F491039
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1163 | 931 | 519 | 281 |
Family's Representative Sequence
| Representative Sequence | 3300021361|Ga0213872_10058442|Ga0213872_100584422 |
| Length | 292 |
| Sequence | MTIASVPKPAPNPTVPKLTGSRLGYRFNAVGVATLVVILAWTLVAIFAPVIIPHPVGEIVDADYFEPISAAAWLGSDYLGRDMFSRVLMGARYTVGISLAAVTIACLSGVVLGMAAAVTGGLFDTLLSRFLDAMNSIPSKLFGLVVVAAVGSSIPVLIVTLAIIYIPGAYRFARALAVNINTMDFMTVARIRGESTFYLIGSEILPNIIRPVLADLGLRFVFIVLLLSGLSFLGLGLQPPYADWGALVRENIGGLPFAAPAVIVPSIAIASLTISVNLLIDNLPQKIRDRSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 3 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 4 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 5 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 6 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 7 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 8 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 9 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 10 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 11 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 12 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 13 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 14 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 15 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 16 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 17 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 18 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 19 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 20 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 21 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 22 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 23 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 24 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 25 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 26 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 27 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 28 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 29 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 30 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 31 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 32 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 33 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 34 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 35 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 36 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 37 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 38 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 39 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 40 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 41 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 42 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 43 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 44 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 45 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 46 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 47 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 48 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 49 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 50 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 51 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 52 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 53 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 54 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 55 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 56 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 57 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 58 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 59 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 60 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 61 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 62 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 63 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 64 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 65 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 66 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 67 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 68 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 69 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 70 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 71 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 72 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 73 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 74 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 75 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 76 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 77 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 78 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 79 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 80 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 81 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 82 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 83 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 84 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 85 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 86 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 87 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 88 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 89 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 90 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 91 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 92 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 93 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 94 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 95 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 96 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 97 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 98 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 99 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 100 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 101 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 102 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 103 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 104 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 105 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 106 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 107 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 108 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 109 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 110 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 111 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 112 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 113 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 114 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 115 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 116 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 117 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 118 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 119 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 120 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 121 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 122 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 123 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 124 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 125 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 126 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 127 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 128 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 129 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 130 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 131 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 132 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 133 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 134 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 135 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 136 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 137 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 138 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 139 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 140 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 141 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 142 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 143 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 144 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 145 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 146 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 147 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 148 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 149 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 150 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 151 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 152 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 153 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 154 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 155 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 156 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 157 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 158 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 159 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 160 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 161 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 162 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 163 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 164 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 165 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 166 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 167 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 168 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 169 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 170 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 171 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 172 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 173 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 174 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 175 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 176 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 177 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 178 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 179 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 180 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 181 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 182 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 183 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 184 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 185 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 186 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 187 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 188 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 189 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 190 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 191 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 192 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 193 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 194 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 195 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 196 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 197 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 198 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 199 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 200 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 201 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 202 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 203 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 204 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 205 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 206 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 207 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 208 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 209 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 210 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 211 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 212 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 213 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 214 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 215 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 216 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 217 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 218 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 219 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 220 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 221 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 222 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 223 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 224 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 225 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 226 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 227 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 228 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 229 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 230 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 231 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 232 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 233 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 234 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 235 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 236 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 237 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 238 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 239 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 240 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 241 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 242 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 243 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 244 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 245 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 246 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 247 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 248 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 249 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 250 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 251 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 252 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 253 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 254 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 255 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 256 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 257 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 258 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 259 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 260 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 261 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 262 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 263 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 264 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 265 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 266 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 267 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 268 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 269 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 270 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 271 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 272 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 273 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 274 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 275 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 276 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 277 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 278 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 279 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 280 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 281 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 282 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 283 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 284 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 285 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 286 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 287 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 288 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 289 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 290 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 291 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 292 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 293 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 294 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 295 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 296 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 297 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 298 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 299 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 300 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 301 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 302 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 303 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 304 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 305 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 306 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 307 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 308 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 309 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 310 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 311 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 312 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 313 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 314 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 315 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 316 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 317 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 318 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 319 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 320 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 321 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 322 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 323 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 324 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 325 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 326 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 327 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 328 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 329 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 330 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 331 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 332 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 333 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 334 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 335 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 336 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 337 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 338 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 339 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 340 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 341 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 342 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 343 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 344 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 345 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 346 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 347 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 348 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 349 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 350 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 351 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 352 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 353 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 354 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 355 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 356 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 357 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 358 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 359 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 360 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 361 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 362 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 363 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 364 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 365 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 366 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 367 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 368 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 369 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 370 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 371 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 372 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 373 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 374 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 375 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 376 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 377 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 378 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 379 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 380 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 381 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 382 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 383 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 384 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 385 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 386 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 387 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 388 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 389 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 390 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 391 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 392 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 393 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 394 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 395 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 396 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 397 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 398 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 399 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 400 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 401 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 402 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 403 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 404 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 405 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 406 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 407 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 408 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 409 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 410 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 411 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 412 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 413 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 414 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 415 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 416 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 417 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 418 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 419 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 420 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 421 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 422 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 423 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 424 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 425 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 426 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 427 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 428 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 429 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 430 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 431 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 432 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 433 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 434 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 435 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 436 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 437 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 438 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 439 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 440 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 441 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 442 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 443 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 444 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 445 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 446 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 447 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 448 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 449 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 450 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 451 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 452 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 453 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 454 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 455 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 456 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 457 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 458 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 459 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 460 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 461 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 462 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 463 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 464 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 465 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 466 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 467 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 468 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 469 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 470 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 471 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 472 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 473 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 474 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 475 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 476 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 477 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 478 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 479 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 480 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 481 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 482 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 483 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 484 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 485 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 486 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 487 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 488 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 489 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 490 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 491 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 492 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 493 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 494 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 495 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 496 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 497 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 498 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 499 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 500 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 501 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 502 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 503 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 504 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 505 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 506 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 507 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 508 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 509 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 510 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 511 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 512 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 513 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 514 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 515 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 516 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 517 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 518 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 519 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 520 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 521 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 522 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 523 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 524 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 525 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 526 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 527 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 528 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 529 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 530 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 531 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 532 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 533 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 534 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 535 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 536 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 537 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 538 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 539 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 540 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 541 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 542 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 543 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 544 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 545 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 546 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 547 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 548 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 549 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 550 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 551 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 552 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 553 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 554 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 555 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 556 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 557 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 558 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 559 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 560 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 561 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 562 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 563 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 564 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 565 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 566 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 567 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 568 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 569 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 570 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 571 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 572 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 573 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 574 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 575 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 576 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 577 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 578 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 579 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 580 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 581 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 582 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 583 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 584 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 585 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 586 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 587 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 588 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 589 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 590 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 591 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 592 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 593 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 594 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 595 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 596 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 597 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 598 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 599 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 600 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 601 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 602 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 603 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 604 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 605 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 606 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 607 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 608 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 609 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 610 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 611 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 612 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 613 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 614 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 615 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 616 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 617 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 618 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 619 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 620 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 621 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 622 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 623 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 624 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 625 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 626 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 627 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 628 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 629 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 630 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 631 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 632 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 633 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 634 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 635 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 636 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 637 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 638 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 639 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 640 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 641 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 642 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 643 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 644 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 645 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 646 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 647 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 648 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 649 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 650 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 651 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 652 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 653 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 654 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 655 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 656 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 657 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 658 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 659 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 660 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 661 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 662 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 663 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 664 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 665 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 666 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 667 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 668 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 669 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 670 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 671 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 672 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 673 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 674 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 675 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 676 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 677 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 678 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 679 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 680 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 681 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 682 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 683 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 684 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 685 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 686 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 687 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 688 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 689 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 690 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 691 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 692 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 693 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 694 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 695 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 696 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 697 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 698 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 699 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 700 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 701 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 702 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 703 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 704 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 705 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 706 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 707 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 708 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 709 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 710 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 711 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 712 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 713 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 714 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 715 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 716 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 717 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 718 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 719 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 720 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 721 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 722 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 723 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 724 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 725 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 726 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 727 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 728 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 729 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 730 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 731 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 732 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 733 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 734 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 735 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 736 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 737 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 738 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 739 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 740 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 741 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 742 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 743 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 744 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 745 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 746 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 747 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 748 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 749 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 750 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 751 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 752 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 753 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 754 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 755 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 756 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 757 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 758 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 759 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 760 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 761 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 762 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 763 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 764 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 765 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 766 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 767 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 768 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 769 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 770 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 771 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 772 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 773 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 774 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 775 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 776 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 777 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 778 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 779 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 780 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 781 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 782 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 783 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 784 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 785 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 786 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 787 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 788 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 789 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 790 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 791 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 792 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 793 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 794 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 795 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 796 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 797 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 798 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 799 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 800 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 801 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 802 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 803 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 804 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 805 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 806 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 807 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 808 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 809 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 810 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 811 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 812 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 813 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 814 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 815 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 816 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 817 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 818 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 819 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 820 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 821 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 822 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 823 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 824 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 825 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 826 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 827 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 828 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 829 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 830 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 831 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 832 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 833 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 834 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 835 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 836 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 837 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 838 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 839 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 840 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 841 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 842 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 843 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 844 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 845 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 846 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 847 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 848 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 849 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 850 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 851 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 852 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 853 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 854 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 855 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 856 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 857 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 858 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 859 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 860 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 861 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 862 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 863 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 864 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 865 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 866 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 867 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 868 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 869 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 870 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 871 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 872 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 873 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 874 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 875 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 876 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 877 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 878 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 879 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 880 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 881 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 882 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 883 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 884 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 885 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 886 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 887 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 888 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 889 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 890 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 891 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 892 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 893 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 894 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 895 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 896 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 897 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 898 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 899 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 900 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 901 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 902 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 903 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 904 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 905 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 906 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 907 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 908 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 909 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 910 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 911 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 912 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 913 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 914 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 915 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 916 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 917 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 918 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 919 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 920 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 921 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 922 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 923 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 924 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 925 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 926 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 927 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 928 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 929 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 930 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 931 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 44.71 |
| Metatranscriptomes | 0 |
| Isolates | 55.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.34 |
| Bulb | 0 |
| Endosphere | 14.53 |
| Nodule | 46.26 |
| Rhizoplane | 1.81 |
| Rhizosphere | 24.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C2804 | 2010549000 | Bacteria | 2371 |
| 2 | JGI24740J21852_10000431 | 3300001979 | Bacteria | 17925 |
| 3 | JGI24740J21852_10008311 | 3300001979 | Bacteria | 4144 |
| 4 | JGI24739J22299_10041822 | 3300001989 | Bacteria | 1522 |
| 5 | JGI24739J22299_10043279 | 3300001989 | Bacteria | 1489 |
| 6 | JGI25155J39150_1000003 | 3300002704 | Bacteria | 279666 |
| 7 | JGI25156J39149_1000004 | 3300002705 | Bacteria | 273027 |
| 8 | JGI25162J39368_1000069 | 3300002737 | Bacteria | 125244 |
| 9 | JGI25154J39366_1000013 | 3300002738 | Bacteria | 268260 |
| 10 | JGI25157J39369_1000004 | 3300002741 | Bacteria | 273009 |
| 11 | JGI25152J39213_1011381 | 3300002773 | Bacteria | 1971 |
| 12 | JGI25151J46595_10000867 | 3300003187 | Bacteria | 23973 |
| 13 | JGI25151J46595_10031432 | 3300003187 | Bacteria | 2074 |
| 14 | JGI25165J46597_1000018 | 3300003214 | Bacteria | 374701 |
| 15 | JGI25165J46597_1000372 | 3300003214 | Bacteria | 50057 |
| 16 | JGI25165J46597_1007625 | 3300003214 | Bacteria | 1774 |
| 17 | JGI25153J46596_10000974 | 3300003215 | Bacteria | 17386 |
| 18 | JGI25153J46596_10011736 | 3300003215 | Bacteria | 3846 |
| 19 | rootH1_10170074 | 3300003316 | Bacteria | 1402 |
| 20 | rootH2_10010113 | 3300003320 | Bacteria | 9520 |
| 21 | rootH1_10024239 | 3300003323 | Bacteria | 2874 |
| 22 | rootH1_10114644 | 3300003323 | Bacteria | 1369 |
| 23 | JGI25160J50197_1000203 | 3300003354 | Bacteria | 49418 |
| 24 | JGI25160J50197_1002223 | 3300003354 | Bacteria | 9111 |
| 25 | JGI25161J50226_1000570 | 3300003374 | Bacteria | 15614 |
| 26 | Ga0055542_1000068 | 3300003762 | Bacteria | 152353 |
| 27 | Ga0055529_1006909 | 3300003763 | Bacteria | 1560 |
| 28 | Ga0055526_1000308 | 3300003771 | Bacteria | 40807 |
| 29 | Ga0055526_1002146 | 3300003771 | Bacteria | 13527 |
| 30 | Ga0055526_1009056 | 3300003771 | Bacteria | 4857 |
| 31 | Ga0055524_1004129 | 3300003775 | Bacteria | 6804 |
| 32 | Ga0055536_1000640 | 3300003781 | Bacteria | 23814 |
| 33 | Ga0055528_1000054 | 3300003790 | Bacteria | 90334 |
| 34 | Ga0055528_1001635 | 3300003790 | Bacteria | 13189 |
| 35 | Ga0055530_10026839 | 3300003791 | Bacteria | 1583 |
| 36 | Ga0055540_1008780 | 3300003792 | Bacteria | 3586 |
| 37 | Ga0055540_1032064 | 3300003792 | Bacteria | 1202 |
| 38 | Ga0055531_10004096 | 3300003794 | Bacteria | 9020 |
| 39 | Ga0058692_1001981 | 3300003856 | Bacteria | 7129 |
| 40 | Ga0058692_1003239 | 3300003856 | Bacteria | 5106 |
| 41 | Ga0058692_1006050 | 3300003856 | Bacteria | 3372 |
| 42 | Ga0055543_1000558 | 3300004625 | Bacteria | 20769 |
| 43 | Ga0055543_1001165 | 3300004625 | Bacteria | 11186 |
| 44 | Ga0065165_1000672 | 3300005262 | Bacteria | 49172 |
| 45 | Ga0065165_1008544 | 3300005262 | Bacteria | 4764 |
| 46 | Ga0070658_10051088 | 3300005327 | Bacteria | 3350 |
| 47 | Ga0070670_100000875 | 3300005331 | Bacteria | 23662 |
| 48 | Ga0070670_100076245 | 3300005331 | Bacteria | 2881 |
| 49 | Ga0070670_100153761 | 3300005331 | Bacteria | 1992 |
| 50 | Ga0070666_10025758 | 3300005335 | Bacteria | 3837 |
| 51 | Ga0068868_100254226 | 3300005338 | Bacteria | 1479 |
| 52 | Ga0070661_100215985 | 3300005344 | Bacteria | 1469 |
| 53 | Ga0070668_100012960 | 3300005347 | Bacteria | 6207 |
| 54 | Ga0070668_100238357 | 3300005347 | Bacteria | 1506 |
| 55 | Ga0070669_100013332 | 3300005353 | Bacteria | 5843 |
| 56 | Ga0070667_100081761 | 3300005367 | Bacteria | 2764 |
| 57 | Ga0070663_100316409 | 3300005455 | Bacteria | 1254 |
| 58 | Ga0070678_100292621 | 3300005456 | Bacteria | 1381 |
| 59 | Ga0070662_100035439 | 3300005457 | Bacteria | 3524 |
| 60 | Ga0068867_100090481 | 3300005459 | Bacteria | 2322 |
| 61 | Ga0068853_100014109 | 3300005539 | Bacteria | 6541 |
| 62 | Ga0070665_100023970 | 3300005548 | Bacteria | 6146 |
| 63 | Ga0070665_100026871 | 3300005548 | Bacteria | 5798 |
| 64 | Ga0070665_100083416 | 3300005548 | Bacteria | 3201 |
| 65 | Ga0068855_100133933 | 3300005563 | Bacteria | 2828 |
| 66 | Ga0068855_100248883 | 3300005563 | Bacteria | 1983 |
| 67 | Ga0068857_100080305 | 3300005577 | Bacteria | 2912 |
| 68 | Ga0068854_100079341 | 3300005578 | Bacteria | 2420 |
| 69 | Ga0068856_100022697 | 3300005614 | Bacteria | 6101 |
| 70 | Ga0068856_100226958 | 3300005614 | Bacteria | 1883 |
| 71 | Ga0068852_100000915 | 3300005616 | Bacteria | 19555 |
| 72 | Ga0068852_100370149 | 3300005616 | Bacteria | 1404 |
| 73 | Ga0068852_100403498 | 3300005616 | Bacteria | 1345 |
| 74 | Ga0068859_100336297 | 3300005617 | Bacteria | 1604 |
| 75 | Ga0068861_100131658 | 3300005719 | Bacteria | 2030 |
| 76 | Ga0068858_100059748 | 3300005842 | Bacteria | 3523 |
| 77 | Ga0068858_100113038 | 3300005842 | Bacteria | 2536 |
| 78 | Ga0068860_100000223 | 3300005843 | Bacteria | 88152 |
| 79 | Ga0068860_100357463 | 3300005843 | Bacteria | 1438 |
| 80 | Ga0070717_10319571 | 3300006028 | Bacteria | 1383 |
| 81 | Ga0075365_10000531 | 3300006038 | Bacteria | 14672 |
| 82 | Ga0075365_10013583 | 3300006038 | Bacteria | 4878 |
| 83 | Ga0075365_10114102 | 3300006038 | Bacteria | 1859 |
| 84 | Ga0075365_10280843 | 3300006038 | Bacteria | 1172 |
| 85 | Ga0075368_10024453 | 3300006042 | Bacteria | 2314 |
| 86 | Ga0075368_10050824 | 3300006042 | Bacteria | 1647 |
| 87 | Ga0075363_100017924 | 3300006048 | Bacteria | 3519 |
| 88 | Ga0075364_10005543 | 3300006051 | Bacteria | 7351 |
| 89 | Ga0075364_10033420 | 3300006051 | Bacteria | 3312 |
| 90 | Ga0075364_10185728 | 3300006051 | Bacteria | 1407 |
| 91 | Ga0075362_10006562 | 3300006177 | Bacteria | 4345 |
| 92 | Ga0075362_10018491 | 3300006177 | Bacteria | 2884 |
| 93 | Ga0075362_10126842 | 3300006177 | Bacteria | 1211 |
| 94 | Ga0075367_10000241 | 3300006178 | Bacteria | 18607 |
| 95 | Ga0075367_10004266 | 3300006178 | Bacteria | 6952 |
| 96 | Ga0075367_10011472 | 3300006178 | Bacteria | 4691 |
| 97 | Ga0075367_10019149 | 3300006178 | Bacteria | 3791 |
| 98 | Ga0075367_10048850 | 3300006178 | Bacteria | 2493 |
| 99 | Ga0075367_10078466 | 3300006178 | Bacteria | 1994 |
| 100 | Ga0075367_10148372 | 3300006178 | Bacteria | 1455 |
| 101 | Ga0075367_10198256 | 3300006178 | Bacteria | 1254 |
| 102 | Ga0075369_10009321 | 3300006186 | Bacteria | 3809 |
| 103 | Ga0075369_10015713 | 3300006186 | Bacteria | 3043 |
| 104 | Ga0075369_10025405 | 3300006186 | Bacteria | 2463 |
| 105 | Ga0075369_10044681 | 3300006186 | Bacteria | 1904 |
| 106 | Ga0075369_10059305 | 3300006186 | Bacteria | 1667 |
| 107 | Ga0075366_10020788 | 3300006195 | Bacteria | 3810 |
| 108 | Ga0075366_10038290 | 3300006195 | Bacteria | 2832 |
| 109 | Ga0075366_10050002 | 3300006195 | Bacteria | 2482 |
| 110 | Ga0075366_10078718 | 3300006195 | Bacteria | 1967 |
| 111 | Ga0075366_10137917 | 3300006195 | Bacteria | 1474 |
| 112 | Ga0075370_10006474 | 3300006353 | Bacteria | 5894 |
| 113 | Ga0075370_10023613 | 3300006353 | Bacteria | 3388 |
| 114 | Ga0075370_10089013 | 3300006353 | Bacteria | 1780 |
| 115 | Ga0097620_100336301 | 3300006931 | Bacteria | 1604 |
| 116 | Ga0099824_1032205 | 3300006942 | Bacteria | 1899 |
| 117 | Ga0079104_1000014 | 3300006946 | Bacteria | 337362 |
| 118 | Ga0079104_1003957 | 3300006946 | Bacteria | 6598 |
| 119 | Ga0099826_10000665 | 3300006948 | Bacteria | 17773 |
| 120 | Ga0099826_10171592 | 3300006948 | Bacteria | 1217 |
| 121 | Ga0105240_10000217 | 3300009093 | Bacteria | 115649 |
| 122 | Ga0105240_10009904 | 3300009093 | Bacteria | 13443 |
| 123 | Ga0105240_10404469 | 3300009093 | Bacteria | 1537 |
| 124 | Ga0111539_10424519 | 3300009094 | Bacteria | 1548 |
| 125 | Ga0105247_10045309 | 3300009101 | Bacteria | 2698 |
| 126 | Ga0105247_10219097 | 3300009101 | Bacteria | 1287 |
| 127 | Ga0105243_10009663 | 3300009148 | Bacteria | 7343 |
| 128 | Ga0105243_10025719 | 3300009148 | Bacteria | 4501 |
| 129 | Ga0105243_10425834 | 3300009148 | Bacteria | 1239 |
| 130 | Ga0105241_10006946 | 3300009174 | Bacteria | 8333 |
| 131 | Ga0105241_10011661 | 3300009174 | Bacteria | 6449 |
| 132 | Ga0105241_10098005 | 3300009174 | Bacteria | 2325 |
| 133 | Ga0105248_10002569 | 3300009177 | Bacteria | 20178 |
| 134 | Ga0105237_10000978 | 3300009545 | Bacteria | 38384 |
| 135 | Ga0105237_10001626 | 3300009545 | Bacteria | 29169 |
| 136 | Ga0105237_10312721 | 3300009545 | Bacteria | 1574 |
| 137 | Ga0105237_10663129 | 3300009545 | Bacteria | 1050 |
| 138 | Ga0105238_10007717 | 3300009551 | Bacteria | 10755 |
| 139 | Ga0105238_10133090 | 3300009551 | Bacteria | 2465 |
| 140 | Ga0105249_10561523 | 3300009553 | Bacteria | 1193 |
| 141 | Ga0123340_1036321 | 3300009763 | Bacteria | 2580 |
| 142 | Ga0123341_1047292 | 3300009765 | Bacteria | 2544 |
| 143 | Ga0105239_10009668 | 3300010375 | Bacteria | 10844 |
| 144 | Ga0105239_10024076 | 3300010375 | Bacteria | 6706 |
| 145 | Ga0105239_10027867 | 3300010375 | Bacteria | 6215 |
| 146 | Ga0105239_10159235 | 3300010375 | Bacteria | 2522 |
| 147 | Ga0105239_10364409 | 3300010375 | Bacteria | 1633 |
| 148 | Ga0105246_10004096 | 3300011119 | Bacteria | 8849 |
| 149 | Ga0105246_10156773 | 3300011119 | Bacteria | 1730 |
| 150 | Ga0105246_10160270 | 3300011119 | Bacteria | 1713 |
| 151 | Ga0157373_10004938 | 3300013100 | Bacteria | 10032 |
| 152 | Ga0157371_10000002 | 3300013102 | Bacteria | 665040 |
| 153 | Ga0157370_10003627 | 3300013104 | Bacteria | 18062 |
| 154 | Ga0157370_10005183 | 3300013104 | Bacteria | 14691 |
| 155 | Ga0157369_10021904 | 3300013105 | Bacteria | 7144 |
| 156 | Ga0171462_1012 | 3300013250 | Bacteria | 208216 |
| 157 | Ga0157374_10119829 | 3300013296 | Bacteria | 2538 |
| 158 | Ga0157374_10157901 | 3300013296 | Bacteria | 2208 |
| 159 | Ga0157378_10039964 | 3300013297 | Bacteria | 4160 |
| 160 | Ga0157378_10325447 | 3300013297 | Bacteria | 1494 |
| 161 | Ga0163162_10085820 | 3300013306 | Bacteria | 3225 |
| 162 | Ga0163162_10229727 | 3300013306 | Bacteria | 1986 |
| 163 | Ga0163163_10007929 | 3300014325 | Bacteria | 9388 |
| 164 | Ga0182008_10105220 | 3300014497 | Bacteria | 1396 |
| 165 | Ga0182006_1090140 | 3300015261 | Bacteria | 1105 |
| 166 | Ga0182007_10011070 | 3300015262 | Bacteria | 3528 |
| 167 | Ga0182007_10031825 | 3300015262 | Bacteria | 1795 |
| 168 | Ga0214544_1000018 | 3300021320 | Bacteria | 187095 |
| 169 | Ga0214542_1000307 | 3300021321 | Bacteria | 83288 |
| 170 | Ga0214543_1000195 | 3300021327 | Bacteria | 89886 |
| 171 | Ga0214543_1011326 | 3300021327 | Bacteria | 12581 |
| 172 | Ga0213872_10058442 | 3300021361 | Bacteria | 1746 |
| 173 | Ga0228711_1004587 | 3300022739 | Bacteria | 21197 |
| 174 | Ga0228710_1004744 | 3300022740 | Bacteria | 21386 |
| 175 | Ga0209435_100006 | 3300025206 | Bacteria | 542459 |
| 176 | Ga0209436_102573 | 3300025208 | Bacteria | 5339 |
| 177 | Ga0209437_100022 | 3300025233 | Bacteria | 625694 |
| 178 | Ga0207425_1022250 | 3300025245 | Bacteria | 1337 |
| 179 | Ga0209646_1000015 | 3300025246 | Bacteria | 542459 |
| 180 | Ga0209026_1000039 | 3300025250 | Bacteria | 280608 |
| 181 | Ga0209677_100826 | 3300025253 | Bacteria | 15447 |
| 182 | Ga0209677_102046 | 3300025253 | Bacteria | 7982 |
| 183 | Ga0209148_1000078 | 3300025254 | Bacteria | 296101 |
| 184 | Ga0209148_1000260 | 3300025254 | Bacteria | 82737 |
| 185 | Ga0209759_1000005 | 3300025256 | Bacteria | 542459 |
| 186 | Ga0209129_1000669 | 3300025258 | Bacteria | 22694 |
| 187 | Ga0209129_1014747 | 3300025258 | Bacteria | 1648 |
| 188 | Ga0209233_1000031 | 3300025261 | Bacteria | 624646 |
| 189 | Ga0209233_1000324 | 3300025261 | Bacteria | 51086 |
| 190 | Ga0209233_1000330 | 3300025261 | Bacteria | 48662 |
| 191 | Ga0209233_1004739 | 3300025261 | Bacteria | 4587 |
| 192 | Ga0209233_1005862 | 3300025261 | Bacteria | 4031 |
| 193 | Ga0209233_1008499 | 3300025261 | Bacteria | 3174 |
| 194 | Ga0209455_1000193 | 3300025272 | Bacteria | 90413 |
| 195 | Ga0209673_1000067 | 3300025273 | Bacteria | 249077 |
| 196 | Ga0209673_1000291 | 3300025273 | Bacteria | 93803 |
| 197 | Ga0209673_1007600 | 3300025273 | Bacteria | 4957 |
| 198 | Ga0209673_1013841 | 3300025273 | Bacteria | 3161 |
| 199 | Ga0209130_1000242 | 3300025284 | Bacteria | 69580 |
| 200 | Ga0209676_1001988 | 3300025292 | Bacteria | 16222 |
| 201 | Ga0209676_1051477 | 3300025292 | Bacteria | 1080 |
| 202 | Ga0209025_1000240 | 3300025294 | Bacteria | 128397 |
| 203 | Ga0209025_1000430 | 3300025294 | Bacteria | 83230 |
| 204 | Ga0209025_1001534 | 3300025294 | Bacteria | 29500 |
| 205 | Ga0209564_1000092 | 3300025295 | Bacteria | 249018 |
| 206 | Ga0209564_1000338 | 3300025295 | Bacteria | 90246 |
| 207 | Ga0209564_1000876 | 3300025295 | Bacteria | 40029 |
| 208 | Ga0209758_1000057 | 3300025297 | Bacteria | 333111 |
| 209 | Ga0209758_1000490 | 3300025297 | Bacteria | 64714 |
| 210 | Ga0209758_1008376 | 3300025297 | Bacteria | 6719 |
| 211 | Ga0209758_1054707 | 3300025297 | Bacteria | 1362 |
| 212 | Ga0209050_1004950 | 3300025298 | Bacteria | 8682 |
| 213 | Ga0209050_1010402 | 3300025298 | Bacteria | 4591 |
| 214 | Ga0209256_1000788 | 3300025299 | Bacteria | 40932 |
| 215 | Ga0209256_1001843 | 3300025299 | Bacteria | 19673 |
| 216 | Ga0209256_1002067 | 3300025299 | Bacteria | 17689 |
| 217 | Ga0209256_1019508 | 3300025299 | Bacteria | 2155 |
| 218 | Ga0207426_1000075 | 3300025302 | Bacteria | 321337 |
| 219 | Ga0207426_1000483 | 3300025302 | Bacteria | 60265 |
| 220 | Ga0209051_1000502 | 3300025303 | Bacteria | 49570 |
| 221 | Ga0209051_1002802 | 3300025303 | Bacteria | 12031 |
| 222 | Ga0209051_1008011 | 3300025303 | Bacteria | 5668 |
| 223 | Ga0209257_1003568 | 3300025304 | Bacteria | 13193 |
| 224 | Ga0209257_1003646 | 3300025304 | Bacteria | 12935 |
| 225 | Ga0209257_1004238 | 3300025304 | Bacteria | 11332 |
| 226 | Ga0209257_1004771 | 3300025304 | Bacteria | 10115 |
| 227 | Ga0207680_10422073 | 3300025903 | Bacteria | 945 |
| 228 | Ga0207647_10001845 | 3300025904 | Bacteria | 16266 |
| 229 | Ga0207647_10081616 | 3300025904 | Bacteria | 1937 |
| 230 | Ga0207645_10081588 | 3300025907 | Bacteria | 2073 |
| 231 | Ga0207654_10008209 | 3300025911 | Bacteria | 5267 |
| 232 | Ga0207654_10014807 | 3300025911 | Bacteria | 4037 |
| 233 | Ga0207654_10155102 | 3300025911 | Bacteria | 1474 |
| 234 | Ga0207695_10000163 | 3300025913 | Bacteria | 197030 |
| 235 | Ga0207695_10001205 | 3300025913 | Bacteria | 44411 |
| 236 | Ga0207671_10000793 | 3300025914 | Bacteria | 40024 |
| 237 | Ga0207671_10006375 | 3300025914 | Bacteria | 10524 |
| 238 | Ga0207671_10139331 | 3300025914 | Bacteria | 1868 |
| 239 | Ga0207671_10169932 | 3300025914 | Bacteria | 1693 |
| 240 | Ga0207657_10102983 | 3300025919 | Bacteria | 2367 |
| 241 | Ga0207681_10038709 | 3300025923 | Bacteria | 3162 |
| 242 | Ga0207694_10046666 | 3300025924 | Bacteria | 3348 |
| 243 | Ga0207694_10160873 | 3300025924 | Bacteria | 1813 |
| 244 | Ga0207650_10000960 | 3300025925 | Bacteria | 21697 |
| 245 | Ga0207650_10193811 | 3300025925 | Bacteria | 1625 |
| 246 | Ga0207644_10126543 | 3300025931 | Bacteria | 1951 |
| 247 | Ga0207706_10129092 | 3300025933 | Bacteria | 2223 |
| 248 | Ga0207709_10030401 | 3300025935 | Bacteria | 3141 |
| 249 | Ga0207711_10463525 | 3300025941 | Bacteria | 1180 |
| 250 | Ga0207667_10146494 | 3300025949 | Bacteria | 2431 |
| 251 | Ga0207667_10230708 | 3300025949 | Bacteria | 1896 |
| 252 | Ga0207668_10089600 | 3300025972 | Bacteria | 2256 |
| 253 | Ga0207668_10159844 | 3300025972 | Bacteria | 1754 |
| 254 | Ga0207640_10018951 | 3300025981 | Bacteria | 4054 |
| 255 | Ga0207640_10048081 | 3300025981 | Bacteria | 2756 |
| 256 | Ga0207677_10025782 | 3300026023 | Bacteria | 3674 |
| 257 | Ga0207703_10395554 | 3300026035 | Bacteria | 1281 |
| 258 | Ga0207639_10033648 | 3300026041 | Bacteria | 3783 |
| 259 | Ga0207678_10035731 | 3300026067 | Bacteria | 4327 |
| 260 | Ga0207702_10015730 | 3300026078 | Bacteria | 6263 |
| 261 | Ga0207702_10105250 | 3300026078 | Bacteria | 2499 |
| 262 | Ga0207648_10134408 | 3300026089 | Bacteria | 2178 |
| 263 | Ga0207674_10027216 | 3300026116 | Bacteria | 6053 |
| 264 | Ga0207674_10082312 | 3300026116 | Bacteria | 3220 |
| 265 | Ga0207675_100126661 | 3300026118 | Bacteria | 2419 |
| 266 | Ga0207675_100247727 | 3300026118 | Bacteria | 1723 |
| 267 | Ga0207683_10068199 | 3300026121 | Bacteria | 3139 |
| 268 | Ga0207698_10456296 | 3300026142 | Bacteria | 1235 |
| 269 | Ga0209281_1000032 | 3300027111 | Bacteria | 401727 |
| 270 | Ga0209281_1000491 | 3300027111 | Bacteria | 54084 |
| 271 | Ga0209281_1000981 | 3300027111 | Bacteria | 22781 |
| 272 | Ga0209389_1000075 | 3300027296 | Bacteria | 92887 |
| 273 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 274 | Ga0209371_1000324 | 3300027312 | Bacteria | 52237 |
| 275 | Ga0209371_1002664 | 3300027312 | Bacteria | 9713 |
| 276 | Ga0209589_1000085 | 3300027357 | Bacteria | 92543 |
| 277 | Ga0209489_100062 | 3300027361 | Bacteria | 145478 |
| 278 | Ga0209282_1000108 | 3300027666 | Bacteria | 54085 |
| 279 | Ga0209282_1000604 | 3300027666 | Bacteria | 17667 |
| 280 | Ga0209282_1145924 | 3300027666 | Bacteria | 1149 |
| 281 | Ga0268266_10082713 | 3300028379 | Bacteria | 2801 |
| 282 | Ga0268266_10109122 | 3300028379 | Bacteria | 2450 |
| 283 | Ga0268266_10315994 | 3300028379 | Bacteria | 1461 |
| 284 | Ga0268265_10034463 | 3300028380 | Bacteria | 3691 |
| 285 | Ga0268264_10000119 | 3300028381 | Bacteria | 192507 |
| 286 | Ga0268264_10360012 | 3300028381 | Bacteria | 1387 |
| 287 | Ga0265337_1000524 | 3300028556 | Bacteria | 20359 |
| 288 | Ga0265326_10001731 | 3300028558 | Bacteria | 7555 |
| 289 | Ga0265319_1007826 | 3300028563 | Bacteria | 4752 |
| 290 | Ga0265334_10000591 | 3300028573 | Bacteria | 18388 |
| 291 | Ga0265318_10003026 | 3300028577 | Bacteria | 8662 |
| 292 | Ga0265323_10000275 | 3300028653 | Bacteria | 29810 |
| 293 | Ga0265336_10000107 | 3300028666 | Bacteria | 63528 |
| 294 | Ga0307515_10001999 | 3300028794 | Bacteria | 45141 |
| 295 | Ga0307515_10009236 | 3300028794 | Bacteria | 19093 |
| 296 | Ga0265338_10000161 | 3300028800 | Bacteria | 122364 |
| 297 | Ga0265324_10016038 | 3300029957 | Bacteria | 2745 |
| 298 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 299 | Ga0268256_1001615 | 3300030500 | Bacteria | 13064 |
| 300 | Ga0268256_1002375 | 3300030500 | Bacteria | 9686 |
| 301 | Ga0316182_1446202 | 3300030745 | Bacteria | 1177 |
| 302 | Ga0307513_10003915 | 3300031456 | Bacteria | 20018 |
| 303 | Ga0307509_10026921 | 3300031507 | Bacteria | 6405 |
| 304 | Ga0307509_10216605 | 3300031507 | Bacteria | 1732 |
| 305 | Ga0307509_10266616 | 3300031507 | Bacteria | 1483 |
| 306 | Ga0307508_10001261 | 3300031616 | Bacteria | 28804 |
| 307 | Ga0307508_10108467 | 3300031616 | Bacteria | 2376 |
| 308 | Ga0307516_10085368 | 3300031730 | Bacteria | 2994 |
| 309 | Ga0315914_1000427 | 3300031967 | Bacteria | 51660 |
| 310 | Ga0307416_100579733 | 3300032002 | Bacteria | 1199 |
| 311 | Ga0315913_1001358 | 3300033430 | Bacteria | 26703 |
| 312 | Ga0315915_1000032 | 3300033464 | Bacteria | 87024 |
| 313 | Ga0373946_0181048 | 3300035171 | Bacteria | 1000 |
| 314 | Ga0373935_0007083 | 3300035692 | Bacteria | 6696 |
| 315 | Ga0373935_0142994 | 3300035692 | Bacteria | 1617 |
| 316 | Ga0373927_0000581 | 3300035695 | Bacteria | 27838 |
| 317 | Ga0373927_0008059 | 3300035695 | Bacteria | 7112 |
| 318 | Ga0395900_0039934 | 3300037418 | Bacteria | 4837 |
| 319 | Ga0395900_0041420 | 3300037418 | Bacteria | 4748 |
| 320 | Ga0395898_0190977 | 3300037466 | Bacteria | 1957 |
| 321 | Ga0395898_0247312 | 3300037466 | Bacteria | 1701 |
| 322 | Ga0395905_0000321 | 3300037471 | Bacteria | 69144 |
| 323 | Ga0395905_0008887 | 3300037471 | Bacteria | 9869 |
| 324 | Ga0395905_0047480 | 3300037471 | Bacteria | 4024 |
| 325 | Ga0395905_0065345 | 3300037471 | Bacteria | 3406 |
| 326 | Ga0395905_0084215 | 3300037471 | Bacteria | 2979 |
| 327 | Ga0395901_0011805 | 3300038443 | Bacteria | 8858 |
| 328 | Ga0395901_0023117 | 3300038443 | Bacteria | 6372 |
| 329 | Ga0436365_1806102 | 3300039437 | Bacteria | 933 |
| 330 | Ga0436361_0117844 | 3300039447 | Bacteria | 3187 |
| 331 | Ga0436361_1160430 | 3300039447 | Bacteria | 8197 |
| 332 | Ga0439465_0001132 | 3300041413 | Bacteria | 8533 |
| 333 | Ga0451841_0655033 | 3300041498 | Bacteria | 2056 |
| 334 | Ga0451855_1487574 | 3300041511 | Bacteria | 1305 |
| 335 | Ga0439433_0019503 | 3300041999 | Bacteria | 1511 |
| 336 | Ga0439449_0129614 | 3300042007 | Bacteria | 937 |
| 337 | Ga0466972_0018693 | 3300044658 | Bacteria | 3465 |
| 338 | Ga0466966_0163249 | 3300044684 | Bacteria | 1356 |
| 339 | Ga0466963_0146701 | 3300044694 | Bacteria | 1637 |
| 340 | Ga0466970_0000136 | 3300044765 | Bacteria | 33881 |
| 341 | Ga0466957_0002082 | 3300044842 | Bacteria | 10705 |
| 342 | Ga0451576_0008472 | 3300045051 | Bacteria | 12070 |
| 343 | Ga0451576_0027482 | 3300045051 | Bacteria | 6110 |
| 344 | Ga0466958_0229106 | 3300045836 | Bacteria | 1186 |
| 345 | Ga0495629_0009432 | 3300046459 | Bacteria | 7137 |
| 346 | Ga0495638_0029107 | 3300046460 | Bacteria | 3563 |
| 347 | Ga0495605_0005741 | 3300046474 | Bacteria | 7198 |
| 348 | Ga0495605_0094043 | 3300046474 | Bacteria | 1385 |
| 349 | Ga0495662_0004214 | 3300046476 | Bacteria | 7235 |
| 350 | Ga0495585_0027986 | 3300046492 | Bacteria | 3217 |
| 351 | Ga0495607_0025260 | 3300046501 | Bacteria | 3697 |
| 352 | Ga0495583_0001811 | 3300046506 | Bacteria | 20150 |
| 353 | Ga0495606_0010507 | 3300046507 | Bacteria | 7669 |
| 354 | Ga0495606_0026163 | 3300046507 | Bacteria | 4162 |
| 355 | Ga0495610_0037467 | 3300046512 | Bacteria | 2467 |
| 356 | Ga0495610_0078559 | 3300046512 | Bacteria | 1521 |
| 357 | Ga0495616_0122478 | 3300046513 | Bacteria | 1199 |
| 358 | Ga0495620_0001877 | 3300046515 | Bacteria | 12353 |
| 359 | Ga0495620_0099673 | 3300046515 | Bacteria | 1159 |
| 360 | Ga0495631_0022769 | 3300046518 | Bacteria | 2912 |
| 361 | Ga0495631_0059438 | 3300046518 | Bacteria | 1661 |
| 362 | Ga0495632_0037014 | 3300046519 | Bacteria | 2479 |
| 363 | Ga0495643_0006040 | 3300046522 | Bacteria | 8073 |
| 364 | Ga0495644_0047166 | 3300046523 | Bacteria | 1619 |
| 365 | Ga0495648_0015554 | 3300046524 | Bacteria | 5522 |
| 366 | Ga0495648_0085494 | 3300046524 | Bacteria | 1782 |
| 367 | Ga0495654_0048553 | 3300046530 | Bacteria | 2082 |
| 368 | Ga0495609_0056542 | 3300046538 | Bacteria | 1738 |
| 369 | Ga0495597_0011739 | 3300046542 | Bacteria | 4242 |
| 370 | Ga0495597_0031607 | 3300046542 | Bacteria | 2407 |
| 371 | Ga0495622_0001480 | 3300046557 | Bacteria | 11803 |
| 372 | Ga0495668_0006776 | 3300046616 | Bacteria | 7445 |
| 373 | Ga0495668_0033505 | 3300046616 | Bacteria | 2886 |
| 374 | Ga0495668_0054192 | 3300046616 | Bacteria | 2217 |
| 375 | Ga0495668_0229121 | 3300046616 | Bacteria | 1017 |
| 376 | Ga0495625_0003205 | 3300046660 | Bacteria | 16616 |
| 377 | Ga0495625_0010911 | 3300046660 | Bacteria | 7464 |
| 378 | Ga0495625_0041169 | 3300046660 | Bacteria | 3364 |
| 379 | Ga0495588_0007248 | 3300046674 | Bacteria | 5035 |
| 380 | Ga0495657_0055012 | 3300046675 | Bacteria | 2656 |
| 381 | Ga0495670_0007464 | 3300046691 | Bacteria | 5370 |
| 382 | Ga0495649_0008058 | 3300046694 | Bacteria | 6363 |
| 383 | Ga0495649_0093027 | 3300046694 | Bacteria | 1605 |
| 384 | Ga0495649_0208922 | 3300046694 | Bacteria | 1012 |
| 385 | Ga0495600_0177183 | 3300046809 | Bacteria | 1374 |
| 386 | Ga0495660_0008181 | 3300046810 | Bacteria | 6135 |
| 387 | Ga0495604_0000886 | 3300047317 | Bacteria | 24880 |
| 388 | Ga0495636_0088757 | 3300047318 | Bacteria | 1340 |
| 389 | Ga0495683_0030310 | 3300047323 | Bacteria | 2760 |
| 390 | Ga0495683_0103540 | 3300047323 | Bacteria | 1366 |
| 391 | Ga0495687_010309 | 3300047443 | Bacteria | 5132 |
| 392 | Ga0495687_102321 | 3300047443 | Bacteria | 1072 |
| 393 | Ga0495681_0017210 | 3300047470 | Bacteria | 4024 |
| 394 | Ga0495681_0128145 | 3300047470 | Bacteria | 1083 |
| 395 | Ga0495686_0008180 | 3300047472 | Bacteria | 7720 |
| 396 | Ga0495615_0003234 | 3300048090 | Bacteria | 2707 |
| 397 | Ga0495626_0024458 | 3300048091 | Bacteria | 2961 |
| 398 | Ga0495626_0082107 | 3300048091 | Bacteria | 1430 |
| 399 | Ga0496101_0113978 | 3300048904 | Bacteria | 2038 |
| 400 | Ga0496101_0130822 | 3300048904 | Bacteria | 1906 |
| 401 | Ga0496102_0248885 | 3300048905 | Bacteria | 1675 |
| 402 | Ga0496103_0004367 | 3300048906 | Bacteria | 8586 |
| 403 | Ga0496103_0179307 | 3300048906 | Bacteria | 1361 |
| 404 | Ga0496105_0035672 | 3300048908 | Bacteria | 4094 |
| 405 | Ga0496106_0251004 | 3300048909 | Bacteria | 1414 |
| 406 | Ga0496107_0160238 | 3300048910 | Bacteria | 1667 |
| 407 | Ga0496108_0090757 | 3300048911 | Bacteria | 2597 |
| 408 | Ga0496112_0025887 | 3300048915 | Bacteria | 5638 |
| 409 | Ga0496112_0056209 | 3300048915 | Bacteria | 3872 |
| 410 | Ga0496113_0093919 | 3300048916 | Bacteria | 2316 |
| 411 | Ga0496115_0345506 | 3300048918 | Bacteria | 1214 |
| 412 | Ga0496116_0015008 | 3300048919 | Bacteria | 6146 |
| 413 | Ga0496117_0000016 | 3300048920 | Bacteria | 523642 |
| 414 | Ga0496117_0002969 | 3300048920 | Bacteria | 20461 |
| 415 | Ga0496117_0017101 | 3300048920 | Bacteria | 6072 |
| 416 | Ga0496117_0031041 | 3300048920 | Bacteria | 4087 |
| 417 | Ga0496117_0101080 | 3300048920 | Bacteria | 1825 |
| 418 | Ga0496117_0147081 | 3300048920 | Bacteria | 1401 |
| 419 | Ga0496118_0000153 | 3300048921 | Bacteria | 122419 |
| 420 | Ga0496118_0011952 | 3300048921 | Bacteria | 8395 |
| 421 | Ga0496118_0013244 | 3300048921 | Bacteria | 7822 |
| 422 | Ga0496118_0041916 | 3300048921 | Bacteria | 3618 |
| 423 | Ga0496118_0083641 | 3300048921 | Bacteria | 2230 |
| 424 | Ga0496119_0007331 | 3300048922 | Bacteria | 9975 |
| 425 | Ga0496119_0008586 | 3300048922 | Bacteria | 8952 |
| 426 | Ga0496119_0018968 | 3300048922 | Bacteria | 5092 |
| 427 | Ga0496119_0030012 | 3300048922 | Bacteria | 3673 |
| 428 | Ga0496119_0040903 | 3300048922 | Bacteria | 2958 |
| 429 | Ga0496119_0067501 | 3300048922 | Bacteria | 2109 |
| 430 | Ga0496119_0085742 | 3300048922 | Bacteria | 1802 |
| 431 | Ga0496120_0000660 | 3300048923 | Bacteria | 50656 |
| 432 | Ga0496120_0004196 | 3300048923 | Bacteria | 12311 |
| 433 | Ga0496120_0106802 | 3300048923 | Bacteria | 1469 |
| 434 | Ga0496121_0001476 | 3300048924 | Bacteria | 39569 |
| 435 | Ga0496121_0135546 | 3300048924 | Bacteria | 1835 |
| 436 | Ga0496122_0000002 | 3300048925 | Bacteria | 905834 |
| 437 | Ga0496122_0002358 | 3300048925 | Bacteria | 27165 |
| 438 | Ga0496122_0003859 | 3300048925 | Bacteria | 19238 |
| 439 | Ga0496122_0007025 | 3300048925 | Bacteria | 12656 |
| 440 | Ga0496122_0007371 | 3300048925 | Bacteria | 12258 |
| 441 | Ga0496122_0026867 | 3300048925 | Bacteria | 4944 |
| 442 | Ga0496122_0042303 | 3300048925 | Bacteria | 3586 |
| 443 | Ga0496123_0000002 | 3300048926 | Bacteria | 1811682 |
| 444 | Ga0496123_0017939 | 3300048926 | Bacteria | 5666 |
| 445 | Ga0496123_0021255 | 3300048926 | Bacteria | 5048 |
| 446 | Ga0496124_0025190 | 3300048927 | Bacteria | 5392 |
| 447 | Ga0496124_0035680 | 3300048927 | Bacteria | 4349 |
| 448 | Ga0496124_0112725 | 3300048927 | Bacteria | 2186 |
| 449 | Ga0496124_0405016 | 3300048927 | Bacteria | 945 |
| 450 | Ga0496124_0405026 | 3300048927 | Bacteria | 945 |
| 451 | Ga0496125_0020431 | 3300048928 | Bacteria | 6215 |
| 452 | Ga0496125_0058623 | 3300048928 | Bacteria | 3109 |
| 453 | Ga0496125_0080584 | 3300048928 | Bacteria | 2490 |
| 454 | Ga0496125_0169090 | 3300048928 | Bacteria | 1472 |
| 455 | Ga0496126_0096902 | 3300048929 | Bacteria | 2586 |
| 456 | Ga0501032_0137182 | 3300049569 | Bacteria | 1612 |
| 457 | Ga0501033_0000697 | 3300049570 | Bacteria | 31065 |
| 458 | Ga0501033_0245026 | 3300049570 | Bacteria | 1271 |
| 459 | Ga0501037_0072493 | 3300049573 | Bacteria | 2505 |
| 460 | Ga0501035_0003274 | 3300049822 | Bacteria | 15525 |
| 461 | Ga0501044_0525071 | 3300049823 | Bacteria | 1083 |
| 462 | nmdc:mga03683_183910_c1 | 3300050489 | Bacteria | 954 |
| 463 | nmdc:mga03683_78992_c1 | 3300050489 | Bacteria | 1418 |
| 464 | nmdc:mga03n38_5449_c1 | 3300050490 | Bacteria | 4336 |
| 465 | nmdc:mga03n38_90357_c1 | 3300050490 | Bacteria | 1457 |
| 466 | nmdc:mga00v17_290130_c1 | 3300050491 | Bacteria | 1062 |
| 467 | nmdc:mga00v17_3_c1 | 3300050491 | Bacteria | 242367 |
| 468 | nmdc:mga0yw44_2963_c1 | 3300050492 | Bacteria | 7398 |
| 469 | nmdc:mga0yw44_41312_c1 | 3300050492 | Bacteria | 2745 |
| 470 | nmdc:mga0yw44_53397_c1 | 3300050492 | Bacteria | 2454 |
| 471 | nmdc:mga0yw44_9622_c1 | 3300050492 | Bacteria | 4901 |
| 472 | nmdc:mga0k408_139470_c1 | 3300050493 | Bacteria | 1442 |
| 473 | nmdc:mga0k408_25554_c1 | 3300050493 | Bacteria | 3345 |
| 474 | nmdc:mga06z11_113912_c1 | 3300050494 | Bacteria | 1501 |
| 475 | nmdc:mga06z11_147689_c1 | 3300050494 | Bacteria | 1334 |
| 476 | nmdc:mga06z11_15769_c1 | 3300050494 | Bacteria | 3382 |
| 477 | nmdc:mga06z11_7336_c1 | 3300050494 | Bacteria | 4531 |
| 478 | nmdc:mga04h51_162738_c1 | 3300050495 | Bacteria | 860 |
| 479 | nmdc:mga04h51_2441_c1 | 3300050495 | Bacteria | 4413 |
| 480 | nmdc:mga07m45_111607_c1 | 3300050496 | Bacteria | 1575 |
| 481 | nmdc:mga07m45_131581_c1 | 3300050496 | Bacteria | 1448 |
| 482 | nmdc:mga07m45_17763_c1 | 3300050496 | Bacteria | 3827 |
| 483 | nmdc:mga07m45_48481_c1 | 3300050496 | Bacteria | 2389 |
| 484 | nmdc:mga0sz30_20499_c1 | 3300050516 | Bacteria | 2307 |
| 485 | nmdc:mga0sz30_514_c1 | 3300050516 | Bacteria | 14418 |
| 486 | nmdc:mga0sz30_54581_c1 | 3300050516 | Bacteria | 1700 |
| 487 | nmdc:mga0sz30_57866_c1 | 3300050516 | Bacteria | 1652 |
| 488 | Ga0500635_0001856 | 3300053080 | Bacteria | 5150 |
| 489 | Ga0495655_0041962 | 3300053083 | Bacteria | 1172 |
| 490 | Ga0500578_0008264 | 3300053086 | Bacteria | 6811 |
| 491 | Ga0500578_0102719 | 3300053086 | Bacteria | 1808 |
| 492 | Ga0500651_0114840 | 3300053093 | Bacteria | 1640 |
| 493 | Ga0500641_0035388 | 3300053096 | Bacteria | 1993 |
| 494 | Ga0500560_000351 | 3300053107 | Bacteria | 6044 |
| 495 | Ga0500560_005649 | 3300053107 | Bacteria | 2788 |
| 496 | Ga0500569_004067 | 3300053109 | Bacteria | 3046 |
| 497 | Ga0500572_004796 | 3300053111 | Bacteria | 3064 |
| 498 | Ga0500594_0005184 | 3300053118 | Bacteria | 2887 |
| 499 | Ga0500594_0010645 | 3300053118 | Bacteria | 2139 |
| 500 | Ga0500618_000605 | 3300053125 | Bacteria | 22012 |
| 501 | Ga0500658_0000280 | 3300053134 | Bacteria | 23185 |
| 502 | Ga0500559_0001421 | 3300053136 | Bacteria | 13590 |
| 503 | Ga0500559_0011473 | 3300053136 | Bacteria | 3784 |
| 504 | Ga0500561_0000632 | 3300053137 | Bacteria | 5599 |
| 505 | Ga0500573_0014661 | 3300053140 | Bacteria | 4436 |
| 506 | Ga0500577_0087440 | 3300053142 | Bacteria | 1254 |
| 507 | Ga0500590_030908 | 3300053148 | Bacteria | 2777 |
| 508 | Ga0500604_0011363 | 3300053151 | Bacteria | 2390 |
| 509 | Ga0500616_0005247 | 3300053153 | Bacteria | 8859 |
| 510 | Ga0500616_0005811 | 3300053153 | Bacteria | 8281 |
| 511 | Ga0500624_000337 | 3300053157 | Bacteria | 15781 |
| 512 | Ga0500627_0008746 | 3300053158 | Bacteria | 3613 |
| 513 | Ga0500639_063128 | 3300053163 | Bacteria | 1905 |
| 514 | Ga0500636_0000001 | 3300053177 | Bacteria | 324086 |
| 515 | Ga0500636_0001440 | 3300053177 | Bacteria | 12937 |
| 516 | Ga0500636_0001623 | 3300053177 | Bacteria | 12274 |
| 517 | Ga0500636_0037430 | 3300053177 | Bacteria | 2870 |
| 518 | Ga0500636_0066000 | 3300053177 | Bacteria | 2105 |
| 519 | Ga0500596_001975 | 3300053735 | Bacteria | 4104 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046474 | Ga0495605_0094043 | Ga0495605_0094043_150_887 | 232 |
| 2 | 3300053096 | Ga0500641_0035388 | Ga0500641_0035388_24_740 | 237 |
| 3 | iso_pu_bacteria | 2510461069 | 2510842453 | 238 |
| 4 | 3300009551 | Ga0105238_10133090 | Ga0105238_101330903 | 249 |
| 5 | 3300010375 | Ga0105239_10159235 | Ga0105239_101592353 | 249 |
| 6 | 3300025924 | Ga0207694_10160873 | Ga0207694_101608732 | 249 |
| 7 | 3300048904 | Ga0496101_0113978 | Ga0496101_0113978_14_763 | 249 |
| 8 | 3300048906 | Ga0496103_0179307 | Ga0496103_0179307_582_1331 | 249 |
| 9 | 3300048927 | Ga0496124_0112725 | Ga0496124_0112725_1198_2052 | 249 |
| 10 | 3300048928 | Ga0496125_0169090 | Ga0496125_0169090_211_1065 | 249 |
| 11 | 3300049569 | Ga0501032_0137182 | Ga0501032_0137182_115_978 | 249 |
| 12 | 3300049570 | Ga0501033_0000697 | Ga0501033_0000697_8004_8867 | 249 |
| 13 | 3300049822 | Ga0501035_0003274 | Ga0501035_0003274_14063_14926 | 249 |
| 14 | 3300005331 | Ga0070670_100000875 | Ga0070670_10000087518 | 250 |
| 15 | 3300025925 | Ga0207650_10000960 | Ga0207650_100009604 | 250 |
| 16 | 3300005842 | Ga0068858_100113038 | Ga0068858_1001130382 | 256 |
| 17 | 3300009101 | Ga0105247_10045309 | Ga0105247_100453092 | 256 |
| 18 | 3300009545 | Ga0105237_10663129 | Ga0105237_106631292 | 256 |
| 19 | 3300009763 | Ga0123340_1036321 | Ga0123340_10363212 | 256 |
| 20 | 3300009765 | Ga0123341_1047292 | Ga0123341_10472922 | 256 |
| 21 | 3300041999 | Ga0439433_0019503 | Ga0439433_0019503_250_1095 | 256 |
| 22 | 3300047470 | Ga0495681_0017210 | Ga0495681_0017210_12_863 | 256 |
| 23 | 3300048920 | Ga0496117_0147081 | Ga0496117_0147081_307_1161 | 256 |
| 24 | 3300025261 | Ga0209233_1004739 | Ga0209233_10047393 | 257 |
| 25 | 3300039437 | Ga0436365_1806102 | Ga0436365_1806102_17_796 | 258 |
| 26 | 3300005347 | Ga0070668_100238357 | Ga0070668_1002383572 | 259 |
| 27 | iso_pu_bacteria | 2588253730 | 2588514380 | 259 |
| 28 | iso_pu_bacteria | 2924710171 | 2924712834 | 259 |
| 29 | 3300046694 | Ga0495649_0208922 | Ga0495649_0208922_50_832 | 260 |
| 30 | 3300009174 | Ga0105241_10098005 | Ga0105241_100980052 | 263 |
| 31 | 3300050492 | nmdc:mga0yw44_41312_c1 | nmdc:mga0yw44_41312_c1_631_1422 | 263 |
| 32 | 3300050495 | nmdc:mga04h51_162738_c1 | nmdc:mga04h51_162738_c1_56_847 | 263 |
| 33 | iso_pu_bacteria | 2841846520 | 2841849529 | 266 |
| 34 | iso_pu_bacteria | 2899845264 | 2899850002 | 266 |
| 35 | iso_pu_bacteria | 2926760298 | 2926763648 | 266 |
| 36 | 3300037471 | Ga0395905_0008887 | Ga0395905_0008887_813_1679 | 267 |
| 37 | 3300006946 | Ga0079104_1000014 | Ga0079104_1000014274 | 269 |
| 38 | 3300027111 | Ga0209281_1000032 | Ga0209281_1000032272 | 269 |
| 39 | 3300048908 | Ga0496105_0035672 | Ga0496105_0035672_3267_4082 | 270 |
| 40 | 3300048922 | Ga0496119_0067501 | Ga0496119_0067501_970_1782 | 270 |
| 41 | iso_pu_bacteria | 2585428058 | 2587733738 | 271 |
| 42 | iso_pu_bacteria | 2869256925 | 2869257487 | 271 |
| 43 | iso_pu_bacteria | 2878738818 | 2878742310 | 271 |
| 44 | iso_pu_bacteria | 2924776078 | 2924780110 | 271 |
| 45 | 3300009093 | Ga0105240_10009904 | Ga0105240_100099048 | 272 |
| 46 | 3300009174 | Ga0105241_10006946 | Ga0105241_100069463 | 272 |
| 47 | 3300009545 | Ga0105237_10001626 | Ga0105237_100016269 | 272 |
| 48 | 3300010375 | Ga0105239_10027867 | Ga0105239_100278673 | 272 |
| 49 | 3300006195 | Ga0075366_10020788 | Ga0075366_100207882 | 273 |
| 50 | 3300006353 | Ga0075370_10023613 | Ga0075370_100236132 | 273 |
| 51 | 3300050493 | nmdc:mga0k408_139470_c1 | nmdc:mga0k408_139470_c1_349_1191 | 273 |
| 52 | 3300050496 | nmdc:mga07m45_48481_c1 | nmdc:mga07m45_48481_c1_1458_2300 | 273 |
| 53 | 3300028556 | Ga0265337_1000524 | Ga0265337_100052410 | 274 |
| 54 | 3300028558 | Ga0265326_10001731 | Ga0265326_100017314 | 274 |
| 55 | 3300028563 | Ga0265319_1007826 | Ga0265319_10078264 | 274 |
| 56 | 3300028573 | Ga0265334_10000591 | Ga0265334_1000059112 | 274 |
| 57 | 3300028577 | Ga0265318_10003026 | Ga0265318_100030266 | 274 |
| 58 | 3300028653 | Ga0265323_10000275 | Ga0265323_1000027527 | 274 |
| 59 | 3300028666 | Ga0265336_10000107 | Ga0265336_1000010732 | 274 |
| 60 | 3300028800 | Ga0265338_10000161 | Ga0265338_1000016190 | 274 |
| 61 | 3300029957 | Ga0265324_10016038 | Ga0265324_100160382 | 274 |
| 62 | 3300042007 | Ga0439449_0129614 | Ga0439449_0129614_26_850 | 274 |
| 63 | 3300049570 | Ga0501033_0245026 | Ga0501033_0245026_160_1008 | 274 |
| 64 | iso_pu_bacteria | 2503198000 | 2503200936 | 274 |
| 65 | iso_pu_bacteria | 2512875024 | 2512963935 | 274 |
| 66 | iso_pu_bacteria | 2513237164 | 2514035812 | 274 |
| 67 | iso_pu_bacteria | 2643221595 | 2643984696 | 274 |
| 68 | iso_pu_bacteria | 2643221627 | 2644153021 | 274 |
| 69 | iso_pu_bacteria | 2791355253 | 2793281324 | 274 |
| 70 | iso_pu_bacteria | 2856364286 | 2856366203 | 274 |
| 71 | iso_pu_bacteria | 2869285874 | 2869287237 | 274 |
| 72 | iso_pu_bacteria | 2871429161 | 2871430537 | 274 |
| 73 | iso_pu_bacteria | 2871435913 | 2871439366 | 274 |
| 74 | iso_pu_bacteria | 2874146452 | 2874149186 | 274 |
| 75 | iso_pu_bacteria | 2874155637 | 2874156029 | 274 |
| 76 | iso_pu_bacteria | 2876363079 | 2876367305 | 274 |
| 77 | iso_pu_bacteria | 2876413966 | 2876415391 | 274 |
| 78 | iso_pu_bacteria | 2878745973 | 2878746969 | 274 |
| 79 | iso_pu_bacteria | 2889016732 | 2889020768 | 274 |
| 80 | iso_pu_bacteria | 2903448605 | 2903453225 | 274 |
| 81 | iso_pu_bacteria | 2903492973 | 2903500514 | 274 |
| 82 | iso_pu_bacteria | 2903521522 | 2903526796 | 274 |
| 83 | iso_pu_bacteria | 2903528002 | 2903530585 | 274 |
| 84 | iso_pu_bacteria | 2906308376 | 2906309783 | 274 |
| 85 | iso_pu_bacteria | 2906321335 | 2906322418 | 274 |
| 86 | iso_pu_bacteria | 2924733363 | 2924737397 | 274 |
| 87 | iso_pu_bacteria | 2937813078 | 2937814920 | 274 |
| 88 | iso_pu_bacteria | 2958041894 | 2958044036 | 274 |
| 89 | iso_pu_bacteria | 2958130278 | 2958131737 | 274 |
| 90 | iso_pu_bacteria | 2958179912 | 2958180797 | 274 |
| 91 | iso_pu_bacteria | 2961077736 | 2961078635 | 274 |
| 92 | iso_pu_bacteria | 2965119406 | 2965126608 | 274 |
| 93 | iso_pu_bacteria | 2977843712 | 2977845620 | 274 |
| 94 | iso_pu_bacteria | 2996386984 | 2996393829 | 274 |
| 95 | iso_pu_bacteria | 3004203850 | 3004204111 | 274 |
| 96 | iso_pu_bacteria | 8004312739 | 8004313821 | 274 |
| 97 | iso_pu_bacteria | 8004387939 | 8004389074 | 274 |
| 98 | iso_pu_bacteria | 8004714634 | 8004716137 | 274 |
| 99 | iso_pu_bacteria | 8055431914 | 8055434871 | 274 |
| 100 | iso_pu_bacteria | 2508501123 | 2509118399 | 275 |
| 101 | iso_pu_bacteria | 2513237088 | 2513595995 | 275 |
| 102 | iso_pu_bacteria | 2582581316 | 2585334523 | 275 |
| 103 | iso_pu_bacteria | 2615840698 | 2616555593 | 275 |
| 104 | iso_pu_bacteria | 2617270742 | 2617385517 | 275 |
| 105 | iso_pu_bacteria | 2667528174 | 2671113173 | 275 |
| 106 | iso_pu_bacteria | 2775507266 | 2778174840 | 275 |
| 107 | iso_pu_bacteria | 2818991448 | 2819613187 | 275 |
| 108 | iso_pu_bacteria | 2838029111 | 2838031689 | 275 |
| 109 | iso_pu_bacteria | 2842475841 | 2842478421 | 275 |
| 110 | iso_pu_bacteria | 2842502639 | 2842505633 | 275 |
| 111 | iso_pu_bacteria | 2842775625 | 2842776492 | 275 |
| 112 | iso_pu_bacteria | 2852387548 | 2852394161 | 275 |
| 113 | iso_pu_bacteria | 2919408235 | 2919412941 | 275 |
| 114 | iso_pu_bacteria | 2937877337 | 2937882630 | 275 |
| 115 | iso_pu_bacteria | 2958144490 | 2958145582 | 275 |
| 116 | iso_pu_bacteria | 2996887358 | 2996893026 | 275 |
| 117 | iso_pu_bacteria | 3005416602 | 3005416648 | 275 |
| 118 | iso_pu_bacteria | 8005314921 | 8005320709 | 275 |
| 119 | iso_pu_bacteria | 8005321885 | 8005327553 | 275 |
| 120 | iso_pu_bacteria | 8005484373 | 8005487624 | 275 |
| 121 | iso_pu_bacteria | 8005645114 | 8005651812 | 275 |
| 122 | iso_pu_bacteria | 8005682033 | 8005686024 | 275 |
| 123 | iso_pu_bacteria | 8046767195 | 8046774212 | 275 |
| 124 | 3300046674 | Ga0495588_0007248 | Ga0495588_0007248_2362_3213 | 276 |
| 125 | 3300053107 | Ga0500560_005649 | Ga0500560_005649_1824_2675 | 276 |
| 126 | iso_pu_bacteria | 2510917022 | 2511135580 | 276 |
| 127 | iso_pu_bacteria | 2512875016 | 2512929137 | 276 |
| 128 | iso_pu_bacteria | 2513237090 | 2513611558 | 276 |
| 129 | iso_pu_bacteria | 2513237305 | 2514423390 | 276 |
| 130 | iso_pu_bacteria | 2524023209 | 2524459177 | 276 |
| 131 | iso_pu_bacteria | 2582581306 | 2585268273 | 276 |
| 132 | iso_pu_bacteria | 2582581307 | 2585272655 | 276 |
| 133 | iso_pu_bacteria | 2582581308 | 2585281205 | 276 |
| 134 | iso_pu_bacteria | 2582581315 | 2585327291 | 276 |
| 135 | iso_pu_bacteria | 2582581865 | 2585391169 | 276 |
| 136 | iso_pu_bacteria | 2585427527 | 2585536135 | 276 |
| 137 | iso_pu_bacteria | 2585427530 | 2585557620 | 276 |
| 138 | iso_pu_bacteria | 2585427531 | 2585562323 | 276 |
| 139 | iso_pu_bacteria | 2585427608 | 2585896763 | 276 |
| 140 | iso_pu_bacteria | 2585427609 | 2585906510 | 276 |
| 141 | iso_pu_bacteria | 2585428125 | 2587981932 | 276 |
| 142 | iso_pu_bacteria | 2599185301 | 2599940076 | 276 |
| 143 | iso_pu_bacteria | 2615840626 | 2616310993 | 276 |
| 144 | iso_pu_bacteria | 2643221558 | 2643810624 | 276 |
| 145 | iso_pu_bacteria | 2721755686 | 2723575015 | 276 |
| 146 | iso_pu_bacteria | 2791355123 | 2792752208 | 276 |
| 147 | iso_pu_bacteria | 2818991453 | 2819641741 | 276 |
| 148 | iso_pu_bacteria | 2842298080 | 2842300964 | 276 |
| 149 | iso_pu_bacteria | 2842357229 | 2842360020 | 276 |
| 150 | iso_pu_bacteria | 2842509118 | 2842513857 | 276 |
| 151 | iso_pu_bacteria | 2844002411 | 2844004712 | 276 |
| 152 | iso_pu_bacteria | 2847670302 | 2847674867 | 276 |
| 153 | iso_pu_bacteria | 2847686936 | 2847688712 | 276 |
| 154 | iso_pu_bacteria | 2854896431 | 2854902250 | 276 |
| 155 | iso_pu_bacteria | 2856314179 | 2856317249 | 276 |
| 156 | iso_pu_bacteria | 2856349417 | 2856353634 | 276 |
| 157 | iso_pu_bacteria | 2856356410 | 2856362633 | 276 |
| 158 | iso_pu_bacteria | 2869162929 | 2869163890 | 276 |
| 159 | iso_pu_bacteria | 2871444079 | 2871447672 | 276 |
| 160 | iso_pu_bacteria | 2871488783 | 2871489469 | 276 |
| 161 | iso_pu_bacteria | 2871495908 | 2871496297 | 276 |
| 162 | iso_pu_bacteria | 2874102143 | 2874103470 | 276 |
| 163 | iso_pu_bacteria | 2876369609 | 2876374667 | 276 |
| 164 | iso_pu_bacteria | 2876392853 | 2876393657 | 276 |
| 165 | iso_pu_bacteria | 2878035449 | 2878038287 | 276 |
| 166 | iso_pu_bacteria | 2878753008 | 2878754126 | 276 |
| 167 | iso_pu_bacteria | 2878760144 | 2878760526 | 276 |
| 168 | iso_pu_bacteria | 2878767105 | 2878767489 | 276 |
| 169 | iso_pu_bacteria | 2881147464 | 2881151117 | 276 |
| 170 | iso_pu_bacteria | 2881155292 | 2881161507 | 276 |
| 171 | iso_pu_bacteria | 2881161766 | 2881163418 | 276 |
| 172 | iso_pu_bacteria | 2881853255 | 2881853438 | 276 |
| 173 | iso_pu_bacteria | 2881861095 | 2881868079 | 276 |
| 174 | iso_pu_bacteria | 2882632389 | 2882637524 | 276 |
| 175 | iso_pu_bacteria | 2882912400 | 2882919042 | 276 |
| 176 | iso_pu_bacteria | 2885305155 | 2885305849 | 276 |
| 177 | iso_pu_bacteria | 2885318864 | 2885324127 | 276 |
| 178 | iso_pu_bacteria | 2885326080 | 2885327745 | 276 |
| 179 | iso_pu_bacteria | 2885334103 | 2885340057 | 276 |
| 180 | iso_pu_bacteria | 2885342637 | 2885346782 | 276 |
| 181 | iso_pu_bacteria | 2885350715 | 2885353211 | 276 |
| 182 | iso_pu_bacteria | 2888337043 | 2888338831 | 276 |
| 183 | iso_pu_bacteria | 2903492973 | 2903494571 | 276 |
| 184 | iso_pu_bacteria | 2903540706 | 2903541091 | 276 |
| 185 | iso_pu_bacteria | 2904659560 | 2904660165 | 276 |
| 186 | iso_pu_bacteria | 2906328253 | 2906331872 | 276 |
| 187 | iso_pu_bacteria | 2906414383 | 2906417311 | 276 |
| 188 | iso_pu_bacteria | 2922158528 | 2922163052 | 276 |
| 189 | iso_pu_bacteria | 2924726620 | 2924728590 | 276 |
| 190 | iso_pu_bacteria | 2924762789 | 2924769112 | 276 |
| 191 | iso_pu_bacteria | 2924784321 | 2924788796 | 276 |
| 192 | iso_pu_bacteria | 2937848649 | 2937848806 | 276 |
| 193 | iso_pu_bacteria | 2937891427 | 2937895581 | 276 |
| 194 | iso_pu_bacteria | 2937994558 | 2937994944 | 276 |
| 195 | iso_pu_bacteria | 2958064165 | 2958064851 | 276 |
| 196 | iso_pu_bacteria | 2958084443 | 2958089755 | 276 |
| 197 | iso_pu_bacteria | 2958092219 | 2958100450 | 276 |
| 198 | iso_pu_bacteria | 2958115193 | 2958121513 | 276 |
| 199 | iso_pu_bacteria | 2958165035 | 2958165424 | 276 |
| 200 | iso_pu_bacteria | 2961114664 | 2961115490 | 276 |
| 201 | iso_pu_bacteria | 2961127735 | 2961129802 | 276 |
| 202 | iso_pu_bacteria | 2961163497 | 2961163882 | 276 |
| 203 | iso_pu_bacteria | 2961170736 | 2961171758 | 276 |
| 204 | iso_pu_bacteria | 2963644680 | 2963650098 | 276 |
| 205 | iso_pu_bacteria | 2965018300 | 2965018687 | 276 |
| 206 | iso_pu_bacteria | 2965062239 | 2965069603 | 276 |
| 207 | iso_pu_bacteria | 2967996073 | 2967996537 | 276 |
| 208 | iso_pu_bacteria | 2968003550 | 2968010252 | 276 |
| 209 | iso_pu_bacteria | 2968083720 | 2968086591 | 276 |
| 210 | iso_pu_bacteria | 2968091066 | 2968095333 | 276 |
| 211 | iso_pu_bacteria | 2968097103 | 2968103090 | 276 |
| 212 | iso_pu_bacteria | 2968110612 | 2968111221 | 276 |
| 213 | iso_pu_bacteria | 2968117919 | 2968118898 | 276 |
| 214 | iso_pu_bacteria | 2968128360 | 2968128549 | 276 |
| 215 | iso_pu_bacteria | 2968171901 | 2968172288 | 276 |
| 216 | iso_pu_bacteria | 2970503327 | 2970504354 | 276 |
| 217 | iso_pu_bacteria | 2970554993 | 2970555378 | 276 |
| 218 | iso_pu_bacteria | 2977821940 | 2977823341 | 276 |
| 219 | iso_pu_bacteria | 2977828996 | 2977831306 | 276 |
| 220 | iso_pu_bacteria | 2977858184 | 2977864086 | 276 |
| 221 | iso_pu_bacteria | 2977864932 | 2977866029 | 276 |
| 222 | iso_pu_bacteria | 2977898635 | 2977903835 | 276 |
| 223 | iso_pu_bacteria | 2977922695 | 2977928385 | 276 |
| 224 | iso_pu_bacteria | 2977986579 | 2977987131 | 276 |
| 225 | iso_pu_bacteria | 2979779861 | 2979784867 | 276 |
| 226 | iso_pu_bacteria | 2979808191 | 2979808991 | 276 |
| 227 | iso_pu_bacteria | 2987659509 | 2987659894 | 276 |
| 228 | iso_pu_bacteria | 2987666974 | 2987672964 | 276 |
| 229 | iso_pu_bacteria | 2996341866 | 2996345385 | 276 |
| 230 | iso_pu_bacteria | 3000135777 | 3000140973 | 276 |
| 231 | iso_pu_bacteria | 3004188549 | 3004188941 | 276 |
| 232 | iso_pu_bacteria | 3004211236 | 3004215608 | 276 |
| 233 | iso_pu_bacteria | 3004218560 | 3004222088 | 276 |
| 234 | iso_pu_bacteria | 3004334049 | 3004335168 | 276 |
| 235 | iso_pu_bacteria | 3005445848 | 3005452077 | 276 |
| 236 | iso_pu_bacteria | 637000159 | 637078897 | 276 |
| 237 | iso_pu_bacteria | 643348564 | 643600624 | 276 |
| 238 | iso_pu_bacteria | 8004374579 | 8004375702 | 276 |
| 239 | iso_pu_bacteria | 8004445564 | 8004451934 | 276 |
| 240 | iso_pu_bacteria | 8004703790 | 8004713246 | 276 |
| 241 | iso_pu_bacteria | 8018150411 | 8018151245 | 276 |
| 242 | iso_pu_bacteria | 8024486573 | 8024493053 | 276 |
| 243 | iso_pu_bacteria | 8054558443 | 8054559623 | 276 |
| 244 | 3300003215 | JGI25153J46596_10000974 | JGI25153J46596_1000097414 | 277 |
| 245 | 3300025297 | Ga0209758_1000057 | Ga0209758_100005788 | 277 |
| 246 | 3300031507 | Ga0307509_10026921 | Ga0307509_100269214 | 277 |
| 247 | 3300053093 | Ga0500651_0114840 | Ga0500651_0114840_523_1377 | 277 |
| 248 | 3300053136 | Ga0500559_0011473 | Ga0500559_0011473_2904_3740 | 277 |
| 249 | 3300053140 | Ga0500573_0014661 | Ga0500573_0014661_1787_2623 | 277 |
| 250 | 3300053177 | Ga0500636_0037430 | Ga0500636_0037430_1988_2824 | 277 |
| 251 | 3300053735 | Ga0500596_001975 | Ga0500596_001975_1470_2306 | 277 |
| 252 | 3300001979 | JGI24740J21852_10008311 | JGI24740J21852_100083113 | 278 |
| 253 | 3300001989 | JGI24739J22299_10043279 | JGI24739J22299_100432792 | 278 |
| 254 | 3300003316 | rootH1_10170074 | rootH1_101700742 | 278 |
| 255 | 3300003323 | rootH1_10114644 | rootH1_101146442 | 278 |
| 256 | 3300003762 | Ga0055542_1000068 | Ga0055542_10000688 | 278 |
| 257 | 3300003763 | Ga0055529_1006909 | Ga0055529_10069092 | 278 |
| 258 | 3300005327 | Ga0070658_10051088 | Ga0070658_100510883 | 278 |
| 259 | 3300005616 | Ga0068852_100370149 | Ga0068852_1003701492 | 278 |
| 260 | 3300006038 | Ga0075365_10000531 | Ga0075365_100005317 | 278 |
| 261 | 3300006178 | Ga0075367_10048850 | Ga0075367_100488503 | 278 |
| 262 | 3300006353 | Ga0075370_10089013 | Ga0075370_100890132 | 278 |
| 263 | 3300009093 | Ga0105240_10404469 | Ga0105240_104044692 | 278 |
| 264 | 3300009101 | Ga0105247_10219097 | Ga0105247_102190972 | 278 |
| 265 | 3300009545 | Ga0105237_10312721 | Ga0105237_103127212 | 278 |
| 266 | 3300009553 | Ga0105249_10561523 | Ga0105249_105615232 | 278 |
| 267 | 3300010375 | Ga0105239_10364409 | Ga0105239_103644092 | 278 |
| 268 | 3300013296 | Ga0157374_10157901 | Ga0157374_101579012 | 278 |
| 269 | 3300014497 | Ga0182008_10105220 | Ga0182008_101052202 | 278 |
| 270 | 3300015262 | Ga0182007_10031825 | Ga0182007_100318252 | 278 |
| 271 | 3300025254 | Ga0209148_1000078 | Ga0209148_1000078151 | 278 |
| 272 | 3300025272 | Ga0209455_1000193 | Ga0209455_100019332 | 278 |
| 273 | 3300025914 | Ga0207671_10139331 | Ga0207671_101393312 | 278 |
| 274 | 3300025919 | Ga0207657_10102983 | Ga0207657_101029832 | 278 |
| 275 | 3300026078 | Ga0207702_10105250 | Ga0207702_101052502 | 278 |
| 276 | 3300037466 | Ga0395898_0190977 | Ga0395898_0190977_273_1118 | 278 |
| 277 | 3300037471 | Ga0395905_0065345 | Ga0395905_0065345_1565_2410 | 278 |
| 278 | 3300037471 | Ga0395905_0084215 | Ga0395905_0084215_1396_2241 | 278 |
| 279 | 3300038443 | Ga0395901_0023117 | Ga0395901_0023117_463_1308 | 278 |
| 280 | 3300048915 | Ga0496112_0025887 | Ga0496112_0025887_2492_3337 | 278 |
| 281 | 3300048922 | Ga0496119_0030012 | Ga0496119_0030012_1919_2764 | 278 |
| 282 | 3300050492 | nmdc:mga0yw44_2963_c1 | nmdc:mga0yw44_2963_c1_6380_7225 | 278 |
| 283 | 3300050496 | nmdc:mga07m45_111607_c1 | nmdc:mga07m45_111607_c1_361_1206 | 278 |
| 284 | iso_pu_bacteria | 2582581866 | 2585396266 | 278 |
| 285 | iso_pu_bacteria | 2917699015 | 2917703762 | 278 |
| 286 | 3300001979 | JGI24740J21852_10000431 | JGI24740J21852_100004319 | 279 |
| 287 | 3300002704 | JGI25155J39150_1000003 | JGI25155J39150_1000003196 | 279 |
| 288 | 3300002705 | JGI25156J39149_1000004 | JGI25156J39149_1000004190 | 279 |
| 289 | 3300002737 | JGI25162J39368_1000069 | JGI25162J39368_100006990 | 279 |
| 290 | 3300002738 | JGI25154J39366_1000013 | JGI25154J39366_1000013273 | 279 |
| 291 | 3300002741 | JGI25157J39369_1000004 | JGI25157J39369_100000487 | 279 |
| 292 | 3300003214 | JGI25165J46597_1000018 | JGI25165J46597_100001859 | 279 |
| 293 | 3300003320 | rootH2_10010113 | rootH2_100101138 | 279 |
| 294 | 3300003323 | rootH1_10024239 | rootH1_100242392 | 279 |
| 295 | 3300003856 | Ga0058692_1003239 | Ga0058692_10032393 | 279 |
| 296 | 3300005331 | Ga0070670_100153761 | Ga0070670_1001537612 | 279 |
| 297 | 3300005614 | Ga0068856_100022697 | Ga0068856_1000226972 | 279 |
| 298 | 3300006028 | Ga0070717_10319571 | Ga0070717_103195712 | 279 |
| 299 | 3300009094 | Ga0111539_10424519 | Ga0111539_104245192 | 279 |
| 300 | 3300013250 | Ga0171462_1012 | Ga0171462_101226 | 279 |
| 301 | 3300025206 | Ga0209435_100006 | Ga0209435_10000686 | 279 |
| 302 | 3300025233 | Ga0209437_100022 | Ga0209437_100022124 | 279 |
| 303 | 3300025246 | Ga0209646_1000015 | Ga0209646_1000015448 | 279 |
| 304 | 3300025250 | Ga0209026_1000039 | Ga0209026_100003986 | 279 |
| 305 | 3300025256 | Ga0209759_1000005 | Ga0209759_100000586 | 279 |
| 306 | 3300025261 | Ga0209233_1000031 | Ga0209233_1000031124 | 279 |
| 307 | 3300026078 | Ga0207702_10015730 | Ga0207702_100157305 | 279 |
| 308 | 3300027312 | Ga0209371_1002664 | Ga0209371_10026645 | 279 |
| 309 | 3300030500 | Ga0268256_1002375 | Ga0268256_10023755 | 279 |
| 310 | 3300037471 | Ga0395905_0000321 | Ga0395905_0000321_43149_44003 | 279 |
| 311 | 3300044684 | Ga0466966_0163249 | Ga0466966_0163249_64_915 | 279 |
| 312 | 3300044694 | Ga0466963_0146701 | Ga0466963_0146701_769_1620 | 279 |
| 313 | 3300044765 | Ga0466970_0000136 | Ga0466970_0000136_16036_16887 | 279 |
| 314 | 3300044842 | Ga0466957_0002082 | Ga0466957_0002082_8854_9705 | 279 |
| 315 | 3300045051 | Ga0451576_0008472 | Ga0451576_0008472_566_1408 | 279 |
| 316 | 3300045836 | Ga0466958_0229106 | Ga0466958_0229106_312_1163 | 279 |
| 317 | 3300046515 | Ga0495620_0099673 | Ga0495620_0099673_120_968 | 279 |
| 318 | 3300048920 | Ga0496117_0101080 | Ga0496117_0101080_117_968 | 279 |
| 319 | 3300048922 | Ga0496119_0007331 | Ga0496119_0007331_2406_3257 | 279 |
| 320 | 3300048925 | Ga0496122_0007371 | Ga0496122_0007371_1135_1986 | 279 |
| 321 | 3300049823 | Ga0501044_0525071 | Ga0501044_0525071_16_867 | 279 |
| 322 | 3300053125 | Ga0500618_000605 | Ga0500618_000605_2129_2980 | 279 |
| 323 | 3300053151 | Ga0500604_0011363 | Ga0500604_0011363_904_1752 | 279 |
| 324 | 3300053177 | Ga0500636_0066000 | Ga0500636_0066000_799_1650 | 279 |
| 325 | iso_pu_bacteria | 2511231028 | 2511393546 | 279 |
| 326 | iso_pu_bacteria | 2511231221 | 2512036704 | 279 |
| 327 | iso_pu_bacteria | 2513237104 | 2513721682 | 279 |
| 328 | iso_pu_bacteria | 2517093001 | 2517105001 | 279 |
| 329 | iso_pu_bacteria | 2537561587 | 2537877491 | 279 |
| 330 | iso_pu_bacteria | 2554235003 | 2554245476 | 279 |
| 331 | iso_pu_bacteria | 2558860242 | 2559296694 | 279 |
| 332 | iso_pu_bacteria | 2582581299 | 2585232688 | 279 |
| 333 | iso_pu_bacteria | 2599185210 | 2599602802 | 279 |
| 334 | iso_pu_bacteria | 2600255279 | 2601610435 | 279 |
| 335 | iso_pu_bacteria | 2600255308 | 2601747235 | 279 |
| 336 | iso_pu_bacteria | 2643221582 | 2643917325 | 279 |
| 337 | iso_pu_bacteria | 2643221693 | 2644520822 | 279 |
| 338 | iso_pu_bacteria | 2643221734 | 2644732950 | 279 |
| 339 | iso_pu_bacteria | 2721755755 | 2723846765 | 279 |
| 340 | iso_pu_bacteria | 2791355264 | 2793345743 | 279 |
| 341 | iso_pu_bacteria | 2808606387 | 2808987147 | 279 |
| 342 | iso_pu_bacteria | 2818991439 | 2819557515 | 279 |
| 343 | iso_pu_bacteria | 2838016132 | 2838020499 | 279 |
| 344 | iso_pu_bacteria | 2838048938 | 2838049940 | 279 |
| 345 | iso_pu_bacteria | 2838675328 | 2838677972 | 279 |
| 346 | iso_pu_bacteria | 2838714209 | 2838717122 | 279 |
| 347 | iso_pu_bacteria | 2838719591 | 2838722267 | 279 |
| 348 | iso_pu_bacteria | 2838724970 | 2838727871 | 279 |
| 349 | iso_pu_bacteria | 2841859092 | 2841861431 | 279 |
| 350 | iso_pu_bacteria | 2841957949 | 2841960421 | 279 |
| 351 | iso_pu_bacteria | 2842124991 | 2842127723 | 279 |
| 352 | iso_pu_bacteria | 2842130223 | 2842132865 | 279 |
| 353 | iso_pu_bacteria | 2842152218 | 2842154858 | 279 |
| 354 | iso_pu_bacteria | 2842170452 | 2842173357 | 279 |
| 355 | iso_pu_bacteria | 2842175837 | 2842178479 | 279 |
| 356 | iso_pu_bacteria | 2842187318 | 2842190230 | 279 |
| 357 | iso_pu_bacteria | 2842211629 | 2842214544 | 279 |
| 358 | iso_pu_bacteria | 2842224351 | 2842227263 | 279 |
| 359 | iso_pu_bacteria | 2842515876 | 2842518302 | 279 |
| 360 | iso_pu_bacteria | 2881665667 | 2881668917 | 279 |
| 361 | iso_pu_bacteria | 2899792073 | 2899796474 | 279 |
| 362 | iso_pu_bacteria | 2919114240 | 2919117380 | 279 |
| 363 | iso_pu_bacteria | 2926754445 | 2926758827 | 279 |
| 364 | iso_pu_bacteria | 2933006813 | 2933009760 | 279 |
| 365 | iso_pu_bacteria | 2933011516 | 2933013931 | 279 |
| 366 | iso_pu_bacteria | 2933594066 | 2933595741 | 279 |
| 367 | iso_pu_bacteria | 2935694250 | 2935702555 | 279 |
| 368 | iso_pu_bacteria | 2979089926 | 2979091312 | 279 |
| 369 | iso_pu_bacteria | 2979095461 | 2979096836 | 279 |
| 370 | iso_pu_bacteria | 2979100975 | 2979102556 | 279 |
| 371 | iso_pu_bacteria | 2984509177 | 2984509559 | 279 |
| 372 | iso_pu_bacteria | 2984518228 | 2984519743 | 279 |
| 373 | iso_pu_bacteria | 2984537506 | 2984537894 | 279 |
| 374 | iso_pu_bacteria | 2984601300 | 2984604639 | 279 |
| 375 | iso_pu_bacteria | 3000017691 | 3000020408 | 279 |
| 376 | iso_pu_bacteria | 3005594810 | 3005596780 | 279 |
| 377 | iso_pu_bacteria | 650716007 | 650843116 | 279 |
| 378 | iso_pu_bacteria | 8003570095 | 8003575462 | 279 |
| 379 | iso_pu_bacteria | 8005430974 | 8005436578 | 279 |
| 380 | iso_pu_bacteria | 8005619151 | 8005624243 | 279 |
| 381 | iso_pu_bacteria | 8005626139 | 8005629509 | 279 |
| 382 | iso_pu_bacteria | 8006964411 | 8006970410 | 279 |
| 383 | iso_pu_bacteria | 8054002106 | 8054005278 | 279 |
| 384 | 3300003214 | JGI25165J46597_1000372 | JGI25165J46597_100037212 | 280 |
| 385 | 3300003214 | JGI25165J46597_1007625 | JGI25165J46597_10076252 | 280 |
| 386 | 3300005459 | Ga0068867_100090481 | Ga0068867_1000904812 | 280 |
| 387 | 3300005548 | Ga0070665_100083416 | Ga0070665_1000834162 | 280 |
| 388 | 3300005563 | Ga0068855_100133933 | Ga0068855_1001339332 | 280 |
| 389 | 3300005616 | Ga0068852_100403498 | Ga0068852_1004034982 | 280 |
| 390 | 3300006042 | Ga0075368_10050824 | Ga0075368_100508242 | 280 |
| 391 | 3300006051 | Ga0075364_10033420 | Ga0075364_100334202 | 280 |
| 392 | 3300006051 | Ga0075364_10185728 | Ga0075364_101857282 | 280 |
| 393 | 3300006178 | Ga0075367_10011472 | Ga0075367_100114725 | 280 |
| 394 | 3300006195 | Ga0075366_10137917 | Ga0075366_101379172 | 280 |
| 395 | 3300009093 | Ga0105240_10000217 | Ga0105240_1000021729 | 280 |
| 396 | 3300009148 | Ga0105243_10425834 | Ga0105243_104258342 | 280 |
| 397 | 3300009545 | Ga0105237_10000978 | Ga0105237_100009789 | 280 |
| 398 | 3300010375 | Ga0105239_10009668 | Ga0105239_100096685 | 280 |
| 399 | 3300011119 | Ga0105246_10160270 | Ga0105246_101602702 | 280 |
| 400 | 3300013104 | Ga0157370_10005183 | Ga0157370_100051837 | 280 |
| 401 | 3300013105 | Ga0157369_10021904 | Ga0157369_100219045 | 280 |
| 402 | 3300013306 | Ga0163162_10229727 | Ga0163162_102297272 | 280 |
| 403 | 3300015261 | Ga0182006_1090140 | Ga0182006_10901402 | 280 |
| 404 | 3300015262 | Ga0182007_10011070 | Ga0182007_100110702 | 280 |
| 405 | 3300021361 | Ga0213872_10058442 | Ga0213872_100584422 | 280 |
| 406 | 3300025253 | Ga0209677_100826 | Ga0209677_10082615 | 280 |
| 407 | 3300025261 | Ga0209233_1000324 | Ga0209233_100032411 | 280 |
| 408 | 3300025261 | Ga0209233_1000330 | Ga0209233_100033022 | 280 |
| 409 | 3300025261 | Ga0209233_1008499 | Ga0209233_10084992 | 280 |
| 410 | 3300025297 | Ga0209758_1054707 | Ga0209758_10547072 | 280 |
| 411 | 3300025904 | Ga0207647_10081616 | Ga0207647_100816162 | 280 |
| 412 | 3300025907 | Ga0207645_10081588 | Ga0207645_100815882 | 280 |
| 413 | 3300025911 | Ga0207654_10155102 | Ga0207654_101551022 | 280 |
| 414 | 3300025913 | Ga0207695_10001205 | Ga0207695_1000120529 | 280 |
| 415 | 3300025914 | Ga0207671_10000793 | Ga0207671_1000079313 | 280 |
| 416 | 3300025933 | Ga0207706_10129092 | Ga0207706_101290922 | 280 |
| 417 | 3300025941 | Ga0207711_10463525 | Ga0207711_104635252 | 280 |
| 418 | 3300025949 | Ga0207667_10146494 | Ga0207667_101464942 | 280 |
| 419 | 3300025972 | Ga0207668_10089600 | Ga0207668_100896002 | 280 |
| 420 | 3300025981 | Ga0207640_10048081 | Ga0207640_100480812 | 280 |
| 421 | 3300026089 | Ga0207648_10134408 | Ga0207648_101344082 | 280 |
| 422 | 3300026116 | Ga0207674_10082312 | Ga0207674_100823124 | 280 |
| 423 | 3300026118 | Ga0207675_100247727 | Ga0207675_1002477272 | 280 |
| 424 | 3300026121 | Ga0207683_10068199 | Ga0207683_100681993 | 280 |
| 425 | 3300026142 | Ga0207698_10456296 | Ga0207698_104562962 | 280 |
| 426 | 3300028379 | Ga0268266_10082713 | Ga0268266_100827133 | 280 |
| 427 | 3300028794 | Ga0307515_10009236 | Ga0307515_1000923612 | 280 |
| 428 | 3300031456 | Ga0307513_10003915 | Ga0307513_1000391514 | 280 |
| 429 | 3300035171 | Ga0373946_0181048 | Ga0373946_0181048_73_918 | 280 |
| 430 | 3300035692 | Ga0373935_0142994 | Ga0373935_0142994_317_1162 | 280 |
| 431 | 3300035695 | Ga0373927_0000581 | Ga0373927_0000581_4071_4916 | 280 |
| 432 | 3300037418 | Ga0395900_0039934 | Ga0395900_0039934_76_927 | 280 |
| 433 | 3300037418 | Ga0395900_0041420 | Ga0395900_0041420_3268_4119 | 280 |
| 434 | 3300037466 | Ga0395898_0247312 | Ga0395898_0247312_708_1559 | 280 |
| 435 | 3300037471 | Ga0395905_0047480 | Ga0395905_0047480_2691_3542 | 280 |
| 436 | 3300038443 | Ga0395901_0011805 | Ga0395901_0011805_1938_2789 | 280 |
| 437 | 3300039447 | Ga0436361_1160430 | Ga0436361_1160430_1853_2731 | 280 |
| 438 | 3300044658 | Ga0466972_0018693 | Ga0466972_0018693_384_1235 | 280 |
| 439 | 3300046459 | Ga0495629_0009432 | Ga0495629_0009432_388_1230 | 280 |
| 440 | 3300046460 | Ga0495638_0029107 | Ga0495638_0029107_2687_3538 | 280 |
| 441 | 3300046476 | Ga0495662_0004214 | Ga0495662_0004214_1981_2823 | 280 |
| 442 | 3300046512 | Ga0495610_0078559 | Ga0495610_0078559_124_975 | 280 |
| 443 | 3300046524 | Ga0495648_0085494 | Ga0495648_0085494_64_906 | 280 |
| 444 | 3300046557 | Ga0495622_0001480 | Ga0495622_0001480_10912_11754 | 280 |
| 445 | 3300046616 | Ga0495668_0229121 | Ga0495668_0229121_19_870 | 280 |
| 446 | 3300046660 | Ga0495625_0041169 | Ga0495625_0041169_1812_2654 | 280 |
| 447 | 3300046675 | Ga0495657_0055012 | Ga0495657_0055012_1194_2036 | 280 |
| 448 | 3300046809 | Ga0495600_0177183 | Ga0495600_0177183_148_990 | 280 |
| 449 | 3300047317 | Ga0495604_0000886 | Ga0495604_0000886_10406_11248 | 280 |
| 450 | 3300048920 | Ga0496117_0002969 | Ga0496117_0002969_1707_2549 | 280 |
| 451 | 3300048921 | Ga0496118_0013244 | Ga0496118_0013244_5091_5933 | 280 |
| 452 | 3300048922 | Ga0496119_0008586 | Ga0496119_0008586_4851_5693 | 280 |
| 453 | 3300048923 | Ga0496120_0004196 | Ga0496120_0004196_5012_5854 | 280 |
| 454 | 3300048924 | Ga0496121_0001476 | Ga0496121_0001476_28844_29686 | 280 |
| 455 | 3300048925 | Ga0496122_0003859 | Ga0496122_0003859_4733_5575 | 280 |
| 456 | 3300048925 | Ga0496122_0007025 | Ga0496122_0007025_10436_11278 | 280 |
| 457 | 3300048926 | Ga0496123_0021255 | Ga0496123_0021255_2211_3053 | 280 |
| 458 | 3300048927 | Ga0496124_0025190 | Ga0496124_0025190_2171_3013 | 280 |
| 459 | 3300049573 | Ga0501037_0072493 | Ga0501037_0072493_1027_1881 | 280 |
| 460 | 3300050490 | nmdc:mga03n38_90357_c1 | nmdc:mga03n38_90357_c1_212_1063 | 280 |
| 461 | 3300053142 | Ga0500577_0087440 | Ga0500577_0087440_289_1140 | 280 |
| 462 | 3300053148 | Ga0500590_030908 | Ga0500590_030908_668_1510 | 280 |
| 463 | 3300053158 | Ga0500627_0008746 | Ga0500627_0008746_2648_3499 | 280 |
| 464 | 3300053177 | Ga0500636_0000001 | Ga0500636_0000001_67718_68560 | 280 |
| 465 | 3300053177 | Ga0500636_0001623 | Ga0500636_0001623_7482_8324 | 280 |
| 466 | iso_pu_bacteria | 2513237144 | 2513910746 | 280 |
| 467 | iso_pu_bacteria | 2516143018 | 2516207165 | 280 |
| 468 | iso_pu_bacteria | 2519899620 | 2520377720 | 280 |
| 469 | iso_pu_bacteria | 2690316117 | 2692318302 | 280 |
| 470 | iso_pu_bacteria | 2718217882 | 2719184854 | 280 |
| 471 | iso_pu_bacteria | 2718218009 | 2719728874 | 280 |
| 472 | iso_pu_bacteria | 2718218232 | 2720610222 | 280 |
| 473 | iso_pu_bacteria | 2718218233 | 2720617646 | 280 |
| 474 | iso_pu_bacteria | 2718218235 | 2720628788 | 280 |
| 475 | iso_pu_bacteria | 2718218269 | 2720772737 | 280 |
| 476 | iso_pu_bacteria | 2718218363 | 2721144565 | 280 |
| 477 | iso_pu_bacteria | 2718218365 | 2721156057 | 280 |
| 478 | iso_pu_bacteria | 2718218366 | 2721161935 | 280 |
| 479 | iso_pu_bacteria | 2721755514 | 2722843080 | 280 |
| 480 | iso_pu_bacteria | 2721755556 | 2723030177 | 280 |
| 481 | iso_pu_bacteria | 2721755685 | 2723569776 | 280 |
| 482 | iso_pu_bacteria | 2721755810 | 2724041899 | 280 |
| 483 | iso_pu_bacteria | 2721755819 | 2724092766 | 280 |
| 484 | iso_pu_bacteria | 2721755822 | 2724101323 | 280 |
| 485 | iso_pu_bacteria | 2721755823 | 2724113153 | 280 |
| 486 | iso_pu_bacteria | 2728369352 | 2730110710 | 280 |
| 487 | iso_pu_bacteria | 2728369365 | 2730160969 | 280 |
| 488 | iso_pu_bacteria | 2728369397 | 2730295590 | 280 |
| 489 | iso_pu_bacteria | 2751185821 | 2753462806 | 280 |
| 490 | iso_pu_bacteria | 2765235802 | 2765468811 | 280 |
| 491 | iso_pu_bacteria | 2767802442 | 2770198475 | 280 |
| 492 | iso_pu_bacteria | 2775507049 | 2776910701 | 280 |
| 493 | iso_pu_bacteria | 2791355094 | 2792640927 | 280 |
| 494 | iso_pu_bacteria | 2791355261 | 2793329900 | 280 |
| 495 | iso_pu_bacteria | 2791355265 | 2793354434 | 280 |
| 496 | iso_pu_bacteria | 2802429605 | 2805928354 | 280 |
| 497 | iso_pu_bacteria | 2802429606 | 2805935165 | 280 |
| 498 | iso_pu_bacteria | 2818991467 | 2819717336 | 280 |
| 499 | iso_pu_bacteria | 2838668709 | 2838669287 | 280 |
| 500 | iso_pu_bacteria | 2838701080 | 2838701659 | 280 |
| 501 | iso_pu_bacteria | 2842192696 | 2842195927 | 280 |
| 502 | iso_pu_bacteria | 2842205361 | 2842209910 | 280 |
| 503 | iso_pu_bacteria | 2842250916 | 2842251917 | 280 |
| 504 | iso_pu_bacteria | 2842264693 | 2842264811 | 280 |
| 505 | iso_pu_bacteria | 2842278818 | 2842283364 | 280 |
| 506 | iso_pu_bacteria | 2842317721 | 2842320319 | 280 |
| 507 | iso_pu_bacteria | 2842402390 | 2842405949 | 280 |
| 508 | iso_pu_bacteria | 2842409023 | 2842412533 | 280 |
| 509 | iso_pu_bacteria | 2842415677 | 2842419177 | 280 |
| 510 | iso_pu_bacteria | 2842428310 | 2842429136 | 280 |
| 511 | iso_pu_bacteria | 2842434925 | 2842435749 | 280 |
| 512 | iso_pu_bacteria | 2842441272 | 2842441389 | 280 |
| 513 | iso_pu_bacteria | 2842469257 | 2842470079 | 280 |
| 514 | iso_pu_bacteria | 2842489311 | 2842489896 | 280 |
| 515 | iso_pu_bacteria | 2842495871 | 2842498060 | 280 |
| 516 | iso_pu_bacteria | 2847417321 | 2847423194 | 280 |
| 517 | iso_pu_bacteria | 2848992105 | 2848997410 | 280 |
| 518 | iso_pu_bacteria | 2855872281 | 2855874183 | 280 |
| 519 | iso_pu_bacteria | 2996893221 | 2996894512 | 280 |
| 520 | iso_pu_bacteria | 3000405567 | 3000406295 | 280 |
| 521 | iso_pu_bacteria | 643692032 | 643822487 | 280 |
| 522 | iso_pu_bacteria | 8005258706 | 8005263786 | 280 |
| 523 | iso_pu_bacteria | 8005289223 | 8005290845 | 280 |
| 524 | iso_pu_bacteria | 8005382845 | 8005383385 | 280 |
| 525 | iso_pu_bacteria | 8005395548 | 8005398979 | 280 |
| 526 | iso_pu_bacteria | 8024501048 | 8024504197 | 280 |
| 527 | iso_pu_bacteria | 8056382006 | 8056382177 | 280 |
| 528 | 2010549000 | RicEn_C2804 | RicEn_51530 | 281 |
| 529 | 3300001989 | JGI24739J22299_10041822 | JGI24739J22299_100418222 | 281 |
| 530 | 3300002773 | JGI25152J39213_1011381 | JGI25152J39213_10113812 | 281 |
| 531 | 3300003187 | JGI25151J46595_10000867 | JGI25151J46595_1000086710 | 281 |
| 532 | 3300003187 | JGI25151J46595_10031432 | JGI25151J46595_100314322 | 281 |
| 533 | 3300003215 | JGI25153J46596_10011736 | JGI25153J46596_100117362 | 281 |
| 534 | 3300003354 | JGI25160J50197_1000203 | JGI25160J50197_100020311 | 281 |
| 535 | 3300003354 | JGI25160J50197_1002223 | JGI25160J50197_10022236 | 281 |
| 536 | 3300003374 | JGI25161J50226_1000570 | JGI25161J50226_10005708 | 281 |
| 537 | 3300003771 | Ga0055526_1000308 | Ga0055526_100030813 | 281 |
| 538 | 3300003771 | Ga0055526_1002146 | Ga0055526_10021466 | 281 |
| 539 | 3300003771 | Ga0055526_1009056 | Ga0055526_10090565 | 281 |
| 540 | 3300003775 | Ga0055524_1004129 | Ga0055524_10041295 | 281 |
| 541 | 3300003781 | Ga0055536_1000640 | Ga0055536_10006405 | 281 |
| 542 | 3300003790 | Ga0055528_1000054 | Ga0055528_100005438 | 281 |
| 543 | 3300003790 | Ga0055528_1001635 | Ga0055528_10016355 | 281 |
| 544 | 3300003791 | Ga0055530_10026839 | Ga0055530_100268392 | 281 |
| 545 | 3300003792 | Ga0055540_1008780 | Ga0055540_10087802 | 281 |
| 546 | 3300003792 | Ga0055540_1032064 | Ga0055540_10320642 | 281 |
| 547 | 3300003794 | Ga0055531_10004096 | Ga0055531_1000409610 | 281 |
| 548 | 3300003856 | Ga0058692_1001981 | Ga0058692_10019814 | 281 |
| 549 | 3300003856 | Ga0058692_1006050 | Ga0058692_10060502 | 281 |
| 550 | 3300004625 | Ga0055543_1000558 | Ga0055543_10005582 | 281 |
| 551 | 3300004625 | Ga0055543_1001165 | Ga0055543_10011655 | 281 |
| 552 | 3300005262 | Ga0065165_1000672 | Ga0065165_100067211 | 281 |
| 553 | 3300005262 | Ga0065165_1008544 | Ga0065165_10085442 | 281 |
| 554 | 3300005331 | Ga0070670_100076245 | Ga0070670_1000762452 | 281 |
| 555 | 3300005335 | Ga0070666_10025758 | Ga0070666_100257581 | 281 |
| 556 | 3300005338 | Ga0068868_100254226 | Ga0068868_1002542262 | 281 |
| 557 | 3300005344 | Ga0070661_100215985 | Ga0070661_1002159852 | 281 |
| 558 | 3300005347 | Ga0070668_100012960 | Ga0070668_1000129602 | 281 |
| 559 | 3300005353 | Ga0070669_100013332 | Ga0070669_1000133323 | 281 |
| 560 | 3300005367 | Ga0070667_100081761 | Ga0070667_1000817612 | 281 |
| 561 | 3300005455 | Ga0070663_100316409 | Ga0070663_1003164092 | 281 |
| 562 | 3300005456 | Ga0070678_100292621 | Ga0070678_1002926212 | 281 |
| 563 | 3300005457 | Ga0070662_100035439 | Ga0070662_1000354392 | 281 |
| 564 | 3300005539 | Ga0068853_100014109 | Ga0068853_1000141093 | 281 |
| 565 | 3300005548 | Ga0070665_100023970 | Ga0070665_1000239703 | 281 |
| 566 | 3300005548 | Ga0070665_100026871 | Ga0070665_1000268715 | 281 |
| 567 | 3300005563 | Ga0068855_100248883 | Ga0068855_1002488832 | 281 |
| 568 | 3300005577 | Ga0068857_100080305 | Ga0068857_1000803052 | 281 |
| 569 | 3300005578 | Ga0068854_100079341 | Ga0068854_1000793413 | 281 |
| 570 | 3300005614 | Ga0068856_100226958 | Ga0068856_1002269582 | 281 |
| 571 | 3300005616 | Ga0068852_100000915 | Ga0068852_1000009157 | 281 |
| 572 | 3300005617 | Ga0068859_100336297 | Ga0068859_1003362972 | 281 |
| 573 | 3300005719 | Ga0068861_100131658 | Ga0068861_1001316582 | 281 |
| 574 | 3300005842 | Ga0068858_100059748 | Ga0068858_1000597482 | 281 |
| 575 | 3300005843 | Ga0068860_100000223 | Ga0068860_10000022360 | 281 |
| 576 | 3300005843 | Ga0068860_100357463 | Ga0068860_1003574632 | 281 |
| 577 | 3300006038 | Ga0075365_10013583 | Ga0075365_100135834 | 281 |
| 578 | 3300006038 | Ga0075365_10114102 | Ga0075365_101141022 | 281 |
| 579 | 3300006038 | Ga0075365_10280843 | Ga0075365_102808432 | 281 |
| 580 | 3300006042 | Ga0075368_10024453 | Ga0075368_100244532 | 281 |
| 581 | 3300006048 | Ga0075363_100017924 | Ga0075363_1000179243 | 281 |
| 582 | 3300006051 | Ga0075364_10005543 | Ga0075364_100055434 | 281 |
| 583 | 3300006177 | Ga0075362_10006562 | Ga0075362_100065622 | 281 |
| 584 | 3300006177 | Ga0075362_10018491 | Ga0075362_100184912 | 281 |
| 585 | 3300006177 | Ga0075362_10126842 | Ga0075362_101268421 | 281 |
| 586 | 3300006178 | Ga0075367_10000241 | Ga0075367_1000024116 | 281 |
| 587 | 3300006178 | Ga0075367_10004266 | Ga0075367_100042663 | 281 |
| 588 | 3300006178 | Ga0075367_10019149 | Ga0075367_100191493 | 281 |
| 589 | 3300006178 | Ga0075367_10078466 | Ga0075367_100784662 | 281 |
| 590 | 3300006178 | Ga0075367_10148372 | Ga0075367_101483722 | 281 |
| 591 | 3300006178 | Ga0075367_10198256 | Ga0075367_101982562 | 281 |
| 592 | 3300006186 | Ga0075369_10009321 | Ga0075369_100093212 | 281 |
| 593 | 3300006186 | Ga0075369_10015713 | Ga0075369_100157132 | 281 |
| 594 | 3300006186 | Ga0075369_10025405 | Ga0075369_100254052 | 281 |
| 595 | 3300006186 | Ga0075369_10044681 | Ga0075369_100446812 | 281 |
| 596 | 3300006186 | Ga0075369_10059305 | Ga0075369_100593052 | 281 |
| 597 | 3300006195 | Ga0075366_10038290 | Ga0075366_100382902 | 281 |
| 598 | 3300006195 | Ga0075366_10050002 | Ga0075366_100500022 | 281 |
| 599 | 3300006195 | Ga0075366_10078718 | Ga0075366_100787182 | 281 |
| 600 | 3300006353 | Ga0075370_10006474 | Ga0075370_100064742 | 281 |
| 601 | 3300006931 | Ga0097620_100336301 | Ga0097620_1003363012 | 281 |
| 602 | 3300006942 | Ga0099824_1032205 | Ga0099824_10322052 | 281 |
| 603 | 3300006946 | Ga0079104_1003957 | Ga0079104_10039575 | 281 |
| 604 | 3300006948 | Ga0099826_10000665 | Ga0099826_100006659 | 281 |
| 605 | 3300006948 | Ga0099826_10171592 | Ga0099826_101715922 | 281 |
| 606 | 3300009148 | Ga0105243_10009663 | Ga0105243_100096634 | 281 |
| 607 | 3300009148 | Ga0105243_10025719 | Ga0105243_100257192 | 281 |
| 608 | 3300009174 | Ga0105241_10011661 | Ga0105241_100116614 | 281 |
| 609 | 3300009177 | Ga0105248_10002569 | Ga0105248_1000256914 | 281 |
| 610 | 3300009551 | Ga0105238_10007717 | Ga0105238_100077173 | 281 |
| 611 | 3300010375 | Ga0105239_10024076 | Ga0105239_100240762 | 281 |
| 612 | 3300011119 | Ga0105246_10004096 | Ga0105246_100040963 | 281 |
| 613 | 3300011119 | Ga0105246_10156773 | Ga0105246_101567732 | 281 |
| 614 | 3300013100 | Ga0157373_10004938 | Ga0157373_100049389 | 281 |
| 615 | 3300013102 | Ga0157371_10000002 | Ga0157371_10000002354 | 281 |
| 616 | 3300013104 | Ga0157370_10003627 | Ga0157370_1000362711 | 281 |
| 617 | 3300013296 | Ga0157374_10119829 | Ga0157374_101198292 | 281 |
| 618 | 3300013297 | Ga0157378_10039964 | Ga0157378_100399644 | 281 |
| 619 | 3300013297 | Ga0157378_10325447 | Ga0157378_103254472 | 281 |
| 620 | 3300013306 | Ga0163162_10085820 | Ga0163162_100858202 | 281 |
| 621 | 3300014325 | Ga0163163_10007929 | Ga0163163_100079292 | 281 |
| 622 | 3300021320 | Ga0214544_1000018 | Ga0214544_1000018170 | 281 |
| 623 | 3300021321 | Ga0214542_1000307 | Ga0214542_100030773 | 281 |
| 624 | 3300021327 | Ga0214543_1000195 | Ga0214543_100019514 | 281 |
| 625 | 3300021327 | Ga0214543_1011326 | Ga0214543_10113266 | 281 |
| 626 | 3300022739 | Ga0228711_1004587 | Ga0228711_100458716 | 281 |
| 627 | 3300022740 | Ga0228710_1004744 | Ga0228710_100474417 | 281 |
| 628 | 3300025208 | Ga0209436_102573 | Ga0209436_1025734 | 281 |
| 629 | 3300025245 | Ga0207425_1022250 | Ga0207425_10222501 | 281 |
| 630 | 3300025253 | Ga0209677_102046 | Ga0209677_1020464 | 281 |
| 631 | 3300025254 | Ga0209148_1000260 | Ga0209148_100026057 | 281 |
| 632 | 3300025258 | Ga0209129_1000669 | Ga0209129_100066913 | 281 |
| 633 | 3300025258 | Ga0209129_1014747 | Ga0209129_10147472 | 281 |
| 634 | 3300025261 | Ga0209233_1005862 | Ga0209233_10058622 | 281 |
| 635 | 3300025273 | Ga0209673_1000067 | Ga0209673_1000067195 | 281 |
| 636 | 3300025273 | Ga0209673_1000291 | Ga0209673_100029146 | 281 |
| 637 | 3300025273 | Ga0209673_1007600 | Ga0209673_10076002 | 281 |
| 638 | 3300025273 | Ga0209673_1013841 | Ga0209673_10138412 | 281 |
| 639 | 3300025284 | Ga0209130_1000242 | Ga0209130_100024230 | 281 |
| 640 | 3300025292 | Ga0209676_1001988 | Ga0209676_10019886 | 281 |
| 641 | 3300025292 | Ga0209676_1051477 | Ga0209676_10514771 | 281 |
| 642 | 3300025294 | Ga0209025_1000240 | Ga0209025_1000240149 | 281 |
| 643 | 3300025294 | Ga0209025_1000430 | Ga0209025_100043034 | 281 |
| 644 | 3300025294 | Ga0209025_1001534 | Ga0209025_10015348 | 281 |
| 645 | 3300025295 | Ga0209564_1000092 | Ga0209564_1000092195 | 281 |
| 646 | 3300025295 | Ga0209564_1000338 | Ga0209564_100033879 | 281 |
| 647 | 3300025295 | Ga0209564_1000876 | Ga0209564_10008769 | 281 |
| 648 | 3300025297 | Ga0209758_1000490 | Ga0209758_100049017 | 281 |
| 649 | 3300025297 | Ga0209758_1008376 | Ga0209758_10083766 | 281 |
| 650 | 3300025298 | Ga0209050_1004950 | Ga0209050_10049504 | 281 |
| 651 | 3300025298 | Ga0209050_1010402 | Ga0209050_10104022 | 281 |
| 652 | 3300025299 | Ga0209256_1000788 | Ga0209256_10007883 | 281 |
| 653 | 3300025299 | Ga0209256_1001843 | Ga0209256_10018432 | 281 |
| 654 | 3300025299 | Ga0209256_1002067 | Ga0209256_10020678 | 281 |
| 655 | 3300025299 | Ga0209256_1019508 | Ga0209256_10195082 | 281 |
| 656 | 3300025302 | Ga0207426_1000075 | Ga0207426_1000075249 | 281 |
| 657 | 3300025302 | Ga0207426_1000483 | Ga0207426_100048350 | 281 |
| 658 | 3300025303 | Ga0209051_1000502 | Ga0209051_100050228 | 281 |
| 659 | 3300025303 | Ga0209051_1002802 | Ga0209051_10028027 | 281 |
| 660 | 3300025303 | Ga0209051_1008011 | Ga0209051_10080115 | 281 |
| 661 | 3300025304 | Ga0209257_1003568 | Ga0209257_10035686 | 281 |
| 662 | 3300025304 | Ga0209257_1003646 | Ga0209257_10036466 | 281 |
| 663 | 3300025304 | Ga0209257_1004238 | Ga0209257_10042385 | 281 |
| 664 | 3300025304 | Ga0209257_1004771 | Ga0209257_10047714 | 281 |
| 665 | 3300025903 | Ga0207680_10422073 | Ga0207680_104220731 | 281 |
| 666 | 3300025904 | Ga0207647_10001845 | Ga0207647_1000184514 | 281 |
| 667 | 3300025911 | Ga0207654_10008209 | Ga0207654_100082093 | 281 |
| 668 | 3300025911 | Ga0207654_10014807 | Ga0207654_100148072 | 281 |
| 669 | 3300025913 | Ga0207695_10000163 | Ga0207695_10000163172 | 281 |
| 670 | 3300025914 | Ga0207671_10006375 | Ga0207671_100063755 | 281 |
| 671 | 3300025914 | Ga0207671_10169932 | Ga0207671_101699322 | 281 |
| 672 | 3300025923 | Ga0207681_10038709 | Ga0207681_100387092 | 281 |
| 673 | 3300025924 | Ga0207694_10046666 | Ga0207694_100466663 | 281 |
| 674 | 3300025925 | Ga0207650_10193811 | Ga0207650_101938112 | 281 |
| 675 | 3300025931 | Ga0207644_10126543 | Ga0207644_101265432 | 281 |
| 676 | 3300025935 | Ga0207709_10030401 | Ga0207709_100304012 | 281 |
| 677 | 3300025949 | Ga0207667_10230708 | Ga0207667_102307082 | 281 |
| 678 | 3300025972 | Ga0207668_10159844 | Ga0207668_101598442 | 281 |
| 679 | 3300025981 | Ga0207640_10018951 | Ga0207640_100189514 | 281 |
| 680 | 3300026023 | Ga0207677_10025782 | Ga0207677_100257824 | 281 |
| 681 | 3300026035 | Ga0207703_10395554 | Ga0207703_103955542 | 281 |
| 682 | 3300026041 | Ga0207639_10033648 | Ga0207639_100336482 | 281 |
| 683 | 3300026067 | Ga0207678_10035731 | Ga0207678_100357314 | 281 |
| 684 | 3300026116 | Ga0207674_10027216 | Ga0207674_100272164 | 281 |
| 685 | 3300026118 | Ga0207675_100126661 | Ga0207675_1001266613 | 281 |
| 686 | 3300027111 | Ga0209281_1000491 | Ga0209281_100049132 | 281 |
| 687 | 3300027111 | Ga0209281_1000981 | Ga0209281_10009818 | 281 |
| 688 | 3300027296 | Ga0209389_1000075 | Ga0209389_100007540 | 281 |
| 689 | 3300027312 | Ga0209371_1000003 | Ga0209371_1000003458 | 281 |
| 690 | 3300027312 | Ga0209371_1000324 | Ga0209371_100032440 | 281 |
| 691 | 3300027357 | Ga0209589_1000085 | Ga0209589_100008539 | 281 |
| 692 | 3300027361 | Ga0209489_100062 | Ga0209489_10006271 | 281 |
| 693 | 3300027666 | Ga0209282_1000108 | Ga0209282_100010826 | 281 |
| 694 | 3300027666 | Ga0209282_1000604 | Ga0209282_10006049 | 281 |
| 695 | 3300027666 | Ga0209282_1145924 | Ga0209282_11459242 | 281 |
| 696 | 3300028379 | Ga0268266_10109122 | Ga0268266_101091222 | 281 |
| 697 | 3300028379 | Ga0268266_10315994 | Ga0268266_103159942 | 281 |
| 698 | 3300028380 | Ga0268265_10034463 | Ga0268265_100344632 | 281 |
| 699 | 3300028381 | Ga0268264_10000119 | Ga0268264_10000119142 | 281 |
| 700 | 3300028381 | Ga0268264_10360012 | Ga0268264_103600122 | 281 |
| 701 | 3300028794 | Ga0307515_10001999 | Ga0307515_1000199939 | 281 |
| 702 | 3300030500 | Ga0268256_1000004 | Ga0268256_1000004592 | 281 |
| 703 | 3300030500 | Ga0268256_1001615 | Ga0268256_10016158 | 281 |
| 704 | 3300030745 | Ga0316182_1446202 | Ga0316182_14462022 | 281 |
| 705 | 3300031507 | Ga0307509_10216605 | Ga0307509_102166052 | 281 |
| 706 | 3300031507 | Ga0307509_10266616 | Ga0307509_102666162 | 281 |
| 707 | 3300031616 | Ga0307508_10001261 | Ga0307508_100012617 | 281 |
| 708 | 3300031616 | Ga0307508_10108467 | Ga0307508_101084671 | 281 |
| 709 | 3300031730 | Ga0307516_10085368 | Ga0307516_100853683 | 281 |
| 710 | 3300031967 | Ga0315914_1000427 | Ga0315914_100042729 | 281 |
| 711 | 3300032002 | Ga0307416_100579733 | Ga0307416_1005797331 | 281 |
| 712 | 3300033430 | Ga0315913_1001358 | Ga0315913_100135815 | 281 |
| 713 | 3300033464 | Ga0315915_1000032 | Ga0315915_100003271 | 281 |
| 714 | 3300035692 | Ga0373935_0007083 | Ga0373935_0007083_3518_4372 | 281 |
| 715 | 3300035695 | Ga0373927_0008059 | Ga0373927_0008059_2981_3835 | 281 |
| 716 | 3300039447 | Ga0436361_0117844 | Ga0436361_0117844_1419_2267 | 281 |
| 717 | 3300041413 | Ga0439465_0001132 | Ga0439465_0001132_4594_5448 | 281 |
| 718 | 3300041498 | Ga0451841_0655033 | Ga0451841_0655033_162_1028 | 281 |
| 719 | 3300041511 | Ga0451855_1487574 | Ga0451855_1487574_35_901 | 281 |
| 720 | 3300045051 | Ga0451576_0027482 | Ga0451576_0027482_1928_2800 | 281 |
| 721 | 3300046474 | Ga0495605_0005741 | Ga0495605_0005741_4300_5166 | 281 |
| 722 | 3300046492 | Ga0495585_0027986 | Ga0495585_0027986_1297_2160 | 281 |
| 723 | 3300046501 | Ga0495607_0025260 | Ga0495607_0025260_274_1140 | 281 |
| 724 | 3300046506 | Ga0495583_0001811 | Ga0495583_0001811_4951_5802 | 281 |
| 725 | 3300046507 | Ga0495606_0010507 | Ga0495606_0010507_4942_5808 | 281 |
| 726 | 3300046507 | Ga0495606_0026163 | Ga0495606_0026163_365_1219 | 281 |
| 727 | 3300046512 | Ga0495610_0037467 | Ga0495610_0037467_1096_1962 | 281 |
| 728 | 3300046513 | Ga0495616_0122478 | Ga0495616_0122478_65_919 | 281 |
| 729 | 3300046515 | Ga0495620_0001877 | Ga0495620_0001877_6546_7412 | 281 |
| 730 | 3300046518 | Ga0495631_0022769 | Ga0495631_0022769_1017_1880 | 281 |
| 731 | 3300046518 | Ga0495631_0059438 | Ga0495631_0059438_610_1476 | 281 |
| 732 | 3300046519 | Ga0495632_0037014 | Ga0495632_0037014_1519_2382 | 281 |
| 733 | 3300046522 | Ga0495643_0006040 | Ga0495643_0006040_3643_4509 | 281 |
| 734 | 3300046523 | Ga0495644_0047166 | Ga0495644_0047166_85_951 | 281 |
| 735 | 3300046524 | Ga0495648_0015554 | Ga0495648_0015554_4396_5262 | 281 |
| 736 | 3300046530 | Ga0495654_0048553 | Ga0495654_0048553_238_1104 | 281 |
| 737 | 3300046538 | Ga0495609_0056542 | Ga0495609_0056542_797_1663 | 281 |
| 738 | 3300046542 | Ga0495597_0011739 | Ga0495597_0011739_193_1047 | 281 |
| 739 | 3300046542 | Ga0495597_0031607 | Ga0495597_0031607_1070_1936 | 281 |
| 740 | 3300046616 | Ga0495668_0006776 | Ga0495668_0006776_4867_5733 | 281 |
| 741 | 3300046616 | Ga0495668_0033505 | Ga0495668_0033505_94_957 | 281 |
| 742 | 3300046616 | Ga0495668_0054192 | Ga0495668_0054192_1167_2021 | 281 |
| 743 | 3300046660 | Ga0495625_0003205 | Ga0495625_0003205_15485_16348 | 281 |
| 744 | 3300046660 | Ga0495625_0010911 | Ga0495625_0010911_4253_5119 | 281 |
| 745 | 3300046691 | Ga0495670_0007464 | Ga0495670_0007464_1760_2626 | 281 |
| 746 | 3300046694 | Ga0495649_0008058 | Ga0495649_0008058_883_1749 | 281 |
| 747 | 3300046694 | Ga0495649_0093027 | Ga0495649_0093027_364_1218 | 281 |
| 748 | 3300046810 | Ga0495660_0008181 | Ga0495660_0008181_4569_5435 | 281 |
| 749 | 3300047318 | Ga0495636_0088757 | Ga0495636_0088757_438_1304 | 281 |
| 750 | 3300047323 | Ga0495683_0030310 | Ga0495683_0030310_608_1462 | 281 |
| 751 | 3300047323 | Ga0495683_0103540 | Ga0495683_0103540_253_1119 | 281 |
| 752 | 3300047443 | Ga0495687_010309 | Ga0495687_010309_447_1301 | 281 |
| 753 | 3300047443 | Ga0495687_102321 | Ga0495687_102321_190_1056 | 281 |
| 754 | 3300047470 | Ga0495681_0128145 | Ga0495681_0128145_88_954 | 281 |
| 755 | 3300047472 | Ga0495686_0008180 | Ga0495686_0008180_1933_2799 | 281 |
| 756 | 3300048090 | Ga0495615_0003234 | Ga0495615_0003234_1298_2164 | 281 |
| 757 | 3300048091 | Ga0495626_0024458 | Ga0495626_0024458_192_1058 | 281 |
| 758 | 3300048091 | Ga0495626_0082107 | Ga0495626_0082107_360_1214 | 281 |
| 759 | 3300048904 | Ga0496101_0130822 | Ga0496101_0130822_336_1190 | 281 |
| 760 | 3300048905 | Ga0496102_0248885 | Ga0496102_0248885_577_1431 | 281 |
| 761 | 3300048906 | Ga0496103_0004367 | Ga0496103_0004367_3495_4349 | 281 |
| 762 | 3300048909 | Ga0496106_0251004 | Ga0496106_0251004_244_1098 | 281 |
| 763 | 3300048910 | Ga0496107_0160238 | Ga0496107_0160238_647_1501 | 281 |
| 764 | 3300048911 | Ga0496108_0090757 | Ga0496108_0090757_840_1694 | 281 |
| 765 | 3300048915 | Ga0496112_0056209 | Ga0496112_0056209_741_1595 | 281 |
| 766 | 3300048916 | Ga0496113_0093919 | Ga0496113_0093919_772_1626 | 281 |
| 767 | 3300048918 | Ga0496115_0345506 | Ga0496115_0345506_225_1079 | 281 |
| 768 | 3300048919 | Ga0496116_0015008 | Ga0496116_0015008_337_1188 | 281 |
| 769 | 3300048920 | Ga0496117_0000016 | Ga0496117_0000016_221234_222085 | 281 |
| 770 | 3300048920 | Ga0496117_0017101 | Ga0496117_0017101_3326_4180 | 281 |
| 771 | 3300048920 | Ga0496117_0031041 | Ga0496117_0031041_1894_2751 | 281 |
| 772 | 3300048921 | Ga0496118_0000153 | Ga0496118_0000153_38340_39191 | 281 |
| 773 | 3300048921 | Ga0496118_0011952 | Ga0496118_0011952_1892_2746 | 281 |
| 774 | 3300048921 | Ga0496118_0041916 | Ga0496118_0041916_583_1437 | 281 |
| 775 | 3300048921 | Ga0496118_0083641 | Ga0496118_0083641_1044_1895 | 281 |
| 776 | 3300048922 | Ga0496119_0018968 | Ga0496119_0018968_1802_2659 | 281 |
| 777 | 3300048922 | Ga0496119_0040903 | Ga0496119_0040903_2036_2887 | 281 |
| 778 | 3300048922 | Ga0496119_0085742 | Ga0496119_0085742_599_1453 | 281 |
| 779 | 3300048923 | Ga0496120_0000660 | Ga0496120_0000660_42580_43431 | 281 |
| 780 | 3300048923 | Ga0496120_0106802 | Ga0496120_0106802_384_1235 | 281 |
| 781 | 3300048924 | Ga0496121_0135546 | Ga0496121_0135546_859_1713 | 281 |
| 782 | 3300048925 | Ga0496122_0000002 | Ga0496122_0000002_221895_222746 | 281 |
| 783 | 3300048925 | Ga0496122_0002358 | Ga0496122_0002358_25101_25958 | 281 |
| 784 | 3300048925 | Ga0496122_0026867 | Ga0496122_0026867_3706_4596 | 281 |
| 785 | 3300048925 | Ga0496122_0042303 | Ga0496122_0042303_816_1673 | 281 |
| 786 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_1588937_1589788 | 281 |
| 787 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_221895_222746 | 281 |
| 788 | 3300048926 | Ga0496123_0017939 | Ga0496123_0017939_3170_4027 | 281 |
| 789 | 3300048927 | Ga0496124_0035680 | Ga0496124_0035680_1541_2395 | 281 |
| 790 | 3300048927 | Ga0496124_0405016 | Ga0496124_0405016_72_923 | 281 |
| 791 | 3300048927 | Ga0496124_0405026 | Ga0496124_0405026_23_874 | 281 |
| 792 | 3300048928 | Ga0496125_0020431 | Ga0496125_0020431_3461_4312 | 281 |
| 793 | 3300048928 | Ga0496125_0058623 | Ga0496125_0058623_2016_2870 | 281 |
| 794 | 3300048928 | Ga0496125_0080584 | Ga0496125_0080584_1208_2065 | 281 |
| 795 | 3300048929 | Ga0496126_0096902 | Ga0496126_0096902_223_1077 | 281 |
| 796 | 3300050489 | nmdc:mga03683_183910_c1 | nmdc:mga03683_183910_c1_54_908 | 281 |
| 797 | 3300050489 | nmdc:mga03683_78992_c1 | nmdc:mga03683_78992_c1_385_1236 | 281 |
| 798 | 3300050490 | nmdc:mga03n38_5449_c1 | nmdc:mga03n38_5449_c1_386_1237 | 281 |
| 799 | 3300050491 | nmdc:mga00v17_290130_c1 | nmdc:mga00v17_290130_c1_80_931 | 281 |
| 800 | 3300050491 | nmdc:mga00v17_3_c1 | nmdc:mga00v17_3_c1_1108_1959 | 281 |
| 801 | 3300050492 | nmdc:mga0yw44_53397_c1 | nmdc:mga0yw44_53397_c1_1250_2110 | 281 |
| 802 | 3300050492 | nmdc:mga0yw44_9622_c1 | nmdc:mga0yw44_9622_c1_23_874 | 281 |
| 803 | 3300050493 | nmdc:mga0k408_25554_c1 | nmdc:mga0k408_25554_c1_343_1203 | 281 |
| 804 | 3300050494 | nmdc:mga06z11_113912_c1 | nmdc:mga06z11_113912_c1_333_1187 | 281 |
| 805 | 3300050494 | nmdc:mga06z11_147689_c1 | nmdc:mga06z11_147689_c1_327_1178 | 281 |
| 806 | 3300050494 | nmdc:mga06z11_15769_c1 | nmdc:mga06z11_15769_c1_1884_2744 | 281 |
| 807 | 3300050494 | nmdc:mga06z11_7336_c1 | nmdc:mga06z11_7336_c1_3360_4217 | 281 |
| 808 | 3300050495 | nmdc:mga04h51_2441_c1 | nmdc:mga04h51_2441_c1_3324_4178 | 281 |
| 809 | 3300050496 | nmdc:mga07m45_131581_c1 | nmdc:mga07m45_131581_c1_312_1163 | 281 |
| 810 | 3300050496 | nmdc:mga07m45_17763_c1 | nmdc:mga07m45_17763_c1_284_1144 | 281 |
| 811 | 3300050516 | nmdc:mga0sz30_20499_c1 | nmdc:mga0sz30_20499_c1_1078_1935 | 281 |
| 812 | 3300050516 | nmdc:mga0sz30_514_c1 | nmdc:mga0sz30_514_c1_2431_3282 | 281 |
| 813 | 3300050516 | nmdc:mga0sz30_54581_c1 | nmdc:mga0sz30_54581_c1_463_1323 | 281 |
| 814 | 3300050516 | nmdc:mga0sz30_57866_c1 | nmdc:mga0sz30_57866_c1_121_972 | 281 |
| 815 | 3300053080 | Ga0500635_0001856 | Ga0500635_0001856_3140_3994 | 281 |
| 816 | 3300053083 | Ga0495655_0041962 | Ga0495655_0041962_54_908 | 281 |
| 817 | 3300053086 | Ga0500578_0008264 | Ga0500578_0008264_2664_3530 | 281 |
| 818 | 3300053086 | Ga0500578_0102719 | Ga0500578_0102719_568_1422 | 281 |
| 819 | 3300053107 | Ga0500560_000351 | Ga0500560_000351_286_1137 | 281 |
| 820 | 3300053109 | Ga0500569_004067 | Ga0500569_004067_1701_2567 | 281 |
| 821 | 3300053111 | Ga0500572_004796 | Ga0500572_004796_2119_2973 | 281 |
| 822 | 3300053118 | Ga0500594_0005184 | Ga0500594_0005184_88_951 | 281 |
| 823 | 3300053118 | Ga0500594_0010645 | Ga0500594_0010645_979_1845 | 281 |
| 824 | 3300053134 | Ga0500658_0000280 | Ga0500658_0000280_707_1573 | 281 |
| 825 | 3300053136 | Ga0500559_0001421 | Ga0500559_0001421_11688_12542 | 281 |
| 826 | 3300053137 | Ga0500561_0000632 | Ga0500561_0000632_944_1795 | 281 |
| 827 | 3300053153 | Ga0500616_0005247 | Ga0500616_0005247_699_1559 | 281 |
| 828 | 3300053153 | Ga0500616_0005811 | Ga0500616_0005811_1701_2567 | 281 |
| 829 | 3300053157 | Ga0500624_000337 | Ga0500624_000337_5412_6263 | 281 |
| 830 | 3300053163 | Ga0500639_063128 | Ga0500639_063128_1039_1893 | 281 |
| 831 | 3300053177 | Ga0500636_0001440 | Ga0500636_0001440_9270_10124 | 281 |
| 832 | iso_pu_bacteria | 2508501050 | 2508731296 | 281 |
| 833 | iso_pu_bacteria | 2509276021 | 2509390524 | 281 |
| 834 | iso_pu_bacteria | 2509276033 | 2509442278 | 281 |
| 835 | iso_pu_bacteria | 2510065019 | 2510136127 | 281 |
| 836 | iso_pu_bacteria | 2510065057 | 2510306058 | 281 |
| 837 | iso_pu_bacteria | 2510461076 | 2510892870 | 281 |
| 838 | iso_pu_bacteria | 2510917028 | 2511184943 | 281 |
| 839 | iso_pu_bacteria | 2511231052 | 2511500088 | 281 |
| 840 | iso_pu_bacteria | 2512047086 | 2512530311 | 281 |
| 841 | iso_pu_bacteria | 2512875026 | 2512975255 | 281 |
| 842 | iso_pu_bacteria | 2513237084 | 2513568428 | 281 |
| 843 | iso_pu_bacteria | 2513237085 | 2513579473 | 281 |
| 844 | iso_pu_bacteria | 2513237086 | 2513584461 | 281 |
| 845 | iso_pu_bacteria | 2513237089 | 2513606798 | 281 |
| 846 | iso_pu_bacteria | 2513237091 | 2513619599 | 281 |
| 847 | iso_pu_bacteria | 2513237093 | 2513630715 | 281 |
| 848 | iso_pu_bacteria | 2513237103 | 2513711933 | 281 |
| 849 | iso_pu_bacteria | 2513237138 | 2513867675 | 281 |
| 850 | iso_pu_bacteria | 2513237140 | 2513883177 | 281 |
| 851 | iso_pu_bacteria | 2513237143 | 2513904259 | 281 |
| 852 | iso_pu_bacteria | 2513237146 | 2513929322 | 281 |
| 853 | iso_pu_bacteria | 2513237160 | 2514006992 | 281 |
| 854 | iso_pu_bacteria | 2513237162 | 2514018262 | 281 |
| 855 | iso_pu_bacteria | 2515075009 | 2515108946 | 281 |
| 856 | iso_pu_bacteria | 2515154113 | 2515633049 | 281 |
| 857 | iso_pu_bacteria | 2515154114 | 2515640254 | 281 |
| 858 | iso_pu_bacteria | 2515154116 | 2515656335 | 281 |
| 859 | iso_pu_bacteria | 2515154134 | 2515738481 | 281 |
| 860 | iso_pu_bacteria | 2516653046 | 2516897619 | 281 |
| 861 | iso_pu_bacteria | 2516653077 | 2517040887 | 281 |
| 862 | iso_pu_bacteria | 2516653085 | 2517080518 | 281 |
| 863 | iso_pu_bacteria | 2517093000 | 2517098487 | 281 |
| 864 | iso_pu_bacteria | 2517287029 | 2517409971 | 281 |
| 865 | iso_pu_bacteria | 2517487022 | 2517566659 | 281 |
| 866 | iso_pu_bacteria | 2524023207 | 2524453365 | 281 |
| 867 | iso_pu_bacteria | 2529292951 | 2530649113 | 281 |
| 868 | iso_pu_bacteria | 2551306084 | 2551674844 | 281 |
| 869 | iso_pu_bacteria | 2551306085 | 2551687096 | 281 |
| 870 | iso_pu_bacteria | 2551306086 | 2551692314 | 281 |
| 871 | iso_pu_bacteria | 2551306087 | 2551697284 | 281 |
| 872 | iso_pu_bacteria | 2551306089 | 2551714293 | 281 |
| 873 | iso_pu_bacteria | 2551306090 | 2551720038 | 281 |
| 874 | iso_pu_bacteria | 2551306090 | 2551723545 | 281 |
| 875 | iso_pu_bacteria | 2551306091 | 2551725208 | 281 |
| 876 | iso_pu_bacteria | 2551306092 | 2551737645 | 281 |
| 877 | iso_pu_bacteria | 2551306093 | 2551739931 | 281 |
| 878 | iso_pu_bacteria | 2558860100 | 2558864942 | 281 |
| 879 | iso_pu_bacteria | 2582581867 | 2585403796 | 281 |
| 880 | iso_pu_bacteria | 2585427526 | 2585526842 | 281 |
| 881 | iso_pu_bacteria | 2585427528 | 2585542396 | 281 |
| 882 | iso_pu_bacteria | 2585427590 | 2585823287 | 281 |
| 883 | iso_pu_bacteria | 2585427593 | 2585841868 | 281 |
| 884 | iso_pu_bacteria | 2599185170 | 2599419315 | 281 |
| 885 | iso_pu_bacteria | 2599185352 | 2600197377 | 281 |
| 886 | iso_pu_bacteria | 2615840624 | 2616298021 | 281 |
| 887 | iso_pu_bacteria | 2643221723 | 2644673430 | 281 |
| 888 | iso_pu_bacteria | 2718217927 | 2719389546 | 281 |
| 889 | iso_pu_bacteria | 2718217997 | 2719668854 | 281 |
| 890 | iso_pu_bacteria | 2718218199 | 2720489547 | 281 |
| 891 | iso_pu_bacteria | 2718218423 | 2721402314 | 281 |
| 892 | iso_pu_bacteria | 2721755684 | 2723564582 | 281 |
| 893 | iso_pu_bacteria | 2721755809 | 2724036147 | 281 |
| 894 | iso_pu_bacteria | 2724679232 | 2725949396 | 281 |
| 895 | iso_pu_bacteria | 2738541333 | 2739038470 | 281 |
| 896 | iso_pu_bacteria | 2751185800 | 2753357768 | 281 |
| 897 | iso_pu_bacteria | 2758568016 | 2758638016 | 281 |
| 898 | iso_pu_bacteria | 2758568016 | 2758638027 | 281 |
| 899 | iso_pu_bacteria | 2765235942 | 2766068866 | 281 |
| 900 | iso_pu_bacteria | 2773857925 | 2774873150 | 281 |
| 901 | iso_pu_bacteria | 2791355082 | 2792583718 | 281 |
| 902 | iso_pu_bacteria | 2791355091 | 2792619359 | 281 |
| 903 | iso_pu_bacteria | 2791355092 | 2792627131 | 281 |
| 904 | iso_pu_bacteria | 2791355256 | 2793299125 | 281 |
| 905 | iso_pu_bacteria | 2791355259 | 2793315026 | 281 |
| 906 | iso_pu_bacteria | 2791355262 | 2793333867 | 281 |
| 907 | iso_pu_bacteria | 2791355263 | 2793342279 | 281 |
| 908 | iso_pu_bacteria | 2791355266 | 2793360284 | 281 |
| 909 | iso_pu_bacteria | 2791355267 | 2793370863 | 281 |
| 910 | iso_pu_bacteria | 2802428858 | 2802720141 | 281 |
| 911 | iso_pu_bacteria | 2802428859 | 2802723828 | 281 |
| 912 | iso_pu_bacteria | 2802428860 | 2802734153 | 281 |
| 913 | iso_pu_bacteria | 2802428861 | 2802739615 | 281 |
| 914 | iso_pu_bacteria | 2802428862 | 2802745999 | 281 |
| 915 | iso_pu_bacteria | 2802428863 | 2802753398 | 281 |
| 916 | iso_pu_bacteria | 2802429268 | 2804754993 | 281 |
| 917 | iso_pu_bacteria | 2802429633 | 2806048813 | 281 |
| 918 | iso_pu_bacteria | 2802429634 | 2806056016 | 281 |
| 919 | iso_pu_bacteria | 2802429635 | 2806062837 | 281 |
| 920 | iso_pu_bacteria | 2802429636 | 2806070267 | 281 |
| 921 | iso_pu_bacteria | 2802429637 | 2806077253 | 281 |
| 922 | iso_pu_bacteria | 2838022645 | 2838025116 | 281 |
| 923 | iso_pu_bacteria | 2838035591 | 2838040152 | 281 |
| 924 | iso_pu_bacteria | 2838042994 | 2838044094 | 281 |
| 925 | iso_pu_bacteria | 2838061910 | 2838062208 | 281 |
| 926 | iso_pu_bacteria | 2838068647 | 2838069434 | 281 |
| 927 | iso_pu_bacteria | 2838074704 | 2838078640 | 281 |
| 928 | iso_pu_bacteria | 2838661181 | 2838665916 | 281 |
| 929 | iso_pu_bacteria | 2838680041 | 2838684723 | 281 |
| 930 | iso_pu_bacteria | 2838686498 | 2838690470 | 281 |
| 931 | iso_pu_bacteria | 2838694306 | 2838698885 | 281 |
| 932 | iso_pu_bacteria | 2838707686 | 2838712235 | 281 |
| 933 | iso_pu_bacteria | 2838729681 | 2838733173 | 281 |
| 934 | iso_pu_bacteria | 2838742623 | 2838747238 | 281 |
| 935 | iso_pu_bacteria | 2841851746 | 2841855391 | 281 |
| 936 | iso_pu_bacteria | 2841864319 | 2841866163 | 281 |
| 937 | iso_pu_bacteria | 2842110456 | 2842116971 | 281 |
| 938 | iso_pu_bacteria | 2842118031 | 2842122634 | 281 |
| 939 | iso_pu_bacteria | 2842156927 | 2842160902 | 281 |
| 940 | iso_pu_bacteria | 2842163707 | 2842164431 | 281 |
| 941 | iso_pu_bacteria | 2842180545 | 2842184518 | 281 |
| 942 | iso_pu_bacteria | 2842198810 | 2842200682 | 281 |
| 943 | iso_pu_bacteria | 2842217011 | 2842219656 | 281 |
| 944 | iso_pu_bacteria | 2842229732 | 2842232101 | 281 |
| 945 | iso_pu_bacteria | 2842237096 | 2842241647 | 281 |
| 946 | iso_pu_bacteria | 2842243621 | 2842248497 | 281 |
| 947 | iso_pu_bacteria | 2842257432 | 2842262695 | 281 |
| 948 | iso_pu_bacteria | 2842271015 | 2842275216 | 281 |
| 949 | iso_pu_bacteria | 2842291075 | 2842295843 | 281 |
| 950 | iso_pu_bacteria | 2842304105 | 2842307348 | 281 |
| 951 | iso_pu_bacteria | 2842311132 | 2842312954 | 281 |
| 952 | iso_pu_bacteria | 2842341865 | 2842342058 | 281 |
| 953 | iso_pu_bacteria | 2842363717 | 2842365962 | 281 |
| 954 | iso_pu_bacteria | 2842370503 | 2842374276 | 281 |
| 955 | iso_pu_bacteria | 2842377471 | 2842382247 | 281 |
| 956 | iso_pu_bacteria | 2842384541 | 2842389182 | 281 |
| 957 | iso_pu_bacteria | 2842395702 | 2842396946 | 281 |
| 958 | iso_pu_bacteria | 2842422224 | 2842422625 | 281 |
| 959 | iso_pu_bacteria | 2842447887 | 2842449786 | 281 |
| 960 | iso_pu_bacteria | 2842462802 | 2842463562 | 281 |
| 961 | iso_pu_bacteria | 2844454524 | 2844460126 | 281 |
| 962 | iso_pu_bacteria | 2850079185 | 2850084665 | 281 |
| 963 | iso_pu_bacteria | 2855825444 | 2855830467 | 281 |
| 964 | iso_pu_bacteria | 2855839649 | 2855845761 | 281 |
| 965 | iso_pu_bacteria | 2857516855 | 2857517692 | 281 |
| 966 | iso_pu_bacteria | 2858800743 | 2858805153 | 281 |
| 967 | iso_pu_bacteria | 2882456835 | 2882463171 | 281 |
| 968 | iso_pu_bacteria | 2896384573 | 2896387525 | 281 |
| 969 | iso_pu_bacteria | 2913295892 | 2913297010 | 281 |
| 970 | iso_pu_bacteria | 2915980308 | 2915984314 | 281 |
| 971 | iso_pu_bacteria | 2915986958 | 2915987016 | 281 |
| 972 | iso_pu_bacteria | 2915993759 | 2915995577 | 281 |
| 973 | iso_pu_bacteria | 2916000859 | 2916004075 | 281 |
| 974 | iso_pu_bacteria | 2916007675 | 2916012472 | 281 |
| 975 | iso_pu_bacteria | 2916014648 | 2916014700 | 281 |
| 976 | iso_pu_bacteria | 2916021584 | 2916026933 | 281 |
| 977 | iso_pu_bacteria | 2916028427 | 2916034044 | 281 |
| 978 | iso_pu_bacteria | 2916035215 | 2916038593 | 281 |
| 979 | iso_pu_bacteria | 2916041962 | 2916046322 | 281 |
| 980 | iso_pu_bacteria | 2916048683 | 2916050821 | 281 |
| 981 | iso_pu_bacteria | 2916055098 | 2916060596 | 281 |
| 982 | iso_pu_bacteria | 2916061851 | 2916066633 | 281 |
| 983 | iso_pu_bacteria | 2916068649 | 2916071646 | 281 |
| 984 | iso_pu_bacteria | 2916076590 | 2916079561 | 281 |
| 985 | iso_pu_bacteria | 2920760137 | 2920763335 | 281 |
| 986 | iso_pu_bacteria | 2920822456 | 2920827231 | 281 |
| 987 | iso_pu_bacteria | 2921201388 | 2921205391 | 281 |
| 988 | iso_pu_bacteria | 2921208531 | 2921210713 | 281 |
| 989 | iso_pu_bacteria | 2921237296 | 2921240623 | 281 |
| 990 | iso_pu_bacteria | 2921244191 | 2921249607 | 281 |
| 991 | iso_pu_bacteria | 2921250672 | 2921254270 | 281 |
| 992 | iso_pu_bacteria | 2921257292 | 2921261701 | 281 |
| 993 | iso_pu_bacteria | 2921263974 | 2921269612 | 281 |
| 994 | iso_pu_bacteria | 2921282425 | 2921285048 | 281 |
| 995 | iso_pu_bacteria | 2921289301 | 2921294216 | 281 |
| 996 | iso_pu_bacteria | 2921296804 | 2921299004 | 281 |
| 997 | iso_pu_bacteria | 2923556063 | 2923559808 | 281 |
| 998 | iso_pu_bacteria | 2924144063 | 2924144375 | 281 |
| 999 | iso_pu_bacteria | 2924150972 | 2924151609 | 281 |
| 1000 | iso_pu_bacteria | 2924158325 | 2924159485 | 281 |
| 1001 | iso_pu_bacteria | 2924165586 | 2924172614 | 281 |
| 1002 | iso_pu_bacteria | 2924172951 | 2924178726 | 281 |
| 1003 | iso_pu_bacteria | 2924179722 | 2924185775 | 281 |
| 1004 | iso_pu_bacteria | 2924193448 | 2924196066 | 281 |
| 1005 | iso_pu_bacteria | 2924200457 | 2924201324 | 281 |
| 1006 | iso_pu_bacteria | 2924207177 | 2924210164 | 281 |
| 1007 | iso_pu_bacteria | 2924214083 | 2924218917 | 281 |
| 1008 | iso_pu_bacteria | 2924221636 | 2924227621 | 281 |
| 1009 | iso_pu_bacteria | 2924228884 | 2924230881 | 281 |
| 1010 | iso_pu_bacteria | 2933570622 | 2933573996 | 281 |
| 1011 | iso_pu_bacteria | 2933586486 | 2933593279 | 281 |
| 1012 | iso_pu_bacteria | 2933599457 | 2933600097 | 281 |
| 1013 | iso_pu_bacteria | 2935894831 | 2935898802 | 281 |
| 1014 | iso_pu_bacteria | 2935901341 | 2935906108 | 281 |
| 1015 | iso_pu_bacteria | 2936367885 | 2936374687 | 281 |
| 1016 | iso_pu_bacteria | 2936375103 | 2936375879 | 281 |
| 1017 | iso_pu_bacteria | 2936381700 | 2936385417 | 281 |
| 1018 | iso_pu_bacteria | 2937002841 | 2937005419 | 281 |
| 1019 | iso_pu_bacteria | 2937009748 | 2937012996 | 281 |
| 1020 | iso_pu_bacteria | 2937016420 | 2937018018 | 281 |
| 1021 | iso_pu_bacteria | 2937023124 | 2937029540 | 281 |
| 1022 | iso_pu_bacteria | 2937029754 | 2937033948 | 281 |
| 1023 | iso_pu_bacteria | 2937036028 | 2937037255 | 281 |
| 1024 | iso_pu_bacteria | 2937042894 | 2937043402 | 281 |
| 1025 | iso_pu_bacteria | 2937049772 | 2937051947 | 281 |
| 1026 | iso_pu_bacteria | 2937063883 | 2937066245 | 281 |
| 1027 | iso_pu_bacteria | 2937071275 | 2937077050 | 281 |
| 1028 | iso_pu_bacteria | 2937078374 | 2937080484 | 281 |
| 1029 | iso_pu_bacteria | 2937084907 | 2937091505 | 281 |
| 1030 | iso_pu_bacteria | 2937091812 | 2937096439 | 281 |
| 1031 | iso_pu_bacteria | 2937098957 | 2937105704 | 281 |
| 1032 | iso_pu_bacteria | 2937106411 | 2937110943 | 281 |
| 1033 | iso_pu_bacteria | 2937113482 | 2937116810 | 281 |
| 1034 | iso_pu_bacteria | 2937119839 | 2937125025 | 281 |
| 1035 | iso_pu_bacteria | 2937126314 | 2937132856 | 281 |
| 1036 | iso_pu_bacteria | 2941499720 | 2941505437 | 281 |
| 1037 | iso_pu_bacteria | 2957375807 | 2957379793 | 281 |
| 1038 | iso_pu_bacteria | 2957382221 | 2957385593 | 281 |
| 1039 | iso_pu_bacteria | 2957388812 | 2957390220 | 281 |
| 1040 | iso_pu_bacteria | 2957395598 | 2957398848 | 281 |
| 1041 | iso_pu_bacteria | 2957402308 | 2957405752 | 281 |
| 1042 | iso_pu_bacteria | 2957408893 | 2957412881 | 281 |
| 1043 | iso_pu_bacteria | 2957415311 | 2957420490 | 281 |
| 1044 | iso_pu_bacteria | 2957422303 | 2957427572 | 281 |
| 1045 | iso_pu_bacteria | 2957430029 | 2957430294 | 281 |
| 1046 | iso_pu_bacteria | 2957437181 | 2957442725 | 281 |
| 1047 | iso_pu_bacteria | 2957443900 | 2957445363 | 281 |
| 1048 | iso_pu_bacteria | 2957450854 | 2957453804 | 281 |
| 1049 | iso_pu_bacteria | 2957457609 | 2957459979 | 281 |
| 1050 | iso_pu_bacteria | 2957464669 | 2957464992 | 281 |
| 1051 | iso_pu_bacteria | 2957471148 | 2957475228 | 281 |
| 1052 | iso_pu_bacteria | 2957478035 | 2957483526 | 281 |
| 1053 | iso_pu_bacteria | 2957484790 | 2957486862 | 281 |
| 1054 | iso_pu_bacteria | 2957491536 | 2957492912 | 281 |
| 1055 | iso_pu_bacteria | 2957498199 | 2957500196 | 281 |
| 1056 | iso_pu_bacteria | 2957505466 | 2957506063 | 281 |
| 1057 | iso_pu_bacteria | 2960584000 | 2960585362 | 281 |
| 1058 | iso_pu_bacteria | 2960591022 | 2960591742 | 281 |
| 1059 | iso_pu_bacteria | 2960597568 | 2960601436 | 281 |
| 1060 | iso_pu_bacteria | 2960603979 | 2960608265 | 281 |
| 1061 | iso_pu_bacteria | 2960610863 | 2960615944 | 281 |
| 1062 | iso_pu_bacteria | 2960617483 | 2960619142 | 281 |
| 1063 | iso_pu_bacteria | 2960624210 | 2960627020 | 281 |
| 1064 | iso_pu_bacteria | 2960631154 | 2960637796 | 281 |
| 1065 | iso_pu_bacteria | 2960637947 | 2960641163 | 281 |
| 1066 | iso_pu_bacteria | 2960645483 | 2960652613 | 281 |
| 1067 | iso_pu_bacteria | 2960652885 | 2960658448 | 281 |
| 1068 | iso_pu_bacteria | 2960660292 | 2960662092 | 281 |
| 1069 | iso_pu_bacteria | 2960667422 | 2960668923 | 281 |
| 1070 | iso_pu_bacteria | 2960680706 | 2960685176 | 281 |
| 1071 | iso_pu_bacteria | 2960687367 | 2960691029 | 281 |
| 1072 | iso_pu_bacteria | 2960693952 | 2960700904 | 281 |
| 1073 | iso_pu_bacteria | 2964615318 | 2964619235 | 281 |
| 1074 | iso_pu_bacteria | 2964621998 | 2964624583 | 281 |
| 1075 | iso_pu_bacteria | 2964628898 | 2964634163 | 281 |
| 1076 | iso_pu_bacteria | 2964636051 | 2964641396 | 281 |
| 1077 | iso_pu_bacteria | 2964643177 | 2964649765 | 281 |
| 1078 | iso_pu_bacteria | 2964649959 | 2964655633 | 281 |
| 1079 | iso_pu_bacteria | 2964656573 | 2964658339 | 281 |
| 1080 | iso_pu_bacteria | 2964663802 | 2964666740 | 281 |
| 1081 | iso_pu_bacteria | 2964670856 | 2964673337 | 281 |
| 1082 | iso_pu_bacteria | 2964678106 | 2964678906 | 281 |
| 1083 | iso_pu_bacteria | 2964685014 | 2964690227 | 281 |
| 1084 | iso_pu_bacteria | 2964691889 | 2964695382 | 281 |
| 1085 | iso_pu_bacteria | 2964698721 | 2964701846 | 281 |
| 1086 | iso_pu_bacteria | 2964705432 | 2964708435 | 281 |
| 1087 | iso_pu_bacteria | 2964712639 | 2964715928 | 281 |
| 1088 | iso_pu_bacteria | 2964719344 | 2964725589 | 281 |
| 1089 | iso_pu_bacteria | 2967664464 | 2967670126 | 281 |
| 1090 | iso_pu_bacteria | 2967671571 | 2967675022 | 281 |
| 1091 | iso_pu_bacteria | 2967678726 | 2967685505 | 281 |
| 1092 | iso_pu_bacteria | 2967686174 | 2967690721 | 281 |
| 1093 | iso_pu_bacteria | 2967693043 | 2967694128 | 281 |
| 1094 | iso_pu_bacteria | 2967699805 | 2967704378 | 281 |
| 1095 | iso_pu_bacteria | 2967706974 | 2967709658 | 281 |
| 1096 | iso_pu_bacteria | 2967714385 | 2967715926 | 281 |
| 1097 | iso_pu_bacteria | 2967721400 | 2967722774 | 281 |
| 1098 | iso_pu_bacteria | 2967728569 | 2967728672 | 281 |
| 1099 | iso_pu_bacteria | 2967735183 | 2967739734 | 281 |
| 1100 | iso_pu_bacteria | 2967742019 | 2967744231 | 281 |
| 1101 | iso_pu_bacteria | 2967748971 | 2967750249 | 281 |
| 1102 | iso_pu_bacteria | 2967755722 | 2967760382 | 281 |
| 1103 | iso_pu_bacteria | 2967762386 | 2967764757 | 281 |
| 1104 | iso_pu_bacteria | 2967769361 | 2967770070 | 281 |
| 1105 | iso_pu_bacteria | 2967775926 | 2967781911 | 281 |
| 1106 | iso_pu_bacteria | 2970019648 | 2970025212 | 281 |
| 1107 | iso_pu_bacteria | 2970026789 | 2970033063 | 281 |
| 1108 | iso_pu_bacteria | 2970033650 | 2970035859 | 281 |
| 1109 | iso_pu_bacteria | 2970040964 | 2970043232 | 281 |
| 1110 | iso_pu_bacteria | 2970047711 | 2970050317 | 281 |
| 1111 | iso_pu_bacteria | 2970054988 | 2970060713 | 281 |
| 1112 | iso_pu_bacteria | 2970061556 | 2970063000 | 281 |
| 1113 | iso_pu_bacteria | 2970068827 | 2970072414 | 281 |
| 1114 | iso_pu_bacteria | 2970076120 | 2970077771 | 281 |
| 1115 | iso_pu_bacteria | 2970088815 | 2970095083 | 281 |
| 1116 | iso_pu_bacteria | 2970095765 | 2970099559 | 281 |
| 1117 | iso_pu_bacteria | 2970102677 | 2970109070 | 281 |
| 1118 | iso_pu_bacteria | 2970109326 | 2970113996 | 281 |
| 1119 | iso_pu_bacteria | 2970116247 | 2970119858 | 281 |
| 1120 | iso_pu_bacteria | 2970122695 | 2970129084 | 281 |
| 1121 | iso_pu_bacteria | 2970129317 | 2970130763 | 281 |
| 1122 | iso_pu_bacteria | 2970136068 | 2970139249 | 281 |
| 1123 | iso_pu_bacteria | 2970143518 | 2970147208 | 281 |
| 1124 | iso_pu_bacteria | 2970149975 | 2970152700 | 281 |
| 1125 | iso_pu_bacteria | 2970156795 | 2970161245 | 281 |
| 1126 | iso_pu_bacteria | 2970164137 | 2970165154 | 281 |
| 1127 | iso_pu_bacteria | 2970170962 | 2970176296 | 281 |
| 1128 | iso_pu_bacteria | 2970184632 | 2970184725 | 281 |
| 1129 | iso_pu_bacteria | 2970191845 | 2970194051 | 281 |
| 1130 | iso_pu_bacteria | 2977516862 | 2977519921 | 281 |
| 1131 | iso_pu_bacteria | 2977523885 | 2977525245 | 281 |
| 1132 | iso_pu_bacteria | 2977530762 | 2977536919 | 281 |
| 1133 | iso_pu_bacteria | 2977537788 | 2977539332 | 281 |
| 1134 | iso_pu_bacteria | 2977544691 | 2977546572 | 281 |
| 1135 | iso_pu_bacteria | 2977551784 | 2977558706 | 281 |
| 1136 | iso_pu_bacteria | 2977558990 | 2977564275 | 281 |
| 1137 | iso_pu_bacteria | 2977565890 | 2977568655 | 281 |
| 1138 | iso_pu_bacteria | 2977572785 | 2977575068 | 281 |
| 1139 | iso_pu_bacteria | 2977579622 | 2977580660 | 281 |
| 1140 | iso_pu_bacteria | 639633055 | 639645368 | 281 |
| 1141 | iso_pu_bacteria | 648276728 | 648738622 | 281 |
| 1142 | iso_pu_bacteria | 8003992118 | 8003997745 | 281 |
| 1143 | iso_pu_bacteria | 8003999396 | 8004005440 | 281 |
| 1144 | iso_pu_bacteria | 8005275841 | 8005277890 | 281 |
| 1145 | iso_pu_bacteria | 8005282627 | 8005285837 | 281 |
| 1146 | iso_pu_bacteria | 8005301065 | 8005301278 | 281 |
| 1147 | iso_pu_bacteria | 8005307578 | 8005308302 | 281 |
| 1148 | iso_pu_bacteria | 8005376324 | 8005380552 | 281 |
| 1149 | iso_pu_bacteria | 8005460587 | 8005467563 | 281 |
| 1150 | iso_pu_bacteria | 8005497431 | 8005502001 | 281 |
| 1151 | iso_pu_bacteria | 8005556819 | 8005559478 | 281 |
| 1152 | iso_pu_bacteria | 8005563573 | 8005566475 | 281 |
| 1153 | iso_pu_bacteria | 8005570704 | 8005571146 | 281 |
| 1154 | iso_pu_bacteria | 8005668836 | 8005673423 | 281 |
| 1155 | iso_pu_bacteria | 8005688590 | 8005688907 | 281 |
| 1156 | iso_pu_bacteria | 8005695170 | 8005697032 | 281 |
| 1157 | iso_pu_bacteria | 8018127388 | 8018132290 | 281 |
| 1158 | iso_pu_bacteria | 8018163183 | 8018163749 | 281 |
| 1159 | iso_pu_bacteria | 8018176218 | 8018176446 | 281 |
| 1160 | iso_pu_bacteria | 8023680758 | 8023681563 | 281 |
| 1161 | iso_pu_bacteria | 8024479707 | 8024481435 | 281 |
| 1162 | iso_pu_bacteria | 8056375014 | 8056379525 | 281 |
| 1163 | iso_pu_bacteria | 8057874678 | 8057881296 | 281 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
109
289
0.99
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.5935 | 71 | 270 |
| 3rlf-assembly1.cif.gz_F | crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp | 0.582 | 82 | 270 |
| 4jbw-assembly1.cif.gz_F | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.5781 | 66 | 272 |
| 7ahh-assembly1.cif.gz_B | opua inhibited inward-facing, sbd docked | 0.5709 | 26 | 272 |
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.5597 | 71 | 270 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FVE9_63_269_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8055 | 70 | 270 | 1.10.3720.10 |
| af_P0AGH5_85_292_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.794 | 70 | 270 | 1.10.3720.10 |
| af_Q2FVE9_63_269_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7811 | 70 | 270 | 1.10.3720.10 |
| af_Q2G1F6_179_383_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7755 | 74 | 270 | 1.10.3720.10 |
| af_Q2FZR6_145_349_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7724 | 71 | 270 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J9E358-F1-model_v4 | deleted | 0.8749 | 17 | 271 |
|
| AF-R7KLC0-F1-model_v4 | Binding-protein-dependent transport system inner membrane component | 0.8537 | 17 | 271 |
GO:0005886
GO:0055085 |
| AF-A0A7Y7IZV0-F1-model_v4 | ABC transporter permease | 0.8514 | 18 | 271 |
GO:0005886
GO:0055085 |
| AF-A0A7Y8UAW6-F1-model_v4 | deleted | 0.8489 | 17 | 271 |
|
| AF-A0A372NEC5-F1-model_v4 | ABC transporter permease | 0.847 | 15 | 271 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar