F491046

General Info

Members Datasets Scaffolds Average Seq Length
1163 667 2326 158

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8019608314|8019611845
Length 148
Sequence HLAASSPLAEHTRLAAFAGEWNGEEVVFPSRWTEGGPATSHVVARMDLNGFYLIQDAVQIRDGKQVFATHGLFTYKLFWYDSLGYTPPSPASGGWVGKTLTLVRGSLRGNARHVYEIIDDNSYSLKIQFSPDAEGWADVLTGIYRRIH

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
85 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
86 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
105 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
106 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
107 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
124 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
125 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
126 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
127 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
128 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
129 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
133 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
134 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
193 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
194 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
195 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
196 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
206 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
207 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
208 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
209 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
210 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
211 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
212 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
215 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
216 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
217 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
218 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
225 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
226 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
227 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
228 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
231 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
232 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
233 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
234 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
235 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
236 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
240 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
249 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
250 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
251 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
252 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
253 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
254 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
255 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
256 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
257 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
258 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
259 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
260 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
261 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
262 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
263 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
264 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
265 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
266 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
267 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
268 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
269 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
270 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
271 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
272 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
273 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
274 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
275 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
276 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
277 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
278 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
279 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
280 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
281 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
282 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
283 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
284 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
285 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
286 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
287 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
288 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
289 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
290 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
291 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
294 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
295 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
296 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
297 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
298 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
299 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
300 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
301 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
302 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
303 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
304 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
305 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
306 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
307 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
308 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
309 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
310 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
311 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
312 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
313 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
314 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
315 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
316 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
317 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
318 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
319 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
320 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
321 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
322 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
323 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
324 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
325 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
326 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
327 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
328 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
329 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
330 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
331 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
332 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
333 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
334 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
335 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
336 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
337 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
338 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
339 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
340 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
341 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
342 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
343 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
344 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
345 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
346 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
347 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
348 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
349 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
350 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
351 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
352 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
353 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
354 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
355 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
356 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
357 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
358 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
359 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
360 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
361 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
362 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
363 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
364 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
365 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
366 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
367 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
368 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
369 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
370 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
371 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
372 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
373 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
374 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
375 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
376 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
377 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
378 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
379 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
380 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
381 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
382 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
383 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
384 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
385 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
386 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
387 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
388 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
389 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
390 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
391 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
392 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
393 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
394 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
395 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
396 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
397 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
398 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
402 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
403 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
404 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
405 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
406 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
407 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
408 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
409 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
410 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
411 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
412 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
413 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
414 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
415 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
416 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
417 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
418 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
419 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
420 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
421 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
422 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
423 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
424 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
425 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
426 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
427 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
428 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
429 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
430 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
431 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
432 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
433 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
434 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
435 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
436 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
437 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
438 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
439 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
440 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
441 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
442 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
443 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
444 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
445 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
446 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
447 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
448 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
449 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
450 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
451 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
452 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
453 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
454 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
455 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
456 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
457 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
458 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
459 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
460 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
461 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
462 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
463 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
464 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
465 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
466 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
467 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
468 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
472 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
473 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
474 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
475 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
476 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
477 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
478 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
479 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
480 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
481 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
482 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
483 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
484 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
485 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
486 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
487 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
488 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
489 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
490 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
491 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
492 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
493 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
494 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
495 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
496 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
497 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
498 2791355199
499 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
500 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
501 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
502 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
503 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
504 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
505 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
506 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
507 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
508 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
509 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
510 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
511 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
512 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
513 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
514 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
515 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
516 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
517 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
518 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
519 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
520 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
521 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
522 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
523 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
524 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
525 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
526 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
527 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
528 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
529 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
530 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
531 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
532 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
533 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
534 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
535 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
536 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
537 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
538 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
539 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
540 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
541 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
542 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
543 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
544 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
545 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
546 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
547 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
548 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
549 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
550 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
551 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
552 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
553 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
554 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
555 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
556 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
557 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
558 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
559 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
560 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
561 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
562 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
563 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
564 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
565 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
566 2922368715
567 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
568 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
569 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
570 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
571 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
572 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
573 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
574 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
575 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
576 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
577 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
578 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
579 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
580 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
581 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
582 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
583 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
584 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
585 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
586 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
587 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
588 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
589 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
590 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
591 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
592 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
593 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
594 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
595 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
596 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
597 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
598 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
599 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
600 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
601 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
602 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
603 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
604 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
605 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
606 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
607 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
608 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
609 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
610 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
611 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
612 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
613 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
614 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
615 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
616 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
617 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
618 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
619 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
620 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
621 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
622 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
623 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
624 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
625 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
626 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
627 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
628 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
629 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
630 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
631 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
632 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
633 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
634 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
635 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
636 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
637 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
638 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
639 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
640 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
641 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
642 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
643 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
644 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
645 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
646 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
647 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
648 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
649 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
650 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
651 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
652 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
653 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
654 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
655 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
656 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
657 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
658 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
659 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
660 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
661 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
662 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
663 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
664 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
665 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
666 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
667 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.86
Metatranscriptomes 0.43
Isolates 16.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.21
Nodule 13.41
Rhizoplane 6.36
Rhizosphere 57.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10056611 3300001989 Bacteria 1250
2 JGI24737J22298_10010921 3300001990 Bacteria 2982
3 JGI24738J21930_10005509 3300002075 Bacteria 3027
4 JGI25406J46586_10005144 3300003203 Bacteria 6072
5 JGI25153J46596_10014690 3300003215 Bacteria 3239
6 JGI25153J46596_10061505 3300003215 Bacteria 1017
7 JGI25160J50197_1019049 3300003354 Bacteria 2116
8 JGI25160J50197_1077645 3300003354 Bacteria 622
9 JGI25404J52841_10003285 3300003659 Bacteria 3177
10 JGI25404J52841_10073108 3300003659 Bacteria 716
11 Ga0055524_1062813 3300003775 Bacteria 759
12 Ga0055524_1085871 3300003775 Bacteria 559
13 Ga0055531_10019481 3300003794 Bacteria 2742
14 Ga0065165_1045702 3300005262 Bacteria 1274
15 Ga0070658_10383733 3300005327 Bacteria 1206
16 Ga0070658_10623219 3300005327 Bacteria 935
17 Ga0070683_100023244 3300005329 Bacteria 5544
18 Ga0070683_100695457 3300005329 Bacteria 974
19 Ga0070670_100542044 3300005331 Bacteria 1037
20 Ga0070670_101195684 3300005331 Bacteria 695
21 Ga0070670_102168246 3300005331 Bacteria 512
22 Ga0068869_100936050 3300005334 Bacteria 751
23 Ga0070680_100014564 3300005336 Bacteria 6150
24 Ga0070680_100015700 3300005336 Bacteria 5944
25 Ga0070682_100442339 3300005337 Bacteria 993
26 Ga0068868_100578760 3300005338 Bacteria 992
27 Ga0070660_100109060 3300005339 Bacteria 2201
28 Ga0070660_100201711 3300005339 Bacteria 1613
29 Ga0070660_100535213 3300005339 Bacteria 976
30 Ga0070689_100344345 3300005340 Bacteria 1249
31 Ga0070687_100539533 3300005343 Bacteria 792
32 Ga0070661_100079443 3300005344 Bacteria 2420
33 Ga0070661_100678029 3300005344 Bacteria 838
34 Ga0070668_100583071 3300005347 Bacteria 976
35 Ga0070669_100238265 3300005353 Bacteria 1444
36 Ga0070669_100281169 3300005353 Bacteria 1333
37 Ga0070671_100706281 3300005355 Bacteria 875
38 Ga0070674_100133626 3300005356 Bacteria 1853
39 Ga0070674_100883062 3300005356 Bacteria 778
40 Ga0070688_100196684 3300005365 Bacteria 1408
41 Ga0070659_100037280 3300005366 Bacteria 3789
42 Ga0070659_100170780 3300005366 Bacteria 1781
43 Ga0070659_100529911 3300005366 Bacteria 1006
44 Ga0070667_100179404 3300005367 Bacteria 1872
45 Ga0070709_10010696 3300005434 Bacteria 5090
46 Ga0070709_10419245 3300005434 Bacteria 1003
47 Ga0070714_100072547 3300005435 Bacteria 2980
48 Ga0070714_100193146 3300005435 Bacteria 1859
49 Ga0070714_101207818 3300005435 Bacteria 738
50 Ga0070713_100068252 3300005436 Bacteria 2996
51 Ga0070713_100080701 3300005436 Bacteria 2774
52 Ga0070710_10000283 3300005437 Bacteria 24031
53 Ga0070710_10051363 3300005437 Bacteria 2314
54 Ga0070711_100020650 3300005439 Bacteria 4249
55 Ga0070711_100240428 3300005439 Bacteria 1415
56 Ga0070663_100253510 3300005455 Bacteria 1393
57 Ga0070663_100803986 3300005455 Bacteria 806
58 Ga0070662_101064158 3300005457 Bacteria 694
59 Ga0070681_10054618 3300005458 Bacteria 3980
60 Ga0070699_100983428 3300005518 Bacteria 774
61 Ga0070679_100050877 3300005530 Bacteria 4127
62 Ga0070684_100187853 3300005535 Bacteria 1879
63 Ga0070697_100032323 3300005536 Bacteria 4211
64 Ga0068853_100000920 3300005539 Bacteria 20589
65 Ga0068853_100397427 3300005539 Bacteria 1289
66 Ga0070686_100183446 3300005544 Bacteria 1488
67 Ga0070693_100235979 3300005547 Bacteria 1205
68 Ga0070693_100351464 3300005547 Bacteria 1009
69 Ga0070665_100028814 3300005548 Bacteria 5590
70 Ga0070665_100102933 3300005548 Bacteria 2859
71 Ga0070665_101492609 3300005548 Bacteria 684
72 Ga0068855_100034165 3300005563 Bacteria 6066
73 Ga0068855_100124443 3300005563 Bacteria 2949
74 Ga0068855_100294811 3300005563 Bacteria 1797
75 Ga0068855_100311730 3300005563 Bacteria 1740
76 Ga0068855_100764269 3300005563 Bacteria 1029
77 Ga0068855_100849040 3300005563 Bacteria 968
78 Ga0068855_101390605 3300005563 Bacteria 724
79 Ga0070664_100650709 3300005564 Bacteria 979
80 Ga0070664_100774044 3300005564 Bacteria 896
81 Ga0070664_101183284 3300005564 Bacteria 721
82 Ga0068854_100277245 3300005578 Bacteria 1348
83 Ga0068854_100292701 3300005578 Bacteria 1314
84 Ga0068854_100377294 3300005578 Bacteria 1167
85 Ga0068856_100349604 3300005614 Bacteria 1497
86 Ga0068856_101292915 3300005614 Bacteria 745
87 Ga0070702_100043889 3300005615 Bacteria 2521
88 Ga0068852_100060632 3300005616 Bacteria 3284
89 Ga0068852_100405525 3300005616 Bacteria 1342
90 Ga0068852_100906959 3300005616 Bacteria 898
91 Ga0068859_100634711 3300005617 Bacteria 1160
92 Ga0068859_100954761 3300005617 Bacteria 940
93 Ga0068864_100162142 3300005618 Bacteria 2033
94 Ga0068864_101054804 3300005618 Bacteria 808
95 Ga0068864_101358644 3300005618 Bacteria 712
96 Ga0068864_101629524 3300005618 Bacteria 649
97 Ga0068861_100237585 3300005719 Bacteria 1548
98 Ga0068861_101094261 3300005719 Bacteria 766
99 Ga0068851_10016235 3300005834 Bacteria 3560
100 Ga0068851_10109325 3300005834 Bacteria 1474
101 Ga0068851_10588484 3300005834 Bacteria 676
102 Ga0068863_100059827 3300005841 Bacteria 3604
103 Ga0068863_100128685 3300005841 Bacteria 2416
104 Ga0068863_100936213 3300005841 Bacteria 868
105 Ga0068858_100415799 3300005842 Bacteria 1293
106 Ga0068858_100453568 3300005842 Bacteria 1236
107 Ga0068858_100673789 3300005842 Bacteria 1006
108 Ga0068858_100676361 3300005842 Bacteria 1004
109 Ga0068858_100949875 3300005842 Bacteria 841
110 Ga0068860_100009370 3300005843 Bacteria 9734
111 Ga0068860_101373757 3300005843 Bacteria 727
112 Ga0068862_100430126 3300005844 Bacteria 1240
113 Ga0081455_10010427 3300005937 Bacteria 9434
114 Ga0081455_10043997 3300005937 Bacteria 3901
115 Ga0081455_10083029 3300005937 Bacteria 2619
116 Ga0081455_10170416 3300005937 Bacteria 1659
117 Ga0081455_10354396 3300005937 Bacteria 1034
118 Ga0081538_10014842 3300005981 Bacteria 6072
119 Ga0081540_1003025 3300005983 Bacteria 13470
120 Ga0081540_1014806 3300005983 Bacteria 4970
121 Ga0081540_1037299 3300005983 Bacteria 2578
122 Ga0081540_1037745 3300005983 Bacteria 2555
123 Ga0081540_1063581 3300005983 Bacteria 1746
124 Ga0081540_1063752 3300005983 Bacteria 1743
125 Ga0081540_1177086 3300005983 Bacteria 804
126 Ga0081539_10000371 3300005985 Bacteria 98455
127 Ga0081539_10037844 3300005985 Bacteria 2867
128 Ga0070717_10036925 3300006028 Bacteria 3965
129 Ga0070717_10078208 3300006028 Bacteria 2771
130 Ga0075365_10057032 3300006038 Bacteria 2598
131 Ga0075365_10111236 3300006038 Bacteria 1882
132 Ga0075365_10114527 3300006038 Bacteria 1855
133 Ga0075365_10208706 3300006038 Bacteria 1369
134 Ga0075365_10384894 3300006038 Bacteria 989
135 Ga0075365_10410113 3300006038 Bacteria 956
136 Ga0075368_10025300 3300006042 Bacteria 2277
137 Ga0075368_10189399 3300006042 Bacteria 868
138 Ga0075363_100073480 3300006048 Bacteria 1860
139 Ga0075364_10024937 3300006051 Bacteria 3802
140 Ga0075364_10860226 3300006051 Bacteria 617
141 Ga0070715_10029252 3300006163 Bacteria 2217
142 Ga0070716_100005381 3300006173 Bacteria 6195
143 Ga0070716_100009820 3300006173 Bacteria 4781
144 Ga0070712_100627367 3300006175 Bacteria 912
145 Ga0075362_10006558 3300006177 Bacteria 4346
146 Ga0075362_10532935 3300006177 Bacteria 602
147 Ga0075367_10117832 3300006178 Bacteria 1634
148 Ga0075367_10125096 3300006178 Bacteria 1586
149 Ga0075367_10154455 3300006178 Bacteria 1425
150 Ga0075369_10091435 3300006186 Bacteria 1358
151 Ga0075369_10194370 3300006186 Bacteria 935
152 Ga0075369_10327134 3300006186 Bacteria 717
153 Ga0075369_10394995 3300006186 Bacteria 651
154 Ga0075369_10417488 3300006186 Bacteria 633
155 Ga0075369_10469828 3300006186 Bacteria 596
156 Ga0075366_10022052 3300006195 Bacteria 3703
157 Ga0075366_10038501 3300006195 Bacteria 2824
158 Ga0075366_10151254 3300006195 Bacteria 1405
159 Ga0097621_100159781 3300006237 Bacteria 1936
160 Ga0097621_100541616 3300006237 Bacteria 1058
161 Ga0097621_100679314 3300006237 Bacteria 947
162 Ga0075370_10033836 3300006353 Bacteria 2863
163 Ga0075370_10771944 3300006353 Bacteria 585
164 Ga0068871_101166374 3300006358 Bacteria 722
165 Ga0075433_10598341 3300006852 Bacteria 968
166 Ga0075434_100048414 3300006871 Bacteria 4218
167 Ga0075429_100836864 3300006880 Bacteria 806
168 Ga0068865_100233401 3300006881 Bacteria 1444
169 Ga0068865_100288795 3300006881 Bacteria 1308
170 Ga0075436_100591414 3300006914 Bacteria 817
171 Ga0097620_100634679 3300006931 Bacteria 1160
172 Ga0097620_100954718 3300006931 Bacteria 940
173 Ga0099824_1012181 3300006942 Bacteria 9470
174 Ga0099822_1052019 3300006943 Bacteria 1651
175 Ga0099823_1082437 3300006944 Bacteria 1219
176 Ga0075435_100018590 3300007076 Bacteria 5291
177 Ga0075435_101224898 3300007076 Bacteria 657
178 Ga0099794_10126689 3300007265 Bacteria 1288
179 Ga0099794_10231908 3300007265 Bacteria 950
180 Ga0099794_10252296 3300007265 Bacteria 910
181 Ga0099795_10096576 3300007788 Bacteria 1153
182 Ga0099795_10310394 3300007788 Bacteria 696
183 Ga0105240_10133951 3300009093 Bacteria 2968
184 Ga0105240_10134427 3300009093 Bacteria 2963
185 Ga0105240_10199932 3300009093 Bacteria 2343
186 Ga0105240_10390825 3300009093 Bacteria 1569
187 Ga0105245_10836303 3300009098 Bacteria 960
188 Ga0105247_10129800 3300009101 Bacteria 1642
189 Ga0105247_10173975 3300009101 Bacteria 1433
190 Ga0105247_10175113 3300009101 Bacteria 1429
191 Ga0105247_11004120 3300009101 Bacteria 652
192 Ga0114129_10686073 3300009147 Bacteria 1318
193 Ga0105243_10126690 3300009148 Bacteria 2161
194 Ga0105243_10195003 3300009148 Bacteria 1772
195 Ga0105241_10187380 3300009174 Bacteria 1720
196 Ga0105241_10357564 3300009174 Bacteria 1270
197 Ga0105241_10507747 3300009174 Bacteria 1076
198 Ga0105241_10747842 3300009174 Bacteria 896
199 Ga0105241_10889141 3300009174 Bacteria 826
200 Ga0105241_11146071 3300009174 Bacteria 734
201 Ga0105242_10330634 3300009176 Bacteria 1401
202 Ga0105242_10783467 3300009176 Bacteria 942
203 Ga0105248_10317132 3300009177 Bacteria 1756
204 Ga0105248_10409701 3300009177 Bacteria 1526
205 Ga0105248_11365466 3300009177 Bacteria 802
206 Ga0105248_12565770 3300009177 Bacteria 581
207 Ga0105237_10028087 3300009545 Bacteria 5732
208 Ga0105237_10039191 3300009545 Bacteria 4783
209 Ga0105237_10099184 3300009545 Bacteria 2905
210 Ga0105237_10218726 3300009545 Bacteria 1905
211 Ga0105237_10265959 3300009545 Bacteria 1718
212 Ga0105237_10313383 3300009545 Bacteria 1572
213 Ga0105237_10460575 3300009545 Bacteria 1278
214 Ga0105237_10732653 3300009545 Bacteria 995
215 Ga0105237_10764420 3300009545 Bacteria 973
216 Ga0105238_10009549 3300009551 Bacteria 9706
217 Ga0105238_10051567 3300009551 Bacteria 4138
218 Ga0105238_10064169 3300009551 Bacteria 3673
219 Ga0105238_11451986 3300009551 Bacteria 714
220 Ga0105238_11469922 3300009551 Bacteria 710
221 Ga0105249_12341912 3300009553 Bacteria 607
222 Ga0099796_10059991 3300010159 Bacteria 1345
223 Ga0105239_10224320 3300010375 Bacteria 2108
224 Ga0105239_10317397 3300010375 Bacteria 1757
225 Ga0105239_10678250 3300010375 Bacteria 1178
226 Ga0105239_11014785 3300010375 Bacteria 954
227 Ga0105239_12934754 3300010375 Bacteria 556
228 Ga0105246_10611925 3300011119 Bacteria 943
229 Ga0105246_10710424 3300011119 Bacteria 882
230 Ga0157317_1005402 3300012475 Bacteria 862
231 Ga0157325_1001878 3300012485 Bacteria 1016
232 Ga0157341_1016465 3300012494 Bacteria 689
233 Ga0157314_1006534 3300012500 Bacteria 917
234 Ga0157371_10405586 3300013102 Bacteria 998
235 Ga0157370_10448627 3300013104 Bacteria 1186
236 Ga0157370_10497151 3300013104 Bacteria 1120
237 Ga0157370_10584017 3300013104 Bacteria 1023
238 Ga0157369_10028102 3300013105 Bacteria 6227
239 Ga0157369_11134977 3300013105 Bacteria 799
240 Ga0157374_10226360 3300013296 Bacteria 1836
241 Ga0157374_10570082 3300013296 Bacteria 1141
242 Ga0157378_10682897 3300013297 Bacteria 1045
243 Ga0163162_10774763 3300013306 Bacteria 1078
244 Ga0163162_11052252 3300013306 Bacteria 921
245 Ga0163162_12263767 3300013306 Bacteria 624
246 Ga0157372_10742684 3300013307 Bacteria 1141
247 Ga0157372_11793834 3300013307 Bacteria 705
248 Ga0157375_10075965 3300013308 Bacteria 3385
249 Ga0157375_10083615 3300013308 Bacteria 3237
250 Ga0163163_10002309 3300014325 Bacteria 16099
251 Ga0163163_10167987 3300014325 Bacteria 2240
252 Ga0157380_10205834 3300014326 Bacteria 1750
253 Ga0182008_10209579 3300014497 Bacteria 994
254 Ga0157379_10059190 3300014968 Bacteria 3425
255 Ga0157379_10611050 3300014968 Bacteria 1018
256 Ga0157379_10850464 3300014968 Bacteria 863
257 Ga0157376_10347916 3300014969 Bacteria 1417
258 Ga0157376_11622740 3300014969 Bacteria 681
259 Ga0163161_10066596 3300017792 Bacteria 2630
260 Ga0163161_10440983 3300017792 Bacteria 1051
261 Ga0154015_1163030 3300020610 Bacteria 1025
262 Ga0214544_1000665 3300021320 Bacteria 65630
263 Ga0214542_1000486 3300021321 Bacteria 71884
264 Ga0214545_1000307 3300021324 Bacteria 71884
265 Ga0214543_1006816 3300021327 Bacteria 20069
266 Ga0213873_10118654 3300021358 Bacteria 775
267 Ga0213872_10169156 3300021361 Bacteria 948
268 Ga0213874_10003623 3300021377 Bacteria 3450
269 Ga0213876_10121422 3300021384 Bacteria 1387
270 Ga0213875_10258424 3300021388 Bacteria 822
271 Ga0213871_10029878 3300021441 Bacteria 1415
272 Ga0209233_1001838 3300025261 Bacteria 8147
273 Ga0209455_1017071 3300025272 Bacteria 1537
274 Ga0209673_1018665 3300025273 Bacteria 2513
275 Ga0207673_1018161 3300025290 Bacteria 941
276 Ga0209564_1011886 3300025295 Bacteria 3854
277 Ga0209564_1043304 3300025295 Bacteria 1183
278 Ga0209758_1000069 3300025297 Bacteria 286161
279 Ga0209758_1001816 3300025297 Bacteria 23562
280 Ga0209758_1002809 3300025297 Bacteria 16970
281 Ga0209758_1003762 3300025297 Bacteria 13418
282 Ga0209256_1011243 3300025299 Bacteria 3609
283 Ga0209256_1080739 3300025299 Bacteria 711
284 Ga0207426_1001802 3300025302 Bacteria 15949
285 Ga0207426_1015230 3300025302 Bacteria 2793
286 Ga0207426_1030924 3300025302 Bacteria 1751
287 Ga0207426_1047994 3300025302 Bacteria 1285
288 Ga0207426_1079718 3300025302 Bacteria 891
289 Ga0209257_1004189 3300025304 Bacteria 11436
290 Ga0207697_10070501 3300025315 Bacteria 1464
291 Ga0207697_10341159 3300025315 Bacteria 665
292 Ga0207656_10015110 3300025321 Bacteria 2984
293 Ga0207682_10315490 3300025893 Bacteria 734
294 Ga0207692_10000528 3300025898 Bacteria 13562
295 Ga0207692_10130821 3300025898 Bacteria 1417
296 Ga0207710_10060320 3300025900 Bacteria 1719
297 Ga0207710_10122943 3300025900 Bacteria 1241
298 Ga0207710_10187507 3300025900 Bacteria 1017
299 Ga0207688_10204077 3300025901 Bacteria 1186
300 Ga0207647_10040407 3300025904 Bacteria 2938
301 Ga0207647_10366999 3300025904 Bacteria 814
302 Ga0207685_10044646 3300025905 Bacteria 1677
303 Ga0207699_10000514 3300025906 Bacteria 19239
304 Ga0207699_10070793 3300025906 Bacteria 2130
305 Ga0207699_11140236 3300025906 Bacteria 577
306 Ga0207645_10298195 3300025907 Bacteria 1073
307 Ga0207705_10234920 3300025909 Bacteria 1395
308 Ga0207654_10014767 3300025911 Bacteria 4040
309 Ga0207654_10322413 3300025911 Bacteria 1056
310 Ga0207654_10599745 3300025911 Bacteria 786
311 Ga0207707_10001402 3300025912 Bacteria 22333
312 Ga0207707_11247731 3300025912 Bacteria 599
313 Ga0207695_10000148 3300025913 Bacteria 208344
314 Ga0207695_10035369 3300025913 Bacteria 5419
315 Ga0207695_11016166 3300025913 Bacteria 709
316 Ga0207671_10010517 3300025914 Bacteria 7627
317 Ga0207671_10171644 3300025914 Bacteria 1684
318 Ga0207671_10178688 3300025914 Bacteria 1651
319 Ga0207671_10361077 3300025914 Bacteria 1153
320 Ga0207671_10507683 3300025914 Bacteria 961
321 Ga0207671_10594310 3300025914 Bacteria 882
322 Ga0207693_11053514 3300025915 Bacteria 619
323 Ga0207663_10000375 3300025916 Bacteria 19499
324 Ga0207663_11407537 3300025916 Bacteria 562
325 Ga0207660_10007154 3300025917 Bacteria 7227
326 Ga0207660_11059302 3300025917 Bacteria 661
327 Ga0207657_10021854 3300025919 Bacteria 6008
328 Ga0207657_10040608 3300025919 Bacteria 4121
329 Ga0207657_10106288 3300025919 Bacteria 2322
330 Ga0207649_10227090 3300025920 Bacteria 1333
331 Ga0207652_10001370 3300025921 Bacteria 21663
332 Ga0207652_10042897 3300025921 Bacteria 3851
333 Ga0207694_10005792 3300025924 Bacteria 9467
334 Ga0207694_10023040 3300025924 Bacteria 4726
335 Ga0207694_10590934 3300025924 Bacteria 933
336 Ga0207650_10242996 3300025925 Bacteria 1455
337 Ga0207700_10074549 3300025928 Bacteria 2626
338 Ga0207700_10145281 3300025928 Bacteria 1954
339 Ga0207700_10210417 3300025928 Bacteria 1644
340 Ga0207664_10018511 3300025929 Bacteria 5130
341 Ga0207644_10350332 3300025931 Bacteria 1199
342 Ga0207644_10618394 3300025931 Bacteria 900
343 Ga0207644_11004837 3300025931 Bacteria 700
344 Ga0207690_10150083 3300025932 Bacteria 1727
345 Ga0207690_10534696 3300025932 Bacteria 951
346 Ga0207690_10685655 3300025932 Bacteria 842
347 Ga0207690_10908302 3300025932 Bacteria 730
348 Ga0207690_10992791 3300025932 Bacteria 698
349 Ga0207709_10054065 3300025935 Bacteria 2474
350 Ga0207709_10311954 3300025935 Bacteria 1174
351 Ga0207670_10293149 3300025936 Bacteria 1271
352 Ga0207669_11479123 3300025937 Bacteria 579
353 Ga0207665_10003115 3300025939 Bacteria 11120
354 Ga0207665_10010646 3300025939 Bacteria 6042
355 Ga0207665_10296491 3300025939 Bacteria 1207
356 Ga0207691_10578544 3300025940 Bacteria 951
357 Ga0207691_10833628 3300025940 Bacteria 774
358 Ga0207711_10107803 3300025941 Bacteria 2473
359 Ga0207661_10078153 3300025944 Bacteria 2723
360 Ga0207679_10171066 3300025945 Bacteria 1789
361 Ga0207667_10011391 3300025949 Bacteria 10340
362 Ga0207667_10046568 3300025949 Bacteria 4592
363 Ga0207667_10183170 3300025949 Bacteria 2150
364 Ga0207667_10507748 3300025949 Bacteria 1222
365 Ga0207651_10581373 3300025960 Bacteria 977
366 Ga0207712_11252058 3300025961 Bacteria 662
367 Ga0207640_11582157 3300025981 Bacteria 590
368 Ga0207677_11522033 3300026023 Bacteria 618
369 Ga0207703_10118886 3300026035 Bacteria 2266
370 Ga0207703_10376871 3300026035 Bacteria 1312
371 Ga0207703_10387474 3300026035 Bacteria 1294
372 Ga0207703_10529086 3300026035 Bacteria 1110
373 Ga0207703_10731290 3300026035 Bacteria 942
374 Ga0207639_10003644 3300026041 Bacteria 10353
375 Ga0207678_10060408 3300026067 Bacteria 3260
376 Ga0207678_10067321 3300026067 Bacteria 3074
377 Ga0207678_10078168 3300026067 Bacteria 2834
378 Ga0207708_10093722 3300026075 Bacteria 2318
379 Ga0207641_10400846 3300026088 Bacteria 1317
380 Ga0207641_10774314 3300026088 Bacteria 948
381 Ga0207676_10538323 3300026095 Bacteria 1114
382 Ga0207674_11485577 3300026116 Bacteria 647
383 Ga0207675_100096943 3300026118 Bacteria 2777
384 Ga0207683_11356461 3300026121 Bacteria 658
385 Ga0207698_10365284 3300026142 Bacteria 1368
386 Ga0207698_10393003 3300026142 Bacteria 1323
387 Ga0207698_10490768 3300026142 Bacteria 1193
388 Ga0209389_1000102 3300027296 Bacteria 78475
389 Ga0209389_1000142 3300027296 Bacteria 62072
390 Ga0209589_1000331 3300027357 Bacteria 62072
391 Ga0209489_100404 3300027361 Bacteria 78473
392 Ga0209489_100818 3300027361 Bacteria 62070
393 Ga0209700_100408 3300027363 Bacteria 78496
394 Ga0209179_1018328 3300027512 Bacteria 1336
395 Ga0209588_1046161 3300027671 Bacteria 1409
396 Ga0209588_1056188 3300027671 Bacteria 1272
397 Ga0209588_1136615 3300027671 Bacteria 781
398 Ga0209813_10017902 3300027866 Bacteria 1951
399 Ga0268266_10060667 3300028379 Bacteria 3260
400 Ga0268266_10182887 3300028379 Bacteria 1909
401 Ga0268266_10645646 3300028379 Bacteria 1018
402 Ga0268266_10659617 3300028379 Bacteria 1007
403 Ga0268265_10600113 3300028380 Bacteria 1052
404 Ga0268265_11547155 3300028380 Bacteria 667
405 Ga0268264_10000062 3300028381 Bacteria 302110
406 Ga0268264_10542965 3300028381 Bacteria 1139
407 Ga0307517_10052032 3300028786 Bacteria 4116
408 Ga0307515_10780960 3300028794 Bacteria 576
409 Ga0265338_10337098 3300028800 Bacteria 1088
410 Ga0307511_10010436 3300030521 Bacteria 9234
411 Ga0307511_10310558 3300030521 Bacteria 705
412 Ga0265330_10312673 3300031235 Bacteria 662
413 Ga0265332_10099658 3300031238 Bacteria 1226
414 Ga0265340_10095977 3300031247 Bacteria 1382
415 Ga0265340_10361349 3300031247 Bacteria 641
416 Ga0265339_10001952 3300031249 Bacteria 15141
417 Ga0265339_10491048 3300031249 Bacteria 567
418 Ga0265331_10085454 3300031250 Bacteria 1462
419 Ga0265331_10299937 3300031250 Bacteria 720
420 Ga0265316_10378917 3300031344 Bacteria 1021
421 Ga0307509_10017327 3300031507 Bacteria 8294
422 Ga0307509_10269134 3300031507 Bacteria 1473
423 Ga0307509_10662878 3300031507 Bacteria 711
424 Ga0307408_100622235 3300031548 Bacteria 962
425 Ga0307408_100657148 3300031548 Bacteria 938
426 Ga0307508_10000045 3300031616 Bacteria 142824
427 Ga0307508_10047658 3300031616 Bacteria 3819
428 Ga0307508_10120784 3300031616 Bacteria 2223
429 Ga0265314_10108259 3300031711 Bacteria 1771
430 Ga0265342_10020865 3300031712 Bacteria 4192
431 Ga0307516_10026835 3300031730 Bacteria 5846
432 Ga0307516_10137097 3300031730 Bacteria 2220
433 Ga0307516_10297040 3300031730 Bacteria 1292
434 Ga0307405_10622847 3300031731 Bacteria 884
435 Ga0307413_10660622 3300031824 Bacteria 863
436 Ga0307413_11119032 3300031824 Bacteria 681
437 Ga0307407_10554950 3300031903 Bacteria 850
438 Ga0307407_10686079 3300031903 Bacteria 770
439 Ga0307412_10502552 3300031911 Bacteria 1010
440 Ga0307409_101088071 3300031995 Bacteria 820
441 Ga0307411_10038130 3300032005 Bacteria 3028
442 Ga0307510_10010957 3300033180 Bacteria 10775
443 Ga0307510_10431818 3300033180 Bacteria 759
444 Ga0316215_1011516 3300033544 Bacteria 876
445 Ga0373959_0038660 3300034820 Bacteria 993
446 Ga0373934_0259164 3300035086 Bacteria 719
447 Ga0373923_0223445 3300035111 Bacteria 876
448 Ga0373936_0332996 3300035113 Bacteria 689
449 Ga0373936_0351452 3300035113 Bacteria 671
450 Ga0373939_0479866 3300035114 Bacteria 528
451 Ga0373954_0061866 3300035118 Bacteria 1767
452 Ga0373954_0173530 3300035118 Bacteria 1056
453 Ga0373954_0192768 3300035118 Bacteria 1001
454 Ga0373956_0007299 3300035119 Bacteria 4449
455 Ga0373956_0146057 3300035119 Bacteria 1112
456 Ga0373957_0007506 3300035120 Bacteria 3490
457 Ga0373957_0223508 3300035120 Bacteria 789
458 Ga0373960_0355211 3300035121 Bacteria 557
459 Ga0373943_0374942 3300035170 Bacteria 818
460 Ga0373955_0003121 3300035172 Bacteria 7253
461 Ga0373955_0396534 3300035172 Bacteria 838
462 Ga0373931_0163171 3300035691 Bacteria 1308
463 Ga0373931_0622943 3300035691 Bacteria 707
464 Ga0373935_0032158 3300035692 Bacteria 3259
465 Ga0373935_0352252 3300035692 Bacteria 1050
466 Ga0373927_0003114 3300035695 Bacteria 11997
467 Ga0373927_0049191 3300035695 Bacteria 2726
468 Ga0373927_0197509 3300035695 Bacteria 1320
469 Ga0373933_0009258 3300035724 Bacteria 5377
470 Ga0373933_0066469 3300035724 Bacteria 2185
471 Ga0373933_0473136 3300035724 Bacteria 820
472 Ga0373947_0282754 3300035725 Bacteria 1103
473 Ga0373947_1134146 3300035725 Bacteria 533
474 Ga0373937_0151876 3300036401 Bacteria 2169
475 Ga0373937_0230904 3300036401 Bacteria 1743
476 Ga0373937_0288496 3300036401 Bacteria 1550
477 Ga0373937_0454536 3300036401 Bacteria 1216
478 Ga0373937_1239083 3300036401 Bacteria 694
479 Ga0373937_1738013 3300036401 Bacteria 570
480 Ga0372808_012769 3300036459 Bacteria 1194
481 Ga0373925_0033134 3300037068 Bacteria 3808
482 Ga0373925_0121975 3300037068 Bacteria 2024
483 Ga0373925_0198658 3300037068 Bacteria 1594
484 Ga0373925_0357950 3300037068 Bacteria 1186
485 Ga0373925_0655045 3300037068 Bacteria 865
486 Ga0373925_0671720 3300037068 Bacteria 854
487 Ga0373925_0775711 3300037068 Bacteria 790
488 Ga0395900_0000423 3300037418 Bacteria 60773
489 Ga0395900_1581642 3300037418 Bacteria 567
490 Ga0395898_0081670 3300037466 Bacteria 3116
491 Ga0395898_0913048 3300037466 Bacteria 816
492 Ga0395905_0005673 3300037471 Bacteria 12694
493 Ga0395905_0115129 3300037471 Bacteria 2527
494 Ga0395905_0176138 3300037471 Bacteria 2008
495 Ga0436364_0051449 3300037853 Bacteria 950
496 Ga0395901_0373835 3300038443 Bacteria 1468
497 Ga0395901_0528170 3300038443 Bacteria 1198
498 Ga0395901_0557647 3300038443 Bacteria 1160
499 Ga0395901_1053206 3300038443 Bacteria 786
500 Ga0436365_0586546 3300039437 Bacteria 1346
501 Ga0436360_0143142 3300039438 Bacteria 4019
502 Ga0436361_0176947 3300039447 Bacteria 1410
503 Ga0436363_0027301 3300039450 Bacteria 3522
504 Ga0436363_0135636 3300039450 Bacteria 1431
505 Ga0436363_0269693 3300039450 Bacteria 847
506 Ga0436363_1282335 3300039450 Bacteria 689
507 Ga0436362_0194607 3300039453 Bacteria 1117
508 Ga0436362_0453804 3300039453 Bacteria 1072
509 Ga0439465_0047746 3300041413 Bacteria 1396
510 Ga0451787_565100 3300041441 Bacteria 570
511 Ga0451793_0482409 3300041452 Bacteria 929
512 Ga0451793_0836339 3300041452 Bacteria 1027
513 Ga0451793_1542853 3300041452 Bacteria 1284
514 Ga0451795_0789601 3300041456 Bacteria 1069
515 Ga0451798_0816637 3300041458 Bacteria 1171
516 Ga0451802_1491483 3300041460 Bacteria 836
517 Ga0451833_1378080 3300041491 Bacteria 798
518 Ga0451835_0981114 3300041492 Bacteria 1163
519 Ga0451839_0985516 3300041496 Bacteria 1248
520 Ga0451841_1090559 3300041498 Bacteria 876
521 Ga0451847_0750816 3300041503 Bacteria 757
522 Ga0451855_0430394 3300041511 Bacteria 1083
523 Ga0451853_1499260 3300041512 Bacteria 1346
524 Ga0451853_2423794 3300041512 Bacteria 761
525 Ga0451853_3390207 3300041512 Bacteria 640
526 Ga0439431_0207559 3300041997 Bacteria 572
527 Ga0439445_0042630 3300042004 Bacteria 1209
528 Ga0439448_0133630 3300042005 Bacteria 856
529 Ga0439455_0099111 3300042012 Bacteria 804
530 Ga0439458_0056226 3300042157 Bacteria 977
531 Ga0439464_0029082 3300042439 Bacteria 1543
532 Ga0466969_0132254 3300044656 Bacteria 1156
533 Ga0466969_0144423 3300044656 Bacteria 1099
534 Ga0466969_0211617 3300044656 Bacteria 883
535 Ga0466972_0025516 3300044658 Bacteria 2929
536 Ga0466965_0069980 3300044683 Bacteria 1763
537 Ga0466966_0004154 3300044684 Bacteria 9559
538 Ga0466966_0031064 3300044684 Bacteria 3464
539 Ga0466966_0204752 3300044684 Bacteria 1193
540 Ga0466961_0002447 3300044693 Bacteria 11519
541 Ga0466961_0285146 3300044693 Bacteria 1010
542 Ga0466963_1160690 3300044694 Bacteria 543
543 Ga0466964_0156272 3300044706 Bacteria 1062
544 Ga0466964_0348381 3300044706 Bacteria 760
545 Ga0466964_0814907 3300044706 Bacteria 528
546 Ga0466968_0073105 3300044735 Bacteria 1496
547 Ga0466968_0101138 3300044735 Bacteria 1287
548 Ga0466970_0437165 3300044765 Bacteria 749
549 Ga0466970_0551289 3300044765 Bacteria 666
550 Ga0466957_0378748 3300044842 Bacteria 965
551 Ga0466960_0447350 3300044901 Bacteria 750
552 Ga0466959_0010880 3300045049 Bacteria 6522
553 Ga0466959_0084689 3300045049 Bacteria 2282
554 Ga0466958_0752566 3300045836 Bacteria 635
555 Ga0466967_0311416 3300045976 Bacteria 1517
556 Ga0466967_0414521 3300045976 Bacteria 1312
557 Ga0495617_100184 3300046452 Bacteria 942
558 Ga0495627_080617 3300046453 Bacteria 944
559 Ga0495592_0138715 3300046454 Bacteria 1693
560 Ga0495603_0002927 3300046455 Bacteria 10095
561 Ga0495603_0067974 3300046455 Bacteria 2096
562 Ga0495603_0104907 3300046455 Bacteria 1649
563 Ga0495603_0259140 3300046455 Bacteria 1001
564 Ga0495629_0002247 3300046459 Bacteria 14887
565 Ga0495629_0045318 3300046459 Bacteria 3085
566 Ga0495638_0061973 3300046460 Bacteria 2310
567 Ga0495651_0041199 3300046462 Bacteria 3588
568 Ga0495651_0060030 3300046462 Bacteria 2914
569 Ga0495651_0071962 3300046462 Bacteria 2627
570 Ga0495651_0155302 3300046462 Bacteria 1645
571 Ga0495651_0546408 3300046462 Bacteria 736
572 Ga0495653_0123109 3300046463 Bacteria 1845
573 Ga0495653_0200290 3300046463 Bacteria 1355
574 Ga0495650_0028358 3300046471 Bacteria 2572
575 Ga0495650_0063070 3300046471 Bacteria 1479
576 Ga0495580_0178259 3300046472 Bacteria 1468
577 Ga0495580_0522598 3300046472 Bacteria 791
578 Ga0495582_0289573 3300046473 Bacteria 941
579 Ga0495582_0445351 3300046473 Bacteria 748
580 Ga0495639_0061264 3300046475 Bacteria 1725
581 Ga0495639_0297634 3300046475 Bacteria 804
582 Ga0495662_0109838 3300046476 Bacteria 1351
583 Ga0495664_0088911 3300046477 Bacteria 1857
584 Ga0495664_0103879 3300046477 Bacteria 1713
585 Ga0495664_0567215 3300046477 Bacteria 676
586 Ga0495664_0633415 3300046477 Bacteria 634
587 Ga0495594_0084225 3300046499 Bacteria 1778
588 Ga0495594_0188951 3300046499 Bacteria 1173
589 Ga0495596_0341271 3300046500 Bacteria 583
590 Ga0495583_0175433 3300046506 Bacteria 879
591 Ga0495583_0214030 3300046506 Bacteria 780
592 Ga0495606_0040010 3300046507 Bacteria 3153
593 Ga0495606_0059574 3300046507 Bacteria 2448
594 Ga0495606_0297457 3300046507 Bacteria 876
595 Ga0495606_0333367 3300046507 Bacteria 811
596 Ga0495608_0005612 3300046511 Bacteria 8964
597 Ga0495608_0133033 3300046511 Bacteria 1590
598 Ga0495608_0170942 3300046511 Bacteria 1378
599 Ga0495610_0168016 3300046512 Bacteria 922
600 Ga0495616_0156768 3300046513 Bacteria 1026
601 Ga0495620_0047973 3300046515 Bacteria 1835
602 Ga0495620_0084851 3300046515 Bacteria 1277
603 Ga0495620_0136284 3300046515 Bacteria 962
604 Ga0495628_0359976 3300046516 Bacteria 1068
605 Ga0495628_0592620 3300046516 Bacteria 792
606 Ga0495628_0678350 3300046516 Bacteria 730
607 Ga0495630_0339545 3300046517 Bacteria 1149
608 Ga0495630_0508099 3300046517 Bacteria 924
609 Ga0495631_0104414 3300046518 Bacteria 1219
610 Ga0495631_0116959 3300046518 Bacteria 1146
611 Ga0495632_0294467 3300046519 Bacteria 721
612 Ga0495643_0023760 3300046522 Bacteria 3481
613 Ga0495643_0299870 3300046522 Bacteria 733
614 Ga0495644_0106904 3300046523 Bacteria 1060
615 Ga0495644_0256654 3300046523 Bacteria 679
616 Ga0495648_0001071 3300046524 Bacteria 27799
617 Ga0495648_0023901 3300046524 Bacteria 4173
618 Ga0495663_0243817 3300046525 Bacteria 636
619 Ga0495666_0136460 3300046526 Bacteria 1145
620 Ga0495666_0482452 3300046526 Bacteria 554
621 Ga0495652_0003554 3300046529 Bacteria 15313
622 Ga0495652_0073428 3300046529 Bacteria 2848
623 Ga0495652_0177268 3300046529 Bacteria 1639
624 Ga0495654_0223988 3300046530 Bacteria 794
625 Ga0495640_0044185 3300046533 Bacteria 3099
626 Ga0495640_0062316 3300046533 Bacteria 2530
627 Ga0495640_0114258 3300046533 Bacteria 1760
628 Ga0495586_0732768 3300046535 Bacteria 571
629 Ga0495587_0033762 3300046536 Bacteria 3086
630 Ga0495587_0091128 3300046536 Bacteria 1761
631 Ga0495587_0204029 3300046536 Bacteria 1117
632 Ga0495598_0049751 3300046537 Bacteria 1257
633 Ga0495598_0448384 3300046537 Bacteria 510
634 Ga0495609_0070949 3300046538 Bacteria 1531
635 Ga0495621_0143424 3300046539 Bacteria 936
636 Ga0495621_0281370 3300046539 Bacteria 685
637 Ga0495597_0057043 3300046542 Bacteria 1709
638 Ga0495645_0068066 3300046543 Bacteria 2571
639 Ga0495645_0378118 3300046543 Bacteria 907
640 Ga0495645_0754309 3300046543 Bacteria 587
641 Ga0495622_0013813 3300046557 Bacteria 3745
642 Ga0495622_0023944 3300046557 Bacteria 2850
643 Ga0495622_0073274 3300046557 Bacteria 1580
644 Ga0495633_0038422 3300046558 Bacteria 2286
645 Ga0495667_0019676 3300046559 Bacteria 4554
646 Ga0495667_0023430 3300046559 Bacteria 4160
647 Ga0495667_0171352 3300046559 Bacteria 1395
648 Ga0495656_0044637 3300046615 Bacteria 1867
649 Ga0495656_0061194 3300046615 Bacteria 1643
650 Ga0495656_0126148 3300046615 Bacteria 1213
651 Ga0495656_0347015 3300046615 Bacteria 768
652 Ga0495668_0075940 3300046616 Bacteria 1845
653 Ga0495634_0021044 3300046642 Bacteria 4618
654 Ga0495634_0303553 3300046642 Bacteria 964
655 Ga0495611_0250768 3300046648 Bacteria 820
656 Ga0495611_0294953 3300046648 Bacteria 748
657 Ga0495611_0341698 3300046648 Bacteria 687
658 Ga0495625_0166693 3300046660 Bacteria 1472
659 Ga0495625_0343974 3300046660 Bacteria 944
660 Ga0495635_0000518 3300046663 Bacteria 24462
661 Ga0495635_0063148 3300046663 Bacteria 2543
662 Ga0495635_0126789 3300046663 Bacteria 1740
663 Ga0495659_0010063 3300046664 Bacteria 3026
664 Ga0495661_0231978 3300046665 Bacteria 951
665 Ga0495661_0329225 3300046665 Bacteria 757
666 Ga0495588_0009837 3300046674 Bacteria 4433
667 Ga0495588_0113878 3300046674 Bacteria 1425
668 Ga0495588_0301906 3300046674 Bacteria 843
669 Ga0495657_0033964 3300046675 Bacteria 3546
670 Ga0495657_0052303 3300046675 Bacteria 2738
671 Ga0495599_0020044 3300046678 Bacteria 4165
672 Ga0495599_0166928 3300046678 Bacteria 1359
673 Ga0495599_0703156 3300046678 Bacteria 582
674 Ga0495623_0067855 3300046679 Bacteria 2225
675 Ga0495623_0085022 3300046679 Bacteria 1951
676 Ga0495623_0127784 3300046679 Bacteria 1525
677 Ga0495623_0335729 3300046679 Bacteria 826
678 Ga0495623_0338732 3300046679 Bacteria 822
679 Ga0495646_0082212 3300046680 Bacteria 1874
680 Ga0495646_0164669 3300046680 Bacteria 1225
681 Ga0495669_0135569 3300046684 Bacteria 1160
682 Ga0495669_0550223 3300046684 Bacteria 561
683 Ga0495613_0030680 3300046689 Bacteria 3993
684 Ga0495613_0259812 3300046689 Bacteria 1210
685 Ga0495624_0011806 3300046690 Bacteria 5993
686 Ga0495670_0536894 3300046691 Bacteria 636
687 Ga0495671_0248144 3300046692 Bacteria 859
688 Ga0495649_0030765 3300046694 Bacteria 2962
689 Ga0495589_0236609 3300046794 Bacteria 855
690 Ga0495589_0271382 3300046794 Bacteria 790
691 Ga0495600_0002373 3300046809 Bacteria 10764
692 Ga0495600_0016070 3300046809 Bacteria 4744
693 Ga0495600_0035930 3300046809 Bacteria 3220
694 Ga0495600_0333784 3300046809 Bacteria 952
695 Ga0495660_0356805 3300046810 Bacteria 649
696 Ga0495581_0198184 3300047315 Bacteria 1174
697 Ga0495581_0436564 3300047315 Bacteria 763
698 Ga0495604_0006952 3300047317 Bacteria 8964
699 Ga0495604_0029653 3300047317 Bacteria 4353
700 Ga0495604_0036855 3300047317 Bacteria 3854
701 Ga0495604_0330886 3300047317 Bacteria 1016
702 Ga0495604_0543772 3300047317 Bacteria 749
703 Ga0495604_0777032 3300047317 Bacteria 604
704 Ga0495636_0202109 3300047318 Bacteria 907
705 Ga0495674_0039456 3300047319 Bacteria 4232
706 Ga0495674_0540577 3300047319 Bacteria 928
707 Ga0495674_0580068 3300047319 Bacteria 890
708 Ga0495676_0130150 3300047321 Bacteria 1818
709 Ga0495676_0215351 3300047321 Bacteria 1326
710 Ga0495680_0000836 3300047322 Bacteria 34084
711 Ga0495680_0008429 3300047322 Bacteria 9368
712 Ga0495680_0485026 3300047322 Bacteria 841
713 Ga0495687_045937 3300047443 Bacteria 1888
714 Ga0495675_0068182 3300047444 Bacteria 2247
715 Ga0495675_0287354 3300047444 Bacteria 979
716 Ga0495677_0188656 3300047445 Bacteria 800
717 Ga0495673_0224770 3300047469 Bacteria 693
718 Ga0495681_0197733 3300047470 Bacteria 817
719 Ga0495681_0198256 3300047470 Bacteria 816
720 Ga0495684_0069405 3300047471 Bacteria 2680
721 Ga0495684_0074557 3300047471 Bacteria 2578
722 Ga0495686_0404260 3300047472 Bacteria 732
723 Ga0495686_0415821 3300047472 Bacteria 719
724 Ga0495686_0468298 3300047472 Bacteria 667
725 Ga0495593_0078690 3300047673 Bacteria 1707
726 Ga0495593_0099511 3300047673 Bacteria 1492
727 Ga0495602_0010323 3300048088 Bacteria 9695
728 Ga0495602_0048250 3300048088 Bacteria 3829
729 Ga0495602_0512717 3300048088 Bacteria 836
730 Ga0495614_0119228 3300048089 Bacteria 1163
731 Ga0495615_0086912 3300048090 Bacteria 866
732 Ga0495615_0095921 3300048090 Bacteria 832
733 Ga0495626_0152403 3300048091 Bacteria 974
734 Ga0496100_0149228 3300048903 Bacteria 1665
735 Ga0496100_0759905 3300048903 Bacteria 758
736 Ga0496101_0265498 3300048904 Bacteria 1339
737 Ga0496101_0321858 3300048904 Bacteria 1213
738 Ga0496101_0655308 3300048904 Bacteria 829
739 Ga0496102_0045566 3300048905 Bacteria 3982
740 Ga0496102_0418109 3300048905 Bacteria 1259
741 Ga0496102_0487919 3300048905 Bacteria 1154
742 Ga0496102_0620921 3300048905 Bacteria 1004
743 Ga0496102_0721381 3300048905 Bacteria 920
744 Ga0496103_0054910 3300048906 Bacteria 2469
745 Ga0496104_0004634 3300048907 Bacteria 11973
746 Ga0496104_0026368 3300048907 Bacteria 5366
747 Ga0496104_0110671 3300048907 Bacteria 2633
748 Ga0496104_0232275 3300048907 Bacteria 1756
749 Ga0496104_0478552 3300048907 Bacteria 1156
750 Ga0496104_0827865 3300048907 Bacteria 831
751 Ga0496105_0003681 3300048908 Bacteria 11408
752 Ga0496105_0081495 3300048908 Bacteria 2673
753 Ga0496105_0170684 3300048908 Bacteria 1783
754 Ga0496105_0382661 3300048908 Bacteria 1119
755 Ga0496105_0582515 3300048908 Bacteria 870
756 Ga0496105_0633839 3300048908 Bacteria 826
757 Ga0496106_0000418 3300048909 Bacteria 30181
758 Ga0496106_0018008 3300048909 Bacteria 5223
759 Ga0496106_0196553 3300048909 Bacteria 1604
760 Ga0496106_0249624 3300048909 Bacteria 1418
761 Ga0496106_0577497 3300048909 Bacteria 901
762 Ga0496106_0771940 3300048909 Bacteria 763
763 Ga0496107_0056745 3300048910 Bacteria 2830
764 Ga0496107_0523153 3300048910 Bacteria 879
765 Ga0496107_1076386 3300048910 Bacteria 581
766 Ga0496108_0000160 3300048911 Bacteria 64120
767 Ga0496108_0139529 3300048911 Bacteria 2088
768 Ga0496108_0301705 3300048911 Bacteria 1395
769 Ga0496108_0351566 3300048911 Bacteria 1286
770 Ga0496108_0612861 3300048911 Bacteria 948
771 Ga0496108_0795381 3300048911 Bacteria 816
772 Ga0496108_1166270 3300048911 Bacteria 652
773 Ga0496109_0000245 3300048912 Bacteria 52201
774 Ga0496109_0080707 3300048912 Bacteria 2997
775 Ga0496109_0268416 3300048912 Bacteria 1607
776 Ga0496110_0016871 3300048913 Bacteria 6102
777 Ga0496110_0063465 3300048913 Bacteria 3264
778 Ga0496110_0259815 3300048913 Bacteria 1580
779 Ga0496110_0261213 3300048913 Bacteria 1576
780 Ga0496110_1007372 3300048913 Bacteria 740
781 Ga0496111_0242194 3300048914 Bacteria 1339
782 Ga0496112_0002354 3300048915 Bacteria 15178
783 Ga0496112_0004583 3300048915 Bacteria 11751
784 Ga0496112_0007772 3300048915 Bacteria 9542
785 Ga0496112_0300031 3300048915 Bacteria 1552
786 Ga0496113_0182620 3300048916 Bacteria 1663
787 Ga0496113_0323863 3300048916 Bacteria 1235
788 Ga0496113_0357999 3300048916 Bacteria 1171
789 Ga0496113_0365118 3300048916 Bacteria 1158
790 Ga0496113_0721963 3300048916 Bacteria 794
791 Ga0496114_0066281 3300048917 Bacteria 3027
792 Ga0496114_0366763 3300048917 Bacteria 1274
793 Ga0496114_0462920 3300048917 Bacteria 1122
794 Ga0496115_0042101 3300048918 Bacteria 3638
795 Ga0496115_0058169 3300048918 Bacteria 3110
796 Ga0496115_0157966 3300048918 Bacteria 1873
797 Ga0496115_0235838 3300048918 Bacteria 1508
798 Ga0496115_0299766 3300048918 Bacteria 1317
799 Ga0496115_0320282 3300048918 Bacteria 1268
800 Ga0496115_0484106 3300048918 Bacteria 996
801 Ga0496117_0079927 3300048920 Bacteria 2152
802 Ga0496117_0084006 3300048920 Bacteria 2079
803 Ga0496117_0178558 3300048920 Bacteria 1223
804 Ga0496118_0084321 3300048921 Bacteria 2217
805 Ga0496118_0087769 3300048921 Bacteria 2155
806 Ga0496118_0117977 3300048921 Bacteria 1739
807 Ga0496119_0019116 3300048922 Bacteria 5062
808 Ga0496120_0027214 3300048923 Bacteria 3521
809 Ga0496120_0085508 3300048923 Bacteria 1697
810 Ga0496120_0117763 3300048923 Bacteria 1378
811 Ga0496121_0000870 3300048924 Bacteria 54546
812 Ga0496121_0013066 3300048924 Bacteria 8965
813 Ga0496121_0099010 3300048924 Bacteria 2254
814 Ga0496121_0171854 3300048924 Bacteria 1573
815 Ga0496121_0220536 3300048924 Bacteria 1336
816 Ga0496121_0289697 3300048924 Bacteria 1116
817 Ga0496121_0305040 3300048924 Bacteria 1079
818 Ga0496121_0438387 3300048924 Bacteria 845
819 Ga0496122_0056378 3300048925 Bacteria 2930
820 Ga0496124_0002001 3300048927 Bacteria 27769
821 Ga0496124_0114932 3300048927 Bacteria 2160
822 Ga0496124_0178979 3300048927 Bacteria 1634
823 Ga0496124_0212059 3300048927 Bacteria 1464
824 Ga0496125_0144598 3300048928 Bacteria 1646
825 Ga0496125_0198535 3300048928 Bacteria 1316
826 Ga0496125_0200222 3300048928 Bacteria 1308
827 Ga0496125_0224925 3300048928 Bacteria 1205
828 Ga0496126_0006373 3300048929 Bacteria 13163
829 Ga0496126_0009545 3300048929 Bacteria 10293
830 Ga0496126_0029863 3300048929 Bacteria 5174
831 Ga0496126_0110823 3300048929 Bacteria 2390
832 Ga0496126_0137150 3300048929 Bacteria 2109
833 Ga0496126_0173050 3300048929 Bacteria 1838
834 Ga0496126_0189018 3300048929 Bacteria 1745
835 Ga0496126_0274071 3300048929 Bacteria 1399
836 Ga0496126_0342784 3300048929 Bacteria 1224
837 Ga0496126_0406444 3300048929 Bacteria 1103
838 Ga0496126_0502755 3300048929 Bacteria 968
839 Ga0496126_0682442 3300048929 Bacteria 800
840 Ga0496126_0709951 3300048929 Bacteria 780
841 Ga0495682_0206565 3300049460 Bacteria 696
842 Ga0501038_0477786 3300049574 Bacteria 955
843 Ga0501041_0143277 3300049577 Bacteria 1491
844 Ga0501042_0176809 3300049578 Bacteria 1540
845 Ga0501067_0359480 3300049583 Bacteria 812
846 Ga0501067_0410813 3300049583 Bacteria 755
847 Ga0501068_0315939 3300049584 Bacteria 1001
848 Ga0501068_0660582 3300049584 Bacteria 683
849 Ga0501069_0466185 3300049585 Bacteria 752
850 Ga0501071_0493807 3300049587 Bacteria 939
851 Ga0501071_0940973 3300049587 Bacteria 667
852 Ga0501076_0511982 3300049592 Bacteria 989
853 Ga0501083_0420202 3300049744 Bacteria 870
854 nmdc:mga03683_112267_c1 3300050489 Bacteria 1206
855 nmdc:mga03683_123265_c1 3300050489 Bacteria 1154
856 nmdc:mga03683_170084_c1 3300050489 Bacteria 990
857 nmdc:mga03n38_122732_c1 3300050490 Bacteria 1279
858 nmdc:mga03n38_1367_c1 3300050490 Bacteria 6917
859 nmdc:mga03n38_278702_c1 3300050490 Bacteria 892
860 nmdc:mga00v17_20079_c1 3300050491 Bacteria 3823
861 nmdc:mga00v17_388103_c1 3300050491 Bacteria 908
862 nmdc:mga0yw44_1004707_c1 3300050492 Bacteria 565
863 nmdc:mga0yw44_121354_c1 3300050492 Bacteria 1684
864 nmdc:mga0yw44_180263_c1 3300050492 Bacteria 1390
865 nmdc:mga0yw44_29735_c1 3300050492 Bacteria 3157
866 nmdc:mga0yw44_8494_c1 3300050492 Bacteria 5122
867 nmdc:mga0yw44_945144_c1 3300050492 Bacteria 584
868 nmdc:mga0k408_132549_c1 3300050493 Bacteria 1480
869 nmdc:mga0k408_26293_c1 3300050493 Bacteria 3299
870 nmdc:mga0k408_502874_c1 3300050493 Bacteria 718
871 nmdc:mga0k408_553883_c1 3300050493 Bacteria 680
872 nmdc:mga06z11_371655_c1 3300050494 Bacteria 858
873 nmdc:mga04h51_156810_c1 3300050495 Bacteria 873
874 nmdc:mga04h51_16720_c1 3300050495 Bacteria 2134
875 nmdc:mga04h51_228340_c1 3300050495 Bacteria 740
876 nmdc:mga07m45_49617_c1 3300050496 Bacteria 2363
877 nmdc:mga05p37_749304_c1 3300050507 Bacteria 1077
878 nmdc:mga0n895_382372_c1 3300050512 Bacteria 1424
879 nmdc:mga0n895_46213_c1 3300050512 Bacteria 4252
880 nmdc:mga0n895_668234_c1 3300050512 Bacteria 1036
881 nmdc:mga0rr50_344517_c1 3300050513 Bacteria 1252
882 nmdc:mga0rr50_71273_c1 3300050513 Bacteria 2651
883 nmdc:mga08x19_104827_c1 3300050514 Bacteria 1879
884 nmdc:mga08x19_714478_c1 3300050514 Bacteria 711
885 nmdc:mga0a205_1135367_c1 3300050515 Bacteria 629
886 nmdc:mga0sz30_151863_c1 3300050516 Bacteria 1024
887 nmdc:mga0sz30_40225_c1 3300050516 Bacteria 1367
888 nmdc:mga0sz30_90811_c1 3300050516 Bacteria 1329
889 Ga0495601_0055846 3300053077 Bacteria 2500
890 Ga0495601_0281500 3300053077 Bacteria 1084
891 Ga0495601_0697931 3300053077 Bacteria 647
892 Ga0495612_0075671 3300053078 Bacteria 1409
893 Ga0495612_0520474 3300053078 Bacteria 547
894 Ga0500635_0063352 3300053080 Bacteria 1296
895 Ga0495655_0031743 3300053083 Bacteria 1287
896 Ga0495655_0123060 3300053083 Bacteria 791
897 Ga0495595_0008882 3300053084 Bacteria 4139
898 Ga0495595_0303218 3300053084 Bacteria 804
899 Ga0495595_0355527 3300053084 Bacteria 740
900 Ga0495619_0005412 3300053085 Bacteria 8088
901 Ga0495619_0284632 3300053085 Bacteria 1145
902 Ga0500578_0270262 3300053086 Bacteria 1017
903 Ga0500581_251194 3300053089 Bacteria 742
904 Ga0500646_0165949 3300053090 Bacteria 740
905 Ga0500647_0095507 3300053091 Bacteria 1422
906 Ga0500647_0234214 3300053091 Bacteria 815
907 Ga0500583_0299714 3300053092 Bacteria 787
908 Ga0500566_0130429 3300053094 Bacteria 1345
909 Ga0500640_054172 3300053095 Bacteria 1750
910 Ga0500648_182016 3300053097 Bacteria 1080
911 Ga0500554_076860 3300053102 Bacteria 1094
912 Ga0500556_0059932 3300053104 Bacteria 1399
913 Ga0500557_000021 3300053105 Bacteria 89662
914 Ga0500562_039860 3300053108 Bacteria 1248
915 Ga0500591_050294 3300053115 Bacteria 1956
916 Ga0500593_189461 3300053117 Bacteria 755
917 Ga0500594_0075919 3300053118 Bacteria 996
918 Ga0500594_0129711 3300053118 Bacteria 798
919 Ga0500594_0213344 3300053118 Bacteria 637
920 Ga0500595_140366 3300053119 Bacteria 677
921 Ga0500597_150326 3300053120 Bacteria 1000
922 Ga0500597_243835 3300053120 Bacteria 738
923 Ga0500608_070625 3300053122 Bacteria 1660
924 Ga0500608_330781 3300053122 Bacteria 550
925 Ga0500614_041049 3300053123 Bacteria 1176
926 Ga0500628_042493 3300053129 Bacteria 1045
927 Ga0500655_059345 3300053133 Bacteria 769
928 Ga0500658_0283307 3300053134 Bacteria 762
929 Ga0500559_0000649 3300053136 Bacteria 23438
930 Ga0500559_0033175 3300053136 Bacteria 2222
931 Ga0500559_0140317 3300053136 Bacteria 1131
932 Ga0500559_0155088 3300053136 Bacteria 1075
933 Ga0500568_0162972 3300053139 Bacteria 822
934 Ga0500568_0333947 3300053139 Bacteria 550
935 Ga0500573_0144977 3300053140 Bacteria 1304
936 Ga0500590_115303 3300053148 Bacteria 1268
937 Ga0500590_185940 3300053148 Bacteria 896
938 Ga0500603_004336 3300053150 Bacteria 3038
939 Ga0500603_064653 3300053150 Bacteria 1030
940 Ga0500616_0052121 3300053153 Bacteria 2153
941 Ga0500622_0013877 3300053156 Bacteria 4338
942 Ga0500627_0279084 3300053158 Bacteria 734
943 Ga0500638_066068 3300053162 Bacteria 1734
944 Ga0500638_160353 3300053162 Bacteria 991
945 Ga0500638_170773 3300053162 Bacteria 947
946 Ga0500638_238668 3300053162 Bacteria 740
947 Ga0500639_048794 3300053163 Bacteria 2209
948 Ga0500639_116387 3300053163 Bacteria 1291
949 Ga0500636_0056063 3300053177 Bacteria 2309
950 Ga0500636_0059218 3300053177 Bacteria 2238
951 Ga0500636_0201176 3300053177 Bacteria 1053
952 Ga0500636_0212514 3300053177 Bacteria 1014
953 Ga0500637_0058713 3300053178 Bacteria 2201
954 Ga0500637_0127423 3300053178 Bacteria 1476
955 Ga0500637_0139669 3300053178 Bacteria 1402
956 Ga0500649_057188 3300053722 Bacteria 1631
957 Ga0500576_222186 3300053725 Bacteria 618
958 Ga0500625_061768 3300053729 Bacteria 1697
959 Ga0500656_008404 3300053732 Bacteria 1095
960 Ga0500596_002420 3300053735 Bacteria 3681
961 Ga0500596_009510 3300053735 Bacteria 1516
962 Ga0500599_008609 3300053736 Bacteria 1327
963 Ga0500601_000725 3300053737 Bacteria 4340
964 Ga0587090_116622 3300059510 Bacteria 575
965 Ga0587101_075440 3300059623 Bacteria 629
966 Ga0587111_0201864 3300060346 Bacteria 564
967 Ga0501082_0697134 3300060353 Bacteria 889
968 8019611845 8019608314 Bacteria 10042931
969 2507505450 2507262055 Bacteria 8048963
970 2508539335 2508501009 Bacteria 7784016
971 2508695663 2508501042 Bacteria 8719808
972 2509152179 2508501128 Bacteria 8613869
973 2511401382 2511231028 Bacteria 8046582
974 2513623926 2513237092 Bacteria 8341956
975 2513642191 2513237094 Bacteria 8789602
976 2513651334 2513237095 Bacteria 8976980
977 2513676315 2513237098 Bacteria 9902361
978 2513695287 2513237101 Bacteria 7952346
979 2513700719 2513237102 Bacteria 7703324
980 2513873347 2513237139 Bacteria 8737671
981 2513888580 2513237141 Bacteria 8496279
982 2514014678 2513237161 Bacteria 8871253
983 2515627645 2515154112 Bacteria 8294334
984 2517106280 2517093001 Bacteria 9002274
985 2524441441 2524023205 Bacteria 8918781
986 2524467227 2524023210 Bacteria 9029266
987 2528853319 2528768022 Bacteria 10457665
988 2617352061 2617270735 Bacteria 9163226
989 2617373530 2617270741 Bacteria 8201522
990 2723841821 2721755755 Bacteria 8322773
991 2728748432 2728368998 Bacteria 8720350
992 2745077575 2744054633 Bacteria 8678936
993 2793062236 2791355196 Bacteria 7323613
994 2793078305
995 2805920695 2802429603 Bacteria 8777136
996 2818237856 2816332527 Bacteria 8933356
997 2824608736 2824600985 Bacteria 8488197
998 2824617663 2824609381 Bacteria 8672835
999 2824624828 2824617872 Bacteria 8814715
1000 2824633706 2824626560 Bacteria 8813858
1001 2824641783 2824635225 Bacteria 8785348
1002 2824651226 2824644064 Bacteria 8743947
1003 2824660126 2824653114 Bacteria 8493680
1004 2824670748 2824661429 Bacteria 9877870
1005 2824676573 2824671348 Bacteria 8369588
1006 2824686613 2824679649 Bacteria 8248951
1007 2824693235 2824687955 Bacteria 8360029
1008 2824703454 2824696289 Bacteria 8335049
1009 2824710500 2824704595 Bacteria 9667483
1010 2824721042 2824714736 Bacteria 8717648
1011 2824731208 2824723954 Bacteria 8758240
1012 2824739251 2824732956 Bacteria 7810675
1013 2824752141 2824746037 Bacteria 7911610
1014 2824761755 2824753945 Bacteria 9787441
1015 2824772254 2824763712 Bacteria 9792355
1016 2824780843 2824773399 Bacteria 8360218
1017 2838124698 2838122688 Bacteria 8803140
1018 2841945390 2841941048 Bacteria 8688029
1019 2841952176 2841949485 Bacteria 8680857
1020 2841965346 2841957949 Bacteria 8652217
1021 2841970437 2841966195 Bacteria 8673214
1022 2841981685 2841974524 Bacteria 8931498
1023 2841984966 2841983080 Bacteria 8395090
1024 2842043320 2842038055 Bacteria 8002051
1025 2842052690 2842045827 Bacteria 8006841
1026 2844315545 2844315083 Bacteria 8138177
1027 2847931248 2847930680 Bacteria 9342022
1028 2847942341 2847939898 Bacteria 8606328
1029 2849083213 2849076700 Bacteria 7039503
1030 2857516354 2857509624 Bacteria 7472071
1031 2874592549 2874590934 Bacteria 8299676
1032 2874607886 2874604998 Bacteria 7834745
1033 2874617980 2874612657 Bacteria 8252029
1034 2874621203 2874620515 Bacteria 8290088
1035 2874628602 2874628541 Bacteria 8630250
1036 2874647168 2874645413 Bacteria 8214782
1037 2876769641 2876761206 Bacteria 10111113
1038 2876772552 2876771140 Bacteria 8287509
1039 2876814185 2876808645 Bacteria 8824342
1040 2876819813 2876818435 Bacteria 8274608
1041 2879076319 2879074833 Bacteria 8279565
1042 2879083770 2879083081 Bacteria 8587928
1043 2879100439 2879099564 Bacteria 10442239
1044 2879113313 2879110137 Bacteria 8907982
1045 2879128803 2879127579 Bacteria 8294491
1046 2879143624 2879142872 Bacteria 8267021
1047 2881673208 2881665667 Bacteria 8175609
1048 2885369335 2885366525 Bacteria 8326213
1049 2885386902 2885383462 Bacteria 9473874
1050 2888379402 2888378607 Bacteria 9652610
1051 2888390501 2888388044 Bacteria 7304136
1052 2888420122 2888419890 Bacteria 7857137
1053 2889035303 2889033259 Bacteria 9099371
1054 2903733686 2903727486 Bacteria 8281579
1055 2903774505 2903768456 Bacteria 9749579
1056 2904667748 2904666416 Bacteria 8226587
1057 2904716330 2904711408 Bacteria 9771557
1058 2906609466 2906602504 Bacteria 8295279
1059 2906631668 2906626472 Bacteria 8826946
1060 2906650273 2906643746 Bacteria 8722424
1061 2908776002 2908775508 Bacteria 8092255
1062 2922369388
1063 2922388488 2922386360 Bacteria 7017218
1064 2922396584 2922393267 Bacteria 8285685
1065 2929618783 2929615660 Bacteria 9193770
1066 2929628532 2929624759 Bacteria 9339455
1067 2932790965 2932784394 Bacteria 9704911
1068 2932794142 2932794094 Bacteria 7915132
1069 2932809218 2932801729 Bacteria 7987968
1070 2932811981 2932809354 Bacteria 9135765
1071 2932825568 2932818245 Bacteria 9955613
1072 2932833681 2932828146 Bacteria 9745859
1073 2933580507 2933577622 Bacteria 9116884
1074 2935615520 2935608549 Bacteria 8203142
1075 2935623207 2935616580 Bacteria 9032984
1076 2935644282 2935638405 Bacteria 10015038
1077 2935654450 2935648319 Bacteria 8801166
1078 2935663330 2935656913 Bacteria 8965014
1079 2935672136 2935665750 Bacteria 9571747
1080 2935679343 2935675223 Bacteria 9928132
1081 2935686585 2935684952 Bacteria 9590419
1082 2935700367 2935694250 Bacteria 9291695
1083 2935710315 2935703347 Bacteria 10242284
1084 2935716273 2935713505 Bacteria 9608509
1085 2935723603 2935722832 Bacteria 9608746
1086 2935735158 2935732158 Bacteria 9706831
1087 2935744051 2935741537 Bacteria 9707219
1088 2935752551 2935750917 Bacteria 9590372
1089 2935763315 2935760218 Bacteria 9817913
1090 2935774289 2935769743 Bacteria 7878163
1091 2935783346 2935777560 Bacteria 8077691
1092 2935788996 2935785616 Bacteria 7962367
1093 2935796746 2935793552 Bacteria 8012592
1094 2935808306 2935801545 Bacteria 9301974
1095 2935816080 2935810662 Bacteria 9401221
1096 2935825679 2935819856 Bacteria 8261050
1097 2935833474 2935827899 Bacteria 10038562
1098 2935845968 2935837841 Bacteria 9454360
1099 2935853443 2935847175 Bacteria 8228321
1100 2935861455 2935855204 Bacteria 9035059
1101 2935869574 2935864058 Bacteria 9784707
1102 2935879903 2935873716 Bacteria 9632195
1103 2935889169 2935883170 Bacteria 7964738
1104 2935915045 2935908558 Bacteria 8568796
1105 2935918893 2935916978 Bacteria 9113783
1106 2935931390 2935926038 Bacteria 8601059
1107 2935939987 2935934488 Bacteria 8602579
1108 2935947666 2935942939 Bacteria 8599779
1109 2935956437 2935951376 Bacteria 8602333
1110 2935966717 2935959822 Bacteria 7869783
1111 2935973231 2935967501 Bacteria 8603075
1112 2935980526 2935975950 Bacteria 8347125
1113 2935990123 2935984226 Bacteria 8302647
1114 2935997874 2935992306 Bacteria 9802711
1115 2936008861 2936002035 Bacteria 9362176
1116 2936017511 2936011229 Bacteria 8801034
1117 2936025988 2936019824 Bacteria 8804134
1118 2936034830 2936028420 Bacteria 8965941
1119 2936041085 2936037263 Bacteria 9446081
1120 2936052912 2936046547 Bacteria 8903709
1121 2936060229 2936055302 Bacteria 8785755
1122 2940558464 2940556831 Bacteria 9590747
1123 2941535343 2941531003 Bacteria 7653939
1124 2941547137 2941538514 Bacteria 9402094
1125 3005486674 3005483717 Bacteria 7877331
1126 3005508980 3005506211 Bacteria 6943378
1127 3005594137 3005587118 Bacteria 7794411
1128 3005595235 3005594810 Bacteria 8716512
1129 3005711177 3005710791 Bacteria 7622528
1130 3005718473 3005718088 Bacteria 8283608
1131 8006930829 8006926726 Bacteria 6749210
1132 8006967636 8006964411 Bacteria 8966052
1133 8006991106 8006984368 Bacteria 9651211
1134 8007000435 8006994254 Bacteria 8309700
1135 8016517993 8016511872 Bacteria 9921665
1136 8016526328 8016522445 Bacteria 8156687
1137 8016531390 8016530956 Bacteria 8155261
1138 8016544604 8016539877 Bacteria 8155419
1139 8016557471 8016548790 Bacteria 8155074
1140 8016569658 8016566248 Bacteria 8158151
1141 8016582266 8016575299 Bacteria 8154085
1142 8016586150 8016583857 Bacteria 10421953
1143 8016603428 8016595262 Bacteria 8149947
1144 8016606365 8016603502 Bacteria 8731218
1145 8016618273 8016613128 Bacteria 8794220
1146 8016622922 8016622563 Bacteria 7999408
1147 8016635426 8016630954 Bacteria 9217207
1148 8017058649 8017057580 Bacteria 10023680
1149 8019531224 8019530166 Bacteria 8155624
1150 8019540329 8019538911 Bacteria 7872763
1151 8019549922 8019547302 Bacteria 7996444
1152 8019595075 8019586578 Bacteria 10212056
1153 8019623163 8019619141 Bacteria 9218857
1154 8019629935 8019629233 Bacteria 8687553
1155 8019640671 8019638758 Bacteria 9062356
1156 8019652282 8019648815 Bacteria 10014479
1157 8019666772 8019659431 Bacteria 8577854
1158 8019676532 8019668869 Bacteria 8791617
1159 8019679456 8019678201 Bacteria 8863603
1160 8019696048 8019687851 Bacteria 8712826
1161 8055742632 8055742211 Bacteria 9226248
1162 8056676140 8056673599 Bacteria 7871253
1163 8056682940 8056681323 Bacteria 8472857
1164 JGI24739J22299_10056611
1165 JGI24737J22298_10010921
1166 JGI24738J21930_10005509
1167 JGI25406J46586_10005144
1168 JGI25153J46596_10014690
1169 JGI25153J46596_10061505
1170 JGI25160J50197_1019049
1171 JGI25160J50197_1077645
1172 JGI25404J52841_10003285
1173 JGI25404J52841_10073108
1174 Ga0055524_1062813
1175 Ga0055524_1085871
1176 Ga0055531_10019481
1177 Ga0065165_1045702
1178 Ga0070658_10383733
1179 Ga0070658_10623219
1180 Ga0070683_100023244
1181 Ga0070683_100695457
1182 Ga0070670_100542044
1183 Ga0070670_101195684
1184 Ga0070670_102168246
1185 Ga0068869_100936050
1186 Ga0070680_100014564
1187 Ga0070680_100015700
1188 Ga0070682_100442339
1189 Ga0068868_100578760
1190 Ga0070660_100109060
1191 Ga0070660_100201711
1192 Ga0070660_100535213
1193 Ga0070689_100344345
1194 Ga0070687_100539533
1195 Ga0070661_100079443
1196 Ga0070661_100678029
1197 Ga0070668_100583071
1198 Ga0070669_100238265
1199 Ga0070669_100281169
1200 Ga0070671_100706281
1201 Ga0070674_100133626
1202 Ga0070674_100883062
1203 Ga0070688_100196684
1204 Ga0070659_100037280
1205 Ga0070659_100170780
1206 Ga0070659_100529911
1207 Ga0070667_100179404
1208 Ga0070709_10010696
1209 Ga0070709_10419245
1210 Ga0070714_100072547
1211 Ga0070714_100193146
1212 Ga0070714_101207818
1213 Ga0070713_100068252
1214 Ga0070713_100080701
1215 Ga0070710_10000283
1216 Ga0070710_10051363
1217 Ga0070711_100020650
1218 Ga0070711_100240428
1219 Ga0070663_100253510
1220 Ga0070663_100803986
1221 Ga0070662_101064158
1222 Ga0070681_10054618
1223 Ga0070699_100983428
1224 Ga0070679_100050877
1225 Ga0070684_100187853
1226 Ga0070697_100032323
1227 Ga0068853_100000920
1228 Ga0068853_100397427
1229 Ga0070686_100183446
1230 Ga0070693_100235979
1231 Ga0070693_100351464
1232 Ga0070665_100028814
1233 Ga0070665_100102933
1234 Ga0070665_101492609
1235 Ga0068855_100034165
1236 Ga0068855_100124443
1237 Ga0068855_100294811
1238 Ga0068855_100311730
1239 Ga0068855_100764269
1240 Ga0068855_100849040
1241 Ga0068855_101390605
1242 Ga0070664_100650709
1243 Ga0070664_100774044
1244 Ga0070664_101183284
1245 Ga0068854_100277245
1246 Ga0068854_100292701
1247 Ga0068854_100377294
1248 Ga0068856_100349604
1249 Ga0068856_101292915
1250 Ga0070702_100043889
1251 Ga0068852_100060632
1252 Ga0068852_100405525
1253 Ga0068852_100906959
1254 Ga0068859_100634711
1255 Ga0068859_100954761
1256 Ga0068864_100162142
1257 Ga0068864_101054804
1258 Ga0068864_101358644
1259 Ga0068864_101629524
1260 Ga0068861_100237585
1261 Ga0068861_101094261
1262 Ga0068851_10016235
1263 Ga0068851_10109325
1264 Ga0068851_10588484
1265 Ga0068863_100059827
1266 Ga0068863_100128685
1267 Ga0068863_100936213
1268 Ga0068858_100415799
1269 Ga0068858_100453568
1270 Ga0068858_100673789
1271 Ga0068858_100676361
1272 Ga0068858_100949875
1273 Ga0068860_100009370
1274 Ga0068860_101373757
1275 Ga0068862_100430126
1276 Ga0081455_10010427
1277 Ga0081455_10043997
1278 Ga0081455_10083029
1279 Ga0081455_10170416
1280 Ga0081455_10354396
1281 Ga0081538_10014842
1282 Ga0081540_1003025
1283 Ga0081540_1014806
1284 Ga0081540_1037299
1285 Ga0081540_1037745
1286 Ga0081540_1063581
1287 Ga0081540_1063752
1288 Ga0081540_1177086
1289 Ga0081539_10000371
1290 Ga0081539_10037844
1291 Ga0070717_10036925
1292 Ga0070717_10078208
1293 Ga0075365_10057032
1294 Ga0075365_10111236
1295 Ga0075365_10114527
1296 Ga0075365_10208706
1297 Ga0075365_10384894
1298 Ga0075365_10410113
1299 Ga0075368_10025300
1300 Ga0075368_10189399
1301 Ga0075363_100073480
1302 Ga0075364_10024937
1303 Ga0075364_10860226
1304 Ga0070715_10029252
1305 Ga0070716_100005381
1306 Ga0070716_100009820
1307 Ga0070712_100627367
1308 Ga0075362_10006558
1309 Ga0075362_10532935
1310 Ga0075367_10117832
1311 Ga0075367_10125096
1312 Ga0075367_10154455
1313 Ga0075369_10091435
1314 Ga0075369_10194370
1315 Ga0075369_10327134
1316 Ga0075369_10394995
1317 Ga0075369_10417488
1318 Ga0075369_10469828
1319 Ga0075366_10022052
1320 Ga0075366_10038501
1321 Ga0075366_10151254
1322 Ga0097621_100159781
1323 Ga0097621_100541616
1324 Ga0097621_100679314
1325 Ga0075370_10033836
1326 Ga0075370_10771944
1327 Ga0068871_101166374
1328 Ga0075433_10598341
1329 Ga0075434_100048414
1330 Ga0075429_100836864
1331 Ga0068865_100233401
1332 Ga0068865_100288795
1333 Ga0075436_100591414
1334 Ga0097620_100634679
1335 Ga0097620_100954718
1336 Ga0099824_1012181
1337 Ga0099822_1052019
1338 Ga0099823_1082437
1339 Ga0075435_100018590
1340 Ga0075435_101224898
1341 Ga0099794_10126689
1342 Ga0099794_10231908
1343 Ga0099794_10252296
1344 Ga0099795_10096576
1345 Ga0099795_10310394
1346 Ga0105240_10133951
1347 Ga0105240_10134427
1348 Ga0105240_10199932
1349 Ga0105240_10390825
1350 Ga0105245_10836303
1351 Ga0105247_10129800
1352 Ga0105247_10173975
1353 Ga0105247_10175113
1354 Ga0105247_11004120
1355 Ga0114129_10686073
1356 Ga0105243_10126690
1357 Ga0105243_10195003
1358 Ga0105241_10187380
1359 Ga0105241_10357564
1360 Ga0105241_10507747
1361 Ga0105241_10747842
1362 Ga0105241_10889141
1363 Ga0105241_11146071
1364 Ga0105242_10330634
1365 Ga0105242_10783467
1366 Ga0105248_10317132
1367 Ga0105248_10409701
1368 Ga0105248_11365466
1369 Ga0105248_12565770
1370 Ga0105237_10028087
1371 Ga0105237_10039191
1372 Ga0105237_10099184
1373 Ga0105237_10218726
1374 Ga0105237_10265959
1375 Ga0105237_10313383
1376 Ga0105237_10460575
1377 Ga0105237_10732653
1378 Ga0105237_10764420
1379 Ga0105238_10009549
1380 Ga0105238_10051567
1381 Ga0105238_10064169
1382 Ga0105238_11451986
1383 Ga0105238_11469922
1384 Ga0105249_12341912
1385 Ga0099796_10059991
1386 Ga0105239_10224320
1387 Ga0105239_10317397
1388 Ga0105239_10678250
1389 Ga0105239_11014785
1390 Ga0105239_12934754
1391 Ga0105246_10611925
1392 Ga0105246_10710424
1393 Ga0157317_1005402
1394 Ga0157325_1001878
1395 Ga0157341_1016465
1396 Ga0157314_1006534
1397 Ga0157371_10405586
1398 Ga0157370_10448627
1399 Ga0157370_10497151
1400 Ga0157370_10584017
1401 Ga0157369_10028102
1402 Ga0157369_11134977
1403 Ga0157374_10226360
1404 Ga0157374_10570082
1405 Ga0157378_10682897
1406 Ga0163162_10774763
1407 Ga0163162_11052252
1408 Ga0163162_12263767
1409 Ga0157372_10742684
1410 Ga0157372_11793834
1411 Ga0157375_10075965
1412 Ga0157375_10083615
1413 Ga0163163_10002309
1414 Ga0163163_10167987
1415 Ga0157380_10205834
1416 Ga0182008_10209579
1417 Ga0157379_10059190
1418 Ga0157379_10611050
1419 Ga0157379_10850464
1420 Ga0157376_10347916
1421 Ga0157376_11622740
1422 Ga0163161_10066596
1423 Ga0163161_10440983
1424 Ga0154015_1163030
1425 Ga0214544_1000665
1426 Ga0214542_1000486
1427 Ga0214545_1000307
1428 Ga0214543_1006816
1429 Ga0213873_10118654
1430 Ga0213872_10169156
1431 Ga0213874_10003623
1432 Ga0213876_10121422
1433 Ga0213875_10258424
1434 Ga0213871_10029878
1435 Ga0209233_1001838
1436 Ga0209455_1017071
1437 Ga0209673_1018665
1438 Ga0207673_1018161
1439 Ga0209564_1011886
1440 Ga0209564_1043304
1441 Ga0209758_1000069
1442 Ga0209758_1001816
1443 Ga0209758_1002809
1444 Ga0209758_1003762
1445 Ga0209256_1011243
1446 Ga0209256_1080739
1447 Ga0207426_1001802
1448 Ga0207426_1015230
1449 Ga0207426_1030924
1450 Ga0207426_1047994
1451 Ga0207426_1079718
1452 Ga0209257_1004189
1453 Ga0207697_10070501
1454 Ga0207697_10341159
1455 Ga0207656_10015110
1456 Ga0207682_10315490
1457 Ga0207692_10000528
1458 Ga0207692_10130821
1459 Ga0207710_10060320
1460 Ga0207710_10122943
1461 Ga0207710_10187507
1462 Ga0207688_10204077
1463 Ga0207647_10040407
1464 Ga0207647_10366999
1465 Ga0207685_10044646
1466 Ga0207699_10000514
1467 Ga0207699_10070793
1468 Ga0207699_11140236
1469 Ga0207645_10298195
1470 Ga0207705_10234920
1471 Ga0207654_10014767
1472 Ga0207654_10322413
1473 Ga0207654_10599745
1474 Ga0207707_10001402
1475 Ga0207707_11247731
1476 Ga0207695_10000148
1477 Ga0207695_10035369
1478 Ga0207695_11016166
1479 Ga0207671_10010517
1480 Ga0207671_10171644
1481 Ga0207671_10178688
1482 Ga0207671_10361077
1483 Ga0207671_10507683
1484 Ga0207671_10594310
1485 Ga0207693_11053514
1486 Ga0207663_10000375
1487 Ga0207663_11407537
1488 Ga0207660_10007154
1489 Ga0207660_11059302
1490 Ga0207657_10021854
1491 Ga0207657_10040608
1492 Ga0207657_10106288
1493 Ga0207649_10227090
1494 Ga0207652_10001370
1495 Ga0207652_10042897
1496 Ga0207694_10005792
1497 Ga0207694_10023040
1498 Ga0207694_10590934
1499 Ga0207650_10242996
1500 Ga0207700_10074549
1501 Ga0207700_10145281
1502 Ga0207700_10210417
1503 Ga0207664_10018511
1504 Ga0207644_10350332
1505 Ga0207644_10618394
1506 Ga0207644_11004837
1507 Ga0207690_10150083
1508 Ga0207690_10534696
1509 Ga0207690_10685655
1510 Ga0207690_10908302
1511 Ga0207690_10992791
1512 Ga0207709_10054065
1513 Ga0207709_10311954
1514 Ga0207670_10293149
1515 Ga0207669_11479123
1516 Ga0207665_10003115
1517 Ga0207665_10010646
1518 Ga0207665_10296491
1519 Ga0207691_10578544
1520 Ga0207691_10833628
1521 Ga0207711_10107803
1522 Ga0207661_10078153
1523 Ga0207679_10171066
1524 Ga0207667_10011391
1525 Ga0207667_10046568
1526 Ga0207667_10183170
1527 Ga0207667_10507748
1528 Ga0207651_10581373
1529 Ga0207712_11252058
1530 Ga0207640_11582157
1531 Ga0207677_11522033
1532 Ga0207703_10118886
1533 Ga0207703_10376871
1534 Ga0207703_10387474
1535 Ga0207703_10529086
1536 Ga0207703_10731290
1537 Ga0207639_10003644
1538 Ga0207678_10060408
1539 Ga0207678_10067321
1540 Ga0207678_10078168
1541 Ga0207708_10093722
1542 Ga0207641_10400846
1543 Ga0207641_10774314
1544 Ga0207676_10538323
1545 Ga0207674_11485577
1546 Ga0207675_100096943
1547 Ga0207683_11356461
1548 Ga0207698_10365284
1549 Ga0207698_10393003
1550 Ga0207698_10490768
1551 Ga0209389_1000102
1552 Ga0209389_1000142
1553 Ga0209589_1000331
1554 Ga0209489_100404
1555 Ga0209489_100818
1556 Ga0209700_100408
1557 Ga0209179_1018328
1558 Ga0209588_1046161
1559 Ga0209588_1056188
1560 Ga0209588_1136615
1561 Ga0209813_10017902
1562 Ga0268266_10060667
1563 Ga0268266_10182887
1564 Ga0268266_10645646
1565 Ga0268266_10659617
1566 Ga0268265_10600113
1567 Ga0268265_11547155
1568 Ga0268264_10000062
1569 Ga0268264_10542965
1570 Ga0307517_10052032
1571 Ga0307515_10780960
1572 Ga0265338_10337098
1573 Ga0307511_10010436
1574 Ga0307511_10310558
1575 Ga0265330_10312673
1576 Ga0265332_10099658
1577 Ga0265340_10095977
1578 Ga0265340_10361349
1579 Ga0265339_10001952
1580 Ga0265339_10491048
1581 Ga0265331_10085454
1582 Ga0265331_10299937
1583 Ga0265316_10378917
1584 Ga0307509_10017327
1585 Ga0307509_10269134
1586 Ga0307509_10662878
1587 Ga0307408_100622235
1588 Ga0307408_100657148
1589 Ga0307508_10000045
1590 Ga0307508_10047658
1591 Ga0307508_10120784
1592 Ga0265314_10108259
1593 Ga0265342_10020865
1594 Ga0307516_10026835
1595 Ga0307516_10137097
1596 Ga0307516_10297040
1597 Ga0307405_10622847
1598 Ga0307413_10660622
1599 Ga0307413_11119032
1600 Ga0307407_10554950
1601 Ga0307407_10686079
1602 Ga0307412_10502552
1603 Ga0307409_101088071
1604 Ga0307411_10038130
1605 Ga0307510_10010957
1606 Ga0307510_10431818
1607 Ga0316215_1011516
1608 Ga0373959_0038660
1609 Ga0373934_0259164
1610 Ga0373923_0223445
1611 Ga0373936_0332996
1612 Ga0373936_0351452
1613 Ga0373939_0479866
1614 Ga0373954_0061866
1615 Ga0373954_0173530
1616 Ga0373954_0192768
1617 Ga0373956_0007299
1618 Ga0373956_0146057
1619 Ga0373957_0007506
1620 Ga0373957_0223508
1621 Ga0373960_0355211
1622 Ga0373943_0374942
1623 Ga0373955_0003121
1624 Ga0373955_0396534
1625 Ga0373931_0163171
1626 Ga0373931_0622943
1627 Ga0373935_0032158
1628 Ga0373935_0352252
1629 Ga0373927_0003114
1630 Ga0373927_0049191
1631 Ga0373927_0197509
1632 Ga0373933_0009258
1633 Ga0373933_0066469
1634 Ga0373933_0473136
1635 Ga0373947_0282754
1636 Ga0373947_1134146
1637 Ga0373937_0151876
1638 Ga0373937_0230904
1639 Ga0373937_0288496
1640 Ga0373937_0454536
1641 Ga0373937_1239083
1642 Ga0373937_1738013
1643 Ga0372808_012769
1644 Ga0373925_0033134
1645 Ga0373925_0121975
1646 Ga0373925_0198658
1647 Ga0373925_0357950
1648 Ga0373925_0655045
1649 Ga0373925_0671720
1650 Ga0373925_0775711
1651 Ga0395900_0000423
1652 Ga0395900_1581642
1653 Ga0395898_0081670
1654 Ga0395898_0913048
1655 Ga0395905_0005673
1656 Ga0395905_0115129
1657 Ga0395905_0176138
1658 Ga0436364_0051449
1659 Ga0395901_0373835
1660 Ga0395901_0528170
1661 Ga0395901_0557647
1662 Ga0395901_1053206
1663 Ga0436365_0586546
1664 Ga0436360_0143142
1665 Ga0436361_0176947
1666 Ga0436363_0027301
1667 Ga0436363_0135636
1668 Ga0436363_0269693
1669 Ga0436363_1282335
1670 Ga0436362_0194607
1671 Ga0436362_0453804
1672 Ga0439465_0047746
1673 Ga0451787_565100
1674 Ga0451793_0482409
1675 Ga0451793_0836339
1676 Ga0451793_1542853
1677 Ga0451795_0789601
1678 Ga0451798_0816637
1679 Ga0451802_1491483
1680 Ga0451833_1378080
1681 Ga0451835_0981114
1682 Ga0451839_0985516
1683 Ga0451841_1090559
1684 Ga0451847_0750816
1685 Ga0451855_0430394
1686 Ga0451853_1499260
1687 Ga0451853_2423794
1688 Ga0451853_3390207
1689 Ga0439431_0207559
1690 Ga0439445_0042630
1691 Ga0439448_0133630
1692 Ga0439455_0099111
1693 Ga0439458_0056226
1694 Ga0439464_0029082
1695 Ga0466969_0132254
1696 Ga0466969_0144423
1697 Ga0466969_0211617
1698 Ga0466972_0025516
1699 Ga0466965_0069980
1700 Ga0466966_0004154
1701 Ga0466966_0031064
1702 Ga0466966_0204752
1703 Ga0466961_0002447
1704 Ga0466961_0285146
1705 Ga0466963_1160690
1706 Ga0466964_0156272
1707 Ga0466964_0348381
1708 Ga0466964_0814907
1709 Ga0466968_0073105
1710 Ga0466968_0101138
1711 Ga0466970_0437165
1712 Ga0466970_0551289
1713 Ga0466957_0378748
1714 Ga0466960_0447350
1715 Ga0466959_0010880
1716 Ga0466959_0084689
1717 Ga0466958_0752566
1718 Ga0466967_0311416
1719 Ga0466967_0414521
1720 Ga0495617_100184
1721 Ga0495627_080617
1722 Ga0495592_0138715
1723 Ga0495603_0002927
1724 Ga0495603_0067974
1725 Ga0495603_0104907
1726 Ga0495603_0259140
1727 Ga0495629_0002247
1728 Ga0495629_0045318
1729 Ga0495638_0061973
1730 Ga0495651_0041199
1731 Ga0495651_0060030
1732 Ga0495651_0071962
1733 Ga0495651_0155302
1734 Ga0495651_0546408
1735 Ga0495653_0123109
1736 Ga0495653_0200290
1737 Ga0495650_0028358
1738 Ga0495650_0063070
1739 Ga0495580_0178259
1740 Ga0495580_0522598
1741 Ga0495582_0289573
1742 Ga0495582_0445351
1743 Ga0495639_0061264
1744 Ga0495639_0297634
1745 Ga0495662_0109838
1746 Ga0495664_0088911
1747 Ga0495664_0103879
1748 Ga0495664_0567215
1749 Ga0495664_0633415
1750 Ga0495594_0084225
1751 Ga0495594_0188951
1752 Ga0495596_0341271
1753 Ga0495583_0175433
1754 Ga0495583_0214030
1755 Ga0495606_0040010
1756 Ga0495606_0059574
1757 Ga0495606_0297457
1758 Ga0495606_0333367
1759 Ga0495608_0005612
1760 Ga0495608_0133033
1761 Ga0495608_0170942
1762 Ga0495610_0168016
1763 Ga0495616_0156768
1764 Ga0495620_0047973
1765 Ga0495620_0084851
1766 Ga0495620_0136284
1767 Ga0495628_0359976
1768 Ga0495628_0592620
1769 Ga0495628_0678350
1770 Ga0495630_0339545
1771 Ga0495630_0508099
1772 Ga0495631_0104414
1773 Ga0495631_0116959
1774 Ga0495632_0294467
1775 Ga0495643_0023760
1776 Ga0495643_0299870
1777 Ga0495644_0106904
1778 Ga0495644_0256654
1779 Ga0495648_0001071
1780 Ga0495648_0023901
1781 Ga0495663_0243817
1782 Ga0495666_0136460
1783 Ga0495666_0482452
1784 Ga0495652_0003554
1785 Ga0495652_0073428
1786 Ga0495652_0177268
1787 Ga0495654_0223988
1788 Ga0495640_0044185
1789 Ga0495640_0062316
1790 Ga0495640_0114258
1791 Ga0495586_0732768
1792 Ga0495587_0033762
1793 Ga0495587_0091128
1794 Ga0495587_0204029
1795 Ga0495598_0049751
1796 Ga0495598_0448384
1797 Ga0495609_0070949
1798 Ga0495621_0143424
1799 Ga0495621_0281370
1800 Ga0495597_0057043
1801 Ga0495645_0068066
1802 Ga0495645_0378118
1803 Ga0495645_0754309
1804 Ga0495622_0013813
1805 Ga0495622_0023944
1806 Ga0495622_0073274
1807 Ga0495633_0038422
1808 Ga0495667_0019676
1809 Ga0495667_0023430
1810 Ga0495667_0171352
1811 Ga0495656_0044637
1812 Ga0495656_0061194
1813 Ga0495656_0126148
1814 Ga0495656_0347015
1815 Ga0495668_0075940
1816 Ga0495634_0021044
1817 Ga0495634_0303553
1818 Ga0495611_0250768
1819 Ga0495611_0294953
1820 Ga0495611_0341698
1821 Ga0495625_0166693
1822 Ga0495625_0343974
1823 Ga0495635_0000518
1824 Ga0495635_0063148
1825 Ga0495635_0126789
1826 Ga0495659_0010063
1827 Ga0495661_0231978
1828 Ga0495661_0329225
1829 Ga0495588_0009837
1830 Ga0495588_0113878
1831 Ga0495588_0301906
1832 Ga0495657_0033964
1833 Ga0495657_0052303
1834 Ga0495599_0020044
1835 Ga0495599_0166928
1836 Ga0495599_0703156
1837 Ga0495623_0067855
1838 Ga0495623_0085022
1839 Ga0495623_0127784
1840 Ga0495623_0335729
1841 Ga0495623_0338732
1842 Ga0495646_0082212
1843 Ga0495646_0164669
1844 Ga0495669_0135569
1845 Ga0495669_0550223
1846 Ga0495613_0030680
1847 Ga0495613_0259812
1848 Ga0495624_0011806
1849 Ga0495670_0536894
1850 Ga0495671_0248144
1851 Ga0495649_0030765
1852 Ga0495589_0236609
1853 Ga0495589_0271382
1854 Ga0495600_0002373
1855 Ga0495600_0016070
1856 Ga0495600_0035930
1857 Ga0495600_0333784
1858 Ga0495660_0356805
1859 Ga0495581_0198184
1860 Ga0495581_0436564
1861 Ga0495604_0006952
1862 Ga0495604_0029653
1863 Ga0495604_0036855
1864 Ga0495604_0330886
1865 Ga0495604_0543772
1866 Ga0495604_0777032
1867 Ga0495636_0202109
1868 Ga0495674_0039456
1869 Ga0495674_0540577
1870 Ga0495674_0580068
1871 Ga0495676_0130150
1872 Ga0495676_0215351
1873 Ga0495680_0000836
1874 Ga0495680_0008429
1875 Ga0495680_0485026
1876 Ga0495687_045937
1877 Ga0495675_0068182
1878 Ga0495675_0287354
1879 Ga0495677_0188656
1880 Ga0495673_0224770
1881 Ga0495681_0197733
1882 Ga0495681_0198256
1883 Ga0495684_0069405
1884 Ga0495684_0074557
1885 Ga0495686_0404260
1886 Ga0495686_0415821
1887 Ga0495686_0468298
1888 Ga0495593_0078690
1889 Ga0495593_0099511
1890 Ga0495602_0010323
1891 Ga0495602_0048250
1892 Ga0495602_0512717
1893 Ga0495614_0119228
1894 Ga0495615_0086912
1895 Ga0495615_0095921
1896 Ga0495626_0152403
1897 Ga0496100_0149228
1898 Ga0496100_0759905
1899 Ga0496101_0265498
1900 Ga0496101_0321858
1901 Ga0496101_0655308
1902 Ga0496102_0045566
1903 Ga0496102_0418109
1904 Ga0496102_0487919
1905 Ga0496102_0620921
1906 Ga0496102_0721381
1907 Ga0496103_0054910
1908 Ga0496104_0004634
1909 Ga0496104_0026368
1910 Ga0496104_0110671
1911 Ga0496104_0232275
1912 Ga0496104_0478552
1913 Ga0496104_0827865
1914 Ga0496105_0003681
1915 Ga0496105_0081495
1916 Ga0496105_0170684
1917 Ga0496105_0382661
1918 Ga0496105_0582515
1919 Ga0496105_0633839
1920 Ga0496106_0000418
1921 Ga0496106_0018008
1922 Ga0496106_0196553
1923 Ga0496106_0249624
1924 Ga0496106_0577497
1925 Ga0496106_0771940
1926 Ga0496107_0056745
1927 Ga0496107_0523153
1928 Ga0496107_1076386
1929 Ga0496108_0000160
1930 Ga0496108_0139529
1931 Ga0496108_0301705
1932 Ga0496108_0351566
1933 Ga0496108_0612861
1934 Ga0496108_0795381
1935 Ga0496108_1166270
1936 Ga0496109_0000245
1937 Ga0496109_0080707
1938 Ga0496109_0268416
1939 Ga0496110_0016871
1940 Ga0496110_0063465
1941 Ga0496110_0259815
1942 Ga0496110_0261213
1943 Ga0496110_1007372
1944 Ga0496111_0242194
1945 Ga0496112_0002354
1946 Ga0496112_0004583
1947 Ga0496112_0007772
1948 Ga0496112_0300031
1949 Ga0496113_0182620
1950 Ga0496113_0323863
1951 Ga0496113_0357999
1952 Ga0496113_0365118
1953 Ga0496113_0721963
1954 Ga0496114_0066281
1955 Ga0496114_0366763
1956 Ga0496114_0462920
1957 Ga0496115_0042101
1958 Ga0496115_0058169
1959 Ga0496115_0157966
1960 Ga0496115_0235838
1961 Ga0496115_0299766
1962 Ga0496115_0320282
1963 Ga0496115_0484106
1964 Ga0496117_0079927
1965 Ga0496117_0084006
1966 Ga0496117_0178558
1967 Ga0496118_0084321
1968 Ga0496118_0087769
1969 Ga0496118_0117977
1970 Ga0496119_0019116
1971 Ga0496120_0027214
1972 Ga0496120_0085508
1973 Ga0496120_0117763
1974 Ga0496121_0000870
1975 Ga0496121_0013066
1976 Ga0496121_0099010
1977 Ga0496121_0171854
1978 Ga0496121_0220536
1979 Ga0496121_0289697
1980 Ga0496121_0305040
1981 Ga0496121_0438387
1982 Ga0496122_0056378
1983 Ga0496124_0002001
1984 Ga0496124_0114932
1985 Ga0496124_0178979
1986 Ga0496124_0212059
1987 Ga0496125_0144598
1988 Ga0496125_0198535
1989 Ga0496125_0200222
1990 Ga0496125_0224925
1991 Ga0496126_0006373
1992 Ga0496126_0009545
1993 Ga0496126_0029863
1994 Ga0496126_0110823
1995 Ga0496126_0137150
1996 Ga0496126_0173050
1997 Ga0496126_0189018
1998 Ga0496126_0274071
1999 Ga0496126_0342784
2000 Ga0496126_0406444
2001 Ga0496126_0502755
2002 Ga0496126_0682442
2003 Ga0496126_0709951
2004 Ga0495682_0206565
2005 Ga0501038_0477786
2006 Ga0501041_0143277
2007 Ga0501042_0176809
2008 Ga0501067_0359480
2009 Ga0501067_0410813
2010 Ga0501068_0315939
2011 Ga0501068_0660582
2012 Ga0501069_0466185
2013 Ga0501071_0493807
2014 Ga0501071_0940973
2015 Ga0501076_0511982
2016 Ga0501083_0420202
2017 nmdc:mga03683_112267_c1
2018 nmdc:mga03683_123265_c1
2019 nmdc:mga03683_170084_c1
2020 nmdc:mga03n38_122732_c1
2021 nmdc:mga03n38_1367_c1
2022 nmdc:mga03n38_278702_c1
2023 nmdc:mga00v17_20079_c1
2024 nmdc:mga00v17_388103_c1
2025 nmdc:mga0yw44_1004707_c1
2026 nmdc:mga0yw44_121354_c1
2027 nmdc:mga0yw44_180263_c1
2028 nmdc:mga0yw44_29735_c1
2029 nmdc:mga0yw44_8494_c1
2030 nmdc:mga0yw44_945144_c1
2031 nmdc:mga0k408_132549_c1
2032 nmdc:mga0k408_26293_c1
2033 nmdc:mga0k408_502874_c1
2034 nmdc:mga0k408_553883_c1
2035 nmdc:mga06z11_371655_c1
2036 nmdc:mga04h51_156810_c1
2037 nmdc:mga04h51_16720_c1
2038 nmdc:mga04h51_228340_c1
2039 nmdc:mga07m45_49617_c1
2040 nmdc:mga05p37_749304_c1
2041 nmdc:mga0n895_382372_c1
2042 nmdc:mga0n895_46213_c1
2043 nmdc:mga0n895_668234_c1
2044 nmdc:mga0rr50_344517_c1
2045 nmdc:mga0rr50_71273_c1
2046 nmdc:mga08x19_104827_c1
2047 nmdc:mga08x19_714478_c1
2048 nmdc:mga0a205_1135367_c1
2049 nmdc:mga0sz30_151863_c1
2050 nmdc:mga0sz30_40225_c1
2051 nmdc:mga0sz30_90811_c1
2052 Ga0495601_0055846
2053 Ga0495601_0281500
2054 Ga0495601_0697931
2055 Ga0495612_0075671
2056 Ga0495612_0520474
2057 Ga0500635_0063352
2058 Ga0495655_0031743
2059 Ga0495655_0123060
2060 Ga0495595_0008882
2061 Ga0495595_0303218
2062 Ga0495595_0355527
2063 Ga0495619_0005412
2064 Ga0495619_0284632
2065 Ga0500578_0270262
2066 Ga0500581_251194
2067 Ga0500646_0165949
2068 Ga0500647_0095507
2069 Ga0500647_0234214
2070 Ga0500583_0299714
2071 Ga0500566_0130429
2072 Ga0500640_054172
2073 Ga0500648_182016
2074 Ga0500554_076860
2075 Ga0500556_0059932
2076 Ga0500557_000021
2077 Ga0500562_039860
2078 Ga0500591_050294
2079 Ga0500593_189461
2080 Ga0500594_0075919
2081 Ga0500594_0129711
2082 Ga0500594_0213344
2083 Ga0500595_140366
2084 Ga0500597_150326
2085 Ga0500597_243835
2086 Ga0500608_070625
2087 Ga0500608_330781
2088 Ga0500614_041049
2089 Ga0500628_042493
2090 Ga0500655_059345
2091 Ga0500658_0283307
2092 Ga0500559_0000649
2093 Ga0500559_0033175
2094 Ga0500559_0140317
2095 Ga0500559_0155088
2096 Ga0500568_0162972
2097 Ga0500568_0333947
2098 Ga0500573_0144977
2099 Ga0500590_115303
2100 Ga0500590_185940
2101 Ga0500603_004336
2102 Ga0500603_064653
2103 Ga0500616_0052121
2104 Ga0500622_0013877
2105 Ga0500627_0279084
2106 Ga0500638_066068
2107 Ga0500638_160353
2108 Ga0500638_170773
2109 Ga0500638_238668
2110 Ga0500639_048794
2111 Ga0500639_116387
2112 Ga0500636_0056063
2113 Ga0500636_0059218
2114 Ga0500636_0201176
2115 Ga0500636_0212514
2116 Ga0500637_0058713
2117 Ga0500637_0127423
2118 Ga0500637_0139669
2119 Ga0500649_057188
2120 Ga0500576_222186
2121 Ga0500625_061768
2122 Ga0500656_008404
2123 Ga0500596_002420
2124 Ga0500596_009510
2125 Ga0500599_008609
2126 Ga0500601_000725
2127 Ga0587090_116622
2128 Ga0587101_075440
2129 Ga0587111_0201864
2130 Ga0501082_0697134
2131 8019611845
2132 2507505450
2133 2508539335
2134 2508695663
2135 2509152179
2136 2511401382
2137 2513623926
2138 2513642191
2139 2513651334
2140 2513676315
2141 2513695287
2142 2513700719
2143 2513873347
2144 2513888580
2145 2514014678
2146 2515627645
2147 2517106280
2148 2524441441
2149 2524467227
2150 2528853319
2151 2617352061
2152 2617373530
2153 2723841821
2154 2728748432
2155 2745077575
2156 2793062236
2157 2793078305
2158 2805920695
2159 2818237856
2160 2824608736
2161 2824617663
2162 2824624828
2163 2824633706
2164 2824641783
2165 2824651226
2166 2824660126
2167 2824670748
2168 2824676573
2169 2824686613
2170 2824693235
2171 2824703454
2172 2824710500
2173 2824721042
2174 2824731208
2175 2824739251
2176 2824752141
2177 2824761755
2178 2824772254
2179 2824780843
2180 2838124698
2181 2841945390
2182 2841952176
2183 2841965346
2184 2841970437
2185 2841981685
2186 2841984966
2187 2842043320
2188 2842052690
2189 2844315545
2190 2847931248
2191 2847942341
2192 2849083213
2193 2857516354
2194 2874592549
2195 2874607886
2196 2874617980
2197 2874621203
2198 2874628602
2199 2874647168
2200 2876769641
2201 2876772552
2202 2876814185
2203 2876819813
2204 2879076319
2205 2879083770
2206 2879100439
2207 2879113313
2208 2879128803
2209 2879143624
2210 2881673208
2211 2885369335
2212 2885386902
2213 2888379402
2214 2888390501
2215 2888420122
2216 2889035303
2217 2903733686
2218 2903774505
2219 2904667748
2220 2904716330
2221 2906609466
2222 2906631668
2223 2906650273
2224 2908776002
2225 2922369388
2226 2922388488
2227 2922396584
2228 2929618783
2229 2929628532
2230 2932790965
2231 2932794142
2232 2932809218
2233 2932811981
2234 2932825568
2235 2932833681
2236 2933580507
2237 2935615520
2238 2935623207
2239 2935644282
2240 2935654450
2241 2935663330
2242 2935672136
2243 2935679343
2244 2935686585
2245 2935700367
2246 2935710315
2247 2935716273
2248 2935723603
2249 2935735158
2250 2935744051
2251 2935752551
2252 2935763315
2253 2935774289
2254 2935783346
2255 2935788996
2256 2935796746
2257 2935808306
2258 2935816080
2259 2935825679
2260 2935833474
2261 2935845968
2262 2935853443
2263 2935861455
2264 2935869574
2265 2935879903
2266 2935889169
2267 2935915045
2268 2935918893
2269 2935931390
2270 2935939987
2271 2935947666
2272 2935956437
2273 2935966717
2274 2935973231
2275 2935980526
2276 2935990123
2277 2935997874
2278 2936008861
2279 2936017511
2280 2936025988
2281 2936034830
2282 2936041085
2283 2936052912
2284 2936060229
2285 2940558464
2286 2941535343
2287 2941547137
2288 3005486674
2289 3005508980
2290 3005594137
2291 3005595235
2292 3005711177
2293 3005718473
2294 8006930829
2295 8006967636
2296 8006991106
2297 8007000435
2298 8016517993
2299 8016526328
2300 8016531390
2301 8016544604
2302 8016557471
2303 8016569658
2304 8016582266
2305 8016586150
2306 8016603428
2307 8016606365
2308 8016618273
2309 8016622922
2310 8016635426
2311 8017058649
2312 8019531224
2313 8019540329
2314 8019549922
2315 8019595075
2316 8019623163
2317 8019629935
2318 8019640671
2319 8019652282
2320 8019666772
2321 8019676532
2322 8019679456
2323 8019696048
2324 8055742632
2325 8056676140
2326 8056682940

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07617

DUF1579

Protein of unknown function (DUF1579)

6

146

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sfn-assembly1.cif.gz_A crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin 0.8596 8 158
7sfn-assembly1.cif.gz_B crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin 0.8564 4 158
7sfn-assembly1.cif.gz_A crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin 0.8435 8 158
7sfn-assembly1.cif.gz_B crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin 0.8407 4 158
3wjg-assembly1.cif.gz_A-2 crystal structure of mutant nitrobindin m75l/h76l/q96c/m148w/h158l (nb10) from arabidopsis thaliana 0.8203 14 157
ID Description Score Start End Superfamily
af_Q556I7_1_158_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8283 12 157 2.40.128.20
5bp3B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Polyketide synthase dehydratase 0.8214 119 155 3.10.129.110
3wjeB00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7975 9 157 2.40.128.20
af_Q22857_66_227_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7889 9 158 2.40.128.20
2fwvA00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7883 10 156 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A7Y4GZB7-F1-model_v4 DUF1579 domain-containing protein 0.984 3 158
AF-A0A534NU50-F1-model_v4 DUF1579 domain-containing protein 0.9835 8 157
AF-A0A537XP13-F1-model_v4 DUF1579 domain-containing protein 0.9823 34 158
AF-A0A2V8TSQ8-F1-model_v4 DUF1579 domain-containing protein 0.9809 6 157
AF-A0A431RL37-F1-model_v4 deleted 0.9744 1 140

Map