509
1030 2935732126 2935722832 Bacteria 9608746
1031 2935741515 2935732158 Bacteria 9706831
1032 2935750877 2935741537 Bacteria 9707219
1033 2935757871 2935750917 Bacteria 9590372
1034 2935764248 2935760218 Bacteria 9817913
1035 2935775128 2935769743 Bacteria 7878163
1036 2935780031 2935777560 Bacteria 8077691
1037 2935790152 2935785616 Bacteria 7962367
1038 2935798806 2935793552 Bacteria 8012592
1039 2935809907 2935801545 Bacteria 9301974
1040 2935819312 2935810662 Bacteria 9401221
1041 2935824955 2935819856 Bacteria 8261050
1042 2935836643 2935827899 Bacteria 10038562
1043 2935846412 2935837841 Bacteria 9454360
1044 2935852175 2935847175 Bacteria 8228321
1045 2935863236 2935855204 Bacteria 9035059
1046 2935868705 2935864058 Bacteria 9784707
1047 2935879479 2935873716 Bacteria 9632195
1048 2935916443 2935908558 Bacteria 8568796
1049 2935925439 2935916978 Bacteria 9113783
1050 2935933943 2935926038 Bacteria 8601059
1051 2935942466 2935934488 Bacteria 8602579
1052 2935950921 2935942939 Bacteria 8599779
1053 2935959382 2935951376 Bacteria 8602333
1054 2935965393 2935959822 Bacteria 7869783
1055 2935975449 2935967501 Bacteria 8603075
1056 2935980119 2935975950 Bacteria 8347125
1057 2935984283 2935984226 Bacteria 8302647
1058 2936000273 2935992306 Bacteria 9802711
1059 2936010315 2936002035 Bacteria 9362176
1060 2936018587 2936011229 Bacteria 8801034
1061 2936027105 2936019824 Bacteria 8804134
1062 2936035928 2936028420 Bacteria 8965941
1063 2936045935 2936037263 Bacteria 9446081
1064 2936054007 2936046547 Bacteria 8903709
1065 2936055363 2936055302 Bacteria 8785755
1066 2940563307 2940556831 Bacteria 9590747
1067 2941507254 2941507105 Bacteria 8166816
1068 2941515681 2941515067 Bacteria 8166720
1069 2941523611 2941523033 Bacteria 8169134
1070 2941531970 2941531003 Bacteria 7653939
1071 2941546840 2941538514 Bacteria 9402094
1072 3005485747 3005483717 Bacteria 7877331
1073 3005506606 3005506211 Bacteria 6943378
1074 3005588739 3005587118 Bacteria 7794411
1075 3005601757 3005594810 Bacteria 8716512
1076 3005717496 3005710791 Bacteria 7622528
1077 3005724433 3005718088 Bacteria 8283608
1078 8006933382 8006926726 Bacteria 6749210
1079 8006935102 8006933436 Bacteria 10410654
1080 8006965371 8006964411 Bacteria 8966052
1081 8006975070 8006973647 Bacteria 10679141
1082 8006986083 8006984368 Bacteria 9651211
1083 8006999243 8006994254 Bacteria 8309700
1084 8016519140 8016511872 Bacteria 9921665
1085 8016538754 8016530956 Bacteria 8155261
1086 8016543042 8016539877 Bacteria 8155419
1087 8016550251 8016548790 Bacteria 8155074
1088 8016558660 8016557553 Bacteria 8154380
1089 8016568446 8016566248 Bacteria 8158151
1090 8016581098 8016575299 Bacteria 8154085
1091 8016587617 8016583857 Bacteria 10421953
1092 8016596638 8016595262 Bacteria 8149947
1093 8016619305 8016613128 Bacteria 8794220
1094 8016630287 8016622563 Bacteria 7999408
1095 8016636860 8016630954 Bacteria 9217207
1096 8017066359 8017057580 Bacteria 10023680
1097 8019541398 8019538911 Bacteria 7872763
1098 8019573671 8019565922 Bacteria 9639779
1099 8019596292 8019586578 Bacteria 10212056
1100 8019605406 8019597564 Bacteria 10041141
1101 8019613134 8019608314 Bacteria 10042931
1102 8019623822 8019619141 Bacteria 9218857
1103 8019641420 8019638758 Bacteria 9062356
1104 8019666135 8019659431 Bacteria 8577854
1105 8019680453 8019678201 Bacteria 8863603
1106 8019695361 8019687851 Bacteria 8712826
1107 8055750480 8055742211 Bacteria 9226248
1108 8056678964 8056673599 Bacteria 7871253
1109 8056685531 8056681323 Bacteria 8472857
1110 8056692827 8056689827 Bacteria 6712655
1111 8056971783 8056967851 Bacteria 9038162
1112 Ga0081540_1021473
1113 JGI24735J21928_10024186
1114 JGI25406J46586_10005201
1115 JGI25153J46596_10005814
1116 rootL2_10017863
1117 rootH1_10149220
1118 JGI25160J50197_1019598
1119 JGI25160J50197_1019601
1120 JGI25404J52841_10003242
1121 JGI25404J52841_10007484
1122 JGI25404J52841_10012840
1123 Ga0055531_10006499
1124 Ga0055531_10018955
1125 Ga0065165_1001465
1126 Ga0065165_1003494
1127 Ga0065165_1007016
1128 Ga0065165_1021815
1129 Ga0068869_100121166
1130 Ga0068869_100344888
1131 Ga0070680_100003569
1132 Ga0070680_100281547
1133 Ga0070680_100415309
1134 Ga0070682_100063668
1135 Ga0070682_100400263
1136 Ga0068868_100017752
1137 Ga0068868_100145011
1138 Ga0070660_100031186
1139 Ga0070660_100068615
1140 Ga0070660_100297090
1141 Ga0070668_100047596
1142 Ga0070668_100115123
1143 Ga0070668_100254836
1144 Ga0070673_100140477
1145 Ga0070673_100220019
1146 Ga0070673_100228968
1147 Ga0070659_100198207
1148 Ga0070659_100402578
1149 Ga0070659_100608300
1150 Ga0070667_100212524
1151 Ga0070667_100420239
1152 Ga0070709_10001461
1153 Ga0070714_100003988
1154 Ga0070713_100004627
1155 Ga0070713_100324844
1156 Ga0070713_100348944
1157 Ga0070713_100659331
1158 Ga0070710_10001981
1159 Ga0070710_10003702
1160 Ga0070710_10100719
1161 Ga0070711_100010613
1162 Ga0070711_100081392
1163 Ga0070708_100672681
1164 Ga0070663_100059739
1165 Ga0070663_100077803
1166 Ga0070663_100172651
1167 Ga0070663_100199397
1168 Ga0070663_100557482
1169 Ga0070678_100005458
1170 Ga0070678_100185492
1171 Ga0070662_100076746
1172 Ga0070662_100103839
1173 Ga0070681_10015034
1174 Ga0070706_100463842
1175 Ga0070698_100133500
1176 Ga0070679_100132475
1177 Ga0070679_100433843
1178 Ga0070684_100106220
1179 Ga0070684_100473399
1180 Ga0070697_100103553
1181 Ga0068853_100019769
1182 Ga0068853_100204925
1183 Ga0068853_100371777
1184 Ga0068853_100624733
1185 Ga0070693_100101737
1186 Ga0070665_100020723
1187 Ga0070665_100070010
1188 Ga0070665_100133651
1189 Ga0070665_100155002
1190 Ga0070665_100156385
1191 Ga0070665_100241352
1192 Ga0070665_100297112
1193 Ga0070665_100665183
1194 Ga0068855_100029909
1195 Ga0068855_100051047
1196 Ga0068855_100060591
1197 Ga0068855_100110634
1198 Ga0068855_100121318
1199 Ga0068855_100483473
1200 Ga0068855_100598929
1201 Ga0068855_100625499
1202 Ga0070664_100151355
1203 Ga0070664_100223336
1204 Ga0070664_100387422
1205 Ga0068857_100005639
1206 Ga0068857_100069443
1207 Ga0068857_100101360
1208 Ga0068857_100171744
1209 Ga0068854_100005923
1210 Ga0068854_100096642
1211 Ga0068854_100102096
1212 Ga0068856_100000476
1213 Ga0068856_100093882
1214 Ga0068856_100162354
1215 Ga0068856_100202844
1216 Ga0068856_100234557
1217 Ga0068856_100285932
1218 Ga0068852_100180576
1219 Ga0068852_100453482
1220 Ga0068859_100172189
1221 Ga0068859_100606990
1222 Ga0068864_100064794
1223 Ga0068864_100433369
1224 Ga0068861_100428100
1225 Ga0068851_10003823
1226 Ga0068851_10020573
1227 Ga0068851_10070129
1228 Ga0068851_10100743
1229 Ga0068870_10086555
1230 Ga0068870_10100319
1231 Ga0068863_100159012
1232 Ga0068863_100285090
1233 Ga0068858_100078638
1234 Ga0068858_100496633
1235 Ga0068862_100076660
1236 Ga0068862_100508564
1237 Ga0081455_10011371
1238 Ga0081455_10076987
1239 Ga0081455_10111202
1240 Ga0081540_1004386
1241 Ga0081540_1005329
1242 Ga0081540_1007078
1243 Ga0081540_1007475
1244 Ga0081540_1013507
1245 Ga0081540_1016353
1246 Ga0081540_1018434
1247 Ga0081540_1048885
1248 Ga0081540_1053054
1249 Ga0081540_1111692
1250 Ga0081539_10001098
1251 Ga0070717_10001915
1252 Ga0070717_10009625
1253 Ga0070717_10034975
1254 Ga0070717_10101140
1255 Ga0070717_10240349
1256 Ga0075365_10037480
1257 Ga0075365_10137418
1258 Ga0075365_10300178
1259 Ga0075365_10309879
1260 Ga0075363_100000795
1261 Ga0075364_10060459
1262 Ga0075364_10198710
1263 Ga0070715_10003656
1264 Ga0070716_100009999
1265 Ga0070716_100017312
1266 Ga0070716_100194790
1267 Ga0075367_10086232
1268 Ga0075367_10115869
1269 Ga0075369_10023467
1270 Ga0075369_10028142
1271 Ga0075369_10032740
1272 Ga0075369_10124553
1273 Ga0075366_10090110
1274 Ga0075366_10152688
1275 Ga0075366_10171511
1276 Ga0097621_100034637
1277 Ga0097621_100109329
1278 Ga0097621_100304885
1279 Ga0075370_10178773
1280 Ga0068871_100044285
1281 Ga0068865_100167092
1282 Ga0097620_100172180
1283 Ga0097620_100416370
1284 Ga0097620_100606905
1285 Ga0099824_1007622
1286 Ga0099824_1030093
1287 Ga0099822_1024573
1288 Ga0099823_1025861
1289 Ga0099794_10004947
1290 Ga0099794_10035717
1291 Ga0099794_10199251
1292 Ga0099795_10045988
1293 Ga0105240_10013609
1294 Ga0105240_10128230
1295 Ga0105240_10217619
1296 Ga0105240_11035930
1297 Ga0111539_10268381
1298 Ga0105245_10030466
1299 Ga0105245_10339887
1300 Ga0114129_10043623
1301 Ga0105243_10179770
1302 Ga0105243_10335919
1303 Ga0105241_10043812
1304 Ga0105241_10060066
1305 Ga0105241_10112909
1306 Ga0105241_10252735
1307 Ga0105241_10262108
1308 Ga0105248_10545891
1309 Ga0105237_10009561
1310 Ga0105237_10045175
1311 Ga0105237_10048901
1312 Ga0105237_10061469
1313 Ga0105237_10103750
1314 Ga0105237_10186478
1315 Ga0105237_10243637
1316 Ga0105237_10579715
1317 Ga0105238_10157658
1318 Ga0105238_10194558
1319 Ga0105238_10262622
1320 Ga0105249_10798089
1321 Ga0105239_10013308
1322 Ga0105239_10128536
1323 Ga0105239_10128753
1324 Ga0105239_10199213
1325 Ga0105239_10393280
1326 Ga0105239_10426864
1327 Ga0105239_10492456
1328 Ga0105246_10019037
1329 Ga0105246_10024007
1330 Ga0105246_10187269
1331 Ga0157370_10079869
1332 Ga0157370_10193297
1333 Ga0157369_10012327
1334 Ga0157369_10490429
1335 Ga0157374_10155057
1336 Ga0157374_10447706
1337 Ga0157378_10006449
1338 Ga0157378_10243912
1339 Ga0163162_10186346
1340 Ga0163162_10267283
1341 Ga0163162_10291181
1342 Ga0163162_10743548
1343 Ga0157372_10096808
1344 Ga0157372_10444064
1345 Ga0157375_10018315
1346 Ga0157375_10133453
1347 Ga0157375_10286649
1348 Ga0157375_10583229
1349 Ga0163163_10044739
1350 Ga0163163_10066420
1351 Ga0163163_10073045
1352 Ga0163163_10879805
1353 Ga0157380_10090556
1354 Ga0157377_10159835
1355 Ga0157379_10067447
1356 Ga0157379_10321013
1357 Ga0157379_10490667
1358 Ga0157379_10717134
1359 Ga0157376_10031939
1360 Ga0157376_10134588
1361 Ga0157376_10455346
1362 Ga0163161_10401145
1363 Ga0214542_1000003
1364 Ga0214545_1000004
1365 Ga0214543_1009591
1366 Ga0213873_10004591
1367 Ga0213872_10094460
1368 Ga0213876_10001391
1369 Ga0213871_10000490
1370 Ga0209148_1000490
1371 Ga0209233_1010343
1372 Ga0209233_1019818
1373 Ga0209233_1030468
1374 Ga0209455_1004977
1375 Ga0209564_1027292
1376 Ga0209758_1000106
1377 Ga0209758_1000982
1378 Ga0209758_1002038
1379 Ga0209758_1003538
1380 Ga0209758_1010528
1381 Ga0209758_1025853
1382 Ga0209050_1029906
1383 Ga0209256_1007012
1384 Ga0209256_1018839
1385 Ga0207426_1000337
1386 Ga0207426_1001470
1387 Ga0207426_1042794
1388 Ga0207426_1064572
1389 Ga0209257_1000348
1390 Ga0209257_1001773
1391 Ga0209257_1010363
1392 Ga0209257_1038474
1393 Ga0207656_10032711
1394 Ga0207692_10002972
1395 Ga0207692_10030002
1396 Ga0207642_10089793
1397 Ga0207647_10000908
1398 Ga0207647_10076385
1399 Ga0207699_10004093
1400 Ga0207699_10176623
1401 Ga0207643_10130130
1402 Ga0207705_10242644
1403 Ga0207654_10004509
1404 Ga0207654_10019456
1405 Ga0207654_10156768
1406 Ga0207707_10002162
1407 Ga0207707_10005294
1408 Ga0207707_10201928
1409 Ga0207695_10001591
1410 Ga0207695_10017338
1411 Ga0207671_10018136
1412 Ga0207671_10031051
1413 Ga0207671_10060866
1414 Ga0207671_10077354
1415 Ga0207671_10078410
1416 Ga0207671_10103392
1417 Ga0207671_10391024
1418 Ga0207693_10009468
1419 Ga0207693_10009993
1420 Ga0207693_10208668
1421 Ga0207660_10030146
1422 Ga0207660_10185538
1423 Ga0207657_10167068
1424 Ga0207657_10196225
1425 Ga0207657_10554633
1426 Ga0207649_10119309
1427 Ga0207652_10106404
1428 Ga0207652_10140411
1429 Ga0207694_10022056
1430 Ga0207694_10031537
1431 Ga0207694_10048565
1432 Ga0207694_10097786
1433 Ga0207694_10119947
1434 Ga0207650_10244482
1435 Ga0207687_10013836
1436 Ga0207687_10131919
1437 Ga0207700_10008050
1438 Ga0207700_10057211
1439 Ga0207700_10162873
1440 Ga0207700_10294456
1441 Ga0207700_10588770
1442 Ga0207664_10010392
1443 Ga0207664_10079512
1444 Ga0207690_10039021
1445 Ga0207706_10034466
1446 Ga0207706_10123613
1447 Ga0207709_10085086
1448 Ga0207709_10116401
1449 Ga0207669_10135393
1450 Ga0207704_10125140
1451 Ga0207665_10006342
1452 Ga0207691_10216166
1453 Ga0207691_10367613
1454 Ga0207689_10081964
1455 Ga0207689_10122888
1456 Ga0207689_10456766
1457 Ga0207661_10094227
1458 Ga0207679_10127513
1459 Ga0207667_10029690
1460 Ga0207667_10044947
1461 Ga0207667_10098667
1462 Ga0207667_10411218
1463 Ga0207651_10153326
1464 Ga0207712_10042423
1465 Ga0207712_10072956
1466 Ga0207668_10100984
1467 Ga0207640_10016570
1468 Ga0207640_10083922
1469 Ga0207640_10266517
1470 Ga0207677_10012673
1471 Ga0207677_10067541
1472 Ga0207677_10184163
1473 Ga0207703_10022563
1474 Ga0207703_10095909
1475 Ga0207703_10210388
1476 Ga0207639_10388199
1477 Ga0207639_10537754
1478 Ga0207678_10045772
1479 Ga0207678_10050255
1480 Ga0207678_10053837
1481 Ga0207678_10070679
1482 Ga0207702_10000003
1483 Ga0207702_10000514
1484 Ga0207641_10256946
1485 Ga0207641_10406020
1486 Ga0207648_10049340
1487 Ga0207648_10064924
1488 Ga0207676_10019625
1489 Ga0207676_10150888
1490 Ga0207674_10048184
1491 Ga0207674_10096974
1492 Ga0207674_10188004
1493 Ga0207674_10234568
1494 Ga0207674_10504816
1495 Ga0207675_100064906
1496 Ga0207675_100070222
1497 Ga0207675_100149277
1498 Ga0207675_100344132
1499 Ga0207683_10019949
1500 Ga0207698_10057798
1501 Ga0207698_10389198
1502 Ga0207698_10480663
1503 Ga0209389_1000016
1504 Ga0209389_1000027
1505 Ga0209589_1000005
1506 Ga0209589_1013736
1507 Ga0209489_100005
1508 Ga0209489_102237
1509 Ga0209489_110753
1510 Ga0209700_100006
1511 Ga0209700_100012
1512 Ga0209179_1000570
1513 Ga0209813_10052679
1514 Ga0268266_10005838
1515 Ga0268266_10051358
1516 Ga0268266_10071200
1517 Ga0268266_10192118
1518 Ga0268266_10241188
1519 Ga0268266_10389125
1520 Ga0268266_10461065
1521 Ga0268266_10517614
1522 Ga0268265_10373474
1523 Ga0268265_10581463
1524 Ga0268264_10131146
1525 Ga0268264_10351696
1526 Ga0268264_10406861
1527 Ga0268264_10508567
1528 Ga0265334_10016514
1529 Ga0307517_10018365
1530 Ga0307515_10278812
1531 Ga0307511_10029041
1532 Ga0307511_10084295
1533 Ga0265330_10013428
1534 Ga0265330_10021180
1535 Ga0265330_10026032
1536 Ga0265332_10008158
1537 Ga0265332_10028166
1538 Ga0265332_10069519
1539 Ga0265328_10029632
1540 Ga0265328_10094481
1541 Ga0265325_10023540
1542 Ga0265340_10018482
1543 Ga0265339_10018617
1544 Ga0265331_10021097
1545 Ga0265316_10028897
1546 Ga0307509_10004649
1547 Ga0307509_10012663
1548 Ga0307509_10175879
1549 Ga0265313_10043303
1550 Ga0307508_10003178
1551 Ga0307508_10045726
1552 Ga0265314_10113147
1553 Ga0307516_10072595
1554 Ga0307516_10106814
1555 Ga0307516_10207372
1556 Ga0307406_10341044
1557 Ga0307412_10396788
1558 Ga0307409_100422305
1559 Ga0307510_10005379
1560 Ga0307510_10083698
1561 Ga0373934_0059952
1562 Ga0373951_0050524
1563 Ga0373923_0058208
1564 Ga0373923_0166737
1565 Ga0373936_0025118
1566 Ga0373945_0007763
1567 Ga0373953_0026940
1568 Ga0373954_0003254
1569 Ga0373956_0004124
1570 Ga0373957_0017874
1571 Ga0373957_0177653
1572 Ga0373943_0102189
1573 Ga0373955_0128359
1574 Ga0373955_0264780
1575 Ga0373924_0080488
1576 Ga0373924_0088153
1577 Ga0373931_0075136
1578 Ga0373931_0080264
1579 Ga0373935_0012074
1580 Ga0373935_0242112
1581 Ga0373935_0360795
1582 Ga0373935_0449956
1583 Ga0373927_0012034
1584 Ga0373927_0033415
1585 Ga0373927_0476852
1586 Ga0373933_0000784
1587 Ga0373933_0009468
1588 Ga0373933_0080016
1589 Ga0373947_0027815
1590 Ga0373937_0026313
1591 Ga0373937_0206960
1592 Ga0373937_0519020
1593 Ga0373937_0538195
1594 Ga0372808_011667
1595 Ga0373925_0062447
1596 Ga0373925_0361964
1597 Ga0395899_0144236
1598 Ga0395900_0016672
1599 Ga0395900_0164314
1600 Ga0395900_0620377
1601 Ga0395898_0104561
1602 Ga0395905_0096770
1603 Ga0395905_0202187
1604 Ga0395905_0372345
1605 Ga0395901_0019475
1606 Ga0395901_0872784
1607 Ga0436365_0328255
1608 Ga0436365_1493072
1609 Ga0436360_1256499
1610 Ga0436361_0385472
1611 Ga0436361_0964292
1612 Ga0436362_0953067
1613 Ga0439465_0020470
1614 Ga0451789_0661496
1615 Ga0439455_0015584
1616 Ga0466969_0070134
1617 Ga0466969_0162768
1618 Ga0466972_0000449
1619 Ga0466972_0072783
1620 Ga0466965_0109412
1621 Ga0466966_0000455
1622 Ga0466961_0000603
1623 Ga0466963_0066822
1624 Ga0466963_0236276
1625 Ga0466964_0129046
1626 Ga0466968_0012673
1627 Ga0466968_0084211
1628 Ga0466970_0030813
1629 Ga0466970_0065716
1630 Ga0466970_0222753
1631 Ga0466960_0014996
1632 Ga0466960_0091010
1633 Ga0466959_0051667
1634 Ga0466959_0142548
1635 Ga0466958_0253883
1636 Ga0495592_0030678
1637 Ga0495592_0035165
1638 Ga0495603_0005606
1639 Ga0495603_0126526
1640 Ga0495590_0090407
1641 Ga0495629_0002984
1642 Ga0495629_0134775
1643 Ga0495629_0145729
1644 Ga0495638_0005250
1645 Ga0495638_0198660
1646 Ga0495641_0018784
1647 Ga0495651_0050286
1648 Ga0495651_0061975
1649 Ga0495651_0123223
1650 Ga0495651_0245177
1651 Ga0495653_0023442
1652 Ga0495653_0077004
1653 Ga0495650_0043671
1654 Ga0495650_0106592
1655 Ga0495582_0111674
1656 Ga0495639_0007837
1657 Ga0495664_0169530
1658 Ga0495585_0045665
1659 Ga0495594_0020690
1660 Ga0495594_0311417
1661 Ga0495596_0022344
1662 Ga0495596_0111725
1663 Ga0495606_0066222
1664 Ga0495608_0023069
1665 Ga0495608_0113898
1666 Ga0495618_0157659
1667 Ga0495618_0167097
1668 Ga0495628_0018851
1669 Ga0495628_0076373
1670 Ga0495628_0136147
1671 Ga0495630_0059721
1672 Ga0495630_0514848
1673 Ga0495632_0035870
1674 Ga0495643_0172918
1675 Ga0495644_0051474
1676 Ga0495644_0060952
1677 Ga0495648_0012715
1678 Ga0495648_0118314
1679 Ga0495666_0098329
1680 Ga0495652_0078081
1681 Ga0495652_0101934
1682 Ga0495652_0122685
1683 Ga0495640_0043124
1684 Ga0495640_0045764
1685 Ga0495640_0160091
1686 Ga0495587_0015723
1687 Ga0495587_0033800
1688 Ga0495609_0099114
1689 Ga0495621_0060160
1690 Ga0495645_0088815
1691 Ga0495622_0015653
1692 Ga0495622_0016701
1693 Ga0495622_0035408
1694 Ga0495622_0036243
1695 Ga0495667_0030518
1696 Ga0495667_0035702
1697 Ga0495667_0139165
1698 Ga0495656_0001017
1699 Ga0495668_0052216
1700 Ga0495634_0005863
1701 Ga0495634_0033851
1702 Ga0495634_0038694
1703 Ga0495611_0040347
1704 Ga0495625_0082968
1705 Ga0495635_0002996
1706 Ga0495635_0024568
1707 Ga0495635_0041945
1708 Ga0495635_0058430
1709 Ga0495659_0008839
1710 Ga0495661_0164586
1711 Ga0495588_0002975
1712 Ga0495588_0136041
1713 Ga0495657_0025879
1714 Ga0495657_0033612
1715 Ga0495657_0086881
1716 Ga0495599_0018837
1717 Ga0495599_0032531
1718 Ga0495623_0005568
1719 Ga0495623_0006324
1720 Ga0495646_0033218
1721 Ga0495646_0046764
1722 Ga0495647_0013604
1723 Ga0495658_0182753
1724 Ga0495658_0325741
1725 Ga0495658_0367751
1726 Ga0495669_0006974
1727 Ga0495669_0049594
1728 Ga0495669_0072437
1729 Ga0495613_0043701
1730 Ga0495613_0044858
1731 Ga0495624_0025788
1732 Ga0495670_0077455
1733 Ga0495671_0070273
1734 Ga0495671_0125644
1735 Ga0495671_0139991
1736 Ga0495649_0233896
1737 Ga0495589_0148222
1738 Ga0495589_0160790
1739 Ga0495600_0004662
1740 Ga0495600_0035570
1741 Ga0495600_0056757
1742 Ga0495581_0039231
1743 Ga0495604_0007789
1744 Ga0495604_0018421
1745 Ga0495604_0077985
1746 Ga0495604_0366374
1747 Ga0495674_0066189
1748 Ga0495674_0087507
1749 Ga0495674_0119336
1750 Ga0495674_0123414
1751 Ga0495676_0048116
1752 Ga0495676_0050003
1753 Ga0495676_0191337
1754 Ga0495680_0035746
1755 Ga0495683_0060361
1756 Ga0495683_0186214
1757 Ga0495687_046799
1758 Ga0495675_0037487
1759 Ga0495673_0089210
1760 Ga0495684_0019268
1761 Ga0495684_0087037
1762 Ga0495686_0057913
1763 Ga0495593_0032879
1764 Ga0495593_0071237
1765 Ga0495602_0013480
1766 Ga0495602_0061833
1767 Ga0495602_0075890
1768 Ga0495602_0316208
1769 Ga0495614_0112115
1770 Ga0496100_0004243
1771 Ga0496100_0522017
1772 Ga0496101_0013036
1773 Ga0496102_0002815
1774 Ga0496102_0077227
1775 Ga0496102_0084967
1776 Ga0496102_0095338
1777 Ga0496103_0030000
1778 Ga0496104_0006611
1779 Ga0496104_0024816
1780 Ga0496104_0033645
1781 Ga0496105_0009154
1782 Ga0496105_0032947
1783 Ga0496105_0107061
1784 Ga0496105_0220523
1785 Ga0496105_0228544
1786 Ga0496106_0005419
1787 Ga0496106_0042125
1788 Ga0496106_0057561
1789 Ga0496106_0330762
1790 Ga0496107_0014935
1791 Ga0496107_0127578
1792 Ga0496108_0046662
1793 Ga0496108_0052073
1794 Ga0496109_0021949
1795 Ga0496109_0035699
1796 Ga0496109_0231547
1797 Ga0496109_0426575
1798 Ga0496110_0023683
1799 Ga0496110_0275222
1800 Ga0496110_0307890
1801 Ga0496111_0138209
1802 Ga0496111_0275631
1803 Ga0496112_0111037
1804 Ga0496112_0119972
1805 Ga0496112_0241122
1806 Ga0496112_0733093
1807 Ga0496113_0024350
1808 Ga0496113_0035208
1809 Ga0496113_0157985
1810 Ga0496114_0102760
1811 Ga0496114_0165612
1812 Ga0496114_0604349
1813 Ga0496115_0009460
1814 Ga0496115_0013575
1815 Ga0496115_0279250
1816 Ga0496115_0327366
1817 Ga0496115_0395224
1818 Ga0496115_0453047
1819 Ga0496117_0039426
1820 Ga0496119_0032422
1821 Ga0496119_0065095
1822 Ga0496119_0108621
1823 Ga0496120_0011992
1824 Ga0496121_0000146
1825 Ga0496121_0002453
1826 Ga0496121_0003864
1827 Ga0496121_0003891
1828 Ga0496121_0042243
1829 Ga0496121_0180611
1830 Ga0496121_0180804
1831 Ga0496121_0186048
1832 Ga0496121_0207091
1833 Ga0496121_0242884
1834 Ga0496121_0277988
1835 Ga0496122_0011039
1836 Ga0496122_0027250
1837 Ga0496122_0124478
1838 Ga0496123_0007911
1839 Ga0496124_0001997
1840 Ga0496124_0160713
1841 Ga0496125_0034974
1842 Ga0496125_0035461
1843 Ga0496126_0006544
1844 Ga0496126_0010063
1845 Ga0496126_0017240
1846 Ga0496126_0035606
1847 Ga0496126_0056121
1848 Ga0496126_0095415
1849 Ga0496126_0123694
1850 Ga0496126_0124200
1851 Ga0496126_0141204
1852 Ga0495682_0026585
1853 Ga0501031_0066881
1854 Ga0501032_0000196
1855 Ga0501033_0003209
1856 Ga0501034_0001151
1857 Ga0501036_0000323
1858 Ga0501037_0001377
1859 Ga0501038_0001622
1860 Ga0501039_0001302
1861 Ga0501042_0046374
1862 Ga0501043_0000409
1863 Ga0501046_0000181
1864 Ga0501047_0002426
1865 Ga0501047_0062965
1866 Ga0501047_0600438
1867 Ga0501048_0003595
1868 Ga0501067_0000145
1869 Ga0501068_0002577
1870 Ga0501069_0071630
1871 Ga0501070_0003510
1872 Ga0501070_0052660
1873 Ga0501072_0017020
1874 Ga0501072_0265402
1875 Ga0501073_0000027
1876 Ga0501073_0039562
1877 Ga0501074_0001347
1878 Ga0501074_0146411
1879 Ga0501079_0048138
1880 Ga0501080_0002621
1881 Ga0501080_0052129
1882 Ga0501083_0002123
1883 Ga0501035_0001852
1884 Ga0501035_0310990
1885 Ga0501044_0003498
1886 Ga0501044_0722639
1887 nmdc:mga03683_46899_c1
1888 nmdc:mga03n38_98_c1
1889 nmdc:mga00v17_121059_c1
1890 nmdc:mga00v17_32131_c1
1891 nmdc:mga00v17_58540_c1
1892 nmdc:mga0yw44_118730_c1
1893 nmdc:mga0yw44_12674_c1
1894 nmdc:mga0yw44_160309_c1
1895 nmdc:mga0yw44_161818_c1
1896 nmdc:mga0yw44_191706_c1
1897 nmdc:mga0yw44_197218_c1
1898 nmdc:mga0yw44_6672_c1
1899 nmdc:mga0k408_100725_c1
1900 nmdc:mga0k408_203983_c1
1901 nmdc:mga0k408_67583_c1
1902 nmdc:mga06z11_137921_c1
1903 nmdc:mga06z11_179874_c1
1904 nmdc:mga06z11_45740_c1
1905 nmdc:mga04h51_18851_c1
1906 nmdc:mga04h51_42826_c1
1907 nmdc:mga07m45_110601_c1
1908 nmdc:mga07m45_41962_c1
1909 nmdc:mga07m45_87961_c1
1910 nmdc:mga09592_277164_c1
1911 nmdc:mga0n895_179818_c1
1912 nmdc:mga0n895_262239_c1
1913 nmdc:mga0sz30_11679_c1
1914 nmdc:mga0sz30_175701_c1
1915 nmdc:mga0sz30_60927_c1
1916 Ga0495601_0023042
1917 Ga0495601_0045290
1918 Ga0495601_0209366
1919 Ga0500635_0003192
1920 Ga0500635_0141457
1921 Ga0495655_0031289
1922 Ga0495595_0058978
1923 Ga0495595_0153870
1924 Ga0495619_0052867
1925 Ga0500643_000052
1926 Ga0500647_0036476
1927 Ga0500647_0063760
1928 Ga0500647_0092965
1929 Ga0500583_0138135
1930 Ga0500583_0189653
1931 Ga0500651_0074272
1932 Ga0500566_0000207
1933 Ga0500566_0002388
1934 Ga0500566_0006524
1935 Ga0500640_003553
1936 Ga0500640_058687
1937 Ga0500641_0001497
1938 Ga0500650_0232835
1939 Ga0500554_000856
1940 Ga0500554_001256
1941 Ga0500556_0008721
1942 Ga0500556_0017680
1943 Ga0500557_000148
1944 Ga0500562_004186
1945 Ga0500569_000873
1946 Ga0500572_000676
1947 Ga0500591_081761
1948 Ga0500591_091052
1949 Ga0500592_007602
1950 Ga0500594_0077242
1951 Ga0500595_000299
1952 Ga0500595_003982
1953 Ga0500595_004108
1954 Ga0500595_011382
1955 Ga0500595_012032
1956 Ga0500595_027476
1957 Ga0500608_051325
1958 Ga0500608_107335
1959 Ga0500614_000572
1960 Ga0500614_005280
1961 Ga0500614_014221
1962 Ga0500642_0000083
1963 Ga0500642_0009622
1964 Ga0500652_017701
1965 Ga0500658_0108552
1966 Ga0500559_0003255
1967 Ga0500559_0019756
1968 Ga0500559_0036777
1969 Ga0500559_0156993
1970 Ga0500559_0194700
1971 Ga0500564_077793
1972 Ga0500568_0008381
1973 Ga0500568_0013248
1974 Ga0500573_0077562
1975 Ga0500577_0044289
1976 Ga0500588_0026259
1977 Ga0500590_056787
1978 Ga0500590_133090
1979 Ga0500590_175827
1980 Ga0500603_000313
1981 Ga0500603_000691
1982 Ga0500603_016677
1983 Ga0500604_0016364
1984 Ga0500622_0106390
1985 Ga0500630_001066
1986 Ga0500638_002777
1987 Ga0500638_003145
1988 Ga0500638_101633
1989 Ga0500639_000072
1990 Ga0500636_0000314
1991 Ga0500636_0039800
1992 Ga0500636_0064281
1993 Ga0500636_0079580
1994 Ga0500636_0119234
1995 Ga0500637_0000065
1996 Ga0500637_0002631
1997 Ga0500637_0059209
1998 Ga0500625_062812
1999 Ga0500645_023607
2000 Ga0500609_018174
2001 Ga0500596_002009
2002 Ga0500596_002393
2003 Ga0500596_008884
2004 Ga0500599_000695
2005 Ga0500601_000099
2006 Ga0500601_003567
2007 Ga0501084_0003235
2008 Ga0500661_001927
2009 Ga0501082_0005376
2010 Ga0530510_0107924
2011 2507504396
2012 2508545828
2013 2509146427
2014 2511396438
2015 2513624206
2016 2513638701
2017 2513649903
2018 2513656191
2019 2513679749
2020 2513702592
2021 2513716731
2022 2513860706
2023 2513892473
2024 2513917629
2025 2514010031
2026 2515624421
2027 2517108171
2028 2517887711
2029 2524442735
2030 2524466636
2031 2524535377
2032 2528850463
2033 2617353829
2034 2617374421
2035 2671120777
2036 2723842482
2037 2728748280
2038 2745074552
2039 2793059334
2040 2793072903
2041 2793078666
2042 2805922093
2043 2818240903
2044 2824604658
2045 2824616134
2046 2824618875
2047 2824632891
2048 2824641000
2049 2824648206
2050 2824658407
2051 2824667418
2052 2824675505
2053 2824685974
2054 2824691728
2055 2824698955
2056 2824709901
2057 2824718018
2058 2824728326
2059 2824734967
2060 2824748114
2061 2824759707
2062 2824769912
2063 2824779722
2064 2838126063
2065 2841942544
2066 2841953106
2067 2841960610
2068 2841970869
2069 2841977871
2070 2841984564
2071 2842041714
2072 2842049756
2073 2844321401
2074 2847932007
2075 2847943248
2076 2849076975
2077 2857514750
2078 2874595650
2079 2874620351
2080 2874621842
2081 2874630236
2082 2874651717
2083 2876766441
2084 2876775845
2085 2876821612
2086 2879079936
2087 2879085686
2088 2879104529
2089 2879134020
2090 2879148505
2091 2881370400
2092 2881666458
2093 2885374419
2094 2885382552
2095 2885384907
2096 2885411551
2097 2888387706
2098 2888391464
2099 2888426915
2100 2889034246
2101 2903734582
2102 2903753644
2103 2903773488
2104 2904669565
2105 2904691841
2106 2904713623
2107 2906608015
2108 2906612721
2109 2906629413
2110 2906640553
2111 2906647219
2112 2906663223
2113 2908745917
2114 2908763946
2115 2908776902
2116 2922367632
2117 2922376692
2118 2922391607
2119 2922393292
2120 2922433201
2121 2929619767
2122 2929629078
2123 2932789747
2124 2932796585
2125 2932817740
2126 2932827148
2127 2932835752
2128 2933581686
2129 2935613191
2130 2935624554
2131 2935630602
2132 2935647219
2133 2935655637
2134 2935664459
2135 2935674318
2136 2935684198
2137 2935694230
2138 2935697671
2139 2935711307
2140 2935720015
2141 2935732126
2142 2935741515
2143 2935750877
2144 2935757871
2145 2935764248
2146 2935775128
2147 2935780031
2148 2935790152
2149 2935798806
2150 2935809907
2151 2935819312
2152 2935824955
2153 2935836643
2154 2935846412
2155 2935852175
2156 2935863236
2157 2935868705
2158 2935879479
2159 2935916443
2160 2935925439
2161 2935933943
2162 2935942466
2163 2935950921
2164 2935959382
2165 2935965393
2166 2935975449
2167 2935980119
2168 2935984283
2169 2936000273
2170 2936010315
2171 2936018587
2172 2936027105
2173 2936035928
2174 2936045935
2175 2936054007
2176 2936055363
2177 2940563307
2178 2941507254
2179 2941515681
2180 2941523611
2181 2941531970
2182 2941546840
2183 3005485747
2184 3005506606
2185 3005588739
2186 3005601757
2187 3005717496
2188 3005724433
2189 8006933382
2190 8006935102
2191 8006965371
2192 8006975070
2193 8006986083
2194 8006999243
2195 8016519140
2196 8016538754
2197 8016543042
2198 8016550251
2199 8016558660
2200 8016568446
2201 8016581098
2202 8016587617
2203 8016596638
2204 8016619305
2205 8016630287
2206 8016636860
2207 8017066359
2208 8019541398
2209 8019573671
2210 8019596292
2211 8019605406
2212 8019613134
2213 8019623822
2214 8019641420
2215 8019666135
2216 8019680453
2217 8019695361
2218 8055750480
2219 8056678964
2220 8056685531
2221 8056692827
2222 8056971783

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

63

191

0.88

PF12146

Hydrolase_4

Serine aminopeptidase, S33

106

201

0.82

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

65

305

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8557 2 120
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.85 2 120
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.8429 2 267
2xua-assembly1.cif.gz_A crystal structure of the enol-lactonase from burkholderia xenovorans lb400 0.8368 2 269
2xua-assembly1.cif.gz_A crystal structure of the enol-lactonase from burkholderia xenovorans lb400 0.8338 2 269
ID Description Score Start End Superfamily
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8912 2 85 3.40.50.12270
5frdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8432 2 268 3.40.50.1820
af_Q922Q6_49_247_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8391 2 268 3.40.50.1820
af_Q9N366_39_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8359 3 268 3.40.50.1820
2xuaH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8348 2 269 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1X7E8R9-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9306 2 268
AF-A0A7X1N7U3-F1-model_v4 Alpha/beta fold hydrolase 0.9264 12 268 GO:0016020
GO:0016787
AF-A0A1X7E8R9-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9205 2 268
AF-A0A1B6FQH5-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9177 11 120 GO:0016020
AF-A0A674ISU8-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9168 2 117 GO:0004301
GO:0016020

Map