F491082
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1166 | 632 | 2222 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300005983|Ga0081540_1021473|Ga0081540_10214736 |
| Length | 312 |
| Sequence | MPSDTRYVKVHRPEQALGTGAVPWKDRVPFSAIPSSEPLMQTLRVNGYDMAYLEVGQGSPGAPPLVCVHGSLCDFRIWSAVLGPLTAKHRVIAVSLRHFFPDHWDGVGDTYSIAQHVDDVIAFIEQVEPRPVDLMGHSRGGHICFRVAQRRPDLLRRLILAEPGGELDGTLDSNYKPGPSPLAARIAASAAVIAKGDIDGGLQIFMDALEGPGAWKRLPATPKQQLRDNATTLIGQMRDQRPPFSKADAEAISTPTLFIGGASTKGVLPLVLHALAAHVKGSRTEMISGATHPMFEQQPQKYCEIVTAFLAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 69 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 70 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 71 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 72 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 99 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 100 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 101 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 102 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 103 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 104 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 105 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 163 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 164 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 165 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 166 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 172 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 173 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 174 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 175 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 178 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 179 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 180 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 183 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 184 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 186 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 188 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 189 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 191 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 192 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 199 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 201 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 215 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 216 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 217 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 218 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 219 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 220 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 221 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 222 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 223 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 224 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 225 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 226 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 227 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 228 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 229 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 230 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 231 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 232 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 233 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 234 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 235 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 236 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 309 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 310 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 311 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 312 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 313 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 314 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 317 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 318 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 319 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 320 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 321 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 322 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 323 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 324 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 325 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 326 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 327 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 328 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 329 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 330 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 331 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 358 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 359 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 360 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 362 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 363 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 364 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 365 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 368 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 370 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 374 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 375 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 376 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 377 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 378 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 379 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 380 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 381 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 382 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 383 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 384 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 385 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 386 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 387 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 388 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 389 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 390 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 391 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 392 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 393 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 394 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 395 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 397 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 398 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 399 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 400 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 401 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 402 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 403 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 404 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 405 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 406 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 407 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 408 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 409 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 411 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 412 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 413 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 414 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 415 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 416 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 417 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 419 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 421 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 422 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 423 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 424 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 425 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 426 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 427 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 428 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 429 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 430 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 431 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 432 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 433 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 434 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 435 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 436 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 437 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 438 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 439 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 440 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 441 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 442 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 443 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 444 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 445 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 446 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 447 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 448 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 449 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 450 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 451 | 2791355199 | |||
| 452 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 453 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 454 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 455 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 456 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 457 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 458 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 459 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 460 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 461 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 462 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 463 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 464 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 465 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 466 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 467 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 468 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 469 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 470 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 471 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 472 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 473 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 474 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 475 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 476 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 477 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 478 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 479 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 480 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 481 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 482 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 483 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 484 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 485 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 486 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 487 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 488 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 489 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 490 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 491 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 492 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 493 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 494 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 495 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 496 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 497 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 498 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 499 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 500 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 501 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 502 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 503 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 504 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 505 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 506 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 507 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 508 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 509 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 510 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 511 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 512 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 513 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 514 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 515 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 516 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 517 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 518 | 2906610324 | |||
| 519 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 520 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 521 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 522 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 523 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 524 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 525 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 526 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 527 | 2922368715 | |||
| 528 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 529 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 530 | 2922425934 | |||
| 531 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 532 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 533 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 534 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 535 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 536 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 537 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 538 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 539 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 540 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 541 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 542 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 543 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 544 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 545 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 546 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 547 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 548 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 549 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 550 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 551 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 552 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 553 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 554 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 555 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 556 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 557 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 558 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 559 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 560 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 561 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 562 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 563 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 564 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 565 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 566 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 567 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 568 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 569 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 570 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 571 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 572 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 573 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 574 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 575 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 576 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 577 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 578 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 579 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 580 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 581 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 582 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 583 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 584 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 585 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 586 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 587 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 588 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 589 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 590 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 591 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 592 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 593 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 594 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 595 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 596 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 597 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 598 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 599 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 600 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 601 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 602 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 603 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 604 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 605 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 606 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 607 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 608 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 609 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 610 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 611 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 612 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 613 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 614 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 615 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 616 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 617 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 618 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 619 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 620 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 621 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 622 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 623 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 624 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 625 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 626 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 627 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 628 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 629 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 630 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 631 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 632 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.01 |
| Metatranscriptomes | 0.09 |
| Isolates | 17.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.32 |
| Nodule | 14.32 |
| Rhizoplane | 5.15 |
| Rhizosphere | 56.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081540_1021473 | 3300005983 | Bacteria | 3842 |
| 2 | JGI24735J21928_10024186 | 3300002067 | Bacteria | 1840 |
| 3 | JGI25406J46586_10005201 | 3300003203 | Bacteria | 6033 |
| 4 | JGI25153J46596_10005814 | 3300003215 | Bacteria | 6411 |
| 5 | rootL2_10017863 | 3300003322 | Bacteria | 1938 |
| 6 | rootH1_10149220 | 3300003323 | Bacteria | 1406 |
| 7 | JGI25160J50197_1019598 | 3300003354 | Bacteria | 2069 |
| 8 | JGI25160J50197_1019601 | 3300003354 | Bacteria | 2069 |
| 9 | JGI25404J52841_10003242 | 3300003659 | Bacteria | 3191 |
| 10 | JGI25404J52841_10007484 | 3300003659 | Bacteria | 2310 |
| 11 | JGI25404J52841_10012840 | 3300003659 | Bacteria | 1817 |
| 12 | Ga0055531_10006499 | 3300003794 | Bacteria | 6626 |
| 13 | Ga0055531_10018955 | 3300003794 | Bacteria | 2812 |
| 14 | Ga0065165_1001465 | 3300005262 | Bacteria | 25288 |
| 15 | Ga0065165_1003494 | 3300005262 | Bacteria | 10960 |
| 16 | Ga0065165_1007016 | 3300005262 | Bacteria | 5679 |
| 17 | Ga0065165_1021815 | 3300005262 | Bacteria | 2213 |
| 18 | Ga0068869_100121166 | 3300005334 | Bacteria | 2001 |
| 19 | Ga0068869_100344888 | 3300005334 | Bacteria | 1213 |
| 20 | Ga0070680_100003569 | 3300005336 | Bacteria | 11609 |
| 21 | Ga0070680_100281547 | 3300005336 | Bacteria | 1409 |
| 22 | Ga0070680_100415309 | 3300005336 | Bacteria | 1148 |
| 23 | Ga0070682_100063668 | 3300005337 | Bacteria | 2339 |
| 24 | Ga0070682_100400263 | 3300005337 | Bacteria | 1038 |
| 25 | Ga0068868_100017752 | 3300005338 | Bacteria | 5306 |
| 26 | Ga0068868_100145011 | 3300005338 | Bacteria | 1952 |
| 27 | Ga0070660_100031186 | 3300005339 | Bacteria | 4002 |
| 28 | Ga0070660_100068615 | 3300005339 | Bacteria | 2764 |
| 29 | Ga0070660_100297090 | 3300005339 | Bacteria | 1324 |
| 30 | Ga0070668_100047596 | 3300005347 | Bacteria | 3297 |
| 31 | Ga0070668_100115123 | 3300005347 | Bacteria | 2143 |
| 32 | Ga0070668_100254836 | 3300005347 | Bacteria | 1458 |
| 33 | Ga0070673_100140477 | 3300005364 | Bacteria | 2036 |
| 34 | Ga0070673_100220019 | 3300005364 | Bacteria | 1643 |
| 35 | Ga0070673_100228968 | 3300005364 | Bacteria | 1612 |
| 36 | Ga0070659_100198207 | 3300005366 | Bacteria | 1652 |
| 37 | Ga0070659_100402578 | 3300005366 | Bacteria | 1156 |
| 38 | Ga0070659_100608300 | 3300005366 | Bacteria | 940 |
| 39 | Ga0070667_100212524 | 3300005367 | Bacteria | 1720 |
| 40 | Ga0070667_100420239 | 3300005367 | Bacteria | 1219 |
| 41 | Ga0070709_10001461 | 3300005434 | Bacteria | 12746 |
| 42 | Ga0070714_100003988 | 3300005435 | Bacteria | 11098 |
| 43 | Ga0070713_100004627 | 3300005436 | Bacteria | 9277 |
| 44 | Ga0070713_100324844 | 3300005436 | Bacteria | 1422 |
| 45 | Ga0070713_100348944 | 3300005436 | Bacteria | 1373 |
| 46 | Ga0070713_100659331 | 3300005436 | Bacteria | 997 |
| 47 | Ga0070710_10001981 | 3300005437 | Bacteria | 9708 |
| 48 | Ga0070710_10003702 | 3300005437 | Bacteria | 7230 |
| 49 | Ga0070710_10100719 | 3300005437 | Bacteria | 1720 |
| 50 | Ga0070711_100010613 | 3300005439 | Bacteria | 5706 |
| 51 | Ga0070711_100081392 | 3300005439 | Bacteria | 2308 |
| 52 | Ga0070708_100672681 | 3300005445 | Bacteria | 975 |
| 53 | Ga0070663_100059739 | 3300005455 | Bacteria | 2740 |
| 54 | Ga0070663_100077803 | 3300005455 | Bacteria | 2430 |
| 55 | Ga0070663_100172651 | 3300005455 | Bacteria | 1672 |
| 56 | Ga0070663_100199397 | 3300005455 | Bacteria | 1561 |
| 57 | Ga0070663_100557482 | 3300005455 | Bacteria | 959 |
| 58 | Ga0070678_100005458 | 3300005456 | Bacteria | 7353 |
| 59 | Ga0070678_100185492 | 3300005456 | Bacteria | 1707 |
| 60 | Ga0070662_100076746 | 3300005457 | Bacteria | 2477 |
| 61 | Ga0070662_100103839 | 3300005457 | Bacteria | 2156 |
| 62 | Ga0070681_10015034 | 3300005458 | Bacteria | 7699 |
| 63 | Ga0070706_100463842 | 3300005467 | Bacteria | 1178 |
| 64 | Ga0070698_100133500 | 3300005471 | Bacteria | 2437 |
| 65 | Ga0070679_100132475 | 3300005530 | Bacteria | 2474 |
| 66 | Ga0070679_100433843 | 3300005530 | Bacteria | 1259 |
| 67 | Ga0070684_100106220 | 3300005535 | Bacteria | 2513 |
| 68 | Ga0070684_100473399 | 3300005535 | Bacteria | 1159 |
| 69 | Ga0070697_100103553 | 3300005536 | Bacteria | 2366 |
| 70 | Ga0068853_100019769 | 3300005539 | Bacteria | 5592 |
| 71 | Ga0068853_100204925 | 3300005539 | Bacteria | 1796 |
| 72 | Ga0068853_100371777 | 3300005539 | Bacteria | 1334 |
| 73 | Ga0068853_100624733 | 3300005539 | Bacteria | 1024 |
| 74 | Ga0070693_100101737 | 3300005547 | Bacteria | 1752 |
| 75 | Ga0070665_100020723 | 3300005548 | Bacteria | 6606 |
| 76 | Ga0070665_100070010 | 3300005548 | Bacteria | 3515 |
| 77 | Ga0070665_100133651 | 3300005548 | Bacteria | 2483 |
| 78 | Ga0070665_100155002 | 3300005548 | Bacteria | 2292 |
| 79 | Ga0070665_100156385 | 3300005548 | Bacteria | 2281 |
| 80 | Ga0070665_100241352 | 3300005548 | Bacteria | 1807 |
| 81 | Ga0070665_100297112 | 3300005548 | Bacteria | 1618 |
| 82 | Ga0070665_100665183 | 3300005548 | Bacteria | 1054 |
| 83 | Ga0068855_100029909 | 3300005563 | Bacteria | 6513 |
| 84 | Ga0068855_100051047 | 3300005563 | Bacteria | 4872 |
| 85 | Ga0068855_100060591 | 3300005563 | Bacteria | 4425 |
| 86 | Ga0068855_100110634 | 3300005563 | Bacteria | 3153 |
| 87 | Ga0068855_100121318 | 3300005563 | Bacteria | 2991 |
| 88 | Ga0068855_100483473 | 3300005563 | Bacteria | 1348 |
| 89 | Ga0068855_100598929 | 3300005563 | Bacteria | 1189 |
| 90 | Ga0068855_100625499 | 3300005563 | Bacteria | 1159 |
| 91 | Ga0070664_100151355 | 3300005564 | Bacteria | 2048 |
| 92 | Ga0070664_100223336 | 3300005564 | Bacteria | 1686 |
| 93 | Ga0070664_100387422 | 3300005564 | Bacteria | 1277 |
| 94 | Ga0068857_100005639 | 3300005577 | Bacteria | 10702 |
| 95 | Ga0068857_100069443 | 3300005577 | Bacteria | 3137 |
| 96 | Ga0068857_100101360 | 3300005577 | Bacteria | 2584 |
| 97 | Ga0068857_100171744 | 3300005577 | Bacteria | 1971 |
| 98 | Ga0068854_100005923 | 3300005578 | Bacteria | 7744 |
| 99 | Ga0068854_100096642 | 3300005578 | Bacteria | 2207 |
| 100 | Ga0068854_100102096 | 3300005578 | Bacteria | 2151 |
| 101 | Ga0068856_100000476 | 3300005614 | Bacteria | 44310 |
| 102 | Ga0068856_100093882 | 3300005614 | Bacteria | 2986 |
| 103 | Ga0068856_100162354 | 3300005614 | Bacteria | 2245 |
| 104 | Ga0068856_100202844 | 3300005614 | Bacteria | 1998 |
| 105 | Ga0068856_100234557 | 3300005614 | Bacteria | 1850 |
| 106 | Ga0068856_100285932 | 3300005614 | Bacteria | 1666 |
| 107 | Ga0068852_100180576 | 3300005616 | Bacteria | 1984 |
| 108 | Ga0068852_100453482 | 3300005616 | Bacteria | 1270 |
| 109 | Ga0068859_100172189 | 3300005617 | Bacteria | 2246 |
| 110 | Ga0068859_100606990 | 3300005617 | Bacteria | 1187 |
| 111 | Ga0068864_100064794 | 3300005618 | Bacteria | 3170 |
| 112 | Ga0068864_100433369 | 3300005618 | Bacteria | 1254 |
| 113 | Ga0068861_100428100 | 3300005719 | Bacteria | 1181 |
| 114 | Ga0068851_10003823 | 3300005834 | Bacteria | 6739 |
| 115 | Ga0068851_10020573 | 3300005834 | Bacteria | 3196 |
| 116 | Ga0068851_10070129 | 3300005834 | Bacteria | 1812 |
| 117 | Ga0068851_10100743 | 3300005834 | Bacteria | 1533 |
| 118 | Ga0068870_10086555 | 3300005840 | Bacteria | 1744 |
| 119 | Ga0068870_10100319 | 3300005840 | Bacteria | 1635 |
| 120 | Ga0068863_100159012 | 3300005841 | Bacteria | 2164 |
| 121 | Ga0068863_100285090 | 3300005841 | Bacteria | 1601 |
| 122 | Ga0068858_100078638 | 3300005842 | Bacteria | 3065 |
| 123 | Ga0068858_100496633 | 3300005842 | Bacteria | 1179 |
| 124 | Ga0068862_100076660 | 3300005844 | Bacteria | 2894 |
| 125 | Ga0068862_100508564 | 3300005844 | Bacteria | 1144 |
| 126 | Ga0081455_10011371 | 3300005937 | Bacteria | 8946 |
| 127 | Ga0081455_10076987 | 3300005937 | Bacteria | 2746 |
| 128 | Ga0081455_10111202 | 3300005937 | Bacteria | 2177 |
| 129 | Ga0081540_1004386 | 3300005983 | Bacteria | 10787 |
| 130 | Ga0081540_1005329 | 3300005983 | Bacteria | 9623 |
| 131 | Ga0081540_1007078 | 3300005983 | Bacteria | 8062 |
| 132 | Ga0081540_1007475 | 3300005983 | Bacteria | 7780 |
| 133 | Ga0081540_1013507 | 3300005983 | Bacteria | 5304 |
| 134 | Ga0081540_1016353 | 3300005983 | Bacteria | 4646 |
| 135 | Ga0081540_1018434 | 3300005983 | Bacteria | 4281 |
| 136 | Ga0081540_1048885 | 3300005983 | Bacteria | 2115 |
| 137 | Ga0081540_1053054 | 3300005983 | Bacteria | 1991 |
| 138 | Ga0081540_1111692 | 3300005983 | Bacteria | 1154 |
| 139 | Ga0081539_10001098 | 3300005985 | Bacteria | 49182 |
| 140 | Ga0070717_10001915 | 3300006028 | Bacteria | 14544 |
| 141 | Ga0070717_10009625 | 3300006028 | Bacteria | 7272 |
| 142 | Ga0070717_10034975 | 3300006028 | Bacteria | 4064 |
| 143 | Ga0070717_10101140 | 3300006028 | Bacteria | 2448 |
| 144 | Ga0070717_10240349 | 3300006028 | Bacteria | 1597 |
| 145 | Ga0075365_10037480 | 3300006038 | Bacteria | 3148 |
| 146 | Ga0075365_10137418 | 3300006038 | Bacteria | 1695 |
| 147 | Ga0075365_10300178 | 3300006038 | Bacteria | 1130 |
| 148 | Ga0075365_10309879 | 3300006038 | Bacteria | 1111 |
| 149 | Ga0075363_100000795 | 3300006048 | Bacteria | 10907 |
| 150 | Ga0075364_10060459 | 3300006051 | Bacteria | 2485 |
| 151 | Ga0075364_10198710 | 3300006051 | Bacteria | 1359 |
| 152 | Ga0070715_10003656 | 3300006163 | Bacteria | 4939 |
| 153 | Ga0070716_100009999 | 3300006173 | Bacteria | 4744 |
| 154 | Ga0070716_100017312 | 3300006173 | Bacteria | 3733 |
| 155 | Ga0070716_100194790 | 3300006173 | Bacteria | 1342 |
| 156 | Ga0075367_10086232 | 3300006178 | Bacteria | 1905 |
| 157 | Ga0075367_10115869 | 3300006178 | Bacteria | 1648 |
| 158 | Ga0075369_10023467 | 3300006186 | Bacteria | 2550 |
| 159 | Ga0075369_10028142 | 3300006186 | Bacteria | 2354 |
| 160 | Ga0075369_10032740 | 3300006186 | Bacteria | 2200 |
| 161 | Ga0075369_10124553 | 3300006186 | Bacteria | 1168 |
| 162 | Ga0075366_10090110 | 3300006195 | Bacteria | 1837 |
| 163 | Ga0075366_10152688 | 3300006195 | Bacteria | 1399 |
| 164 | Ga0075366_10171511 | 3300006195 | Bacteria | 1316 |
| 165 | Ga0097621_100034637 | 3300006237 | Bacteria | 4029 |
| 166 | Ga0097621_100109329 | 3300006237 | Bacteria | 2335 |
| 167 | Ga0097621_100304885 | 3300006237 | Bacteria | 1407 |
| 168 | Ga0075370_10178773 | 3300006353 | Bacteria | 1248 |
| 169 | Ga0068871_100044285 | 3300006358 | Bacteria | 3578 |
| 170 | Ga0068865_100167092 | 3300006881 | Bacteria | 1683 |
| 171 | Ga0097620_100172180 | 3300006931 | Bacteria | 2246 |
| 172 | Ga0097620_100416370 | 3300006931 | Bacteria | 1440 |
| 173 | Ga0097620_100606905 | 3300006931 | Bacteria | 1187 |
| 174 | Ga0099824_1007622 | 3300006942 | Bacteria | 14251 |
| 175 | Ga0099824_1030093 | 3300006942 | Bacteria | 2220 |
| 176 | Ga0099822_1024573 | 3300006943 | Bacteria | 5376 |
| 177 | Ga0099823_1025861 | 3300006944 | Bacteria | 5226 |
| 178 | Ga0099794_10004947 | 3300007265 | Bacteria | 5300 |
| 179 | Ga0099794_10035717 | 3300007265 | Bacteria | 2346 |
| 180 | Ga0099794_10199251 | 3300007265 | Bacteria | 1025 |
| 181 | Ga0099795_10045988 | 3300007788 | Bacteria | 1571 |
| 182 | Ga0105240_10013609 | 3300009093 | Bacteria | 11162 |
| 183 | Ga0105240_10128230 | 3300009093 | Bacteria | 3046 |
| 184 | Ga0105240_10217619 | 3300009093 | Bacteria | 2227 |
| 185 | Ga0105240_11035930 | 3300009093 | Bacteria | 876 |
| 186 | Ga0111539_10268381 | 3300009094 | Bacteria | 1987 |
| 187 | Ga0105245_10030466 | 3300009098 | Bacteria | 4770 |
| 188 | Ga0105245_10339887 | 3300009098 | Bacteria | 1484 |
| 189 | Ga0114129_10043623 | 3300009147 | Bacteria | 6310 |
| 190 | Ga0105243_10179770 | 3300009148 | Bacteria | 1839 |
| 191 | Ga0105243_10335919 | 3300009148 | Bacteria | 1382 |
| 192 | Ga0105241_10043812 | 3300009174 | Bacteria | 3389 |
| 193 | Ga0105241_10060066 | 3300009174 | Bacteria | 2924 |
| 194 | Ga0105241_10112909 | 3300009174 | Bacteria | 2177 |
| 195 | Ga0105241_10252735 | 3300009174 | Bacteria | 1495 |
| 196 | Ga0105241_10262108 | 3300009174 | Bacteria | 1469 |
| 197 | Ga0105248_10545891 | 3300009177 | Bacteria | 1307 |
| 198 | Ga0105237_10009561 | 3300009545 | Bacteria | 10380 |
| 199 | Ga0105237_10045175 | 3300009545 | Bacteria | 4434 |
| 200 | Ga0105237_10048901 | 3300009545 | Bacteria | 4251 |
| 201 | Ga0105237_10061469 | 3300009545 | Bacteria | 3755 |
| 202 | Ga0105237_10103750 | 3300009545 | Bacteria | 2835 |
| 203 | Ga0105237_10186478 | 3300009545 | Bacteria | 2074 |
| 204 | Ga0105237_10243637 | 3300009545 | Bacteria | 1799 |
| 205 | Ga0105237_10579715 | 3300009545 | Bacteria | 1129 |
| 206 | Ga0105238_10157658 | 3300009551 | Bacteria | 2245 |
| 207 | Ga0105238_10194558 | 3300009551 | Bacteria | 2004 |
| 208 | Ga0105238_10262622 | 3300009551 | Bacteria | 1706 |
| 209 | Ga0105249_10798089 | 3300009553 | Bacteria | 1008 |
| 210 | Ga0105239_10013308 | 3300010375 | Bacteria | 9143 |
| 211 | Ga0105239_10128536 | 3300010375 | Bacteria | 2817 |
| 212 | Ga0105239_10128753 | 3300010375 | Bacteria | 2814 |
| 213 | Ga0105239_10199213 | 3300010375 | Bacteria | 2243 |
| 214 | Ga0105239_10393280 | 3300010375 | Bacteria | 1568 |
| 215 | Ga0105239_10426864 | 3300010375 | Bacteria | 1502 |
| 216 | Ga0105239_10492456 | 3300010375 | Bacteria | 1393 |
| 217 | Ga0105246_10019037 | 3300011119 | Bacteria | 4380 |
| 218 | Ga0105246_10024007 | 3300011119 | Bacteria | 3954 |
| 219 | Ga0105246_10187269 | 3300011119 | Bacteria | 1599 |
| 220 | Ga0157370_10079869 | 3300013104 | Bacteria | 3080 |
| 221 | Ga0157370_10193297 | 3300013104 | Bacteria | 1889 |
| 222 | Ga0157369_10012327 | 3300013105 | Bacteria | 9710 |
| 223 | Ga0157369_10490429 | 3300013105 | Bacteria | 1271 |
| 224 | Ga0157374_10155057 | 3300013296 | Bacteria | 2228 |
| 225 | Ga0157374_10447706 | 3300013296 | Bacteria | 1292 |
| 226 | Ga0157378_10006449 | 3300013297 | Bacteria | 10260 |
| 227 | Ga0157378_10243912 | 3300013297 | Bacteria | 1717 |
| 228 | Ga0163162_10186346 | 3300013306 | Bacteria | 2202 |
| 229 | Ga0163162_10267283 | 3300013306 | Bacteria | 1842 |
| 230 | Ga0163162_10291181 | 3300013306 | Bacteria | 1765 |
| 231 | Ga0163162_10743548 | 3300013306 | Bacteria | 1100 |
| 232 | Ga0157372_10096808 | 3300013307 | Bacteria | 3364 |
| 233 | Ga0157372_10444064 | 3300013307 | Bacteria | 1512 |
| 234 | Ga0157375_10018315 | 3300013308 | Bacteria | 6349 |
| 235 | Ga0157375_10133453 | 3300013308 | Bacteria | 2604 |
| 236 | Ga0157375_10286649 | 3300013308 | Bacteria | 1810 |
| 237 | Ga0157375_10583229 | 3300013308 | Bacteria | 1278 |
| 238 | Ga0163163_10044739 | 3300014325 | Bacteria | 4344 |
| 239 | Ga0163163_10066420 | 3300014325 | Bacteria | 3582 |
| 240 | Ga0163163_10073045 | 3300014325 | Bacteria | 3420 |
| 241 | Ga0163163_10879805 | 3300014325 | Bacteria | 959 |
| 242 | Ga0157380_10090556 | 3300014326 | Bacteria | 2523 |
| 243 | Ga0157377_10159835 | 3300014745 | Bacteria | 1400 |
| 244 | Ga0157379_10067447 | 3300014968 | Bacteria | 3198 |
| 245 | Ga0157379_10321013 | 3300014968 | Bacteria | 1414 |
| 246 | Ga0157379_10490667 | 3300014968 | Bacteria | 1137 |
| 247 | Ga0157379_10717134 | 3300014968 | Bacteria | 940 |
| 248 | Ga0157376_10031939 | 3300014969 | Bacteria | 4223 |
| 249 | Ga0157376_10134588 | 3300014969 | Bacteria | 2210 |
| 250 | Ga0157376_10455346 | 3300014969 | Bacteria | 1249 |
| 251 | Ga0163161_10401145 | 3300017792 | Bacteria | 1100 |
| 252 | Ga0214542_1000003 | 3300021321 | Bacteria | 435700 |
| 253 | Ga0214545_1000004 | 3300021324 | Bacteria | 453352 |
| 254 | Ga0214543_1009591 | 3300021327 | Bacteria | 14941 |
| 255 | Ga0213873_10004591 | 3300021358 | Bacteria | 2591 |
| 256 | Ga0213872_10094460 | 3300021361 | Bacteria | 1336 |
| 257 | Ga0213876_10001391 | 3300021384 | Bacteria | 15091 |
| 258 | Ga0213871_10000490 | 3300021441 | Bacteria | 5411 |
| 259 | Ga0209148_1000490 | 3300025254 | Bacteria | 40827 |
| 260 | Ga0209233_1010343 | 3300025261 | Bacteria | 2798 |
| 261 | Ga0209233_1019818 | 3300025261 | Bacteria | 1778 |
| 262 | Ga0209233_1030468 | 3300025261 | Bacteria | 1271 |
| 263 | Ga0209455_1004977 | 3300025272 | Bacteria | 4213 |
| 264 | Ga0209564_1027292 | 3300025295 | Bacteria | 1858 |
| 265 | Ga0209758_1000106 | 3300025297 | Bacteria | 218450 |
| 266 | Ga0209758_1000982 | 3300025297 | Bacteria | 38353 |
| 267 | Ga0209758_1002038 | 3300025297 | Bacteria | 21691 |
| 268 | Ga0209758_1003538 | 3300025297 | Bacteria | 14070 |
| 269 | Ga0209758_1010528 | 3300025297 | Bacteria | 5516 |
| 270 | Ga0209758_1025853 | 3300025297 | Bacteria | 2562 |
| 271 | Ga0209050_1029906 | 3300025298 | Bacteria | 1729 |
| 272 | Ga0209256_1007012 | 3300025299 | Bacteria | 5721 |
| 273 | Ga0209256_1018839 | 3300025299 | Bacteria | 2224 |
| 274 | Ga0207426_1000337 | 3300025302 | Bacteria | 88200 |
| 275 | Ga0207426_1001470 | 3300025302 | Bacteria | 19401 |
| 276 | Ga0207426_1042794 | 3300025302 | Bacteria | 1396 |
| 277 | Ga0207426_1064572 | 3300025302 | Bacteria | 1041 |
| 278 | Ga0209257_1000348 | 3300025304 | Bacteria | 95101 |
| 279 | Ga0209257_1001773 | 3300025304 | Bacteria | 23881 |
| 280 | Ga0209257_1010363 | 3300025304 | Bacteria | 4735 |
| 281 | Ga0209257_1038474 | 3300025304 | Bacteria | 1448 |
| 282 | Ga0207656_10032711 | 3300025321 | Bacteria | 2161 |
| 283 | Ga0207692_10002972 | 3300025898 | Bacteria | 6568 |
| 284 | Ga0207692_10030002 | 3300025898 | Bacteria | 2589 |
| 285 | Ga0207642_10089793 | 3300025899 | Bacteria | 1515 |
| 286 | Ga0207647_10000908 | 3300025904 | Bacteria | 22882 |
| 287 | Ga0207647_10076385 | 3300025904 | Bacteria | 2015 |
| 288 | Ga0207699_10004093 | 3300025906 | Bacteria | 6981 |
| 289 | Ga0207699_10176623 | 3300025906 | Bacteria | 1433 |
| 290 | Ga0207643_10130130 | 3300025908 | Bacteria | 1497 |
| 291 | Ga0207705_10242644 | 3300025909 | Bacteria | 1373 |
| 292 | Ga0207654_10004509 | 3300025911 | Bacteria | 7032 |
| 293 | Ga0207654_10019456 | 3300025911 | Bacteria | 3584 |
| 294 | Ga0207654_10156768 | 3300025911 | Bacteria | 1467 |
| 295 | Ga0207707_10002162 | 3300025912 | Bacteria | 17780 |
| 296 | Ga0207707_10005294 | 3300025912 | Bacteria | 11286 |
| 297 | Ga0207707_10201928 | 3300025912 | Bacteria | 1733 |
| 298 | Ga0207695_10001591 | 3300025913 | Bacteria | 36866 |
| 299 | Ga0207695_10017338 | 3300025913 | Bacteria | 8383 |
| 300 | Ga0207671_10018136 | 3300025914 | Bacteria | 5408 |
| 301 | Ga0207671_10031051 | 3300025914 | Bacteria | 3983 |
| 302 | Ga0207671_10060866 | 3300025914 | Bacteria | 2801 |
| 303 | Ga0207671_10077354 | 3300025914 | Bacteria | 2491 |
| 304 | Ga0207671_10078410 | 3300025914 | Bacteria | 2474 |
| 305 | Ga0207671_10103392 | 3300025914 | Bacteria | 2160 |
| 306 | Ga0207671_10391024 | 3300025914 | Bacteria | 1105 |
| 307 | Ga0207693_10009468 | 3300025915 | Bacteria | 7934 |
| 308 | Ga0207693_10009993 | 3300025915 | Bacteria | 7715 |
| 309 | Ga0207693_10208668 | 3300025915 | Bacteria | 1536 |
| 310 | Ga0207660_10030146 | 3300025917 | Bacteria | 3727 |
| 311 | Ga0207660_10185538 | 3300025917 | Bacteria | 1617 |
| 312 | Ga0207657_10167068 | 3300025919 | Bacteria | 1784 |
| 313 | Ga0207657_10196225 | 3300025919 | Bacteria | 1626 |
| 314 | Ga0207657_10554633 | 3300025919 | Bacteria | 898 |
| 315 | Ga0207649_10119309 | 3300025920 | Bacteria | 1776 |
| 316 | Ga0207652_10106404 | 3300025921 | Bacteria | 2483 |
| 317 | Ga0207652_10140411 | 3300025921 | Bacteria | 2160 |
| 318 | Ga0207694_10022056 | 3300025924 | Bacteria | 4829 |
| 319 | Ga0207694_10031537 | 3300025924 | Bacteria | 4049 |
| 320 | Ga0207694_10048565 | 3300025924 | Bacteria | 3284 |
| 321 | Ga0207694_10097786 | 3300025924 | Bacteria | 2323 |
| 322 | Ga0207694_10119947 | 3300025924 | Bacteria | 2099 |
| 323 | Ga0207650_10244482 | 3300025925 | Bacteria | 1451 |
| 324 | Ga0207687_10013836 | 3300025927 | Bacteria | 5270 |
| 325 | Ga0207687_10131919 | 3300025927 | Bacteria | 1884 |
| 326 | Ga0207700_10008050 | 3300025928 | Bacteria | 6500 |
| 327 | Ga0207700_10057211 | 3300025928 | Bacteria | 2939 |
| 328 | Ga0207700_10162873 | 3300025928 | Bacteria | 1854 |
| 329 | Ga0207700_10294456 | 3300025928 | Bacteria | 1400 |
| 330 | Ga0207700_10588770 | 3300025928 | Bacteria | 989 |
| 331 | Ga0207664_10010392 | 3300025929 | Bacteria | 6574 |
| 332 | Ga0207664_10079512 | 3300025929 | Bacteria | 2662 |
| 333 | Ga0207690_10039021 | 3300025932 | Bacteria | 3096 |
| 334 | Ga0207706_10034466 | 3300025933 | Bacteria | 4503 |
| 335 | Ga0207706_10123613 | 3300025933 | Bacteria | 2276 |
| 336 | Ga0207709_10085086 | 3300025935 | Bacteria | 2049 |
| 337 | Ga0207709_10116401 | 3300025935 | Bacteria | 1797 |
| 338 | Ga0207669_10135393 | 3300025937 | Bacteria | 1700 |
| 339 | Ga0207704_10125140 | 3300025938 | Bacteria | 1768 |
| 340 | Ga0207665_10006342 | 3300025939 | Bacteria | 7841 |
| 341 | Ga0207691_10216166 | 3300025940 | Bacteria | 1663 |
| 342 | Ga0207691_10367613 | 3300025940 | Bacteria | 1229 |
| 343 | Ga0207689_10081964 | 3300025942 | Bacteria | 2652 |
| 344 | Ga0207689_10122888 | 3300025942 | Bacteria | 2135 |
| 345 | Ga0207689_10456766 | 3300025942 | Bacteria | 1068 |
| 346 | Ga0207661_10094227 | 3300025944 | Bacteria | 2501 |
| 347 | Ga0207679_10127513 | 3300025945 | Bacteria | 2036 |
| 348 | Ga0207667_10029690 | 3300025949 | Bacteria | 5925 |
| 349 | Ga0207667_10044947 | 3300025949 | Bacteria | 4678 |
| 350 | Ga0207667_10098667 | 3300025949 | Bacteria | 3014 |
| 351 | Ga0207667_10411218 | 3300025949 | Bacteria | 1377 |
| 352 | Ga0207651_10153326 | 3300025960 | Bacteria | 1797 |
| 353 | Ga0207712_10042423 | 3300025961 | Bacteria | 3132 |
| 354 | Ga0207712_10072956 | 3300025961 | Bacteria | 2474 |
| 355 | Ga0207668_10100984 | 3300025972 | Bacteria | 2143 |
| 356 | Ga0207640_10016570 | 3300025981 | Bacteria | 4290 |
| 357 | Ga0207640_10083922 | 3300025981 | Bacteria | 2186 |
| 358 | Ga0207640_10266517 | 3300025981 | Bacteria | 1338 |
| 359 | Ga0207677_10012673 | 3300026023 | Bacteria | 4857 |
| 360 | Ga0207677_10067541 | 3300026023 | Bacteria | 2505 |
| 361 | Ga0207677_10184163 | 3300026023 | Bacteria | 1645 |
| 362 | Ga0207703_10022563 | 3300026035 | Bacteria | 4938 |
| 363 | Ga0207703_10095909 | 3300026035 | Bacteria | 2503 |
| 364 | Ga0207703_10210388 | 3300026035 | Bacteria | 1734 |
| 365 | Ga0207639_10388199 | 3300026041 | Bacteria | 1255 |
| 366 | Ga0207639_10537754 | 3300026041 | Bacteria | 1072 |
| 367 | Ga0207678_10045772 | 3300026067 | Bacteria | 3783 |
| 368 | Ga0207678_10050255 | 3300026067 | Bacteria | 3603 |
| 369 | Ga0207678_10053837 | 3300026067 | Bacteria | 3467 |
| 370 | Ga0207678_10070679 | 3300026067 | Bacteria | 2993 |
| 371 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 372 | Ga0207702_10000514 | 3300026078 | Bacteria | 43618 |
| 373 | Ga0207641_10256946 | 3300026088 | Bacteria | 1634 |
| 374 | Ga0207641_10406020 | 3300026088 | Bacteria | 1309 |
| 375 | Ga0207648_10049340 | 3300026089 | Bacteria | 3683 |
| 376 | Ga0207648_10064924 | 3300026089 | Bacteria | 3182 |
| 377 | Ga0207676_10019625 | 3300026095 | Bacteria | 4934 |
| 378 | Ga0207676_10150888 | 3300026095 | Bacteria | 2001 |
| 379 | Ga0207674_10048184 | 3300026116 | Bacteria | 4362 |
| 380 | Ga0207674_10096974 | 3300026116 | Bacteria | 2933 |
| 381 | Ga0207674_10188004 | 3300026116 | Bacteria | 2015 |
| 382 | Ga0207674_10234568 | 3300026116 | Bacteria | 1782 |
| 383 | Ga0207674_10504816 | 3300026116 | Bacteria | 1168 |
| 384 | Ga0207675_100064906 | 3300026118 | Bacteria | 3412 |
| 385 | Ga0207675_100070222 | 3300026118 | Bacteria | 3273 |
| 386 | Ga0207675_100149277 | 3300026118 | Bacteria | 2224 |
| 387 | Ga0207675_100344132 | 3300026118 | Bacteria | 1460 |
| 388 | Ga0207683_10019949 | 3300026121 | Bacteria | 5728 |
| 389 | Ga0207698_10057798 | 3300026142 | Bacteria | 3003 |
| 390 | Ga0207698_10389198 | 3300026142 | Bacteria | 1329 |
| 391 | Ga0207698_10480663 | 3300026142 | Bacteria | 1205 |
| 392 | Ga0209389_1000016 | 3300027296 | Bacteria | 184844 |
| 393 | Ga0209389_1000027 | 3300027296 | Bacteria | 146917 |
| 394 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 395 | Ga0209589_1013736 | 3300027357 | Bacteria | 10448 |
| 396 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 397 | Ga0209489_102237 | 3300027361 | Bacteria | 39491 |
| 398 | Ga0209489_110753 | 3300027361 | Bacteria | 10002 |
| 399 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 400 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 401 | Ga0209179_1000570 | 3300027512 | Bacteria | 3866 |
| 402 | Ga0209813_10052679 | 3300027866 | Bacteria | 1277 |
| 403 | Ga0268266_10005838 | 3300028379 | Bacteria | 11389 |
| 404 | Ga0268266_10051358 | 3300028379 | Bacteria | 3539 |
| 405 | Ga0268266_10071200 | 3300028379 | Bacteria | 3013 |
| 406 | Ga0268266_10192118 | 3300028379 | Bacteria | 1864 |
| 407 | Ga0268266_10241188 | 3300028379 | Bacteria | 1668 |
| 408 | Ga0268266_10389125 | 3300028379 | Bacteria | 1316 |
| 409 | Ga0268266_10461065 | 3300028379 | Bacteria | 1209 |
| 410 | Ga0268266_10517614 | 3300028379 | Bacteria | 1140 |
| 411 | Ga0268265_10373474 | 3300028380 | Bacteria | 1309 |
| 412 | Ga0268265_10581463 | 3300028380 | Bacteria | 1067 |
| 413 | Ga0268264_10131146 | 3300028381 | Bacteria | 2222 |
| 414 | Ga0268264_10351696 | 3300028381 | Bacteria | 1403 |
| 415 | Ga0268264_10406861 | 3300028381 | Bacteria | 1309 |
| 416 | Ga0268264_10508567 | 3300028381 | Bacteria | 1176 |
| 417 | Ga0265334_10016514 | 3300028573 | Bacteria | 3053 |
| 418 | Ga0307517_10018365 | 3300028786 | Bacteria | 9051 |
| 419 | Ga0307515_10278812 | 3300028794 | Bacteria | 1382 |
| 420 | Ga0307511_10029041 | 3300030521 | Bacteria | 5004 |
| 421 | Ga0307511_10084295 | 3300030521 | Bacteria | 2207 |
| 422 | Ga0265330_10013428 | 3300031235 | Bacteria | 3817 |
| 423 | Ga0265330_10021180 | 3300031235 | Bacteria | 2969 |
| 424 | Ga0265330_10026032 | 3300031235 | Bacteria | 2650 |
| 425 | Ga0265332_10008158 | 3300031238 | Bacteria | 4710 |
| 426 | Ga0265332_10028166 | 3300031238 | Bacteria | 2460 |
| 427 | Ga0265332_10069519 | 3300031238 | Bacteria | 1500 |
| 428 | Ga0265328_10029632 | 3300031239 | Bacteria | 2042 |
| 429 | Ga0265328_10094481 | 3300031239 | Bacteria | 1105 |
| 430 | Ga0265325_10023540 | 3300031241 | Bacteria | 3360 |
| 431 | Ga0265340_10018482 | 3300031247 | Bacteria | 3594 |
| 432 | Ga0265339_10018617 | 3300031249 | Bacteria | 4091 |
| 433 | Ga0265331_10021097 | 3300031250 | Bacteria | 3337 |
| 434 | Ga0265316_10028897 | 3300031344 | Bacteria | 4567 |
| 435 | Ga0307509_10004649 | 3300031507 | Bacteria | 19608 |
| 436 | Ga0307509_10012663 | 3300031507 | Bacteria | 10066 |
| 437 | Ga0307509_10175879 | 3300031507 | Bacteria | 2013 |
| 438 | Ga0265313_10043303 | 3300031595 | Bacteria | 2205 |
| 439 | Ga0307508_10003178 | 3300031616 | Bacteria | 16796 |
| 440 | Ga0307508_10045726 | 3300031616 | Bacteria | 3910 |
| 441 | Ga0265314_10113147 | 3300031711 | Bacteria | 1721 |
| 442 | Ga0307516_10072595 | 3300031730 | Bacteria | 3300 |
| 443 | Ga0307516_10106814 | 3300031730 | Bacteria | 2609 |
| 444 | Ga0307516_10207372 | 3300031730 | Bacteria | 1676 |
| 445 | Ga0307406_10341044 | 3300031901 | Bacteria | 1167 |
| 446 | Ga0307412_10396788 | 3300031911 | Bacteria | 1122 |
| 447 | Ga0307409_100422305 | 3300031995 | Bacteria | 1279 |
| 448 | Ga0307510_10005379 | 3300033180 | Bacteria | 15241 |
| 449 | Ga0307510_10083698 | 3300033180 | Bacteria | 3078 |
| 450 | Ga0373934_0059952 | 3300035086 | Bacteria | 1515 |
| 451 | Ga0373951_0050524 | 3300035091 | Bacteria | 1022 |
| 452 | Ga0373923_0058208 | 3300035111 | Bacteria | 1636 |
| 453 | Ga0373923_0166737 | 3300035111 | Bacteria | 1007 |
| 454 | Ga0373936_0025118 | 3300035113 | Bacteria | 2328 |
| 455 | Ga0373945_0007763 | 3300035116 | Bacteria | 3481 |
| 456 | Ga0373953_0026940 | 3300035117 | Bacteria | 2205 |
| 457 | Ga0373954_0003254 | 3300035118 | Bacteria | 6857 |
| 458 | Ga0373956_0004124 | 3300035119 | Bacteria | 5831 |
| 459 | Ga0373957_0017874 | 3300035120 | Bacteria | 2476 |
| 460 | Ga0373957_0177653 | 3300035120 | Bacteria | 881 |
| 461 | Ga0373943_0102189 | 3300035170 | Bacteria | 1501 |
| 462 | Ga0373955_0128359 | 3300035172 | Bacteria | 1478 |
| 463 | Ga0373955_0264780 | 3300035172 | Bacteria | 1032 |
| 464 | Ga0373924_0080488 | 3300035410 | Bacteria | 1385 |
| 465 | Ga0373924_0088153 | 3300035410 | Bacteria | 1325 |
| 466 | Ga0373931_0075136 | 3300035691 | Bacteria | 1853 |
| 467 | Ga0373931_0080264 | 3300035691 | Bacteria | 1799 |
| 468 | Ga0373935_0012074 | 3300035692 | Bacteria | 5192 |
| 469 | Ga0373935_0242112 | 3300035692 | Bacteria | 1260 |
| 470 | Ga0373935_0360795 | 3300035692 | Bacteria | 1037 |
| 471 | Ga0373935_0449956 | 3300035692 | Bacteria | 930 |
| 472 | Ga0373927_0012034 | 3300035695 | Bacteria | 5755 |
| 473 | Ga0373927_0033415 | 3300035695 | Bacteria | 3349 |
| 474 | Ga0373927_0476852 | 3300035695 | Bacteria | 824 |
| 475 | Ga0373933_0000784 | 3300035724 | Bacteria | 19397 |
| 476 | Ga0373933_0009468 | 3300035724 | Bacteria | 5320 |
| 477 | Ga0373933_0080016 | 3300035724 | Bacteria | 2002 |
| 478 | Ga0373947_0027815 | 3300035725 | Bacteria | 3311 |
| 479 | Ga0373937_0026313 | 3300036401 | Bacteria | 5256 |
| 480 | Ga0373937_0206960 | 3300036401 | Bacteria | 1845 |
| 481 | Ga0373937_0519020 | 3300036401 | Bacteria | 1132 |
| 482 | Ga0373937_0538195 | 3300036401 | Bacteria | 1109 |
| 483 | Ga0372808_011667 | 3300036459 | Bacteria | 1244 |
| 484 | Ga0373925_0062447 | 3300037068 | Bacteria | 2801 |
| 485 | Ga0373925_0361964 | 3300037068 | Bacteria | 1179 |
| 486 | Ga0395899_0144236 | 3300037312 | Bacteria | 1692 |
| 487 | Ga0395900_0016672 | 3300037418 | Bacteria | 7493 |
| 488 | Ga0395900_0164314 | 3300037418 | Bacteria | 2263 |
| 489 | Ga0395900_0620377 | 3300037418 | Bacteria | 1020 |
| 490 | Ga0395898_0104561 | 3300037466 | Bacteria | 2715 |
| 491 | Ga0395905_0096770 | 3300037471 | Bacteria | 2771 |
| 492 | Ga0395905_0202187 | 3300037471 | Bacteria | 1862 |
| 493 | Ga0395905_0372345 | 3300037471 | Bacteria | 1322 |
| 494 | Ga0395901_0019475 | 3300038443 | Bacteria | 6939 |
| 495 | Ga0395901_0872784 | 3300038443 | Bacteria | 883 |
| 496 | Ga0436365_0328255 | 3300039437 | Bacteria | 67874 |
| 497 | Ga0436365_1493072 | 3300039437 | Bacteria | 8985 |
| 498 | Ga0436360_1256499 | 3300039438 | Bacteria | 5819 |
| 499 | Ga0436361_0385472 | 3300039447 | Bacteria | 2237 |
| 500 | Ga0436361_0964292 | 3300039447 | Bacteria | 1654 |
| 501 | Ga0436362_0953067 | 3300039453 | Bacteria | 5962 |
| 502 | Ga0439465_0020470 | 3300041413 | Bacteria | 2073 |
| 503 | Ga0451789_0661496 | 3300041443 | Bacteria | 942 |
| 504 | Ga0439455_0015584 | 3300042012 | Bacteria | 1749 |
| 505 | Ga0466969_0070134 | 3300044656 | Bacteria | 1686 |
| 506 | Ga0466969_0162768 | 3300044656 | Bacteria | 1025 |
| 507 | Ga0466972_0000449 | 3300044658 | Bacteria | 21167 |
| 508 | Ga0466972_0072783 | 3300044658 | Bacteria | 1638 |
| 509 | Ga0466965_0109412 | 3300044683 | Bacteria | 1419 |
| 510 | Ga0466966_0000455 | 3300044684 | Bacteria | 26381 |
| 511 | Ga0466961_0000603 | 3300044693 | Bacteria | 22634 |
| 512 | Ga0466963_0066822 | 3300044694 | Bacteria | 2412 |
| 513 | Ga0466963_0236276 | 3300044694 | Bacteria | 1281 |
| 514 | Ga0466964_0129046 | 3300044706 | Bacteria | 1149 |
| 515 | Ga0466968_0012673 | 3300044735 | Bacteria | 3306 |
| 516 | Ga0466968_0084211 | 3300044735 | Bacteria | 1401 |
| 517 | Ga0466970_0030813 | 3300044765 | Bacteria | 2830 |
| 518 | Ga0466970_0065716 | 3300044765 | Bacteria | 1947 |
| 519 | Ga0466970_0222753 | 3300044765 | Bacteria | 1053 |
| 520 | Ga0466960_0014996 | 3300044901 | Bacteria | 3332 |
| 521 | Ga0466960_0091010 | 3300044901 | Bacteria | 1555 |
| 522 | Ga0466959_0051667 | 3300045049 | Bacteria | 3013 |
| 523 | Ga0466959_0142548 | 3300045049 | Bacteria | 1692 |
| 524 | Ga0466958_0253883 | 3300045836 | Bacteria | 1125 |
| 525 | Ga0495592_0030678 | 3300046454 | Bacteria | 4066 |
| 526 | Ga0495592_0035165 | 3300046454 | Bacteria | 3775 |
| 527 | Ga0495603_0005606 | 3300046455 | Bacteria | 7501 |
| 528 | Ga0495603_0126526 | 3300046455 | Bacteria | 1489 |
| 529 | Ga0495590_0090407 | 3300046457 | Bacteria | 1083 |
| 530 | Ga0495629_0002984 | 3300046459 | Bacteria | 12864 |
| 531 | Ga0495629_0134775 | 3300046459 | Bacteria | 1720 |
| 532 | Ga0495629_0145729 | 3300046459 | Bacteria | 1647 |
| 533 | Ga0495638_0005250 | 3300046460 | Bacteria | 9673 |
| 534 | Ga0495638_0198660 | 3300046460 | Bacteria | 1133 |
| 535 | Ga0495641_0018784 | 3300046461 | Bacteria | 3558 |
| 536 | Ga0495651_0050286 | 3300046462 | Bacteria | 3216 |
| 537 | Ga0495651_0061975 | 3300046462 | Bacteria | 2862 |
| 538 | Ga0495651_0123223 | 3300046462 | Bacteria | 1901 |
| 539 | Ga0495651_0245177 | 3300046462 | Bacteria | 1226 |
| 540 | Ga0495653_0023442 | 3300046463 | Bacteria | 4985 |
| 541 | Ga0495653_0077004 | 3300046463 | Bacteria | 2478 |
| 542 | Ga0495650_0043671 | 3300046471 | Bacteria | 1900 |
| 543 | Ga0495650_0106592 | 3300046471 | Bacteria | 1046 |
| 544 | Ga0495582_0111674 | 3300046473 | Bacteria | 1535 |
| 545 | Ga0495639_0007837 | 3300046475 | Bacteria | 4591 |
| 546 | Ga0495664_0169530 | 3300046477 | Bacteria | 1324 |
| 547 | Ga0495585_0045665 | 3300046492 | Bacteria | 2444 |
| 548 | Ga0495594_0020690 | 3300046499 | Bacteria | 3506 |
| 549 | Ga0495594_0311417 | 3300046499 | Bacteria | 897 |
| 550 | Ga0495596_0022344 | 3300046500 | Bacteria | 2576 |
| 551 | Ga0495596_0111725 | 3300046500 | Bacteria | 1061 |
| 552 | Ga0495606_0066222 | 3300046507 | Bacteria | 2292 |
| 553 | Ga0495608_0023069 | 3300046511 | Bacteria | 4266 |
| 554 | Ga0495608_0113898 | 3300046511 | Bacteria | 1737 |
| 555 | Ga0495618_0157659 | 3300046514 | Bacteria | 1448 |
| 556 | Ga0495618_0167097 | 3300046514 | Bacteria | 1401 |
| 557 | Ga0495628_0018851 | 3300046516 | Bacteria | 5712 |
| 558 | Ga0495628_0076373 | 3300046516 | Bacteria | 2607 |
| 559 | Ga0495628_0136147 | 3300046516 | Bacteria | 1877 |
| 560 | Ga0495630_0059721 | 3300046517 | Bacteria | 2861 |
| 561 | Ga0495630_0514848 | 3300046517 | Bacteria | 917 |
| 562 | Ga0495632_0035870 | 3300046519 | Bacteria | 2526 |
| 563 | Ga0495643_0172918 | 3300046522 | Bacteria | 1055 |
| 564 | Ga0495644_0051474 | 3300046523 | Bacteria | 1546 |
| 565 | Ga0495644_0060952 | 3300046523 | Bacteria | 1418 |
| 566 | Ga0495648_0012715 | 3300046524 | Bacteria | 6256 |
| 567 | Ga0495648_0118314 | 3300046524 | Bacteria | 1429 |
| 568 | Ga0495666_0098329 | 3300046526 | Bacteria | 1380 |
| 569 | Ga0495652_0078081 | 3300046529 | Bacteria | 2742 |
| 570 | Ga0495652_0101934 | 3300046529 | Bacteria | 2326 |
| 571 | Ga0495652_0122685 | 3300046529 | Bacteria | 2069 |
| 572 | Ga0495640_0043124 | 3300046533 | Bacteria | 3143 |
| 573 | Ga0495640_0045764 | 3300046533 | Bacteria | 3036 |
| 574 | Ga0495640_0160091 | 3300046533 | Bacteria | 1443 |
| 575 | Ga0495587_0015723 | 3300046536 | Bacteria | 4719 |
| 576 | Ga0495587_0033800 | 3300046536 | Bacteria | 3085 |
| 577 | Ga0495609_0099114 | 3300046538 | Bacteria | 1263 |
| 578 | Ga0495621_0060160 | 3300046539 | Bacteria | 1377 |
| 579 | Ga0495645_0088815 | 3300046543 | Bacteria | 2210 |
| 580 | Ga0495622_0015653 | 3300046557 | Bacteria | 3526 |
| 581 | Ga0495622_0016701 | 3300046557 | Bacteria | 3418 |
| 582 | Ga0495622_0035408 | 3300046557 | Bacteria | 2328 |
| 583 | Ga0495622_0036243 | 3300046557 | Bacteria | 2300 |
| 584 | Ga0495667_0030518 | 3300046559 | Bacteria | 3621 |
| 585 | Ga0495667_0035702 | 3300046559 | Bacteria | 3321 |
| 586 | Ga0495667_0139165 | 3300046559 | Bacteria | 1564 |
| 587 | Ga0495656_0001017 | 3300046615 | Bacteria | 9073 |
| 588 | Ga0495668_0052216 | 3300046616 | Bacteria | 2262 |
| 589 | Ga0495634_0005863 | 3300046642 | Bacteria | 9385 |
| 590 | Ga0495634_0033851 | 3300046642 | Bacteria | 3509 |
| 591 | Ga0495634_0038694 | 3300046642 | Bacteria | 3251 |
| 592 | Ga0495611_0040347 | 3300046648 | Bacteria | 2081 |
| 593 | Ga0495625_0082968 | 3300046660 | Bacteria | 2228 |
| 594 | Ga0495635_0002996 | 3300046663 | Bacteria | 11592 |
| 595 | Ga0495635_0024568 | 3300046663 | Bacteria | 4199 |
| 596 | Ga0495635_0041945 | 3300046663 | Bacteria | 3161 |
| 597 | Ga0495635_0058430 | 3300046663 | Bacteria | 2653 |
| 598 | Ga0495659_0008839 | 3300046664 | Bacteria | 3208 |
| 599 | Ga0495661_0164586 | 3300046665 | Bacteria | 1188 |
| 600 | Ga0495588_0002975 | 3300046674 | Bacteria | 7320 |
| 601 | Ga0495588_0136041 | 3300046674 | Bacteria | 1297 |
| 602 | Ga0495657_0025879 | 3300046675 | Bacteria | 4162 |
| 603 | Ga0495657_0033612 | 3300046675 | Bacteria | 3569 |
| 604 | Ga0495657_0086881 | 3300046675 | Bacteria | 2013 |
| 605 | Ga0495599_0018837 | 3300046678 | Bacteria | 4302 |
| 606 | Ga0495599_0032531 | 3300046678 | Bacteria | 3274 |
| 607 | Ga0495623_0005568 | 3300046679 | Bacteria | 8224 |
| 608 | Ga0495623_0006324 | 3300046679 | Bacteria | 7698 |
| 609 | Ga0495646_0033218 | 3300046680 | Bacteria | 3209 |
| 610 | Ga0495646_0046764 | 3300046680 | Bacteria | 2636 |
| 611 | Ga0495647_0013604 | 3300046681 | Bacteria | 2823 |
| 612 | Ga0495658_0182753 | 3300046683 | Bacteria | 1301 |
| 613 | Ga0495658_0325741 | 3300046683 | Bacteria | 974 |
| 614 | Ga0495658_0367751 | 3300046683 | Bacteria | 915 |
| 615 | Ga0495669_0006974 | 3300046684 | Bacteria | 4731 |
| 616 | Ga0495669_0049594 | 3300046684 | Bacteria | 1880 |
| 617 | Ga0495669_0072437 | 3300046684 | Bacteria | 1572 |
| 618 | Ga0495613_0043701 | 3300046689 | Bacteria | 3315 |
| 619 | Ga0495613_0044858 | 3300046689 | Bacteria | 3270 |
| 620 | Ga0495624_0025788 | 3300046690 | Bacteria | 3856 |
| 621 | Ga0495670_0077455 | 3300046691 | Bacteria | 1690 |
| 622 | Ga0495671_0070273 | 3300046692 | Bacteria | 1720 |
| 623 | Ga0495671_0125644 | 3300046692 | Bacteria | 1251 |
| 624 | Ga0495671_0139991 | 3300046692 | Bacteria | 1179 |
| 625 | Ga0495649_0233896 | 3300046694 | Bacteria | 948 |
| 626 | Ga0495589_0148222 | 3300046794 | Bacteria | 1121 |
| 627 | Ga0495589_0160790 | 3300046794 | Bacteria | 1070 |
| 628 | Ga0495600_0004662 | 3300046809 | Bacteria | 8215 |
| 629 | Ga0495600_0035570 | 3300046809 | Bacteria | 3235 |
| 630 | Ga0495600_0056757 | 3300046809 | Bacteria | 2559 |
| 631 | Ga0495581_0039231 | 3300047315 | Bacteria | 2741 |
| 632 | Ga0495604_0007789 | 3300047317 | Bacteria | 8484 |
| 633 | Ga0495604_0018421 | 3300047317 | Bacteria | 5591 |
| 634 | Ga0495604_0077985 | 3300047317 | Bacteria | 2488 |
| 635 | Ga0495604_0366374 | 3300047317 | Bacteria | 954 |
| 636 | Ga0495674_0066189 | 3300047319 | Bacteria | 3136 |
| 637 | Ga0495674_0087507 | 3300047319 | Bacteria | 2666 |
| 638 | Ga0495674_0119336 | 3300047319 | Bacteria | 2229 |
| 639 | Ga0495674_0123414 | 3300047319 | Bacteria | 2187 |
| 640 | Ga0495676_0048116 | 3300047321 | Bacteria | 3441 |
| 641 | Ga0495676_0050003 | 3300047321 | Bacteria | 3356 |
| 642 | Ga0495676_0191337 | 3300047321 | Bacteria | 1427 |
| 643 | Ga0495680_0035746 | 3300047322 | Bacteria | 3997 |
| 644 | Ga0495683_0060361 | 3300047323 | Bacteria | 1880 |
| 645 | Ga0495683_0186214 | 3300047323 | Bacteria | 945 |
| 646 | Ga0495687_046799 | 3300047443 | Bacteria | 1865 |
| 647 | Ga0495675_0037487 | 3300047444 | Bacteria | 3087 |
| 648 | Ga0495673_0089210 | 3300047469 | Bacteria | 1263 |
| 649 | Ga0495684_0019268 | 3300047471 | Bacteria | 5253 |
| 650 | Ga0495684_0087037 | 3300047471 | Bacteria | 2368 |
| 651 | Ga0495686_0057913 | 3300047472 | Bacteria | 2417 |
| 652 | Ga0495593_0032879 | 3300047673 | Bacteria | 2826 |
| 653 | Ga0495593_0071237 | 3300047673 | Bacteria | 1805 |
| 654 | Ga0495602_0013480 | 3300048088 | Bacteria | 8354 |
| 655 | Ga0495602_0061833 | 3300048088 | Bacteria | 3252 |
| 656 | Ga0495602_0075890 | 3300048088 | Bacteria | 2851 |
| 657 | Ga0495602_0316208 | 3300048088 | Bacteria | 1137 |
| 658 | Ga0495614_0112115 | 3300048089 | Bacteria | 1198 |
| 659 | Ga0496100_0004243 | 3300048903 | Bacteria | 7576 |
| 660 | Ga0496100_0522017 | 3300048903 | Bacteria | 917 |
| 661 | Ga0496101_0013036 | 3300048904 | Bacteria | 5562 |
| 662 | Ga0496102_0002815 | 3300048905 | Bacteria | 14815 |
| 663 | Ga0496102_0077227 | 3300048905 | Bacteria | 3065 |
| 664 | Ga0496102_0084967 | 3300048905 | Bacteria | 2922 |
| 665 | Ga0496102_0095338 | 3300048905 | Bacteria | 2758 |
| 666 | Ga0496103_0030000 | 3300048906 | Bacteria | 3307 |
| 667 | Ga0496104_0006611 | 3300048907 | Bacteria | 10198 |
| 668 | Ga0496104_0024816 | 3300048907 | Bacteria | 5519 |
| 669 | Ga0496104_0033645 | 3300048907 | Bacteria | 4777 |
| 670 | Ga0496105_0009154 | 3300048908 | Bacteria | 7726 |
| 671 | Ga0496105_0032947 | 3300048908 | Bacteria | 4253 |
| 672 | Ga0496105_0107061 | 3300048908 | Bacteria | 2308 |
| 673 | Ga0496105_0220523 | 3300048908 | Bacteria | 1544 |
| 674 | Ga0496105_0228544 | 3300048908 | Bacteria | 1512 |
| 675 | Ga0496106_0005419 | 3300048909 | Bacteria | 9436 |
| 676 | Ga0496106_0042125 | 3300048909 | Bacteria | 3423 |
| 677 | Ga0496106_0057561 | 3300048909 | Bacteria | 2940 |
| 678 | Ga0496106_0330762 | 3300048909 | Bacteria | 1223 |
| 679 | Ga0496107_0014935 | 3300048910 | Bacteria | 5438 |
| 680 | Ga0496107_0127578 | 3300048910 | Bacteria | 1877 |
| 681 | Ga0496108_0046662 | 3300048911 | Bacteria | 3620 |
| 682 | Ga0496108_0052073 | 3300048911 | Bacteria | 3429 |
| 683 | Ga0496109_0021949 | 3300048912 | Bacteria | 5653 |
| 684 | Ga0496109_0035699 | 3300048912 | Bacteria | 4486 |
| 685 | Ga0496109_0231547 | 3300048912 | Bacteria | 1738 |
| 686 | Ga0496109_0426575 | 3300048912 | Bacteria | 1253 |
| 687 | Ga0496110_0023683 | 3300048913 | Bacteria | 5223 |
| 688 | Ga0496110_0275222 | 3300048913 | Bacteria | 1533 |
| 689 | Ga0496110_0307890 | 3300048913 | Bacteria | 1443 |
| 690 | Ga0496111_0138209 | 3300048914 | Bacteria | 1805 |
| 691 | Ga0496111_0275631 | 3300048914 | Bacteria | 1248 |
| 692 | Ga0496112_0111037 | 3300048915 | Bacteria | 2712 |
| 693 | Ga0496112_0119972 | 3300048915 | Bacteria | 2600 |
| 694 | Ga0496112_0241122 | 3300048915 | Bacteria | 1760 |
| 695 | Ga0496112_0733093 | 3300048915 | Bacteria | 915 |
| 696 | Ga0496113_0024350 | 3300048916 | Bacteria | 4301 |
| 697 | Ga0496113_0035208 | 3300048916 | Bacteria | 3661 |
| 698 | Ga0496113_0157985 | 3300048916 | Bacteria | 1791 |
| 699 | Ga0496114_0102760 | 3300048917 | Bacteria | 2442 |
| 700 | Ga0496114_0165612 | 3300048917 | Bacteria | 1924 |
| 701 | Ga0496114_0604349 | 3300048917 | Bacteria | 967 |
| 702 | Ga0496115_0009460 | 3300048918 | Bacteria | 7239 |
| 703 | Ga0496115_0013575 | 3300048918 | Bacteria | 6164 |
| 704 | Ga0496115_0279250 | 3300048918 | Bacteria | 1371 |
| 705 | Ga0496115_0327366 | 3300048918 | Bacteria | 1252 |
| 706 | Ga0496115_0395224 | 3300048918 | Bacteria | 1122 |
| 707 | Ga0496115_0453047 | 3300048918 | Bacteria | 1036 |
| 708 | Ga0496117_0039426 | 3300048920 | Bacteria | 3487 |
| 709 | Ga0496119_0032422 | 3300048922 | Bacteria | 3482 |
| 710 | Ga0496119_0065095 | 3300048922 | Bacteria | 2161 |
| 711 | Ga0496119_0108621 | 3300048922 | Bacteria | 1544 |
| 712 | Ga0496120_0011992 | 3300048923 | Bacteria | 5925 |
| 713 | Ga0496121_0000146 | 3300048924 | Bacteria | 154459 |
| 714 | Ga0496121_0002453 | 3300048924 | Bacteria | 28353 |
| 715 | Ga0496121_0003864 | 3300048924 | Bacteria | 20824 |
| 716 | Ga0496121_0003891 | 3300048924 | Bacteria | 20749 |
| 717 | Ga0496121_0042243 | 3300048924 | Bacteria | 3970 |
| 718 | Ga0496121_0180611 | 3300048924 | Bacteria | 1523 |
| 719 | Ga0496121_0180804 | 3300048924 | Bacteria | 1522 |
| 720 | Ga0496121_0186048 | 3300048924 | Bacteria | 1494 |
| 721 | Ga0496121_0207091 | 3300048924 | Bacteria | 1393 |
| 722 | Ga0496121_0242884 | 3300048924 | Bacteria | 1253 |
| 723 | Ga0496121_0277988 | 3300048924 | Bacteria | 1147 |
| 724 | Ga0496122_0011039 | 3300048925 | Bacteria | 9221 |
| 725 | Ga0496122_0027250 | 3300048925 | Bacteria | 4891 |
| 726 | Ga0496122_0124478 | 3300048925 | Bacteria | 1654 |
| 727 | Ga0496123_0007911 | 3300048926 | Bacteria | 9874 |
| 728 | Ga0496124_0001997 | 3300048927 | Bacteria | 27793 |
| 729 | Ga0496124_0160713 | 3300048927 | Bacteria | 1751 |
| 730 | Ga0496125_0034974 | 3300048928 | Bacteria | 4419 |
| 731 | Ga0496125_0035461 | 3300048928 | Bacteria | 4374 |
| 732 | Ga0496126_0006544 | 3300048929 | Bacteria | 12970 |
| 733 | Ga0496126_0010063 | 3300048929 | Bacteria | 9977 |
| 734 | Ga0496126_0017240 | 3300048929 | Bacteria | 7197 |
| 735 | Ga0496126_0035606 | 3300048929 | Bacteria | 4664 |
| 736 | Ga0496126_0056121 | 3300048929 | Bacteria | 3561 |
| 737 | Ga0496126_0095415 | 3300048929 | Bacteria | 2609 |
| 738 | Ga0496126_0123694 | 3300048929 | Bacteria | 2241 |
| 739 | Ga0496126_0124200 | 3300048929 | Bacteria | 2235 |
| 740 | Ga0496126_0141204 | 3300048929 | Bacteria | 2073 |
| 741 | Ga0495682_0026585 | 3300049460 | Bacteria | 2147 |
| 742 | Ga0501031_0066881 | 3300049568 | Bacteria | 2341 |
| 743 | Ga0501032_0000196 | 3300049569 | Bacteria | 50261 |
| 744 | Ga0501033_0003209 | 3300049570 | Bacteria | 13536 |
| 745 | Ga0501034_0001151 | 3300049571 | Bacteria | 36663 |
| 746 | Ga0501036_0000323 | 3300049572 | Bacteria | 33256 |
| 747 | Ga0501037_0001377 | 3300049573 | Bacteria | 17808 |
| 748 | Ga0501038_0001622 | 3300049574 | Bacteria | 20925 |
| 749 | Ga0501039_0001302 | 3300049575 | Bacteria | 18240 |
| 750 | Ga0501042_0046374 | 3300049578 | Bacteria | 3098 |
| 751 | Ga0501043_0000409 | 3300049579 | Bacteria | 38657 |
| 752 | Ga0501046_0000181 | 3300049580 | Bacteria | 64035 |
| 753 | Ga0501047_0002426 | 3300049581 | Bacteria | 17808 |
| 754 | Ga0501047_0062965 | 3300049581 | Bacteria | 3578 |
| 755 | Ga0501047_0600438 | 3300049581 | Bacteria | 922 |
| 756 | Ga0501048_0003595 | 3300049582 | Bacteria | 11806 |
| 757 | Ga0501067_0000145 | 3300049583 | Bacteria | 39277 |
| 758 | Ga0501068_0002577 | 3300049584 | Bacteria | 9611 |
| 759 | Ga0501069_0071630 | 3300049585 | Bacteria | 1943 |
| 760 | Ga0501070_0003510 | 3300049586 | Bacteria | 13565 |
| 761 | Ga0501070_0052660 | 3300049586 | Bacteria | 3378 |
| 762 | Ga0501072_0017020 | 3300049588 | Bacteria | 5585 |
| 763 | Ga0501072_0265402 | 3300049588 | Bacteria | 1366 |
| 764 | Ga0501073_0000027 | 3300049589 | Bacteria | 121860 |
| 765 | Ga0501073_0039562 | 3300049589 | Bacteria | 3340 |
| 766 | Ga0501074_0001347 | 3300049590 | Bacteria | 16291 |
| 767 | Ga0501074_0146411 | 3300049590 | Bacteria | 1689 |
| 768 | Ga0501079_0048138 | 3300049741 | Bacteria | 3290 |
| 769 | Ga0501080_0002621 | 3300049742 | Bacteria | 15752 |
| 770 | Ga0501080_0052129 | 3300049742 | Bacteria | 3808 |
| 771 | Ga0501083_0002123 | 3300049744 | Bacteria | 13604 |
| 772 | Ga0501035_0001852 | 3300049822 | Bacteria | 21281 |
| 773 | Ga0501035_0310990 | 3300049822 | Bacteria | 1326 |
| 774 | Ga0501044_0003498 | 3300049823 | Bacteria | 17680 |
| 775 | Ga0501044_0722639 | 3300049823 | Bacteria | 880 |
| 776 | nmdc:mga03683_46899_c1 | 3300050489 | Bacteria | 1792 |
| 777 | nmdc:mga03n38_98_c1 | 3300050490 | Bacteria | 19203 |
| 778 | nmdc:mga00v17_121059_c1 | 3300050491 | Bacteria | 1666 |
| 779 | nmdc:mga00v17_32131_c1 | 3300050491 | Bacteria | 3101 |
| 780 | nmdc:mga00v17_58540_c1 | 3300050491 | Bacteria | 2361 |
| 781 | nmdc:mga0yw44_118730_c1 | 3300050492 | Bacteria | 1702 |
| 782 | nmdc:mga0yw44_12674_c1 | 3300050492 | Bacteria | 4405 |
| 783 | nmdc:mga0yw44_160309_c1 | 3300050492 | Bacteria | 1472 |
| 784 | nmdc:mga0yw44_161818_c1 | 3300050492 | Bacteria | 1466 |
| 785 | nmdc:mga0yw44_191706_c1 | 3300050492 | Bacteria | 1348 |
| 786 | nmdc:mga0yw44_197218_c1 | 3300050492 | Bacteria | 1329 |
| 787 | nmdc:mga0yw44_6672_c1 | 3300050492 | Bacteria | 5602 |
| 788 | nmdc:mga0k408_100725_c1 | 3300050493 | Bacteria | 1703 |
| 789 | nmdc:mga0k408_203983_c1 | 3300050493 | Bacteria | 1180 |
| 790 | nmdc:mga0k408_67583_c1 | 3300050493 | Bacteria | 2083 |
| 791 | nmdc:mga06z11_137921_c1 | 3300050494 | Bacteria | 1376 |
| 792 | nmdc:mga06z11_179874_c1 | 3300050494 | Bacteria | 1219 |
| 793 | nmdc:mga06z11_45740_c1 | 3300050494 | Bacteria | 2214 |
| 794 | nmdc:mga04h51_18851_c1 | 3300050495 | Bacteria | 2038 |
| 795 | nmdc:mga04h51_42826_c1 | 3300050495 | Bacteria | 1486 |
| 796 | nmdc:mga07m45_110601_c1 | 3300050496 | Bacteria | 1582 |
| 797 | nmdc:mga07m45_41962_c1 | 3300050496 | Bacteria | 2563 |
| 798 | nmdc:mga07m45_87961_c1 | 3300050496 | Bacteria | 1778 |
| 799 | nmdc:mga09592_277164_c1 | 3300050508 | Bacteria | 1454 |
| 800 | nmdc:mga0n895_179818_c1 | 3300050512 | Bacteria | 2146 |
| 801 | nmdc:mga0n895_262239_c1 | 3300050512 | Bacteria | 1753 |
| 802 | nmdc:mga0sz30_11679_c1 | 3300050516 | Bacteria | 3398 |
| 803 | nmdc:mga0sz30_175701_c1 | 3300050516 | Bacteria | 950 |
| 804 | nmdc:mga0sz30_60927_c1 | 3300050516 | Bacteria | 1612 |
| 805 | Ga0495601_0023042 | 3300053077 | Bacteria | 3826 |
| 806 | Ga0495601_0045290 | 3300053077 | Bacteria | 2766 |
| 807 | Ga0495601_0209366 | 3300053077 | Bacteria | 1274 |
| 808 | Ga0500635_0003192 | 3300053080 | Bacteria | 4104 |
| 809 | Ga0500635_0141457 | 3300053080 | Bacteria | 913 |
| 810 | Ga0495655_0031289 | 3300053083 | Bacteria | 1294 |
| 811 | Ga0495595_0058978 | 3300053084 | Bacteria | 1793 |
| 812 | Ga0495595_0153870 | 3300053084 | Bacteria | 1132 |
| 813 | Ga0495619_0052867 | 3300053085 | Bacteria | 2685 |
| 814 | Ga0500643_000052 | 3300053087 | Bacteria | 144656 |
| 815 | Ga0500647_0036476 | 3300053091 | Bacteria | 2351 |
| 816 | Ga0500647_0063760 | 3300053091 | Bacteria | 1772 |
| 817 | Ga0500647_0092965 | 3300053091 | Bacteria | 1443 |
| 818 | Ga0500583_0138135 | 3300053092 | Bacteria | 1210 |
| 819 | Ga0500583_0189653 | 3300053092 | Bacteria | 1023 |
| 820 | Ga0500651_0074272 | 3300053093 | Bacteria | 2112 |
| 821 | Ga0500566_0000207 | 3300053094 | Bacteria | 31105 |
| 822 | Ga0500566_0002388 | 3300053094 | Bacteria | 11108 |
| 823 | Ga0500566_0006524 | 3300053094 | Bacteria | 6914 |
| 824 | Ga0500640_003553 | 3300053095 | Bacteria | 5477 |
| 825 | Ga0500640_058687 | 3300053095 | Bacteria | 1671 |
| 826 | Ga0500641_0001497 | 3300053096 | Bacteria | 8343 |
| 827 | Ga0500650_0232835 | 3300053098 | Bacteria | 831 |
| 828 | Ga0500554_000856 | 3300053102 | Bacteria | 5978 |
| 829 | Ga0500554_001256 | 3300053102 | Bacteria | 4908 |
| 830 | Ga0500556_0008721 | 3300053104 | Bacteria | 2930 |
| 831 | Ga0500556_0017680 | 3300053104 | Bacteria | 2238 |
| 832 | Ga0500557_000148 | 3300053105 | Bacteria | 16266 |
| 833 | Ga0500562_004186 | 3300053108 | Bacteria | 3642 |
| 834 | Ga0500569_000873 | 3300053109 | Bacteria | 5363 |
| 835 | Ga0500572_000676 | 3300053111 | Bacteria | 11214 |
| 836 | Ga0500591_081761 | 3300053115 | Bacteria | 1433 |
| 837 | Ga0500591_091052 | 3300053115 | Bacteria | 1331 |
| 838 | Ga0500592_007602 | 3300053116 | Bacteria | 1722 |
| 839 | Ga0500594_0077242 | 3300053118 | Bacteria | 990 |
| 840 | Ga0500595_000299 | 3300053119 | Bacteria | 32634 |
| 841 | Ga0500595_003982 | 3300053119 | Bacteria | 6751 |
| 842 | Ga0500595_004108 | 3300053119 | Bacteria | 6601 |
| 843 | Ga0500595_011382 | 3300053119 | Bacteria | 3487 |
| 844 | Ga0500595_012032 | 3300053119 | Bacteria | 3358 |
| 845 | Ga0500595_027476 | 3300053119 | Bacteria | 1948 |
| 846 | Ga0500608_051325 | 3300053122 | Bacteria | 1981 |
| 847 | Ga0500608_107335 | 3300053122 | Bacteria | 1284 |
| 848 | Ga0500614_000572 | 3300053123 | Bacteria | 9506 |
| 849 | Ga0500614_005280 | 3300053123 | Bacteria | 2713 |
| 850 | Ga0500614_014221 | 3300053123 | Bacteria | 1759 |
| 851 | Ga0500642_0000083 | 3300053130 | Bacteria | 50718 |
| 852 | Ga0500642_0009622 | 3300053130 | Bacteria | 3365 |
| 853 | Ga0500652_017701 | 3300053131 | Bacteria | 2617 |
| 854 | Ga0500658_0108552 | 3300053134 | Bacteria | 1219 |
| 855 | Ga0500559_0003255 | 3300053136 | Bacteria | 8063 |
| 856 | Ga0500559_0019756 | 3300053136 | Bacteria | 2847 |
| 857 | Ga0500559_0036777 | 3300053136 | Bacteria | 2119 |
| 858 | Ga0500559_0156993 | 3300053136 | Bacteria | 1068 |
| 859 | Ga0500559_0194700 | 3300053136 | Bacteria | 955 |
| 860 | Ga0500564_077793 | 3300053138 | Bacteria | 1490 |
| 861 | Ga0500568_0008381 | 3300053139 | Bacteria | 4985 |
| 862 | Ga0500568_0013248 | 3300053139 | Bacteria | 3761 |
| 863 | Ga0500573_0077562 | 3300053140 | Bacteria | 1890 |
| 864 | Ga0500577_0044289 | 3300053142 | Bacteria | 1639 |
| 865 | Ga0500588_0026259 | 3300053146 | Bacteria | 1627 |
| 866 | Ga0500590_056787 | 3300053148 | Bacteria | 1977 |
| 867 | Ga0500590_133090 | 3300053148 | Bacteria | 1148 |
| 868 | Ga0500590_175827 | 3300053148 | Bacteria | 936 |
| 869 | Ga0500603_000313 | 3300053150 | Bacteria | 12755 |
| 870 | Ga0500603_000691 | 3300053150 | Bacteria | 8222 |
| 871 | Ga0500603_016677 | 3300053150 | Bacteria | 1746 |
| 872 | Ga0500604_0016364 | 3300053151 | Bacteria | 2042 |
| 873 | Ga0500622_0106390 | 3300053156 | Bacteria | 1375 |
| 874 | Ga0500630_001066 | 3300053159 | Bacteria | 12827 |
| 875 | Ga0500638_002777 | 3300053162 | Bacteria | 6250 |
| 876 | Ga0500638_003145 | 3300053162 | Bacteria | 6024 |
| 877 | Ga0500638_101633 | 3300053162 | Bacteria | 1340 |
| 878 | Ga0500639_000072 | 3300053163 | Bacteria | 46512 |
| 879 | Ga0500636_0000314 | 3300053177 | Bacteria | 26665 |
| 880 | Ga0500636_0039800 | 3300053177 | Bacteria | 2781 |
| 881 | Ga0500636_0064281 | 3300053177 | Bacteria | 2137 |
| 882 | Ga0500636_0079580 | 3300053177 | Bacteria | 1890 |
| 883 | Ga0500636_0119234 | 3300053177 | Bacteria | 1481 |
| 884 | Ga0500637_0000065 | 3300053178 | Bacteria | 37771 |
| 885 | Ga0500637_0002631 | 3300053178 | Bacteria | 8033 |
| 886 | Ga0500637_0059209 | 3300053178 | Bacteria | 2192 |
| 887 | Ga0500625_062812 | 3300053729 | Bacteria | 1679 |
| 888 | Ga0500645_023607 | 3300053730 | Bacteria | 1885 |
| 889 | Ga0500609_018174 | 3300053731 | Bacteria | 956 |
| 890 | Ga0500596_002009 | 3300053735 | Bacteria | 4064 |
| 891 | Ga0500596_002393 | 3300053735 | Bacteria | 3699 |
| 892 | Ga0500596_008884 | 3300053735 | Bacteria | 1587 |
| 893 | Ga0500599_000695 | 3300053736 | Bacteria | 3634 |
| 894 | Ga0500601_000099 | 3300053737 | Bacteria | 18048 |
| 895 | Ga0500601_003567 | 3300053737 | Bacteria | 1687 |
| 896 | Ga0501084_0003235 | 3300054114 | Bacteria | 13188 |
| 897 | Ga0500661_001927 | 3300055283 | Bacteria | 3916 |
| 898 | Ga0501082_0005376 | 3300060353 | Bacteria | 11113 |
| 899 | Ga0530510_0107924 | 3300061734 | Bacteria | 2038 |
| 900 | 2507504396 | 2507262055 | Bacteria | 8048963 |
| 901 | 2508545828 | 2508501009 | Bacteria | 7784016 |
| 902 | 2509146427 | 2508501128 | Bacteria | 8613869 |
| 903 | 2511396438 | 2511231028 | Bacteria | 8046582 |
| 904 | 2513624206 | 2513237092 | Bacteria | 8341956 |
| 905 | 2513638701 | 2513237094 | Bacteria | 8789602 |
| 906 | 2513649903 | 2513237095 | Bacteria | 8976980 |
| 907 | 2513656191 | 2513237096 | Bacteria | 8722461 |
| 908 | 2513679749 | 2513237098 | Bacteria | 9902361 |
| 909 | 2513702592 | 2513237102 | Bacteria | 7703324 |
| 910 | 2513716731 | 2513237104 | Bacteria | 10034502 |
| 911 | 2513860706 | 2513237137 | Bacteria | 9558895 |
| 912 | 2513892473 | 2513237141 | Bacteria | 8496279 |
| 913 | 2513917629 | 2513237145 | Bacteria | 8979722 |
| 914 | 2514010031 | 2513237161 | Bacteria | 8871253 |
| 915 | 2515624421 | 2515154112 | Bacteria | 8294334 |
| 916 | 2517108171 | 2517093001 | Bacteria | 9002274 |
| 917 | 2517887711 | 2517572143 | Bacteria | 9484767 |
| 918 | 2524442735 | 2524023205 | Bacteria | 8918781 |
| 919 | 2524466636 | 2524023210 | Bacteria | 9029266 |
| 920 | 2524535377 | 2524023228 | Bacteria | 10118060 |
| 921 | 2528850463 | 2528768022 | Bacteria | 10457665 |
| 922 | 2617353829 | 2617270735 | Bacteria | 9163226 |
| 923 | 2617374421 | 2617270741 | Bacteria | 8201522 |
| 924 | 2671120777 | 2667528175 | Bacteria | 7532676 |
| 925 | 2723842482 | 2721755755 | Bacteria | 8322773 |
| 926 | 2728748280 | 2728368998 | Bacteria | 8720350 |
| 927 | 2745074552 | 2744054633 | Bacteria | 8678936 |
| 928 | 2793059334 | 2791355196 | Bacteria | 7323613 |
| 929 | 2793072903 | 2791355197 | Bacteria | 8420563 |
| 930 | 2793078666 | |||
| 931 | 2805922093 | 2802429603 | Bacteria | 8777136 |
| 932 | 2818240903 | 2816332527 | Bacteria | 8933356 |
| 933 | 2824604658 | 2824600985 | Bacteria | 8488197 |
| 934 | 2824616134 | 2824609381 | Bacteria | 8672835 |
| 935 | 2824618875 | 2824617872 | Bacteria | 8814715 |
| 936 | 2824632891 | 2824626560 | Bacteria | 8813858 |
| 937 | 2824641000 | 2824635225 | Bacteria | 8785348 |
| 938 | 2824648206 | 2824644064 | Bacteria | 8743947 |
| 939 | 2824658407 | 2824653114 | Bacteria | 8493680 |
| 940 | 2824667418 | 2824661429 | Bacteria | 9877870 |
| 941 | 2824675505 | 2824671348 | Bacteria | 8369588 |
| 942 | 2824685974 | 2824679649 | Bacteria | 8248951 |
| 943 | 2824691728 | 2824687955 | Bacteria | 8360029 |
| 944 | 2824698955 | 2824696289 | Bacteria | 8335049 |
| 945 | 2824709901 | 2824704595 | Bacteria | 9667483 |
| 946 | 2824718018 | 2824714736 | Bacteria | 8717648 |
| 947 | 2824728326 | 2824723954 | Bacteria | 8758240 |
| 948 | 2824734967 | 2824732956 | Bacteria | 7810675 |
| 949 | 2824748114 | 2824746037 | Bacteria | 7911610 |
| 950 | 2824759707 | 2824753945 | Bacteria | 9787441 |
| 951 | 2824769912 | 2824763712 | Bacteria | 9792355 |
| 952 | 2824779722 | 2824773399 | Bacteria | 8360218 |
| 953 | 2838126063 | 2838122688 | Bacteria | 8803140 |
| 954 | 2841942544 | 2841941048 | Bacteria | 8688029 |
| 955 | 2841953106 | 2841949485 | Bacteria | 8680857 |
| 956 | 2841960610 | 2841957949 | Bacteria | 8652217 |
| 957 | 2841970869 | 2841966195 | Bacteria | 8673214 |
| 958 | 2841977871 | 2841974524 | Bacteria | 8931498 |
| 959 | 2841984564 | 2841983080 | Bacteria | 8395090 |
| 960 | 2842041714 | 2842038055 | Bacteria | 8002051 |
| 961 | 2842049756 | 2842045827 | Bacteria | 8006841 |
| 962 | 2844321401 | 2844315083 | Bacteria | 8138177 |
| 963 | 2847932007 | 2847930680 | Bacteria | 9342022 |
| 964 | 2847943248 | 2847939898 | Bacteria | 8606328 |
| 965 | 2849076975 | 2849076700 | Bacteria | 7039503 |
| 966 | 2857514750 | 2857509624 | Bacteria | 7472071 |
| 967 | 2874595650 | 2874590934 | Bacteria | 8299676 |
| 968 | 2874620351 | 2874612657 | Bacteria | 8252029 |
| 969 | 2874621842 | 2874620515 | Bacteria | 8290088 |
| 970 | 2874630236 | 2874628541 | Bacteria | 8630250 |
| 971 | 2874651717 | 2874645413 | Bacteria | 8214782 |
| 972 | 2876766441 | 2876761206 | Bacteria | 10111113 |
| 973 | 2876775845 | 2876771140 | Bacteria | 8287509 |
| 974 | 2876821612 | 2876818435 | Bacteria | 8274608 |
| 975 | 2879079936 | 2879074833 | Bacteria | 8279565 |
| 976 | 2879085686 | 2879083081 | Bacteria | 8587928 |
| 977 | 2879104529 | 2879099564 | Bacteria | 10442239 |
| 978 | 2879134020 | 2879127579 | Bacteria | 8294491 |
| 979 | 2879148505 | 2879142872 | Bacteria | 8267021 |
| 980 | 2881370400 | 2881364244 | Bacteria | 7710352 |
| 981 | 2881666458 | 2881665667 | Bacteria | 8175609 |
| 982 | 2885374419 | 2885366525 | Bacteria | 8326213 |
| 983 | 2885382552 | 2885374607 | Bacteria | 8927485 |
| 984 | 2885384907 | 2885383462 | Bacteria | 9473874 |
| 985 | 2885411551 | 2885409591 | Bacteria | 9235467 |
| 986 | 2888387706 | 2888378607 | Bacteria | 9652610 |
| 987 | 2888391464 | 2888388044 | Bacteria | 7304136 |
| 988 | 2888426915 | 2888419890 | Bacteria | 7857137 |
| 989 | 2889034246 | 2889033259 | Bacteria | 9099371 |
| 990 | 2903734582 | 2903727486 | Bacteria | 8281579 |
| 991 | 2903753644 | 2903748898 | Bacteria | 9972761 |
| 992 | 2903773488 | 2903768456 | Bacteria | 9749579 |
| 993 | 2904669565 | 2904666416 | Bacteria | 8226587 |
| 994 | 2904691841 | 2904690495 | Bacteria | 9412302 |
| 995 | 2904713623 | 2904711408 | Bacteria | 9771557 |
| 996 | 2906608015 | 2906602504 | Bacteria | 8295279 |
| 997 | 2906612721 | |||
| 998 | 2906629413 | 2906626472 | Bacteria | 8826946 |
| 999 | 2906640553 | 2906635258 | Bacteria | 8601019 |
| 1000 | 2906647219 | 2906643746 | Bacteria | 8722424 |
| 1001 | 2906663223 | 2906660503 | Bacteria | 8595048 |
| 1002 | 2908745917 | 2908739725 | Bacteria | 8628932 |
| 1003 | 2908763946 | 2908756301 | Bacteria | 8864324 |
| 1004 | 2908776902 | 2908775508 | Bacteria | 8092255 |
| 1005 | 2922367632 | 2922361189 | Bacteria | 7436256 |
| 1006 | 2922376692 | |||
| 1007 | 2922391607 | 2922386360 | Bacteria | 7017218 |
| 1008 | 2922393292 | 2922393267 | Bacteria | 8285685 |
| 1009 | 2922433201 | |||
| 1010 | 2929619767 | 2929615660 | Bacteria | 9193770 |
| 1011 | 2929629078 | 2929624759 | Bacteria | 9339455 |
| 1012 | 2932789747 | 2932784394 | Bacteria | 9704911 |
| 1013 | 2932796585 | 2932794094 | Bacteria | 7915132 |
| 1014 | 2932817740 | 2932809354 | Bacteria | 9135765 |
| 1015 | 2932827148 | 2932818245 | Bacteria | 9955613 |
| 1016 | 2932835752 | 2932828146 | Bacteria | 9745859 |
| 1017 | 2933581686 | 2933577622 | Bacteria | 9116884 |
| 1018 | 2935613191 | 2935608549 | Bacteria | 8203142 |
| 1019 | 2935624554 | 2935616580 | Bacteria | 9032984 |
| 1020 | 2935630602 | 2935630451 | Bacteria | 8169952 |
| 1021 | 2935647219 | 2935638405 | Bacteria | 10015038 |
| 1022 | 2935655637 | 2935648319 | Bacteria | 8801166 |
| 1023 | 2935664459 | 2935656913 | Bacteria | 8965014 |
| 1024 | 2935674318 | 2935665750 | Bacteria | 9571747 |
| 1025 | 2935684198 | 2935675223 | Bacteria | 9928132 |
| 1026 | 2935694230 | 2935684952 | Bacteria | 9590419 |
| 1027 | 2935697671 | 2935694250 | Bacteria | 9291695 |
| 1028 | 2935711307 | 2935703347 | Bacteria | 10242284 |
| 1029 | 2935720015 | 2935713505 | Bacteria | 9608509 |
| 1030 | 2935732126 | 2935722832 | Bacteria | 9608746 |
| 1031 | 2935741515 | 2935732158 | Bacteria | 9706831 |
| 1032 | 2935750877 | 2935741537 | Bacteria | 9707219 |
| 1033 | 2935757871 | 2935750917 | Bacteria | 9590372 |
| 1034 | 2935764248 | 2935760218 | Bacteria | 9817913 |
| 1035 | 2935775128 | 2935769743 | Bacteria | 7878163 |
| 1036 | 2935780031 | 2935777560 | Bacteria | 8077691 |
| 1037 | 2935790152 | 2935785616 | Bacteria | 7962367 |
| 1038 | 2935798806 | 2935793552 | Bacteria | 8012592 |
| 1039 | 2935809907 | 2935801545 | Bacteria | 9301974 |
| 1040 | 2935819312 | 2935810662 | Bacteria | 9401221 |
| 1041 | 2935824955 | 2935819856 | Bacteria | 8261050 |
| 1042 | 2935836643 | 2935827899 | Bacteria | 10038562 |
| 1043 | 2935846412 | 2935837841 | Bacteria | 9454360 |
| 1044 | 2935852175 | 2935847175 | Bacteria | 8228321 |
| 1045 | 2935863236 | 2935855204 | Bacteria | 9035059 |
| 1046 | 2935868705 | 2935864058 | Bacteria | 9784707 |
| 1047 | 2935879479 | 2935873716 | Bacteria | 9632195 |
| 1048 | 2935916443 | 2935908558 | Bacteria | 8568796 |
| 1049 | 2935925439 | 2935916978 | Bacteria | 9113783 |
| 1050 | 2935933943 | 2935926038 | Bacteria | 8601059 |
| 1051 | 2935942466 | 2935934488 | Bacteria | 8602579 |
| 1052 | 2935950921 | 2935942939 | Bacteria | 8599779 |
| 1053 | 2935959382 | 2935951376 | Bacteria | 8602333 |
| 1054 | 2935965393 | 2935959822 | Bacteria | 7869783 |
| 1055 | 2935975449 | 2935967501 | Bacteria | 8603075 |
| 1056 | 2935980119 | 2935975950 | Bacteria | 8347125 |
| 1057 | 2935984283 | 2935984226 | Bacteria | 8302647 |
| 1058 | 2936000273 | 2935992306 | Bacteria | 9802711 |
| 1059 | 2936010315 | 2936002035 | Bacteria | 9362176 |
| 1060 | 2936018587 | 2936011229 | Bacteria | 8801034 |
| 1061 | 2936027105 | 2936019824 | Bacteria | 8804134 |
| 1062 | 2936035928 | 2936028420 | Bacteria | 8965941 |
| 1063 | 2936045935 | 2936037263 | Bacteria | 9446081 |
| 1064 | 2936054007 | 2936046547 | Bacteria | 8903709 |
| 1065 | 2936055363 | 2936055302 | Bacteria | 8785755 |
| 1066 | 2940563307 | 2940556831 | Bacteria | 9590747 |
| 1067 | 2941507254 | 2941507105 | Bacteria | 8166816 |
| 1068 | 2941515681 | 2941515067 | Bacteria | 8166720 |
| 1069 | 2941523611 | 2941523033 | Bacteria | 8169134 |
| 1070 | 2941531970 | 2941531003 | Bacteria | 7653939 |
| 1071 | 2941546840 | 2941538514 | Bacteria | 9402094 |
| 1072 | 3005485747 | 3005483717 | Bacteria | 7877331 |
| 1073 | 3005506606 | 3005506211 | Bacteria | 6943378 |
| 1074 | 3005588739 | 3005587118 | Bacteria | 7794411 |
| 1075 | 3005601757 | 3005594810 | Bacteria | 8716512 |
| 1076 | 3005717496 | 3005710791 | Bacteria | 7622528 |
| 1077 | 3005724433 | 3005718088 | Bacteria | 8283608 |
| 1078 | 8006933382 | 8006926726 | Bacteria | 6749210 |
| 1079 | 8006935102 | 8006933436 | Bacteria | 10410654 |
| 1080 | 8006965371 | 8006964411 | Bacteria | 8966052 |
| 1081 | 8006975070 | 8006973647 | Bacteria | 10679141 |
| 1082 | 8006986083 | 8006984368 | Bacteria | 9651211 |
| 1083 | 8006999243 | 8006994254 | Bacteria | 8309700 |
| 1084 | 8016519140 | 8016511872 | Bacteria | 9921665 |
| 1085 | 8016538754 | 8016530956 | Bacteria | 8155261 |
| 1086 | 8016543042 | 8016539877 | Bacteria | 8155419 |
| 1087 | 8016550251 | 8016548790 | Bacteria | 8155074 |
| 1088 | 8016558660 | 8016557553 | Bacteria | 8154380 |
| 1089 | 8016568446 | 8016566248 | Bacteria | 8158151 |
| 1090 | 8016581098 | 8016575299 | Bacteria | 8154085 |
| 1091 | 8016587617 | 8016583857 | Bacteria | 10421953 |
| 1092 | 8016596638 | 8016595262 | Bacteria | 8149947 |
| 1093 | 8016619305 | 8016613128 | Bacteria | 8794220 |
| 1094 | 8016630287 | 8016622563 | Bacteria | 7999408 |
| 1095 | 8016636860 | 8016630954 | Bacteria | 9217207 |
| 1096 | 8017066359 | 8017057580 | Bacteria | 10023680 |
| 1097 | 8019541398 | 8019538911 | Bacteria | 7872763 |
| 1098 | 8019573671 | 8019565922 | Bacteria | 9639779 |
| 1099 | 8019596292 | 8019586578 | Bacteria | 10212056 |
| 1100 | 8019605406 | 8019597564 | Bacteria | 10041141 |
| 1101 | 8019613134 | 8019608314 | Bacteria | 10042931 |
| 1102 | 8019623822 | 8019619141 | Bacteria | 9218857 |
| 1103 | 8019641420 | 8019638758 | Bacteria | 9062356 |
| 1104 | 8019666135 | 8019659431 | Bacteria | 8577854 |
| 1105 | 8019680453 | 8019678201 | Bacteria | 8863603 |
| 1106 | 8019695361 | 8019687851 | Bacteria | 8712826 |
| 1107 | 8055750480 | 8055742211 | Bacteria | 9226248 |
| 1108 | 8056678964 | 8056673599 | Bacteria | 7871253 |
| 1109 | 8056685531 | 8056681323 | Bacteria | 8472857 |
| 1110 | 8056692827 | 8056689827 | Bacteria | 6712655 |
| 1111 | 8056971783 | 8056967851 | Bacteria | 9038162 |
| 1112 | Ga0081540_1021473 | |||
| 1113 | JGI24735J21928_10024186 | |||
| 1114 | JGI25406J46586_10005201 | |||
| 1115 | JGI25153J46596_10005814 | |||
| 1116 | rootL2_10017863 | |||
| 1117 | rootH1_10149220 | |||
| 1118 | JGI25160J50197_1019598 | |||
| 1119 | JGI25160J50197_1019601 | |||
| 1120 | JGI25404J52841_10003242 | |||
| 1121 | JGI25404J52841_10007484 | |||
| 1122 | JGI25404J52841_10012840 | |||
| 1123 | Ga0055531_10006499 | |||
| 1124 | Ga0055531_10018955 | |||
| 1125 | Ga0065165_1001465 | |||
| 1126 | Ga0065165_1003494 | |||
| 1127 | Ga0065165_1007016 | |||
| 1128 | Ga0065165_1021815 | |||
| 1129 | Ga0068869_100121166 | |||
| 1130 | Ga0068869_100344888 | |||
| 1131 | Ga0070680_100003569 | |||
| 1132 | Ga0070680_100281547 | |||
| 1133 | Ga0070680_100415309 | |||
| 1134 | Ga0070682_100063668 | |||
| 1135 | Ga0070682_100400263 | |||
| 1136 | Ga0068868_100017752 | |||
| 1137 | Ga0068868_100145011 | |||
| 1138 | Ga0070660_100031186 | |||
| 1139 | Ga0070660_100068615 | |||
| 1140 | Ga0070660_100297090 | |||
| 1141 | Ga0070668_100047596 | |||
| 1142 | Ga0070668_100115123 | |||
| 1143 | Ga0070668_100254836 | |||
| 1144 | Ga0070673_100140477 | |||
| 1145 | Ga0070673_100220019 | |||
| 1146 | Ga0070673_100228968 | |||
| 1147 | Ga0070659_100198207 | |||
| 1148 | Ga0070659_100402578 | |||
| 1149 | Ga0070659_100608300 | |||
| 1150 | Ga0070667_100212524 | |||
| 1151 | Ga0070667_100420239 | |||
| 1152 | Ga0070709_10001461 | |||
| 1153 | Ga0070714_100003988 | |||
| 1154 | Ga0070713_100004627 | |||
| 1155 | Ga0070713_100324844 | |||
| 1156 | Ga0070713_100348944 | |||
| 1157 | Ga0070713_100659331 | |||
| 1158 | Ga0070710_10001981 | |||
| 1159 | Ga0070710_10003702 | |||
| 1160 | Ga0070710_10100719 | |||
| 1161 | Ga0070711_100010613 | |||
| 1162 | Ga0070711_100081392 | |||
| 1163 | Ga0070708_100672681 | |||
| 1164 | Ga0070663_100059739 | |||
| 1165 | Ga0070663_100077803 | |||
| 1166 | Ga0070663_100172651 | |||
| 1167 | Ga0070663_100199397 | |||
| 1168 | Ga0070663_100557482 | |||
| 1169 | Ga0070678_100005458 | |||
| 1170 | Ga0070678_100185492 | |||
| 1171 | Ga0070662_100076746 | |||
| 1172 | Ga0070662_100103839 | |||
| 1173 | Ga0070681_10015034 | |||
| 1174 | Ga0070706_100463842 | |||
| 1175 | Ga0070698_100133500 | |||
| 1176 | Ga0070679_100132475 | |||
| 1177 | Ga0070679_100433843 | |||
| 1178 | Ga0070684_100106220 | |||
| 1179 | Ga0070684_100473399 | |||
| 1180 | Ga0070697_100103553 | |||
| 1181 | Ga0068853_100019769 | |||
| 1182 | Ga0068853_100204925 | |||
| 1183 | Ga0068853_100371777 | |||
| 1184 | Ga0068853_100624733 | |||
| 1185 | Ga0070693_100101737 | |||
| 1186 | Ga0070665_100020723 | |||
| 1187 | Ga0070665_100070010 | |||
| 1188 | Ga0070665_100133651 | |||
| 1189 | Ga0070665_100155002 | |||
| 1190 | Ga0070665_100156385 | |||
| 1191 | Ga0070665_100241352 | |||
| 1192 | Ga0070665_100297112 | |||
| 1193 | Ga0070665_100665183 | |||
| 1194 | Ga0068855_100029909 | |||
| 1195 | Ga0068855_100051047 | |||
| 1196 | Ga0068855_100060591 | |||
| 1197 | Ga0068855_100110634 | |||
| 1198 | Ga0068855_100121318 | |||
| 1199 | Ga0068855_100483473 | |||
| 1200 | Ga0068855_100598929 | |||
| 1201 | Ga0068855_100625499 | |||
| 1202 | Ga0070664_100151355 | |||
| 1203 | Ga0070664_100223336 | |||
| 1204 | Ga0070664_100387422 | |||
| 1205 | Ga0068857_100005639 | |||
| 1206 | Ga0068857_100069443 | |||
| 1207 | Ga0068857_100101360 | |||
| 1208 | Ga0068857_100171744 | |||
| 1209 | Ga0068854_100005923 | |||
| 1210 | Ga0068854_100096642 | |||
| 1211 | Ga0068854_100102096 | |||
| 1212 | Ga0068856_100000476 | |||
| 1213 | Ga0068856_100093882 | |||
| 1214 | Ga0068856_100162354 | |||
| 1215 | Ga0068856_100202844 | |||
| 1216 | Ga0068856_100234557 | |||
| 1217 | Ga0068856_100285932 | |||
| 1218 | Ga0068852_100180576 | |||
| 1219 | Ga0068852_100453482 | |||
| 1220 | Ga0068859_100172189 | |||
| 1221 | Ga0068859_100606990 | |||
| 1222 | Ga0068864_100064794 | |||
| 1223 | Ga0068864_100433369 | |||
| 1224 | Ga0068861_100428100 | |||
| 1225 | Ga0068851_10003823 | |||
| 1226 | Ga0068851_10020573 | |||
| 1227 | Ga0068851_10070129 | |||
| 1228 | Ga0068851_10100743 | |||
| 1229 | Ga0068870_10086555 | |||
| 1230 | Ga0068870_10100319 | |||
| 1231 | Ga0068863_100159012 | |||
| 1232 | Ga0068863_100285090 | |||
| 1233 | Ga0068858_100078638 | |||
| 1234 | Ga0068858_100496633 | |||
| 1235 | Ga0068862_100076660 | |||
| 1236 | Ga0068862_100508564 | |||
| 1237 | Ga0081455_10011371 | |||
| 1238 | Ga0081455_10076987 | |||
| 1239 | Ga0081455_10111202 | |||
| 1240 | Ga0081540_1004386 | |||
| 1241 | Ga0081540_1005329 | |||
| 1242 | Ga0081540_1007078 | |||
| 1243 | Ga0081540_1007475 | |||
| 1244 | Ga0081540_1013507 | |||
| 1245 | Ga0081540_1016353 | |||
| 1246 | Ga0081540_1018434 | |||
| 1247 | Ga0081540_1048885 | |||
| 1248 | Ga0081540_1053054 | |||
| 1249 | Ga0081540_1111692 | |||
| 1250 | Ga0081539_10001098 | |||
| 1251 | Ga0070717_10001915 | |||
| 1252 | Ga0070717_10009625 | |||
| 1253 | Ga0070717_10034975 | |||
| 1254 | Ga0070717_10101140 | |||
| 1255 | Ga0070717_10240349 | |||
| 1256 | Ga0075365_10037480 | |||
| 1257 | Ga0075365_10137418 | |||
| 1258 | Ga0075365_10300178 | |||
| 1259 | Ga0075365_10309879 | |||
| 1260 | Ga0075363_100000795 | |||
| 1261 | Ga0075364_10060459 | |||
| 1262 | Ga0075364_10198710 | |||
| 1263 | Ga0070715_10003656 | |||
| 1264 | Ga0070716_100009999 | |||
| 1265 | Ga0070716_100017312 | |||
| 1266 | Ga0070716_100194790 | |||
| 1267 | Ga0075367_10086232 | |||
| 1268 | Ga0075367_10115869 | |||
| 1269 | Ga0075369_10023467 | |||
| 1270 | Ga0075369_10028142 | |||
| 1271 | Ga0075369_10032740 | |||
| 1272 | Ga0075369_10124553 | |||
| 1273 | Ga0075366_10090110 | |||
| 1274 | Ga0075366_10152688 | |||
| 1275 | Ga0075366_10171511 | |||
| 1276 | Ga0097621_100034637 | |||
| 1277 | Ga0097621_100109329 | |||
| 1278 | Ga0097621_100304885 | |||
| 1279 | Ga0075370_10178773 | |||
| 1280 | Ga0068871_100044285 | |||
| 1281 | Ga0068865_100167092 | |||
| 1282 | Ga0097620_100172180 | |||
| 1283 | Ga0097620_100416370 | |||
| 1284 | Ga0097620_100606905 | |||
| 1285 | Ga0099824_1007622 | |||
| 1286 | Ga0099824_1030093 | |||
| 1287 | Ga0099822_1024573 | |||
| 1288 | Ga0099823_1025861 | |||
| 1289 | Ga0099794_10004947 | |||
| 1290 | Ga0099794_10035717 | |||
| 1291 | Ga0099794_10199251 | |||
| 1292 | Ga0099795_10045988 | |||
| 1293 | Ga0105240_10013609 | |||
| 1294 | Ga0105240_10128230 | |||
| 1295 | Ga0105240_10217619 | |||
| 1296 | Ga0105240_11035930 | |||
| 1297 | Ga0111539_10268381 | |||
| 1298 | Ga0105245_10030466 | |||
| 1299 | Ga0105245_10339887 | |||
| 1300 | Ga0114129_10043623 | |||
| 1301 | Ga0105243_10179770 | |||
| 1302 | Ga0105243_10335919 | |||
| 1303 | Ga0105241_10043812 | |||
| 1304 | Ga0105241_10060066 | |||
| 1305 | Ga0105241_10112909 | |||
| 1306 | Ga0105241_10252735 | |||
| 1307 | Ga0105241_10262108 | |||
| 1308 | Ga0105248_10545891 | |||
| 1309 | Ga0105237_10009561 | |||
| 1310 | Ga0105237_10045175 | |||
| 1311 | Ga0105237_10048901 | |||
| 1312 | Ga0105237_10061469 | |||
| 1313 | Ga0105237_10103750 | |||
| 1314 | Ga0105237_10186478 | |||
| 1315 | Ga0105237_10243637 | |||
| 1316 | Ga0105237_10579715 | |||
| 1317 | Ga0105238_10157658 | |||
| 1318 | Ga0105238_10194558 | |||
| 1319 | Ga0105238_10262622 | |||
| 1320 | Ga0105249_10798089 | |||
| 1321 | Ga0105239_10013308 | |||
| 1322 | Ga0105239_10128536 | |||
| 1323 | Ga0105239_10128753 | |||
| 1324 | Ga0105239_10199213 | |||
| 1325 | Ga0105239_10393280 | |||
| 1326 | Ga0105239_10426864 | |||
| 1327 | Ga0105239_10492456 | |||
| 1328 | Ga0105246_10019037 | |||
| 1329 | Ga0105246_10024007 | |||
| 1330 | Ga0105246_10187269 | |||
| 1331 | Ga0157370_10079869 | |||
| 1332 | Ga0157370_10193297 | |||
| 1333 | Ga0157369_10012327 | |||
| 1334 | Ga0157369_10490429 | |||
| 1335 | Ga0157374_10155057 | |||
| 1336 | Ga0157374_10447706 | |||
| 1337 | Ga0157378_10006449 | |||
| 1338 | Ga0157378_10243912 | |||
| 1339 | Ga0163162_10186346 | |||
| 1340 | Ga0163162_10267283 | |||
| 1341 | Ga0163162_10291181 | |||
| 1342 | Ga0163162_10743548 | |||
| 1343 | Ga0157372_10096808 | |||
| 1344 | Ga0157372_10444064 | |||
| 1345 | Ga0157375_10018315 | |||
| 1346 | Ga0157375_10133453 | |||
| 1347 | Ga0157375_10286649 | |||
| 1348 | Ga0157375_10583229 | |||
| 1349 | Ga0163163_10044739 | |||
| 1350 | Ga0163163_10066420 | |||
| 1351 | Ga0163163_10073045 | |||
| 1352 | Ga0163163_10879805 | |||
| 1353 | Ga0157380_10090556 | |||
| 1354 | Ga0157377_10159835 | |||
| 1355 | Ga0157379_10067447 | |||
| 1356 | Ga0157379_10321013 | |||
| 1357 | Ga0157379_10490667 | |||
| 1358 | Ga0157379_10717134 | |||
| 1359 | Ga0157376_10031939 | |||
| 1360 | Ga0157376_10134588 | |||
| 1361 | Ga0157376_10455346 | |||
| 1362 | Ga0163161_10401145 | |||
| 1363 | Ga0214542_1000003 | |||
| 1364 | Ga0214545_1000004 | |||
| 1365 | Ga0214543_1009591 | |||
| 1366 | Ga0213873_10004591 | |||
| 1367 | Ga0213872_10094460 | |||
| 1368 | Ga0213876_10001391 | |||
| 1369 | Ga0213871_10000490 | |||
| 1370 | Ga0209148_1000490 | |||
| 1371 | Ga0209233_1010343 | |||
| 1372 | Ga0209233_1019818 | |||
| 1373 | Ga0209233_1030468 | |||
| 1374 | Ga0209455_1004977 | |||
| 1375 | Ga0209564_1027292 | |||
| 1376 | Ga0209758_1000106 | |||
| 1377 | Ga0209758_1000982 | |||
| 1378 | Ga0209758_1002038 | |||
| 1379 | Ga0209758_1003538 | |||
| 1380 | Ga0209758_1010528 | |||
| 1381 | Ga0209758_1025853 | |||
| 1382 | Ga0209050_1029906 | |||
| 1383 | Ga0209256_1007012 | |||
| 1384 | Ga0209256_1018839 | |||
| 1385 | Ga0207426_1000337 | |||
| 1386 | Ga0207426_1001470 | |||
| 1387 | Ga0207426_1042794 | |||
| 1388 | Ga0207426_1064572 | |||
| 1389 | Ga0209257_1000348 | |||
| 1390 | Ga0209257_1001773 | |||
| 1391 | Ga0209257_1010363 | |||
| 1392 | Ga0209257_1038474 | |||
| 1393 | Ga0207656_10032711 | |||
| 1394 | Ga0207692_10002972 | |||
| 1395 | Ga0207692_10030002 | |||
| 1396 | Ga0207642_10089793 | |||
| 1397 | Ga0207647_10000908 | |||
| 1398 | Ga0207647_10076385 | |||
| 1399 | Ga0207699_10004093 | |||
| 1400 | Ga0207699_10176623 | |||
| 1401 | Ga0207643_10130130 | |||
| 1402 | Ga0207705_10242644 | |||
| 1403 | Ga0207654_10004509 | |||
| 1404 | Ga0207654_10019456 | |||
| 1405 | Ga0207654_10156768 | |||
| 1406 | Ga0207707_10002162 | |||
| 1407 | Ga0207707_10005294 | |||
| 1408 | Ga0207707_10201928 | |||
| 1409 | Ga0207695_10001591 | |||
| 1410 | Ga0207695_10017338 | |||
| 1411 | Ga0207671_10018136 | |||
| 1412 | Ga0207671_10031051 | |||
| 1413 | Ga0207671_10060866 | |||
| 1414 | Ga0207671_10077354 | |||
| 1415 | Ga0207671_10078410 | |||
| 1416 | Ga0207671_10103392 | |||
| 1417 | Ga0207671_10391024 | |||
| 1418 | Ga0207693_10009468 | |||
| 1419 | Ga0207693_10009993 | |||
| 1420 | Ga0207693_10208668 | |||
| 1421 | Ga0207660_10030146 | |||
| 1422 | Ga0207660_10185538 | |||
| 1423 | Ga0207657_10167068 | |||
| 1424 | Ga0207657_10196225 | |||
| 1425 | Ga0207657_10554633 | |||
| 1426 | Ga0207649_10119309 | |||
| 1427 | Ga0207652_10106404 | |||
| 1428 | Ga0207652_10140411 | |||
| 1429 | Ga0207694_10022056 | |||
| 1430 | Ga0207694_10031537 | |||
| 1431 | Ga0207694_10048565 | |||
| 1432 | Ga0207694_10097786 | |||
| 1433 | Ga0207694_10119947 | |||
| 1434 | Ga0207650_10244482 | |||
| 1435 | Ga0207687_10013836 | |||
| 1436 | Ga0207687_10131919 | |||
| 1437 | Ga0207700_10008050 | |||
| 1438 | Ga0207700_10057211 | |||
| 1439 | Ga0207700_10162873 | |||
| 1440 | Ga0207700_10294456 | |||
| 1441 | Ga0207700_10588770 | |||
| 1442 | Ga0207664_10010392 | |||
| 1443 | Ga0207664_10079512 | |||
| 1444 | Ga0207690_10039021 | |||
| 1445 | Ga0207706_10034466 | |||
| 1446 | Ga0207706_10123613 | |||
| 1447 | Ga0207709_10085086 | |||
| 1448 | Ga0207709_10116401 | |||
| 1449 | Ga0207669_10135393 | |||
| 1450 | Ga0207704_10125140 | |||
| 1451 | Ga0207665_10006342 | |||
| 1452 | Ga0207691_10216166 | |||
| 1453 | Ga0207691_10367613 | |||
| 1454 | Ga0207689_10081964 | |||
| 1455 | Ga0207689_10122888 | |||
| 1456 | Ga0207689_10456766 | |||
| 1457 | Ga0207661_10094227 | |||
| 1458 | Ga0207679_10127513 | |||
| 1459 | Ga0207667_10029690 | |||
| 1460 | Ga0207667_10044947 | |||
| 1461 | Ga0207667_10098667 | |||
| 1462 | Ga0207667_10411218 | |||
| 1463 | Ga0207651_10153326 | |||
| 1464 | Ga0207712_10042423 | |||
| 1465 | Ga0207712_10072956 | |||
| 1466 | Ga0207668_10100984 | |||
| 1467 | Ga0207640_10016570 | |||
| 1468 | Ga0207640_10083922 | |||
| 1469 | Ga0207640_10266517 | |||
| 1470 | Ga0207677_10012673 | |||
| 1471 | Ga0207677_10067541 | |||
| 1472 | Ga0207677_10184163 | |||
| 1473 | Ga0207703_10022563 | |||
| 1474 | Ga0207703_10095909 | |||
| 1475 | Ga0207703_10210388 | |||
| 1476 | Ga0207639_10388199 | |||
| 1477 | Ga0207639_10537754 | |||
| 1478 | Ga0207678_10045772 | |||
| 1479 | Ga0207678_10050255 | |||
| 1480 | Ga0207678_10053837 | |||
| 1481 | Ga0207678_10070679 | |||
| 1482 | Ga0207702_10000003 | |||
| 1483 | Ga0207702_10000514 | |||
| 1484 | Ga0207641_10256946 | |||
| 1485 | Ga0207641_10406020 | |||
| 1486 | Ga0207648_10049340 | |||
| 1487 | Ga0207648_10064924 | |||
| 1488 | Ga0207676_10019625 | |||
| 1489 | Ga0207676_10150888 | |||
| 1490 | Ga0207674_10048184 | |||
| 1491 | Ga0207674_10096974 | |||
| 1492 | Ga0207674_10188004 | |||
| 1493 | Ga0207674_10234568 | |||
| 1494 | Ga0207674_10504816 | |||
| 1495 | Ga0207675_100064906 | |||
| 1496 | Ga0207675_100070222 | |||
| 1497 | Ga0207675_100149277 | |||
| 1498 | Ga0207675_100344132 | |||
| 1499 | Ga0207683_10019949 | |||
| 1500 | Ga0207698_10057798 | |||
| 1501 | Ga0207698_10389198 | |||
| 1502 | Ga0207698_10480663 | |||
| 1503 | Ga0209389_1000016 | |||
| 1504 | Ga0209389_1000027 | |||
| 1505 | Ga0209589_1000005 | |||
| 1506 | Ga0209589_1013736 | |||
| 1507 | Ga0209489_100005 | |||
| 1508 | Ga0209489_102237 | |||
| 1509 | Ga0209489_110753 | |||
| 1510 | Ga0209700_100006 | |||
| 1511 | Ga0209700_100012 | |||
| 1512 | Ga0209179_1000570 | |||
| 1513 | Ga0209813_10052679 | |||
| 1514 | Ga0268266_10005838 | |||
| 1515 | Ga0268266_10051358 | |||
| 1516 | Ga0268266_10071200 | |||
| 1517 | Ga0268266_10192118 | |||
| 1518 | Ga0268266_10241188 | |||
| 1519 | Ga0268266_10389125 | |||
| 1520 | Ga0268266_10461065 | |||
| 1521 | Ga0268266_10517614 | |||
| 1522 | Ga0268265_10373474 | |||
| 1523 | Ga0268265_10581463 | |||
| 1524 | Ga0268264_10131146 | |||
| 1525 | Ga0268264_10351696 | |||
| 1526 | Ga0268264_10406861 | |||
| 1527 | Ga0268264_10508567 | |||
| 1528 | Ga0265334_10016514 | |||
| 1529 | Ga0307517_10018365 | |||
| 1530 | Ga0307515_10278812 | |||
| 1531 | Ga0307511_10029041 | |||
| 1532 | Ga0307511_10084295 | |||
| 1533 | Ga0265330_10013428 | |||
| 1534 | Ga0265330_10021180 | |||
| 1535 | Ga0265330_10026032 | |||
| 1536 | Ga0265332_10008158 | |||
| 1537 | Ga0265332_10028166 | |||
| 1538 | Ga0265332_10069519 | |||
| 1539 | Ga0265328_10029632 | |||
| 1540 | Ga0265328_10094481 | |||
| 1541 | Ga0265325_10023540 | |||
| 1542 | Ga0265340_10018482 | |||
| 1543 | Ga0265339_10018617 | |||
| 1544 | Ga0265331_10021097 | |||
| 1545 | Ga0265316_10028897 | |||
| 1546 | Ga0307509_10004649 | |||
| 1547 | Ga0307509_10012663 | |||
| 1548 | Ga0307509_10175879 | |||
| 1549 | Ga0265313_10043303 | |||
| 1550 | Ga0307508_10003178 | |||
| 1551 | Ga0307508_10045726 | |||
| 1552 | Ga0265314_10113147 | |||
| 1553 | Ga0307516_10072595 | |||
| 1554 | Ga0307516_10106814 | |||
| 1555 | Ga0307516_10207372 | |||
| 1556 | Ga0307406_10341044 | |||
| 1557 | Ga0307412_10396788 | |||
| 1558 | Ga0307409_100422305 | |||
| 1559 | Ga0307510_10005379 | |||
| 1560 | Ga0307510_10083698 | |||
| 1561 | Ga0373934_0059952 | |||
| 1562 | Ga0373951_0050524 | |||
| 1563 | Ga0373923_0058208 | |||
| 1564 | Ga0373923_0166737 | |||
| 1565 | Ga0373936_0025118 | |||
| 1566 | Ga0373945_0007763 | |||
| 1567 | Ga0373953_0026940 | |||
| 1568 | Ga0373954_0003254 | |||
| 1569 | Ga0373956_0004124 | |||
| 1570 | Ga0373957_0017874 | |||
| 1571 | Ga0373957_0177653 | |||
| 1572 | Ga0373943_0102189 | |||
| 1573 | Ga0373955_0128359 | |||
| 1574 | Ga0373955_0264780 | |||
| 1575 | Ga0373924_0080488 | |||
| 1576 | Ga0373924_0088153 | |||
| 1577 | Ga0373931_0075136 | |||
| 1578 | Ga0373931_0080264 | |||
| 1579 | Ga0373935_0012074 | |||
| 1580 | Ga0373935_0242112 | |||
| 1581 | Ga0373935_0360795 | |||
| 1582 | Ga0373935_0449956 | |||
| 1583 | Ga0373927_0012034 | |||
| 1584 | Ga0373927_0033415 | |||
| 1585 | Ga0373927_0476852 | |||
| 1586 | Ga0373933_0000784 | |||
| 1587 | Ga0373933_0009468 | |||
| 1588 | Ga0373933_0080016 | |||
| 1589 | Ga0373947_0027815 | |||
| 1590 | Ga0373937_0026313 | |||
| 1591 | Ga0373937_0206960 | |||
| 1592 | Ga0373937_0519020 | |||
| 1593 | Ga0373937_0538195 | |||
| 1594 | Ga0372808_011667 | |||
| 1595 | Ga0373925_0062447 | |||
| 1596 | Ga0373925_0361964 | |||
| 1597 | Ga0395899_0144236 | |||
| 1598 | Ga0395900_0016672 | |||
| 1599 | Ga0395900_0164314 | |||
| 1600 | Ga0395900_0620377 | |||
| 1601 | Ga0395898_0104561 | |||
| 1602 | Ga0395905_0096770 | |||
| 1603 | Ga0395905_0202187 | |||
| 1604 | Ga0395905_0372345 | |||
| 1605 | Ga0395901_0019475 | |||
| 1606 | Ga0395901_0872784 | |||
| 1607 | Ga0436365_0328255 | |||
| 1608 | Ga0436365_1493072 | |||
| 1609 | Ga0436360_1256499 | |||
| 1610 | Ga0436361_0385472 | |||
| 1611 | Ga0436361_0964292 | |||
| 1612 | Ga0436362_0953067 | |||
| 1613 | Ga0439465_0020470 | |||
| 1614 | Ga0451789_0661496 | |||
| 1615 | Ga0439455_0015584 | |||
| 1616 | Ga0466969_0070134 | |||
| 1617 | Ga0466969_0162768 | |||
| 1618 | Ga0466972_0000449 | |||
| 1619 | Ga0466972_0072783 | |||
| 1620 | Ga0466965_0109412 | |||
| 1621 | Ga0466966_0000455 | |||
| 1622 | Ga0466961_0000603 | |||
| 1623 | Ga0466963_0066822 | |||
| 1624 | Ga0466963_0236276 | |||
| 1625 | Ga0466964_0129046 | |||
| 1626 | Ga0466968_0012673 | |||
| 1627 | Ga0466968_0084211 | |||
| 1628 | Ga0466970_0030813 | |||
| 1629 | Ga0466970_0065716 | |||
| 1630 | Ga0466970_0222753 | |||
| 1631 | Ga0466960_0014996 | |||
| 1632 | Ga0466960_0091010 | |||
| 1633 | Ga0466959_0051667 | |||
| 1634 | Ga0466959_0142548 | |||
| 1635 | Ga0466958_0253883 | |||
| 1636 | Ga0495592_0030678 | |||
| 1637 | Ga0495592_0035165 | |||
| 1638 | Ga0495603_0005606 | |||
| 1639 | Ga0495603_0126526 | |||
| 1640 | Ga0495590_0090407 | |||
| 1641 | Ga0495629_0002984 | |||
| 1642 | Ga0495629_0134775 | |||
| 1643 | Ga0495629_0145729 | |||
| 1644 | Ga0495638_0005250 | |||
| 1645 | Ga0495638_0198660 | |||
| 1646 | Ga0495641_0018784 | |||
| 1647 | Ga0495651_0050286 | |||
| 1648 | Ga0495651_0061975 | |||
| 1649 | Ga0495651_0123223 | |||
| 1650 | Ga0495651_0245177 | |||
| 1651 | Ga0495653_0023442 | |||
| 1652 | Ga0495653_0077004 | |||
| 1653 | Ga0495650_0043671 | |||
| 1654 | Ga0495650_0106592 | |||
| 1655 | Ga0495582_0111674 | |||
| 1656 | Ga0495639_0007837 | |||
| 1657 | Ga0495664_0169530 | |||
| 1658 | Ga0495585_0045665 | |||
| 1659 | Ga0495594_0020690 | |||
| 1660 | Ga0495594_0311417 | |||
| 1661 | Ga0495596_0022344 | |||
| 1662 | Ga0495596_0111725 | |||
| 1663 | Ga0495606_0066222 | |||
| 1664 | Ga0495608_0023069 | |||
| 1665 | Ga0495608_0113898 | |||
| 1666 | Ga0495618_0157659 | |||
| 1667 | Ga0495618_0167097 | |||
| 1668 | Ga0495628_0018851 | |||
| 1669 | Ga0495628_0076373 | |||
| 1670 | Ga0495628_0136147 | |||
| 1671 | Ga0495630_0059721 | |||
| 1672 | Ga0495630_0514848 | |||
| 1673 | Ga0495632_0035870 | |||
| 1674 | Ga0495643_0172918 | |||
| 1675 | Ga0495644_0051474 | |||
| 1676 | Ga0495644_0060952 | |||
| 1677 | Ga0495648_0012715 | |||
| 1678 | Ga0495648_0118314 | |||
| 1679 | Ga0495666_0098329 | |||
| 1680 | Ga0495652_0078081 | |||
| 1681 | Ga0495652_0101934 | |||
| 1682 | Ga0495652_0122685 | |||
| 1683 | Ga0495640_0043124 | |||
| 1684 | Ga0495640_0045764 | |||
| 1685 | Ga0495640_0160091 | |||
| 1686 | Ga0495587_0015723 | |||
| 1687 | Ga0495587_0033800 | |||
| 1688 | Ga0495609_0099114 | |||
| 1689 | Ga0495621_0060160 | |||
| 1690 | Ga0495645_0088815 | |||
| 1691 | Ga0495622_0015653 | |||
| 1692 | Ga0495622_0016701 | |||
| 1693 | Ga0495622_0035408 | |||
| 1694 | Ga0495622_0036243 | |||
| 1695 | Ga0495667_0030518 | |||
| 1696 | Ga0495667_0035702 | |||
| 1697 | Ga0495667_0139165 | |||
| 1698 | Ga0495656_0001017 | |||
| 1699 | Ga0495668_0052216 | |||
| 1700 | Ga0495634_0005863 | |||
| 1701 | Ga0495634_0033851 | |||
| 1702 | Ga0495634_0038694 | |||
| 1703 | Ga0495611_0040347 | |||
| 1704 | Ga0495625_0082968 | |||
| 1705 | Ga0495635_0002996 | |||
| 1706 | Ga0495635_0024568 | |||
| 1707 | Ga0495635_0041945 | |||
| 1708 | Ga0495635_0058430 | |||
| 1709 | Ga0495659_0008839 | |||
| 1710 | Ga0495661_0164586 | |||
| 1711 | Ga0495588_0002975 | |||
| 1712 | Ga0495588_0136041 | |||
| 1713 | Ga0495657_0025879 | |||
| 1714 | Ga0495657_0033612 | |||
| 1715 | Ga0495657_0086881 | |||
| 1716 | Ga0495599_0018837 | |||
| 1717 | Ga0495599_0032531 | |||
| 1718 | Ga0495623_0005568 | |||
| 1719 | Ga0495623_0006324 | |||
| 1720 | Ga0495646_0033218 | |||
| 1721 | Ga0495646_0046764 | |||
| 1722 | Ga0495647_0013604 | |||
| 1723 | Ga0495658_0182753 | |||
| 1724 | Ga0495658_0325741 | |||
| 1725 | Ga0495658_0367751 | |||
| 1726 | Ga0495669_0006974 | |||
| 1727 | Ga0495669_0049594 | |||
| 1728 | Ga0495669_0072437 | |||
| 1729 | Ga0495613_0043701 | |||
| 1730 | Ga0495613_0044858 | |||
| 1731 | Ga0495624_0025788 | |||
| 1732 | Ga0495670_0077455 | |||
| 1733 | Ga0495671_0070273 | |||
| 1734 | Ga0495671_0125644 | |||
| 1735 | Ga0495671_0139991 | |||
| 1736 | Ga0495649_0233896 | |||
| 1737 | Ga0495589_0148222 | |||
| 1738 | Ga0495589_0160790 | |||
| 1739 | Ga0495600_0004662 | |||
| 1740 | Ga0495600_0035570 | |||
| 1741 | Ga0495600_0056757 | |||
| 1742 | Ga0495581_0039231 | |||
| 1743 | Ga0495604_0007789 | |||
| 1744 | Ga0495604_0018421 | |||
| 1745 | Ga0495604_0077985 | |||
| 1746 | Ga0495604_0366374 | |||
| 1747 | Ga0495674_0066189 | |||
| 1748 | Ga0495674_0087507 | |||
| 1749 | Ga0495674_0119336 | |||
| 1750 | Ga0495674_0123414 | |||
| 1751 | Ga0495676_0048116 | |||
| 1752 | Ga0495676_0050003 | |||
| 1753 | Ga0495676_0191337 | |||
| 1754 | Ga0495680_0035746 | |||
| 1755 | Ga0495683_0060361 | |||
| 1756 | Ga0495683_0186214 | |||
| 1757 | Ga0495687_046799 | |||
| 1758 | Ga0495675_0037487 | |||
| 1759 | Ga0495673_0089210 | |||
| 1760 | Ga0495684_0019268 | |||
| 1761 | Ga0495684_0087037 | |||
| 1762 | Ga0495686_0057913 | |||
| 1763 | Ga0495593_0032879 | |||
| 1764 | Ga0495593_0071237 | |||
| 1765 | Ga0495602_0013480 | |||
| 1766 | Ga0495602_0061833 | |||
| 1767 | Ga0495602_0075890 | |||
| 1768 | Ga0495602_0316208 | |||
| 1769 | Ga0495614_0112115 | |||
| 1770 | Ga0496100_0004243 | |||
| 1771 | Ga0496100_0522017 | |||
| 1772 | Ga0496101_0013036 | |||
| 1773 | Ga0496102_0002815 | |||
| 1774 | Ga0496102_0077227 | |||
| 1775 | Ga0496102_0084967 | |||
| 1776 | Ga0496102_0095338 | |||
| 1777 | Ga0496103_0030000 | |||
| 1778 | Ga0496104_0006611 | |||
| 1779 | Ga0496104_0024816 | |||
| 1780 | Ga0496104_0033645 | |||
| 1781 | Ga0496105_0009154 | |||
| 1782 | Ga0496105_0032947 | |||
| 1783 | Ga0496105_0107061 | |||
| 1784 | Ga0496105_0220523 | |||
| 1785 | Ga0496105_0228544 | |||
| 1786 | Ga0496106_0005419 | |||
| 1787 | Ga0496106_0042125 | |||
| 1788 | Ga0496106_0057561 | |||
| 1789 | Ga0496106_0330762 | |||
| 1790 | Ga0496107_0014935 | |||
| 1791 | Ga0496107_0127578 | |||
| 1792 | Ga0496108_0046662 | |||
| 1793 | Ga0496108_0052073 | |||
| 1794 | Ga0496109_0021949 | |||
| 1795 | Ga0496109_0035699 | |||
| 1796 | Ga0496109_0231547 | |||
| 1797 | Ga0496109_0426575 | |||
| 1798 | Ga0496110_0023683 | |||
| 1799 | Ga0496110_0275222 | |||
| 1800 | Ga0496110_0307890 | |||
| 1801 | Ga0496111_0138209 | |||
| 1802 | Ga0496111_0275631 | |||
| 1803 | Ga0496112_0111037 | |||
| 1804 | Ga0496112_0119972 | |||
| 1805 | Ga0496112_0241122 | |||
| 1806 | Ga0496112_0733093 | |||
| 1807 | Ga0496113_0024350 | |||
| 1808 | Ga0496113_0035208 | |||
| 1809 | Ga0496113_0157985 | |||
| 1810 | Ga0496114_0102760 | |||
| 1811 | Ga0496114_0165612 | |||
| 1812 | Ga0496114_0604349 | |||
| 1813 | Ga0496115_0009460 | |||
| 1814 | Ga0496115_0013575 | |||
| 1815 | Ga0496115_0279250 | |||
| 1816 | Ga0496115_0327366 | |||
| 1817 | Ga0496115_0395224 | |||
| 1818 | Ga0496115_0453047 | |||
| 1819 | Ga0496117_0039426 | |||
| 1820 | Ga0496119_0032422 | |||
| 1821 | Ga0496119_0065095 | |||
| 1822 | Ga0496119_0108621 | |||
| 1823 | Ga0496120_0011992 | |||
| 1824 | Ga0496121_0000146 | |||
| 1825 | Ga0496121_0002453 | |||
| 1826 | Ga0496121_0003864 | |||
| 1827 | Ga0496121_0003891 | |||
| 1828 | Ga0496121_0042243 | |||
| 1829 | Ga0496121_0180611 | |||
| 1830 | Ga0496121_0180804 | |||
| 1831 | Ga0496121_0186048 | |||
| 1832 | Ga0496121_0207091 | |||
| 1833 | Ga0496121_0242884 | |||
| 1834 | Ga0496121_0277988 | |||
| 1835 | Ga0496122_0011039 | |||
| 1836 | Ga0496122_0027250 | |||
| 1837 | Ga0496122_0124478 | |||
| 1838 | Ga0496123_0007911 | |||
| 1839 | Ga0496124_0001997 | |||
| 1840 | Ga0496124_0160713 | |||
| 1841 | Ga0496125_0034974 | |||
| 1842 | Ga0496125_0035461 | |||
| 1843 | Ga0496126_0006544 | |||
| 1844 | Ga0496126_0010063 | |||
| 1845 | Ga0496126_0017240 | |||
| 1846 | Ga0496126_0035606 | |||
| 1847 | Ga0496126_0056121 | |||
| 1848 | Ga0496126_0095415 | |||
| 1849 | Ga0496126_0123694 | |||
| 1850 | Ga0496126_0124200 | |||
| 1851 | Ga0496126_0141204 | |||
| 1852 | Ga0495682_0026585 | |||
| 1853 | Ga0501031_0066881 | |||
| 1854 | Ga0501032_0000196 | |||
| 1855 | Ga0501033_0003209 | |||
| 1856 | Ga0501034_0001151 | |||
| 1857 | Ga0501036_0000323 | |||
| 1858 | Ga0501037_0001377 | |||
| 1859 | Ga0501038_0001622 | |||
| 1860 | Ga0501039_0001302 | |||
| 1861 | Ga0501042_0046374 | |||
| 1862 | Ga0501043_0000409 | |||
| 1863 | Ga0501046_0000181 | |||
| 1864 | Ga0501047_0002426 | |||
| 1865 | Ga0501047_0062965 | |||
| 1866 | Ga0501047_0600438 | |||
| 1867 | Ga0501048_0003595 | |||
| 1868 | Ga0501067_0000145 | |||
| 1869 | Ga0501068_0002577 | |||
| 1870 | Ga0501069_0071630 | |||
| 1871 | Ga0501070_0003510 | |||
| 1872 | Ga0501070_0052660 | |||
| 1873 | Ga0501072_0017020 | |||
| 1874 | Ga0501072_0265402 | |||
| 1875 | Ga0501073_0000027 | |||
| 1876 | Ga0501073_0039562 | |||
| 1877 | Ga0501074_0001347 | |||
| 1878 | Ga0501074_0146411 | |||
| 1879 | Ga0501079_0048138 | |||
| 1880 | Ga0501080_0002621 | |||
| 1881 | Ga0501080_0052129 | |||
| 1882 | Ga0501083_0002123 | |||
| 1883 | Ga0501035_0001852 | |||
| 1884 | Ga0501035_0310990 | |||
| 1885 | Ga0501044_0003498 | |||
| 1886 | Ga0501044_0722639 | |||
| 1887 | nmdc:mga03683_46899_c1 | |||
| 1888 | nmdc:mga03n38_98_c1 | |||
| 1889 | nmdc:mga00v17_121059_c1 | |||
| 1890 | nmdc:mga00v17_32131_c1 | |||
| 1891 | nmdc:mga00v17_58540_c1 | |||
| 1892 | nmdc:mga0yw44_118730_c1 | |||
| 1893 | nmdc:mga0yw44_12674_c1 | |||
| 1894 | nmdc:mga0yw44_160309_c1 | |||
| 1895 | nmdc:mga0yw44_161818_c1 | |||
| 1896 | nmdc:mga0yw44_191706_c1 | |||
| 1897 | nmdc:mga0yw44_197218_c1 | |||
| 1898 | nmdc:mga0yw44_6672_c1 | |||
| 1899 | nmdc:mga0k408_100725_c1 | |||
| 1900 | nmdc:mga0k408_203983_c1 | |||
| 1901 | nmdc:mga0k408_67583_c1 | |||
| 1902 | nmdc:mga06z11_137921_c1 | |||
| 1903 | nmdc:mga06z11_179874_c1 | |||
| 1904 | nmdc:mga06z11_45740_c1 | |||
| 1905 | nmdc:mga04h51_18851_c1 | |||
| 1906 | nmdc:mga04h51_42826_c1 | |||
| 1907 | nmdc:mga07m45_110601_c1 | |||
| 1908 | nmdc:mga07m45_41962_c1 | |||
| 1909 | nmdc:mga07m45_87961_c1 | |||
| 1910 | nmdc:mga09592_277164_c1 | |||
| 1911 | nmdc:mga0n895_179818_c1 | |||
| 1912 | nmdc:mga0n895_262239_c1 | |||
| 1913 | nmdc:mga0sz30_11679_c1 | |||
| 1914 | nmdc:mga0sz30_175701_c1 | |||
| 1915 | nmdc:mga0sz30_60927_c1 | |||
| 1916 | Ga0495601_0023042 | |||
| 1917 | Ga0495601_0045290 | |||
| 1918 | Ga0495601_0209366 | |||
| 1919 | Ga0500635_0003192 | |||
| 1920 | Ga0500635_0141457 | |||
| 1921 | Ga0495655_0031289 | |||
| 1922 | Ga0495595_0058978 | |||
| 1923 | Ga0495595_0153870 | |||
| 1924 | Ga0495619_0052867 | |||
| 1925 | Ga0500643_000052 | |||
| 1926 | Ga0500647_0036476 | |||
| 1927 | Ga0500647_0063760 | |||
| 1928 | Ga0500647_0092965 | |||
| 1929 | Ga0500583_0138135 | |||
| 1930 | Ga0500583_0189653 | |||
| 1931 | Ga0500651_0074272 | |||
| 1932 | Ga0500566_0000207 | |||
| 1933 | Ga0500566_0002388 | |||
| 1934 | Ga0500566_0006524 | |||
| 1935 | Ga0500640_003553 | |||
| 1936 | Ga0500640_058687 | |||
| 1937 | Ga0500641_0001497 | |||
| 1938 | Ga0500650_0232835 | |||
| 1939 | Ga0500554_000856 | |||
| 1940 | Ga0500554_001256 | |||
| 1941 | Ga0500556_0008721 | |||
| 1942 | Ga0500556_0017680 | |||
| 1943 | Ga0500557_000148 | |||
| 1944 | Ga0500562_004186 | |||
| 1945 | Ga0500569_000873 | |||
| 1946 | Ga0500572_000676 | |||
| 1947 | Ga0500591_081761 | |||
| 1948 | Ga0500591_091052 | |||
| 1949 | Ga0500592_007602 | |||
| 1950 | Ga0500594_0077242 | |||
| 1951 | Ga0500595_000299 | |||
| 1952 | Ga0500595_003982 | |||
| 1953 | Ga0500595_004108 | |||
| 1954 | Ga0500595_011382 | |||
| 1955 | Ga0500595_012032 | |||
| 1956 | Ga0500595_027476 | |||
| 1957 | Ga0500608_051325 | |||
| 1958 | Ga0500608_107335 | |||
| 1959 | Ga0500614_000572 | |||
| 1960 | Ga0500614_005280 | |||
| 1961 | Ga0500614_014221 | |||
| 1962 | Ga0500642_0000083 | |||
| 1963 | Ga0500642_0009622 | |||
| 1964 | Ga0500652_017701 | |||
| 1965 | Ga0500658_0108552 | |||
| 1966 | Ga0500559_0003255 | |||
| 1967 | Ga0500559_0019756 | |||
| 1968 | Ga0500559_0036777 | |||
| 1969 | Ga0500559_0156993 | |||
| 1970 | Ga0500559_0194700 | |||
| 1971 | Ga0500564_077793 | |||
| 1972 | Ga0500568_0008381 | |||
| 1973 | Ga0500568_0013248 | |||
| 1974 | Ga0500573_0077562 | |||
| 1975 | Ga0500577_0044289 | |||
| 1976 | Ga0500588_0026259 | |||
| 1977 | Ga0500590_056787 | |||
| 1978 | Ga0500590_133090 | |||
| 1979 | Ga0500590_175827 | |||
| 1980 | Ga0500603_000313 | |||
| 1981 | Ga0500603_000691 | |||
| 1982 | Ga0500603_016677 | |||
| 1983 | Ga0500604_0016364 | |||
| 1984 | Ga0500622_0106390 | |||
| 1985 | Ga0500630_001066 | |||
| 1986 | Ga0500638_002777 | |||
| 1987 | Ga0500638_003145 | |||
| 1988 | Ga0500638_101633 | |||
| 1989 | Ga0500639_000072 | |||
| 1990 | Ga0500636_0000314 | |||
| 1991 | Ga0500636_0039800 | |||
| 1992 | Ga0500636_0064281 | |||
| 1993 | Ga0500636_0079580 | |||
| 1994 | Ga0500636_0119234 | |||
| 1995 | Ga0500637_0000065 | |||
| 1996 | Ga0500637_0002631 | |||
| 1997 | Ga0500637_0059209 | |||
| 1998 | Ga0500625_062812 | |||
| 1999 | Ga0500645_023607 | |||
| 2000 | Ga0500609_018174 | |||
| 2001 | Ga0500596_002009 | |||
| 2002 | Ga0500596_002393 | |||
| 2003 | Ga0500596_008884 | |||
| 2004 | Ga0500599_000695 | |||
| 2005 | Ga0500601_000099 | |||
| 2006 | Ga0500601_003567 | |||
| 2007 | Ga0501084_0003235 | |||
| 2008 | Ga0500661_001927 | |||
| 2009 | Ga0501082_0005376 | |||
| 2010 | Ga0530510_0107924 | |||
| 2011 | 2507504396 | |||
| 2012 | 2508545828 | |||
| 2013 | 2509146427 | |||
| 2014 | 2511396438 | |||
| 2015 | 2513624206 | |||
| 2016 | 2513638701 | |||
| 2017 | 2513649903 | |||
| 2018 | 2513656191 | |||
| 2019 | 2513679749 | |||
| 2020 | 2513702592 | |||
| 2021 | 2513716731 | |||
| 2022 | 2513860706 | |||
| 2023 | 2513892473 | |||
| 2024 | 2513917629 | |||
| 2025 | 2514010031 | |||
| 2026 | 2515624421 | |||
| 2027 | 2517108171 | |||
| 2028 | 2517887711 | |||
| 2029 | 2524442735 | |||
| 2030 | 2524466636 | |||
| 2031 | 2524535377 | |||
| 2032 | 2528850463 | |||
| 2033 | 2617353829 | |||
| 2034 | 2617374421 | |||
| 2035 | 2671120777 | |||
| 2036 | 2723842482 | |||
| 2037 | 2728748280 | |||
| 2038 | 2745074552 | |||
| 2039 | 2793059334 | |||
| 2040 | 2793072903 | |||
| 2041 | 2793078666 | |||
| 2042 | 2805922093 | |||
| 2043 | 2818240903 | |||
| 2044 | 2824604658 | |||
| 2045 | 2824616134 | |||
| 2046 | 2824618875 | |||
| 2047 | 2824632891 | |||
| 2048 | 2824641000 | |||
| 2049 | 2824648206 | |||
| 2050 | 2824658407 | |||
| 2051 | 2824667418 | |||
| 2052 | 2824675505 | |||
| 2053 | 2824685974 | |||
| 2054 | 2824691728 | |||
| 2055 | 2824698955 | |||
| 2056 | 2824709901 | |||
| 2057 | 2824718018 | |||
| 2058 | 2824728326 | |||
| 2059 | 2824734967 | |||
| 2060 | 2824748114 | |||
| 2061 | 2824759707 | |||
| 2062 | 2824769912 | |||
| 2063 | 2824779722 | |||
| 2064 | 2838126063 | |||
| 2065 | 2841942544 | |||
| 2066 | 2841953106 | |||
| 2067 | 2841960610 | |||
| 2068 | 2841970869 | |||
| 2069 | 2841977871 | |||
| 2070 | 2841984564 | |||
| 2071 | 2842041714 | |||
| 2072 | 2842049756 | |||
| 2073 | 2844321401 | |||
| 2074 | 2847932007 | |||
| 2075 | 2847943248 | |||
| 2076 | 2849076975 | |||
| 2077 | 2857514750 | |||
| 2078 | 2874595650 | |||
| 2079 | 2874620351 | |||
| 2080 | 2874621842 | |||
| 2081 | 2874630236 | |||
| 2082 | 2874651717 | |||
| 2083 | 2876766441 | |||
| 2084 | 2876775845 | |||
| 2085 | 2876821612 | |||
| 2086 | 2879079936 | |||
| 2087 | 2879085686 | |||
| 2088 | 2879104529 | |||
| 2089 | 2879134020 | |||
| 2090 | 2879148505 | |||
| 2091 | 2881370400 | |||
| 2092 | 2881666458 | |||
| 2093 | 2885374419 | |||
| 2094 | 2885382552 | |||
| 2095 | 2885384907 | |||
| 2096 | 2885411551 | |||
| 2097 | 2888387706 | |||
| 2098 | 2888391464 | |||
| 2099 | 2888426915 | |||
| 2100 | 2889034246 | |||
| 2101 | 2903734582 | |||
| 2102 | 2903753644 | |||
| 2103 | 2903773488 | |||
| 2104 | 2904669565 | |||
| 2105 | 2904691841 | |||
| 2106 | 2904713623 | |||
| 2107 | 2906608015 | |||
| 2108 | 2906612721 | |||
| 2109 | 2906629413 | |||
| 2110 | 2906640553 | |||
| 2111 | 2906647219 | |||
| 2112 | 2906663223 | |||
| 2113 | 2908745917 | |||
| 2114 | 2908763946 | |||
| 2115 | 2908776902 | |||
| 2116 | 2922367632 | |||
| 2117 | 2922376692 | |||
| 2118 | 2922391607 | |||
| 2119 | 2922393292 | |||
| 2120 | 2922433201 | |||
| 2121 | 2929619767 | |||
| 2122 | 2929629078 | |||
| 2123 | 2932789747 | |||
| 2124 | 2932796585 | |||
| 2125 | 2932817740 | |||
| 2126 | 2932827148 | |||
| 2127 | 2932835752 | |||
| 2128 | 2933581686 | |||
| 2129 | 2935613191 | |||
| 2130 | 2935624554 | |||
| 2131 | 2935630602 | |||
| 2132 | 2935647219 | |||
| 2133 | 2935655637 | |||
| 2134 | 2935664459 | |||
| 2135 | 2935674318 | |||
| 2136 | 2935684198 | |||
| 2137 | 2935694230 | |||
| 2138 | 2935697671 | |||
| 2139 | 2935711307 | |||
| 2140 | 2935720015 | |||
| 2141 | 2935732126 | |||
| 2142 | 2935741515 | |||
| 2143 | 2935750877 | |||
| 2144 | 2935757871 | |||
| 2145 | 2935764248 | |||
| 2146 | 2935775128 | |||
| 2147 | 2935780031 | |||
| 2148 | 2935790152 | |||
| 2149 | 2935798806 | |||
| 2150 | 2935809907 | |||
| 2151 | 2935819312 | |||
| 2152 | 2935824955 | |||
| 2153 | 2935836643 | |||
| 2154 | 2935846412 | |||
| 2155 | 2935852175 | |||
| 2156 | 2935863236 | |||
| 2157 | 2935868705 | |||
| 2158 | 2935879479 | |||
| 2159 | 2935916443 | |||
| 2160 | 2935925439 | |||
| 2161 | 2935933943 | |||
| 2162 | 2935942466 | |||
| 2163 | 2935950921 | |||
| 2164 | 2935959382 | |||
| 2165 | 2935965393 | |||
| 2166 | 2935975449 | |||
| 2167 | 2935980119 | |||
| 2168 | 2935984283 | |||
| 2169 | 2936000273 | |||
| 2170 | 2936010315 | |||
| 2171 | 2936018587 | |||
| 2172 | 2936027105 | |||
| 2173 | 2936035928 | |||
| 2174 | 2936045935 | |||
| 2175 | 2936054007 | |||
| 2176 | 2936055363 | |||
| 2177 | 2940563307 | |||
| 2178 | 2941507254 | |||
| 2179 | 2941515681 | |||
| 2180 | 2941523611 | |||
| 2181 | 2941531970 | |||
| 2182 | 2941546840 | |||
| 2183 | 3005485747 | |||
| 2184 | 3005506606 | |||
| 2185 | 3005588739 | |||
| 2186 | 3005601757 | |||
| 2187 | 3005717496 | |||
| 2188 | 3005724433 | |||
| 2189 | 8006933382 | |||
| 2190 | 8006935102 | |||
| 2191 | 8006965371 | |||
| 2192 | 8006975070 | |||
| 2193 | 8006986083 | |||
| 2194 | 8006999243 | |||
| 2195 | 8016519140 | |||
| 2196 | 8016538754 | |||
| 2197 | 8016543042 | |||
| 2198 | 8016550251 | |||
| 2199 | 8016558660 | |||
| 2200 | 8016568446 | |||
| 2201 | 8016581098 | |||
| 2202 | 8016587617 | |||
| 2203 | 8016596638 | |||
| 2204 | 8016619305 | |||
| 2205 | 8016630287 | |||
| 2206 | 8016636860 | |||
| 2207 | 8017066359 | |||
| 2208 | 8019541398 | |||
| 2209 | 8019573671 | |||
| 2210 | 8019596292 | |||
| 2211 | 8019605406 | |||
| 2212 | 8019613134 | |||
| 2213 | 8019623822 | |||
| 2214 | 8019641420 | |||
| 2215 | 8019666135 | |||
| 2216 | 8019680453 | |||
| 2217 | 8019695361 | |||
| 2218 | 8055750480 | |||
| 2219 | 8056678964 | |||
| 2220 | 8056685531 | |||
| 2221 | 8056692827 | |||
| 2222 | 8056971783 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8b6o-assembly1.cif.gz_A | x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 | 0.8557 | 2 | 120 |
| 8b6n-assembly1.cif.gz_A | x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) | 0.85 | 2 | 120 |
| 3bdi-assembly1.cif.gz_A | crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution | 0.8429 | 2 | 267 |
| 2xua-assembly1.cif.gz_A | crystal structure of the enol-lactonase from burkholderia xenovorans lb400 | 0.8368 | 2 | 269 |
| 2xua-assembly1.cif.gz_A | crystal structure of the enol-lactonase from burkholderia xenovorans lb400 | 0.8338 | 2 | 269 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0KMM0_1_93_3.40.50.12270 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8912 | 2 | 85 | 3.40.50.12270 |
| 5frdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8432 | 2 | 268 | 3.40.50.1820 |
| af_Q922Q6_49_247_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8391 | 2 | 268 | 3.40.50.1820 |
| af_Q9N366_39_241_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8359 | 3 | 268 | 3.40.50.1820 |
| 2xuaH00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8348 | 2 | 269 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1X7E8R9-F1-model_v4 | Pimeloyl-ACP methyl ester carboxylesterase | 0.9306 | 2 | 268 |
|
| AF-A0A7X1N7U3-F1-model_v4 | Alpha/beta fold hydrolase | 0.9264 | 12 | 268 |
GO:0016020
GO:0016787 |
| AF-A0A1X7E8R9-F1-model_v4 | Pimeloyl-ACP methyl ester carboxylesterase | 0.9205 | 2 | 268 |
|
| AF-A0A1B6FQH5-F1-model_v4 | AB hydrolase-1 domain-containing protein | 0.9177 | 11 | 120 |
GO:0016020
|
| AF-A0A674ISU8-F1-model_v4 | AB hydrolase-1 domain-containing protein | 0.9168 | 2 | 117 |
GO:0004301
GO:0016020 |