F491039

General Info

Members Datasets Scaffolds Average Seq Length
1163 931 519 281

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10058442|Ga0213872_100584422
Length 292
Sequence MTIASVPKPAPNPTVPKLTGSRLGYRFNAVGVATLVVILAWTLVAIFAPVIIPHPVGEIVDADYFEPISAAAWLGSDYLGRDMFSRVLMGARYTVGISLAAVTIACLSGVVLGMAAAVTGGLFDTLLSRFLDAMNSIPSKLFGLVVVAAVGSSIPVLIVTLAIIYIPGAYRFARALAVNINTMDFMTVARIRGESTFYLIGSEILPNIIRPVLADLGLRFVFIVLLLSGLSFLGLGLQPPYADWGALVRENIGGLPFAAPAVIVPSIAIASLTISVNLLIDNLPQKIRDRSA

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2508501050 Microvirga lupini Lut6 Isolate Nodule
4 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
7 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
8 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
9 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
10 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
11 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
12 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
13 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
14 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
15 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
16 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
17 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
18 2512875024 Mesorhizobium loti R88b Isolate Nodule
19 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
20 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
21 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
22 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
23 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
24 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
25 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
26 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
27 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
28 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
29 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
30 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
31 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
32 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
33 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
34 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
35 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
36 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
37 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
38 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
39 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
40 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
41 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
42 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
43 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
44 2516143018 Ensifer sp. BR816 Isolate Nodule
45 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
46 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
47 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
48 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
49 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
50 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
51 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
52 2519899620 Rhizobium sp. Pop5 Isolate Nodule
53 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
54 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
55 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
56 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
57 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
58 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
59 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
60 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
61 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
62 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
63 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
64 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
65 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
66 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
67 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
68 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
69 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
70 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
71 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
72 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
73 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
74 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
75 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
76 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
77 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
78 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
79 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
80 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
81 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
82 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
83 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
84 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
85 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
86 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
87 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
88 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
89 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
90 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
91 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
92 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
93 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
94 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
95 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
96 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
97 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
98 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
99 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
100 2643221558 Rhizobium sp. Root149 Isolate Unclassified
101 2643221582 Rhizobium sp. Root651 Isolate Unclassified
102 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
103 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
104 2643221693 Rhizobium sp. Root491 Isolate Unclassified
105 2643221723 Ensifer sp. Root278 Isolate Unclassified
106 2643221734 Bosea sp. Root670 Isolate Unclassified
107 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
108 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
109 2718217882 Rhizobium sp. N741 Isolate Nodule
110 2718217927 Rhizobium sp. N324 Isolate Nodule
111 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
112 2718218009 Rhizobium sp. N561 Isolate Nodule
113 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
114 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
115 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
116 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
117 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
118 2718218363 Rhizobium sp. N113 Isolate Nodule
119 2718218365 Rhizobium sp. N731 Isolate Nodule
120 2718218366 Rhizobium sp. N621 Isolate Nodule
121 2718218423 Rhizobium sp. N941 Isolate Nodule
122 2721755514 Rhizobium sp. N6212 Isolate Nodule
123 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
124 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
125 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
126 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
127 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
128 2721755809 Rhizobium sp. N541 Isolate Nodule
129 2721755810 Rhizobium sp. N871 Isolate Nodule
130 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
131 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
132 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
133 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
134 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
135 2728369365 Rhizobium sp. N1341 Isolate Nodule
136 2728369397 Rhizobium sp. N1314 Isolate Nodule
137 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
138 2751185800 Brucella pituitosa AA2 Isolate Unclassified
139 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
140 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
141 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
142 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
143 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
144 2773857925 Microvirga vignae BR3299 Isolate Unclassified
145 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
146 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
147 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
148 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
149 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
150 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
151 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
152 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
153 2791355256 Rhizobium sp. M10 Isolate Nodule
154 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
155 2791355261 Rhizobium sp. J15 Isolate Nodule
156 2791355262 Rhizobium sp. M1 Isolate Nodule
157 2791355263 Rhizobium chutanense C5 Isolate Nodule
158 2791355264 Rhizobium sp. S9 Isolate Nodule
159 2791355265 Rhizobium sp. H4 Isolate Nodule
160 2791355266 Rhizobium sp. L43 Isolate Nodule
161 2791355267 Rhizobium sp. L18 Isolate Nodule
162 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
163 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
164 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
165 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
166 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
167 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
168 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
169 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
170 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
171 2802429633 Rhizobium anhuiense J3 Isolate Nodule
172 2802429634 Rhizobium anhuiense S10 Isolate Nodule
173 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
174 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
175 2802429637 Rhizobium anhuiense C15 Isolate Nodule
176 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
177 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
178 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
179 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
180 2818991467 Bosea vestrisii 3192 Isolate Unclassified
181 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
182 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
183 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
184 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
185 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
186 2838048938 Rhizobium pisi 27/80 Isolate Nodule
187 2838061910 Rhizobium phaseoli L15 Isolate Nodule
188 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
189 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
190 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
191 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
192 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
193 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
194 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
195 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
196 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
197 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
198 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
199 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
200 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
201 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
202 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
203 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
204 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
205 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
206 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
207 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
208 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
209 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
210 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
211 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
212 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
213 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
214 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
215 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
216 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
217 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
218 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
219 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
220 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
221 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
222 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
223 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
224 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
225 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
226 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
227 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
228 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
229 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
230 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
231 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
232 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
233 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
234 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
235 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
236 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
237 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
238 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
239 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
240 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
241 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
242 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
243 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
244 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
245 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
246 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
247 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
248 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
249 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
250 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
251 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
252 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
253 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
254 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
255 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
256 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
257 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
258 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
259 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
260 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
261 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
262 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
263 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
264 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
265 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
266 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
267 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
268 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
269 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
270 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
271 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
272 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
273 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
274 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
275 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
276 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
277 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
278 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
279 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
280 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
281 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
282 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
283 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
284 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
285 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
286 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
287 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
288 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
289 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
290 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
291 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
292 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
293 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
294 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
295 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
296 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
297 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
298 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
299 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
300 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
301 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
302 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
303 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
304 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
305 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
306 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
307 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
308 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
309 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
310 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
311 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
312 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
313 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
314 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
315 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
316 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
317 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
318 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
319 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
320 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
321 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
322 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
323 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
324 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
325 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
326 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
327 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
328 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
329 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
330 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
331 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
332 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
333 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
334 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
335 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
336 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
337 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
338 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
339 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
340 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
341 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
342 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
343 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
344 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
345 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
346 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
347 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
348 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
349 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
350 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
351 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
352 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
353 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
354 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
355 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
356 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
357 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
358 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
359 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
360 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
361 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
362 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
363 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
364 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
365 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
366 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
367 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
368 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
369 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
370 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
371 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
372 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
373 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
374 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
375 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
376 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
377 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
378 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
379 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
380 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
381 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
382 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
383 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
384 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
385 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
386 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
387 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
388 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
389 2933599457 Rhizobium phaseoli M3 Isolate Nodule
390 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
391 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
392 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
393 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
394 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
395 2936381700 Rhizobium chutanense C16 Isolate Unclassified
396 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
397 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
398 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
399 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
400 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
401 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
402 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
403 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
404 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
405 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
406 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
407 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
408 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
409 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
410 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
411 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
412 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
413 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
414 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
415 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
416 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
417 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
418 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
419 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
420 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
421 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
422 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
423 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
424 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
425 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
426 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
427 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
428 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
429 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
430 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
431 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
432 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
433 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
434 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
435 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
436 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
437 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
438 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
439 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
440 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
441 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
442 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
443 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
444 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
445 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
446 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
447 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
448 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
449 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
450 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
451 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
452 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
453 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
454 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
455 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
456 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
457 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
458 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
459 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
460 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
461 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
462 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
463 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
464 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
465 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
466 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
467 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
468 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
469 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
470 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
471 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
472 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
473 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
474 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
475 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
476 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
477 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
478 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
479 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
480 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
481 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
482 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
483 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
484 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
485 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
486 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
487 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
488 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
489 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
490 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
491 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
492 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
493 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
494 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
495 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
496 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
497 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
498 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
499 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
500 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
501 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
502 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
503 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
504 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
505 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
506 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
507 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
508 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
509 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
510 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
511 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
512 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
513 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
514 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
515 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
516 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
517 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
518 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
519 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
520 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
521 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
522 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
523 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
524 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
525 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
526 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
527 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
528 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
529 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
530 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
531 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
532 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
533 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
534 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
535 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
536 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
537 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
538 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
539 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
540 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
541 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
542 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
543 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
544 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
545 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
546 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
547 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
548 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
549 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
550 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
551 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
552 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
553 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
554 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
555 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
556 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
557 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
558 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
559 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
560 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
561 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
562 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
563 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
564 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
565 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
566 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
567 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
568 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
569 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
570 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
571 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
572 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
573 2996887358 Rhizobium sp. R711 Isolate Nodule
574 2996893221 Rhizobium sp. R635 Isolate Nodule
575 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
576 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
577 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
578 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
579 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
580 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
581 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
582 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
583 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
584 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
585 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
586 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
587 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
588 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
589 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
590 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
591 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
592 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
593 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
594 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
595 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
596 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
597 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
598 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
599 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
600 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
601 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
602 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
603 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
604 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
605 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
606 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
607 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
608 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
609 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
610 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
611 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
612 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
613 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
614 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
615 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
616 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
617 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
618 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
619 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
620 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
621 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
622 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
623 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
624 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
625 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
626 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
627 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
628 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
629 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
630 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
631 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
632 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
633 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
634 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
635 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
636 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
637 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
638 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
639 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
640 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
641 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
642 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
643 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
644 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
645 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
646 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
647 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
648 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
649 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
650 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
651 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
652 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
653 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
654 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
655 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
656 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
657 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
658 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
659 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
660 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
661 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
662 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
663 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
664 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
665 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
666 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
667 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
668 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
669 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
670 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
671 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
672 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
673 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
674 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
675 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
676 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
677 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
678 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
679 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
680 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
681 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
682 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
683 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
684 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
685 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
686 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
687 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
688 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
689 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
690 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
691 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
692 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
693 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
694 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
695 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
696 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
697 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
698 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
699 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
700 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
701 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
702 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
703 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
704 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
705 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
706 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
707 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
708 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
709 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
710 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
711 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
712 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
713 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
714 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
715 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
716 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
717 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
718 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
719 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
720 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
721 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
722 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
723 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
724 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
725 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
726 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
727 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
728 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
729 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
730 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
731 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
732 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
733 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
734 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
735 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
736 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
737 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
738 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
739 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
740 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
741 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
742 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
743 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
744 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
745 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
746 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
747 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
748 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
749 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
750 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
751 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
752 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
753 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
754 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
755 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
756 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
757 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
758 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
759 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
760 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
761 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
762 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
763 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
764 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
765 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
766 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
767 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
768 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
769 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
770 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
771 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
772 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
773 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
774 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
775 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
776 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
777 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
778 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
779 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
780 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
781 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
782 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
783 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
784 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
785 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
786 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
787 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
788 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
789 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
790 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
791 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
792 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
793 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
794 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
795 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
796 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
797 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
798 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
799 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
800 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
801 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
802 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
803 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
804 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
805 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
806 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
807 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
808 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
809 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
810 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
811 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
812 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
813 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
814 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
815 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
816 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
817 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
818 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
819 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
820 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
821 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
822 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
823 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
824 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
825 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
826 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
827 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
828 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
829 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
830 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
831 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
832 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
833 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
834 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
835 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
836 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
837 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
838 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
839 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
840 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
841 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
842 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
843 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
844 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
845 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
846 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
847 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
848 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
849 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
850 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
851 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
852 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
853 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
854 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
855 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
856 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
857 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
858 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
859 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
860 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
861 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
862 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
863 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
864 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
865 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
866 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
867 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
868 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
869 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
870 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
871 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
872 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
873 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
874 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
875 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
876 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
877 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
878 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
879 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
880 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
881 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
882 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
883 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
884 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
885 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
886 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
887 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
888 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
889 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
890 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
891 8005258706 Rhizobium sp. R693 Isolate Nodule
892 8005275841 Rhizobium sp. N4311 Isolate Nodule
893 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
894 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
895 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
896 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
897 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
898 8005321885 Rhizobium sp. R72 Isolate Nodule
899 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
900 8005382845 Rhizobium sp. R634 Isolate Nodule
901 8005395548 Rhizobium sp. R339 Isolate Nodule
902 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
903 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
904 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
905 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
906 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
907 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
908 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
909 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
910 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
911 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
912 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
913 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
914 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
915 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
916 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
917 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
918 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
919 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
920 8018176218 Rhizobium sp. N122 Isolate Nodule
921 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
922 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
923 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
924 8024501048 Rhizobium sp. H4 Isolate Nodule
925 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
926 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
927 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
928 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
929 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
930 8056382006 Rhizobium croatiense 13T Isolate Nodule
931 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 44.71
Metatranscriptomes 0
Isolates 55.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.34
Bulb 0
Endosphere 14.53
Nodule 46.26
Rhizoplane 1.81
Rhizosphere 24.85
Stem 0
Stem Tuber 0
Unclassified 12.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C2804 2010549000 Bacteria 2371
2 JGI24740J21852_10000431 3300001979 Bacteria 17925
3 JGI24740J21852_10008311 3300001979 Bacteria 4144
4 JGI24739J22299_10041822 3300001989 Bacteria 1522
5 JGI24739J22299_10043279 3300001989 Bacteria 1489
6 JGI25155J39150_1000003 3300002704 Bacteria 279666
7 JGI25156J39149_1000004 3300002705 Bacteria 273027
8 JGI25162J39368_1000069 3300002737 Bacteria 125244
9 JGI25154J39366_1000013 3300002738 Bacteria 268260
10 JGI25157J39369_1000004 3300002741 Bacteria 273009
11 JGI25152J39213_1011381 3300002773 Bacteria 1971
12 JGI25151J46595_10000867 3300003187 Bacteria 23973
13 JGI25151J46595_10031432 3300003187 Bacteria 2074
14 JGI25165J46597_1000018 3300003214 Bacteria 374701
15 JGI25165J46597_1000372 3300003214 Bacteria 50057
16 JGI25165J46597_1007625 3300003214 Bacteria 1774
17 JGI25153J46596_10000974 3300003215 Bacteria 17386
18 JGI25153J46596_10011736 3300003215 Bacteria 3846
19 rootH1_10170074 3300003316 Bacteria 1402
20 rootH2_10010113 3300003320 Bacteria 9520
21 rootH1_10024239 3300003323 Bacteria 2874
22 rootH1_10114644 3300003323 Bacteria 1369
23 JGI25160J50197_1000203 3300003354 Bacteria 49418
24 JGI25160J50197_1002223 3300003354 Bacteria 9111
25 JGI25161J50226_1000570 3300003374 Bacteria 15614
26 Ga0055542_1000068 3300003762 Bacteria 152353
27 Ga0055529_1006909 3300003763 Bacteria 1560
28 Ga0055526_1000308 3300003771 Bacteria 40807
29 Ga0055526_1002146 3300003771 Bacteria 13527
30 Ga0055526_1009056 3300003771 Bacteria 4857
31 Ga0055524_1004129 3300003775 Bacteria 6804
32 Ga0055536_1000640 3300003781 Bacteria 23814
33 Ga0055528_1000054 3300003790 Bacteria 90334
34 Ga0055528_1001635 3300003790 Bacteria 13189
35 Ga0055530_10026839 3300003791 Bacteria 1583
36 Ga0055540_1008780 3300003792 Bacteria 3586
37 Ga0055540_1032064 3300003792 Bacteria 1202
38 Ga0055531_10004096 3300003794 Bacteria 9020
39 Ga0058692_1001981 3300003856 Bacteria 7129
40 Ga0058692_1003239 3300003856 Bacteria 5106
41 Ga0058692_1006050 3300003856 Bacteria 3372
42 Ga0055543_1000558 3300004625 Bacteria 20769
43 Ga0055543_1001165 3300004625 Bacteria 11186
44 Ga0065165_1000672 3300005262 Bacteria 49172
45 Ga0065165_1008544 3300005262 Bacteria 4764
46 Ga0070658_10051088 3300005327 Bacteria 3350
47 Ga0070670_100000875 3300005331 Bacteria 23662
48 Ga0070670_100076245 3300005331 Bacteria 2881
49 Ga0070670_100153761 3300005331 Bacteria 1992
50 Ga0070666_10025758 3300005335 Bacteria 3837
51 Ga0068868_100254226 3300005338 Bacteria 1479
52 Ga0070661_100215985 3300005344 Bacteria 1469
53 Ga0070668_100012960 3300005347 Bacteria 6207
54 Ga0070668_100238357 3300005347 Bacteria 1506
55 Ga0070669_100013332 3300005353 Bacteria 5843
56 Ga0070667_100081761 3300005367 Bacteria 2764
57 Ga0070663_100316409 3300005455 Bacteria 1254
58 Ga0070678_100292621 3300005456 Bacteria 1381
59 Ga0070662_100035439 3300005457 Bacteria 3524
60 Ga0068867_100090481 3300005459 Bacteria 2322
61 Ga0068853_100014109 3300005539 Bacteria 6541
62 Ga0070665_100023970 3300005548 Bacteria 6146
63 Ga0070665_100026871 3300005548 Bacteria 5798
64 Ga0070665_100083416 3300005548 Bacteria 3201
65 Ga0068855_100133933 3300005563 Bacteria 2828
66 Ga0068855_100248883 3300005563 Bacteria 1983
67 Ga0068857_100080305 3300005577 Bacteria 2912
68 Ga0068854_100079341 3300005578 Bacteria 2420
69 Ga0068856_100022697 3300005614 Bacteria 6101
70 Ga0068856_100226958 3300005614 Bacteria 1883
71 Ga0068852_100000915 3300005616 Bacteria 19555
72 Ga0068852_100370149 3300005616 Bacteria 1404
73 Ga0068852_100403498 3300005616 Bacteria 1345
74 Ga0068859_100336297 3300005617 Bacteria 1604
75 Ga0068861_100131658 3300005719 Bacteria 2030
76 Ga0068858_100059748 3300005842 Bacteria 3523
77 Ga0068858_100113038 3300005842 Bacteria 2536
78 Ga0068860_100000223 3300005843 Bacteria 88152
79 Ga0068860_100357463 3300005843 Bacteria 1438
80 Ga0070717_10319571 3300006028 Bacteria 1383
81 Ga0075365_10000531 3300006038 Bacteria 14672
82 Ga0075365_10013583 3300006038 Bacteria 4878
83 Ga0075365_10114102 3300006038 Bacteria 1859
84 Ga0075365_10280843 3300006038 Bacteria 1172
85 Ga0075368_10024453 3300006042 Bacteria 2314
86 Ga0075368_10050824 3300006042 Bacteria 1647
87 Ga0075363_100017924 3300006048 Bacteria 3519
88 Ga0075364_10005543 3300006051 Bacteria 7351
89 Ga0075364_10033420 3300006051 Bacteria 3312
90 Ga0075364_10185728 3300006051 Bacteria 1407
91 Ga0075362_10006562 3300006177 Bacteria 4345
92 Ga0075362_10018491 3300006177 Bacteria 2884
93 Ga0075362_10126842 3300006177 Bacteria 1211
94 Ga0075367_10000241 3300006178 Bacteria 18607
95 Ga0075367_10004266 3300006178 Bacteria 6952
96 Ga0075367_10011472 3300006178 Bacteria 4691
97 Ga0075367_10019149 3300006178 Bacteria 3791
98 Ga0075367_10048850 3300006178 Bacteria 2493
99 Ga0075367_10078466 3300006178 Bacteria 1994
100 Ga0075367_10148372 3300006178 Bacteria 1455
101 Ga0075367_10198256 3300006178 Bacteria 1254
102 Ga0075369_10009321 3300006186 Bacteria 3809
103 Ga0075369_10015713 3300006186 Bacteria 3043
104 Ga0075369_10025405 3300006186 Bacteria 2463
105 Ga0075369_10044681 3300006186 Bacteria 1904
106 Ga0075369_10059305 3300006186 Bacteria 1667
107 Ga0075366_10020788 3300006195 Bacteria 3810
108 Ga0075366_10038290 3300006195 Bacteria 2832
109 Ga0075366_10050002 3300006195 Bacteria 2482
110 Ga0075366_10078718 3300006195 Bacteria 1967
111 Ga0075366_10137917 3300006195 Bacteria 1474
112 Ga0075370_10006474 3300006353 Bacteria 5894
113 Ga0075370_10023613 3300006353 Bacteria 3388
114 Ga0075370_10089013 3300006353 Bacteria 1780
115 Ga0097620_100336301 3300006931 Bacteria 1604
116 Ga0099824_1032205 3300006942 Bacteria 1899
117 Ga0079104_1000014 3300006946 Bacteria 337362
118 Ga0079104_1003957 3300006946 Bacteria 6598
119 Ga0099826_10000665 3300006948 Bacteria 17773
120 Ga0099826_10171592 3300006948 Bacteria 1217
121 Ga0105240_10000217 3300009093 Bacteria 115649
122 Ga0105240_10009904 3300009093 Bacteria 13443
123 Ga0105240_10404469 3300009093 Bacteria 1537
124 Ga0111539_10424519 3300009094 Bacteria 1548
125 Ga0105247_10045309 3300009101 Bacteria 2698
126 Ga0105247_10219097 3300009101 Bacteria 1287
127 Ga0105243_10009663 3300009148 Bacteria 7343
128 Ga0105243_10025719 3300009148 Bacteria 4501
129 Ga0105243_10425834 3300009148 Bacteria 1239
130 Ga0105241_10006946 3300009174 Bacteria 8333
131 Ga0105241_10011661 3300009174 Bacteria 6449
132 Ga0105241_10098005 3300009174 Bacteria 2325
133 Ga0105248_10002569 3300009177 Bacteria 20178
134 Ga0105237_10000978 3300009545 Bacteria 38384
135 Ga0105237_10001626 3300009545 Bacteria 29169
136 Ga0105237_10312721 3300009545 Bacteria 1574
137 Ga0105237_10663129 3300009545 Bacteria 1050
138 Ga0105238_10007717 3300009551 Bacteria 10755
139 Ga0105238_10133090 3300009551 Bacteria 2465
140 Ga0105249_10561523 3300009553 Bacteria 1193
141 Ga0123340_1036321 3300009763 Bacteria 2580
142 Ga0123341_1047292 3300009765 Bacteria 2544
143 Ga0105239_10009668 3300010375 Bacteria 10844
144 Ga0105239_10024076 3300010375 Bacteria 6706
145 Ga0105239_10027867 3300010375 Bacteria 6215
146 Ga0105239_10159235 3300010375 Bacteria 2522
147 Ga0105239_10364409 3300010375 Bacteria 1633
148 Ga0105246_10004096 3300011119 Bacteria 8849
149 Ga0105246_10156773 3300011119 Bacteria 1730
150 Ga0105246_10160270 3300011119 Bacteria 1713
151 Ga0157373_10004938 3300013100 Bacteria 10032
152 Ga0157371_10000002 3300013102 Bacteria 665040
153 Ga0157370_10003627 3300013104 Bacteria 18062
154 Ga0157370_10005183 3300013104 Bacteria 14691
155 Ga0157369_10021904 3300013105 Bacteria 7144
156 Ga0171462_1012 3300013250 Bacteria 208216
157 Ga0157374_10119829 3300013296 Bacteria 2538
158 Ga0157374_10157901 3300013296 Bacteria 2208
159 Ga0157378_10039964 3300013297 Bacteria 4160
160 Ga0157378_10325447 3300013297 Bacteria 1494
161 Ga0163162_10085820 3300013306 Bacteria 3225
162 Ga0163162_10229727 3300013306 Bacteria 1986
163 Ga0163163_10007929 3300014325 Bacteria 9388
164 Ga0182008_10105220 3300014497 Bacteria 1396
165 Ga0182006_1090140 3300015261 Bacteria 1105
166 Ga0182007_10011070 3300015262 Bacteria 3528
167 Ga0182007_10031825 3300015262 Bacteria 1795
168 Ga0214544_1000018 3300021320 Bacteria 187095
169 Ga0214542_1000307 3300021321 Bacteria 83288
170 Ga0214543_1000195 3300021327 Bacteria 89886
171 Ga0214543_1011326 3300021327 Bacteria 12581
172 Ga0213872_10058442 3300021361 Bacteria 1746
173 Ga0228711_1004587 3300022739 Bacteria 21197
174 Ga0228710_1004744 3300022740 Bacteria 21386
175 Ga0209435_100006 3300025206 Bacteria 542459
176 Ga0209436_102573 3300025208 Bacteria 5339
177 Ga0209437_100022 3300025233 Bacteria 625694
178 Ga0207425_1022250 3300025245 Bacteria 1337
179 Ga0209646_1000015 3300025246 Bacteria 542459
180 Ga0209026_1000039 3300025250 Bacteria 280608
181 Ga0209677_100826 3300025253 Bacteria 15447
182 Ga0209677_102046 3300025253 Bacteria 7982
183 Ga0209148_1000078 3300025254 Bacteria 296101
184 Ga0209148_1000260 3300025254 Bacteria 82737
185 Ga0209759_1000005 3300025256 Bacteria 542459
186 Ga0209129_1000669 3300025258 Bacteria 22694
187 Ga0209129_1014747 3300025258 Bacteria 1648
188 Ga0209233_1000031 3300025261 Bacteria 624646
189 Ga0209233_1000324 3300025261 Bacteria 51086
190 Ga0209233_1000330 3300025261 Bacteria 48662
191 Ga0209233_1004739 3300025261 Bacteria 4587
192 Ga0209233_1005862 3300025261 Bacteria 4031
193 Ga0209233_1008499 3300025261 Bacteria 3174
194 Ga0209455_1000193 3300025272 Bacteria 90413
195 Ga0209673_1000067 3300025273 Bacteria 249077
196 Ga0209673_1000291 3300025273 Bacteria 93803
197 Ga0209673_1007600 3300025273 Bacteria 4957
198 Ga0209673_1013841 3300025273 Bacteria 3161
199 Ga0209130_1000242 3300025284 Bacteria 69580
200 Ga0209676_1001988 3300025292 Bacteria 16222
201 Ga0209676_1051477 3300025292 Bacteria 1080
202 Ga0209025_1000240 3300025294 Bacteria 128397
203 Ga0209025_1000430 3300025294 Bacteria 83230
204 Ga0209025_1001534 3300025294 Bacteria 29500
205 Ga0209564_1000092 3300025295 Bacteria 249018
206 Ga0209564_1000338 3300025295 Bacteria 90246
207 Ga0209564_1000876 3300025295 Bacteria 40029
208 Ga0209758_1000057 3300025297 Bacteria 333111
209 Ga0209758_1000490 3300025297 Bacteria 64714
210 Ga0209758_1008376 3300025297 Bacteria 6719
211 Ga0209758_1054707 3300025297 Bacteria 1362
212 Ga0209050_1004950 3300025298 Bacteria 8682
213 Ga0209050_1010402 3300025298 Bacteria 4591
214 Ga0209256_1000788 3300025299 Bacteria 40932
215 Ga0209256_1001843 3300025299 Bacteria 19673
216 Ga0209256_1002067 3300025299 Bacteria 17689
217 Ga0209256_1019508 3300025299 Bacteria 2155
218 Ga0207426_1000075 3300025302 Bacteria 321337
219 Ga0207426_1000483 3300025302 Bacteria 60265
220 Ga0209051_1000502 3300025303 Bacteria 49570
221 Ga0209051_1002802 3300025303 Bacteria 12031
222 Ga0209051_1008011 3300025303 Bacteria 5668
223 Ga0209257_1003568 3300025304 Bacteria 13193
224 Ga0209257_1003646 3300025304 Bacteria 12935
225 Ga0209257_1004238 3300025304 Bacteria 11332
226 Ga0209257_1004771 3300025304 Bacteria 10115
227 Ga0207680_10422073 3300025903 Bacteria 945
228 Ga0207647_10001845 3300025904 Bacteria 16266
229 Ga0207647_10081616 3300025904 Bacteria 1937
230 Ga0207645_10081588 3300025907 Bacteria 2073
231 Ga0207654_10008209 3300025911 Bacteria 5267
232 Ga0207654_10014807 3300025911 Bacteria 4037
233 Ga0207654_10155102 3300025911 Bacteria 1474
234 Ga0207695_10000163 3300025913 Bacteria 197030
235 Ga0207695_10001205 3300025913 Bacteria 44411
236 Ga0207671_10000793 3300025914 Bacteria 40024
237 Ga0207671_10006375 3300025914 Bacteria 10524
238 Ga0207671_10139331 3300025914 Bacteria 1868
239 Ga0207671_10169932 3300025914 Bacteria 1693
240 Ga0207657_10102983 3300025919 Bacteria 2367
241 Ga0207681_10038709 3300025923 Bacteria 3162
242 Ga0207694_10046666 3300025924 Bacteria 3348
243 Ga0207694_10160873 3300025924 Bacteria 1813
244 Ga0207650_10000960 3300025925 Bacteria 21697
245 Ga0207650_10193811 3300025925 Bacteria 1625
246 Ga0207644_10126543 3300025931 Bacteria 1951
247 Ga0207706_10129092 3300025933 Bacteria 2223
248 Ga0207709_10030401 3300025935 Bacteria 3141
249 Ga0207711_10463525 3300025941 Bacteria 1180
250 Ga0207667_10146494 3300025949 Bacteria 2431
251 Ga0207667_10230708 3300025949 Bacteria 1896
252 Ga0207668_10089600 3300025972 Bacteria 2256
253 Ga0207668_10159844 3300025972 Bacteria 1754
254 Ga0207640_10018951 3300025981 Bacteria 4054
255 Ga0207640_10048081 3300025981 Bacteria 2756
256 Ga0207677_10025782 3300026023 Bacteria 3674
257 Ga0207703_10395554 3300026035 Bacteria 1281
258 Ga0207639_10033648 3300026041 Bacteria 3783
259 Ga0207678_10035731 3300026067 Bacteria 4327
260 Ga0207702_10015730 3300026078 Bacteria 6263
261 Ga0207702_10105250 3300026078 Bacteria 2499
262 Ga0207648_10134408 3300026089 Bacteria 2178
263 Ga0207674_10027216 3300026116 Bacteria 6053
264 Ga0207674_10082312 3300026116 Bacteria 3220
265 Ga0207675_100126661 3300026118 Bacteria 2419
266 Ga0207675_100247727 3300026118 Bacteria 1723
267 Ga0207683_10068199 3300026121 Bacteria 3139
268 Ga0207698_10456296 3300026142 Bacteria 1235
269 Ga0209281_1000032 3300027111 Bacteria 401727
270 Ga0209281_1000491 3300027111 Bacteria 54084
271 Ga0209281_1000981 3300027111 Bacteria 22781
272 Ga0209389_1000075 3300027296 Bacteria 92887
273 Ga0209371_1000003 3300027312 Bacteria 1122971
274 Ga0209371_1000324 3300027312 Bacteria 52237
275 Ga0209371_1002664 3300027312 Bacteria 9713
276 Ga0209589_1000085 3300027357 Bacteria 92543
277 Ga0209489_100062 3300027361 Bacteria 145478
278 Ga0209282_1000108 3300027666 Bacteria 54085
279 Ga0209282_1000604 3300027666 Bacteria 17667
280 Ga0209282_1145924 3300027666 Bacteria 1149
281 Ga0268266_10082713 3300028379 Bacteria 2801
282 Ga0268266_10109122 3300028379 Bacteria 2450
283 Ga0268266_10315994 3300028379 Bacteria 1461
284 Ga0268265_10034463 3300028380 Bacteria 3691
285 Ga0268264_10000119 3300028381 Bacteria 192507
286 Ga0268264_10360012 3300028381 Bacteria 1387
287 Ga0265337_1000524 3300028556 Bacteria 20359
288 Ga0265326_10001731 3300028558 Bacteria 7555
289 Ga0265319_1007826 3300028563 Bacteria 4752
290 Ga0265334_10000591 3300028573 Bacteria 18388
291 Ga0265318_10003026 3300028577 Bacteria 8662
292 Ga0265323_10000275 3300028653 Bacteria 29810
293 Ga0265336_10000107 3300028666 Bacteria 63528
294 Ga0307515_10001999 3300028794 Bacteria 45141
295 Ga0307515_10009236 3300028794 Bacteria 19093
296 Ga0265338_10000161 3300028800 Bacteria 122364
297 Ga0265324_10016038 3300029957 Bacteria 2745
298 Ga0268256_1000004 3300030500 Bacteria 1122967
299 Ga0268256_1001615 3300030500 Bacteria 13064
300 Ga0268256_1002375 3300030500 Bacteria 9686
301 Ga0316182_1446202 3300030745 Bacteria 1177
302 Ga0307513_10003915 3300031456 Bacteria 20018
303 Ga0307509_10026921 3300031507 Bacteria 6405
304 Ga0307509_10216605 3300031507 Bacteria 1732
305 Ga0307509_10266616 3300031507 Bacteria 1483
306 Ga0307508_10001261 3300031616 Bacteria 28804
307 Ga0307508_10108467 3300031616 Bacteria 2376
308 Ga0307516_10085368 3300031730 Bacteria 2994
309 Ga0315914_1000427 3300031967 Bacteria 51660
310 Ga0307416_100579733 3300032002 Bacteria 1199
311 Ga0315913_1001358 3300033430 Bacteria 26703
312 Ga0315915_1000032 3300033464 Bacteria 87024
313 Ga0373946_0181048 3300035171 Bacteria 1000
314 Ga0373935_0007083 3300035692 Bacteria 6696
315 Ga0373935_0142994 3300035692 Bacteria 1617
316 Ga0373927_0000581 3300035695 Bacteria 27838
317 Ga0373927_0008059 3300035695 Bacteria 7112
318 Ga0395900_0039934 3300037418 Bacteria 4837
319 Ga0395900_0041420 3300037418 Bacteria 4748
320 Ga0395898_0190977 3300037466 Bacteria 1957
321 Ga0395898_0247312 3300037466 Bacteria 1701
322 Ga0395905_0000321 3300037471 Bacteria 69144
323 Ga0395905_0008887 3300037471 Bacteria 9869
324 Ga0395905_0047480 3300037471 Bacteria 4024
325 Ga0395905_0065345 3300037471 Bacteria 3406
326 Ga0395905_0084215 3300037471 Bacteria 2979
327 Ga0395901_0011805 3300038443 Bacteria 8858
328 Ga0395901_0023117 3300038443 Bacteria 6372
329 Ga0436365_1806102 3300039437 Bacteria 933
330 Ga0436361_0117844 3300039447 Bacteria 3187
331 Ga0436361_1160430 3300039447 Bacteria 8197
332 Ga0439465_0001132 3300041413 Bacteria 8533
333 Ga0451841_0655033 3300041498 Bacteria 2056
334 Ga0451855_1487574 3300041511 Bacteria 1305
335 Ga0439433_0019503 3300041999 Bacteria 1511
336 Ga0439449_0129614 3300042007 Bacteria 937
337 Ga0466972_0018693 3300044658 Bacteria 3465
338 Ga0466966_0163249 3300044684 Bacteria 1356
339 Ga0466963_0146701 3300044694 Bacteria 1637
340 Ga0466970_0000136 3300044765 Bacteria 33881
341 Ga0466957_0002082 3300044842 Bacteria 10705
342 Ga0451576_0008472 3300045051 Bacteria 12070
343 Ga0451576_0027482 3300045051 Bacteria 6110
344 Ga0466958_0229106 3300045836 Bacteria 1186
345 Ga0495629_0009432 3300046459 Bacteria 7137
346 Ga0495638_0029107 3300046460 Bacteria 3563
347 Ga0495605_0005741 3300046474 Bacteria 7198
348 Ga0495605_0094043 3300046474 Bacteria 1385
349 Ga0495662_0004214 3300046476 Bacteria 7235
350 Ga0495585_0027986 3300046492 Bacteria 3217
351 Ga0495607_0025260 3300046501 Bacteria 3697
352 Ga0495583_0001811 3300046506 Bacteria 20150
353 Ga0495606_0010507 3300046507 Bacteria 7669
354 Ga0495606_0026163 3300046507 Bacteria 4162
355 Ga0495610_0037467 3300046512 Bacteria 2467
356 Ga0495610_0078559 3300046512 Bacteria 1521
357 Ga0495616_0122478 3300046513 Bacteria 1199
358 Ga0495620_0001877 3300046515 Bacteria 12353
359 Ga0495620_0099673 3300046515 Bacteria 1159
360 Ga0495631_0022769 3300046518 Bacteria 2912
361 Ga0495631_0059438 3300046518 Bacteria 1661
362 Ga0495632_0037014 3300046519 Bacteria 2479
363 Ga0495643_0006040 3300046522 Bacteria 8073
364 Ga0495644_0047166 3300046523 Bacteria 1619
365 Ga0495648_0015554 3300046524 Bacteria 5522
366 Ga0495648_0085494 3300046524 Bacteria 1782
367 Ga0495654_0048553 3300046530 Bacteria 2082
368 Ga0495609_0056542 3300046538 Bacteria 1738
369 Ga0495597_0011739 3300046542 Bacteria 4242
370 Ga0495597_0031607 3300046542 Bacteria 2407
371 Ga0495622_0001480 3300046557 Bacteria 11803
372 Ga0495668_0006776 3300046616 Bacteria 7445
373 Ga0495668_0033505 3300046616 Bacteria 2886
374 Ga0495668_0054192 3300046616 Bacteria 2217
375 Ga0495668_0229121 3300046616 Bacteria 1017
376 Ga0495625_0003205 3300046660 Bacteria 16616
377 Ga0495625_0010911 3300046660 Bacteria 7464
378 Ga0495625_0041169 3300046660 Bacteria 3364
379 Ga0495588_0007248 3300046674 Bacteria 5035
380 Ga0495657_0055012 3300046675 Bacteria 2656
381 Ga0495670_0007464 3300046691 Bacteria 5370
382 Ga0495649_0008058 3300046694 Bacteria 6363
383 Ga0495649_0093027 3300046694 Bacteria 1605
384 Ga0495649_0208922 3300046694 Bacteria 1012
385 Ga0495600_0177183 3300046809 Bacteria 1374
386 Ga0495660_0008181 3300046810 Bacteria 6135
387 Ga0495604_0000886 3300047317 Bacteria 24880
388 Ga0495636_0088757 3300047318 Bacteria 1340
389 Ga0495683_0030310 3300047323 Bacteria 2760
390 Ga0495683_0103540 3300047323 Bacteria 1366
391 Ga0495687_010309 3300047443 Bacteria 5132
392 Ga0495687_102321 3300047443 Bacteria 1072
393 Ga0495681_0017210 3300047470 Bacteria 4024
394 Ga0495681_0128145 3300047470 Bacteria 1083
395 Ga0495686_0008180 3300047472 Bacteria 7720
396 Ga0495615_0003234 3300048090 Bacteria 2707
397 Ga0495626_0024458 3300048091 Bacteria 2961
398 Ga0495626_0082107 3300048091 Bacteria 1430
399 Ga0496101_0113978 3300048904 Bacteria 2038
400 Ga0496101_0130822 3300048904 Bacteria 1906
401 Ga0496102_0248885 3300048905 Bacteria 1675
402 Ga0496103_0004367 3300048906 Bacteria 8586
403 Ga0496103_0179307 3300048906 Bacteria 1361
404 Ga0496105_0035672 3300048908 Bacteria 4094
405 Ga0496106_0251004 3300048909 Bacteria 1414
406 Ga0496107_0160238 3300048910 Bacteria 1667
407 Ga0496108_0090757 3300048911 Bacteria 2597
408 Ga0496112_0025887 3300048915 Bacteria 5638
409 Ga0496112_0056209 3300048915 Bacteria 3872
410 Ga0496113_0093919 3300048916 Bacteria 2316
411 Ga0496115_0345506 3300048918 Bacteria 1214
412 Ga0496116_0015008 3300048919 Bacteria 6146
413 Ga0496117_0000016 3300048920 Bacteria 523642
414 Ga0496117_0002969 3300048920 Bacteria 20461
415 Ga0496117_0017101 3300048920 Bacteria 6072
416 Ga0496117_0031041 3300048920 Bacteria 4087
417 Ga0496117_0101080 3300048920 Bacteria 1825
418 Ga0496117_0147081 3300048920 Bacteria 1401
419 Ga0496118_0000153 3300048921 Bacteria 122419
420 Ga0496118_0011952 3300048921 Bacteria 8395
421 Ga0496118_0013244 3300048921 Bacteria 7822
422 Ga0496118_0041916 3300048921 Bacteria 3618
423 Ga0496118_0083641 3300048921 Bacteria 2230
424 Ga0496119_0007331 3300048922 Bacteria 9975
425 Ga0496119_0008586 3300048922 Bacteria 8952
426 Ga0496119_0018968 3300048922 Bacteria 5092
427 Ga0496119_0030012 3300048922 Bacteria 3673
428 Ga0496119_0040903 3300048922 Bacteria 2958
429 Ga0496119_0067501 3300048922 Bacteria 2109
430 Ga0496119_0085742 3300048922 Bacteria 1802
431 Ga0496120_0000660 3300048923 Bacteria 50656
432 Ga0496120_0004196 3300048923 Bacteria 12311
433 Ga0496120_0106802 3300048923 Bacteria 1469
434 Ga0496121_0001476 3300048924 Bacteria 39569
435 Ga0496121_0135546 3300048924 Bacteria 1835
436 Ga0496122_0000002 3300048925 Bacteria 905834
437 Ga0496122_0002358 3300048925 Bacteria 27165
438 Ga0496122_0003859 3300048925 Bacteria 19238
439 Ga0496122_0007025 3300048925 Bacteria 12656
440 Ga0496122_0007371 3300048925 Bacteria 12258
441 Ga0496122_0026867 3300048925 Bacteria 4944
442 Ga0496122_0042303 3300048925 Bacteria 3586
443 Ga0496123_0000002 3300048926 Bacteria 1811682
444 Ga0496123_0017939 3300048926 Bacteria 5666
445 Ga0496123_0021255 3300048926 Bacteria 5048
446 Ga0496124_0025190 3300048927 Bacteria 5392
447 Ga0496124_0035680 3300048927 Bacteria 4349
448 Ga0496124_0112725 3300048927 Bacteria 2186
449 Ga0496124_0405016 3300048927 Bacteria 945
450 Ga0496124_0405026 3300048927 Bacteria 945
451 Ga0496125_0020431 3300048928 Bacteria 6215
452 Ga0496125_0058623 3300048928 Bacteria 3109
453 Ga0496125_0080584 3300048928 Bacteria 2490
454 Ga0496125_0169090 3300048928 Bacteria 1472
455 Ga0496126_0096902 3300048929 Bacteria 2586
456 Ga0501032_0137182 3300049569 Bacteria 1612
457 Ga0501033_0000697 3300049570 Bacteria 31065
458 Ga0501033_0245026 3300049570 Bacteria 1271
459 Ga0501037_0072493 3300049573 Bacteria 2505
460 Ga0501035_0003274 3300049822 Bacteria 15525
461 Ga0501044_0525071 3300049823 Bacteria 1083
462 nmdc:mga03683_183910_c1 3300050489 Bacteria 954
463 nmdc:mga03683_78992_c1 3300050489 Bacteria 1418
464 nmdc:mga03n38_5449_c1 3300050490 Bacteria 4336
465 nmdc:mga03n38_90357_c1 3300050490 Bacteria 1457
466 nmdc:mga00v17_290130_c1 3300050491 Bacteria 1062
467 nmdc:mga00v17_3_c1 3300050491 Bacteria 242367
468 nmdc:mga0yw44_2963_c1 3300050492 Bacteria 7398
469 nmdc:mga0yw44_41312_c1 3300050492 Bacteria 2745
470 nmdc:mga0yw44_53397_c1 3300050492 Bacteria 2454
471 nmdc:mga0yw44_9622_c1 3300050492 Bacteria 4901
472 nmdc:mga0k408_139470_c1 3300050493 Bacteria 1442
473 nmdc:mga0k408_25554_c1 3300050493 Bacteria 3345
474 nmdc:mga06z11_113912_c1 3300050494 Bacteria 1501
475 nmdc:mga06z11_147689_c1 3300050494 Bacteria 1334
476 nmdc:mga06z11_15769_c1 3300050494 Bacteria 3382
477 nmdc:mga06z11_7336_c1 3300050494 Bacteria 4531
478 nmdc:mga04h51_162738_c1 3300050495 Bacteria 860
479 nmdc:mga04h51_2441_c1 3300050495 Bacteria 4413
480 nmdc:mga07m45_111607_c1 3300050496 Bacteria 1575
481 nmdc:mga07m45_131581_c1 3300050496 Bacteria 1448
482 nmdc:mga07m45_17763_c1 3300050496 Bacteria 3827
483 nmdc:mga07m45_48481_c1 3300050496 Bacteria 2389
484 nmdc:mga0sz30_20499_c1 3300050516 Bacteria 2307
485 nmdc:mga0sz30_514_c1 3300050516 Bacteria 14418
486 nmdc:mga0sz30_54581_c1 3300050516 Bacteria 1700
487 nmdc:mga0sz30_57866_c1 3300050516 Bacteria 1652
488 Ga0500635_0001856 3300053080 Bacteria 5150
489 Ga0495655_0041962 3300053083 Bacteria 1172
490 Ga0500578_0008264 3300053086 Bacteria 6811
491 Ga0500578_0102719 3300053086 Bacteria 1808
492 Ga0500651_0114840 3300053093 Bacteria 1640
493 Ga0500641_0035388 3300053096 Bacteria 1993
494 Ga0500560_000351 3300053107 Bacteria 6044
495 Ga0500560_005649 3300053107 Bacteria 2788
496 Ga0500569_004067 3300053109 Bacteria 3046
497 Ga0500572_004796 3300053111 Bacteria 3064
498 Ga0500594_0005184 3300053118 Bacteria 2887
499 Ga0500594_0010645 3300053118 Bacteria 2139
500 Ga0500618_000605 3300053125 Bacteria 22012
501 Ga0500658_0000280 3300053134 Bacteria 23185
502 Ga0500559_0001421 3300053136 Bacteria 13590
503 Ga0500559_0011473 3300053136 Bacteria 3784
504 Ga0500561_0000632 3300053137 Bacteria 5599
505 Ga0500573_0014661 3300053140 Bacteria 4436
506 Ga0500577_0087440 3300053142 Bacteria 1254
507 Ga0500590_030908 3300053148 Bacteria 2777
508 Ga0500604_0011363 3300053151 Bacteria 2390
509 Ga0500616_0005247 3300053153 Bacteria 8859
510 Ga0500616_0005811 3300053153 Bacteria 8281
511 Ga0500624_000337 3300053157 Bacteria 15781
512 Ga0500627_0008746 3300053158 Bacteria 3613
513 Ga0500639_063128 3300053163 Bacteria 1905
514 Ga0500636_0000001 3300053177 Bacteria 324086
515 Ga0500636_0001440 3300053177 Bacteria 12937
516 Ga0500636_0001623 3300053177 Bacteria 12274
517 Ga0500636_0037430 3300053177 Bacteria 2870
518 Ga0500636_0066000 3300053177 Bacteria 2105
519 Ga0500596_001975 3300053735 Bacteria 4104

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046474 Ga0495605_0094043 Ga0495605_0094043_150_887 232
2 3300053096 Ga0500641_0035388 Ga0500641_0035388_24_740 237
3 iso_pu_bacteria 2510461069 2510842453 238
4 3300009551 Ga0105238_10133090 Ga0105238_101330903 249
5 3300010375 Ga0105239_10159235 Ga0105239_101592353 249
6 3300025924 Ga0207694_10160873 Ga0207694_101608732 249
7 3300048904 Ga0496101_0113978 Ga0496101_0113978_14_763 249
8 3300048906 Ga0496103_0179307 Ga0496103_0179307_582_1331 249
9 3300048927 Ga0496124_0112725 Ga0496124_0112725_1198_2052 249
10 3300048928 Ga0496125_0169090 Ga0496125_0169090_211_1065 249
11 3300049569 Ga0501032_0137182 Ga0501032_0137182_115_978 249
12 3300049570 Ga0501033_0000697 Ga0501033_0000697_8004_8867 249
13 3300049822 Ga0501035_0003274 Ga0501035_0003274_14063_14926 249
14 3300005331 Ga0070670_100000875 Ga0070670_10000087518 250
15 3300025925 Ga0207650_10000960 Ga0207650_100009604 250
16 3300005842 Ga0068858_100113038 Ga0068858_1001130382 256
17 3300009101 Ga0105247_10045309 Ga0105247_100453092 256
18 3300009545 Ga0105237_10663129 Ga0105237_106631292 256
19 3300009763 Ga0123340_1036321 Ga0123340_10363212 256
20 3300009765 Ga0123341_1047292 Ga0123341_10472922 256
21 3300041999 Ga0439433_0019503 Ga0439433_0019503_250_1095 256
22 3300047470 Ga0495681_0017210 Ga0495681_0017210_12_863 256
23 3300048920 Ga0496117_0147081 Ga0496117_0147081_307_1161 256
24 3300025261 Ga0209233_1004739 Ga0209233_10047393 257
25 3300039437 Ga0436365_1806102 Ga0436365_1806102_17_796 258
26 3300005347 Ga0070668_100238357 Ga0070668_1002383572 259
27 iso_pu_bacteria 2588253730 2588514380 259
28 iso_pu_bacteria 2924710171 2924712834 259
29 3300046694 Ga0495649_0208922 Ga0495649_0208922_50_832 260
30 3300009174 Ga0105241_10098005 Ga0105241_100980052 263
31 3300050492 nmdc:mga0yw44_41312_c1 nmdc:mga0yw44_41312_c1_631_1422 263
32 3300050495 nmdc:mga04h51_162738_c1 nmdc:mga04h51_162738_c1_56_847 263
33 iso_pu_bacteria 2841846520 2841849529 266
34 iso_pu_bacteria 2899845264 2899850002 266
35 iso_pu_bacteria 2926760298 2926763648 266
36 3300037471 Ga0395905_0008887 Ga0395905_0008887_813_1679 267
37 3300006946 Ga0079104_1000014 Ga0079104_1000014274 269
38 3300027111 Ga0209281_1000032 Ga0209281_1000032272 269
39 3300048908 Ga0496105_0035672 Ga0496105_0035672_3267_4082 270
40 3300048922 Ga0496119_0067501 Ga0496119_0067501_970_1782 270
41 iso_pu_bacteria 2585428058 2587733738 271
42 iso_pu_bacteria 2869256925 2869257487 271
43 iso_pu_bacteria 2878738818 2878742310 271
44 iso_pu_bacteria 2924776078 2924780110 271
45 3300009093 Ga0105240_10009904 Ga0105240_100099048 272
46 3300009174 Ga0105241_10006946 Ga0105241_100069463 272
47 3300009545 Ga0105237_10001626 Ga0105237_100016269 272
48 3300010375 Ga0105239_10027867 Ga0105239_100278673 272
49 3300006195 Ga0075366_10020788 Ga0075366_100207882 273
50 3300006353 Ga0075370_10023613 Ga0075370_100236132 273
51 3300050493 nmdc:mga0k408_139470_c1 nmdc:mga0k408_139470_c1_349_1191 273
52 3300050496 nmdc:mga07m45_48481_c1 nmdc:mga07m45_48481_c1_1458_2300 273
53 3300028556 Ga0265337_1000524 Ga0265337_100052410 274
54 3300028558 Ga0265326_10001731 Ga0265326_100017314 274
55 3300028563 Ga0265319_1007826 Ga0265319_10078264 274
56 3300028573 Ga0265334_10000591 Ga0265334_1000059112 274
57 3300028577 Ga0265318_10003026 Ga0265318_100030266 274
58 3300028653 Ga0265323_10000275 Ga0265323_1000027527 274
59 3300028666 Ga0265336_10000107 Ga0265336_1000010732 274
60 3300028800 Ga0265338_10000161 Ga0265338_1000016190 274
61 3300029957 Ga0265324_10016038 Ga0265324_100160382 274
62 3300042007 Ga0439449_0129614 Ga0439449_0129614_26_850 274
63 3300049570 Ga0501033_0245026 Ga0501033_0245026_160_1008 274
64 iso_pu_bacteria 2503198000 2503200936 274
65 iso_pu_bacteria 2512875024 2512963935 274
66 iso_pu_bacteria 2513237164 2514035812 274
67 iso_pu_bacteria 2643221595 2643984696 274
68 iso_pu_bacteria 2643221627 2644153021 274
69 iso_pu_bacteria 2791355253 2793281324 274
70 iso_pu_bacteria 2856364286 2856366203 274
71 iso_pu_bacteria 2869285874 2869287237 274
72 iso_pu_bacteria 2871429161 2871430537 274
73 iso_pu_bacteria 2871435913 2871439366 274
74 iso_pu_bacteria 2874146452 2874149186 274
75 iso_pu_bacteria 2874155637 2874156029 274
76 iso_pu_bacteria 2876363079 2876367305 274
77 iso_pu_bacteria 2876413966 2876415391 274
78 iso_pu_bacteria 2878745973 2878746969 274
79 iso_pu_bacteria 2889016732 2889020768 274
80 iso_pu_bacteria 2903448605 2903453225 274
81 iso_pu_bacteria 2903492973 2903500514 274
82 iso_pu_bacteria 2903521522 2903526796 274
83 iso_pu_bacteria 2903528002 2903530585 274
84 iso_pu_bacteria 2906308376 2906309783 274
85 iso_pu_bacteria 2906321335 2906322418 274
86 iso_pu_bacteria 2924733363 2924737397 274
87 iso_pu_bacteria 2937813078 2937814920 274
88 iso_pu_bacteria 2958041894 2958044036 274
89 iso_pu_bacteria 2958130278 2958131737 274
90 iso_pu_bacteria 2958179912 2958180797 274
91 iso_pu_bacteria 2961077736 2961078635 274
92 iso_pu_bacteria 2965119406 2965126608 274
93 iso_pu_bacteria 2977843712 2977845620 274
94 iso_pu_bacteria 2996386984 2996393829 274
95 iso_pu_bacteria 3004203850 3004204111 274
96 iso_pu_bacteria 8004312739 8004313821 274
97 iso_pu_bacteria 8004387939 8004389074 274
98 iso_pu_bacteria 8004714634 8004716137 274
99 iso_pu_bacteria 8055431914 8055434871 274
100 iso_pu_bacteria 2508501123 2509118399 275
101 iso_pu_bacteria 2513237088 2513595995 275
102 iso_pu_bacteria 2582581316 2585334523 275
103 iso_pu_bacteria 2615840698 2616555593 275
104 iso_pu_bacteria 2617270742 2617385517 275
105 iso_pu_bacteria 2667528174 2671113173 275
106 iso_pu_bacteria 2775507266 2778174840 275
107 iso_pu_bacteria 2818991448 2819613187 275
108 iso_pu_bacteria 2838029111 2838031689 275
109 iso_pu_bacteria 2842475841 2842478421 275
110 iso_pu_bacteria 2842502639 2842505633 275
111 iso_pu_bacteria 2842775625 2842776492 275
112 iso_pu_bacteria 2852387548 2852394161 275
113 iso_pu_bacteria 2919408235 2919412941 275
114 iso_pu_bacteria 2937877337 2937882630 275
115 iso_pu_bacteria 2958144490 2958145582 275
116 iso_pu_bacteria 2996887358 2996893026 275
117 iso_pu_bacteria 3005416602 3005416648 275
118 iso_pu_bacteria 8005314921 8005320709 275
119 iso_pu_bacteria 8005321885 8005327553 275
120 iso_pu_bacteria 8005484373 8005487624 275
121 iso_pu_bacteria 8005645114 8005651812 275
122 iso_pu_bacteria 8005682033 8005686024 275
123 iso_pu_bacteria 8046767195 8046774212 275
124 3300046674 Ga0495588_0007248 Ga0495588_0007248_2362_3213 276
125 3300053107 Ga0500560_005649 Ga0500560_005649_1824_2675 276
126 iso_pu_bacteria 2510917022 2511135580 276
127 iso_pu_bacteria 2512875016 2512929137 276
128 iso_pu_bacteria 2513237090 2513611558 276
129 iso_pu_bacteria 2513237305 2514423390 276
130 iso_pu_bacteria 2524023209 2524459177 276
131 iso_pu_bacteria 2582581306 2585268273 276
132 iso_pu_bacteria 2582581307 2585272655 276
133 iso_pu_bacteria 2582581308 2585281205 276
134 iso_pu_bacteria 2582581315 2585327291 276
135 iso_pu_bacteria 2582581865 2585391169 276
136 iso_pu_bacteria 2585427527 2585536135 276
137 iso_pu_bacteria 2585427530 2585557620 276
138 iso_pu_bacteria 2585427531 2585562323 276
139 iso_pu_bacteria 2585427608 2585896763 276
140 iso_pu_bacteria 2585427609 2585906510 276
141 iso_pu_bacteria 2585428125 2587981932 276
142 iso_pu_bacteria 2599185301 2599940076 276
143 iso_pu_bacteria 2615840626 2616310993 276
144 iso_pu_bacteria 2643221558 2643810624 276
145 iso_pu_bacteria 2721755686 2723575015 276
146 iso_pu_bacteria 2791355123 2792752208 276
147 iso_pu_bacteria 2818991453 2819641741 276
148 iso_pu_bacteria 2842298080 2842300964 276
149 iso_pu_bacteria 2842357229 2842360020 276
150 iso_pu_bacteria 2842509118 2842513857 276
151 iso_pu_bacteria 2844002411 2844004712 276
152 iso_pu_bacteria 2847670302 2847674867 276
153 iso_pu_bacteria 2847686936 2847688712 276
154 iso_pu_bacteria 2854896431 2854902250 276
155 iso_pu_bacteria 2856314179 2856317249 276
156 iso_pu_bacteria 2856349417 2856353634 276
157 iso_pu_bacteria 2856356410 2856362633 276
158 iso_pu_bacteria 2869162929 2869163890 276
159 iso_pu_bacteria 2871444079 2871447672 276
160 iso_pu_bacteria 2871488783 2871489469 276
161 iso_pu_bacteria 2871495908 2871496297 276
162 iso_pu_bacteria 2874102143 2874103470 276
163 iso_pu_bacteria 2876369609 2876374667 276
164 iso_pu_bacteria 2876392853 2876393657 276
165 iso_pu_bacteria 2878035449 2878038287 276
166 iso_pu_bacteria 2878753008 2878754126 276
167 iso_pu_bacteria 2878760144 2878760526 276
168 iso_pu_bacteria 2878767105 2878767489 276
169 iso_pu_bacteria 2881147464 2881151117 276
170 iso_pu_bacteria 2881155292 2881161507 276
171 iso_pu_bacteria 2881161766 2881163418 276
172 iso_pu_bacteria 2881853255 2881853438 276
173 iso_pu_bacteria 2881861095 2881868079 276
174 iso_pu_bacteria 2882632389 2882637524 276
175 iso_pu_bacteria 2882912400 2882919042 276
176 iso_pu_bacteria 2885305155 2885305849 276
177 iso_pu_bacteria 2885318864 2885324127 276
178 iso_pu_bacteria 2885326080 2885327745 276
179 iso_pu_bacteria 2885334103 2885340057 276
180 iso_pu_bacteria 2885342637 2885346782 276
181 iso_pu_bacteria 2885350715 2885353211 276
182 iso_pu_bacteria 2888337043 2888338831 276
183 iso_pu_bacteria 2903492973 2903494571 276
184 iso_pu_bacteria 2903540706 2903541091 276
185 iso_pu_bacteria 2904659560 2904660165 276
186 iso_pu_bacteria 2906328253 2906331872 276
187 iso_pu_bacteria 2906414383 2906417311 276
188 iso_pu_bacteria 2922158528 2922163052 276
189 iso_pu_bacteria 2924726620 2924728590 276
190 iso_pu_bacteria 2924762789 2924769112 276
191 iso_pu_bacteria 2924784321 2924788796 276
192 iso_pu_bacteria 2937848649 2937848806 276
193 iso_pu_bacteria 2937891427 2937895581 276
194 iso_pu_bacteria 2937994558 2937994944 276
195 iso_pu_bacteria 2958064165 2958064851 276
196 iso_pu_bacteria 2958084443 2958089755 276
197 iso_pu_bacteria 2958092219 2958100450 276
198 iso_pu_bacteria 2958115193 2958121513 276
199 iso_pu_bacteria 2958165035 2958165424 276
200 iso_pu_bacteria 2961114664 2961115490 276
201 iso_pu_bacteria 2961127735 2961129802 276
202 iso_pu_bacteria 2961163497 2961163882 276
203 iso_pu_bacteria 2961170736 2961171758 276
204 iso_pu_bacteria 2963644680 2963650098 276
205 iso_pu_bacteria 2965018300 2965018687 276
206 iso_pu_bacteria 2965062239 2965069603 276
207 iso_pu_bacteria 2967996073 2967996537 276
208 iso_pu_bacteria 2968003550 2968010252 276
209 iso_pu_bacteria 2968083720 2968086591 276
210 iso_pu_bacteria 2968091066 2968095333 276
211 iso_pu_bacteria 2968097103 2968103090 276
212 iso_pu_bacteria 2968110612 2968111221 276
213 iso_pu_bacteria 2968117919 2968118898 276
214 iso_pu_bacteria 2968128360 2968128549 276
215 iso_pu_bacteria 2968171901 2968172288 276
216 iso_pu_bacteria 2970503327 2970504354 276
217 iso_pu_bacteria 2970554993 2970555378 276
218 iso_pu_bacteria 2977821940 2977823341 276
219 iso_pu_bacteria 2977828996 2977831306 276
220 iso_pu_bacteria 2977858184 2977864086 276
221 iso_pu_bacteria 2977864932 2977866029 276
222 iso_pu_bacteria 2977898635 2977903835 276
223 iso_pu_bacteria 2977922695 2977928385 276
224 iso_pu_bacteria 2977986579 2977987131 276
225 iso_pu_bacteria 2979779861 2979784867 276
226 iso_pu_bacteria 2979808191 2979808991 276
227 iso_pu_bacteria 2987659509 2987659894 276
228 iso_pu_bacteria 2987666974 2987672964 276
229 iso_pu_bacteria 2996341866 2996345385 276
230 iso_pu_bacteria 3000135777 3000140973 276
231 iso_pu_bacteria 3004188549 3004188941 276
232 iso_pu_bacteria 3004211236 3004215608 276
233 iso_pu_bacteria 3004218560 3004222088 276
234 iso_pu_bacteria 3004334049 3004335168 276
235 iso_pu_bacteria 3005445848 3005452077 276
236 iso_pu_bacteria 637000159 637078897 276
237 iso_pu_bacteria 643348564 643600624 276
238 iso_pu_bacteria 8004374579 8004375702 276
239 iso_pu_bacteria 8004445564 8004451934 276
240 iso_pu_bacteria 8004703790 8004713246 276
241 iso_pu_bacteria 8018150411 8018151245 276
242 iso_pu_bacteria 8024486573 8024493053 276
243 iso_pu_bacteria 8054558443 8054559623 276
244 3300003215 JGI25153J46596_10000974 JGI25153J46596_1000097414 277
245 3300025297 Ga0209758_1000057 Ga0209758_100005788 277
246 3300031507 Ga0307509_10026921 Ga0307509_100269214 277
247 3300053093 Ga0500651_0114840 Ga0500651_0114840_523_1377 277
248 3300053136 Ga0500559_0011473 Ga0500559_0011473_2904_3740 277
249 3300053140 Ga0500573_0014661 Ga0500573_0014661_1787_2623 277
250 3300053177 Ga0500636_0037430 Ga0500636_0037430_1988_2824 277
251 3300053735 Ga0500596_001975 Ga0500596_001975_1470_2306 277
252 3300001979 JGI24740J21852_10008311 JGI24740J21852_100083113 278
253 3300001989 JGI24739J22299_10043279 JGI24739J22299_100432792 278
254 3300003316 rootH1_10170074 rootH1_101700742 278
255 3300003323 rootH1_10114644 rootH1_101146442 278
256 3300003762 Ga0055542_1000068 Ga0055542_10000688 278
257 3300003763 Ga0055529_1006909 Ga0055529_10069092 278
258 3300005327 Ga0070658_10051088 Ga0070658_100510883 278
259 3300005616 Ga0068852_100370149 Ga0068852_1003701492 278
260 3300006038 Ga0075365_10000531 Ga0075365_100005317 278
261 3300006178 Ga0075367_10048850 Ga0075367_100488503 278
262 3300006353 Ga0075370_10089013 Ga0075370_100890132 278
263 3300009093 Ga0105240_10404469 Ga0105240_104044692 278
264 3300009101 Ga0105247_10219097 Ga0105247_102190972 278
265 3300009545 Ga0105237_10312721 Ga0105237_103127212 278
266 3300009553 Ga0105249_10561523 Ga0105249_105615232 278
267 3300010375 Ga0105239_10364409 Ga0105239_103644092 278
268 3300013296 Ga0157374_10157901 Ga0157374_101579012 278
269 3300014497 Ga0182008_10105220 Ga0182008_101052202 278
270 3300015262 Ga0182007_10031825 Ga0182007_100318252 278
271 3300025254 Ga0209148_1000078 Ga0209148_1000078151 278
272 3300025272 Ga0209455_1000193 Ga0209455_100019332 278
273 3300025914 Ga0207671_10139331 Ga0207671_101393312 278
274 3300025919 Ga0207657_10102983 Ga0207657_101029832 278
275 3300026078 Ga0207702_10105250 Ga0207702_101052502 278
276 3300037466 Ga0395898_0190977 Ga0395898_0190977_273_1118 278
277 3300037471 Ga0395905_0065345 Ga0395905_0065345_1565_2410 278
278 3300037471 Ga0395905_0084215 Ga0395905_0084215_1396_2241 278
279 3300038443 Ga0395901_0023117 Ga0395901_0023117_463_1308 278
280 3300048915 Ga0496112_0025887 Ga0496112_0025887_2492_3337 278
281 3300048922 Ga0496119_0030012 Ga0496119_0030012_1919_2764 278
282 3300050492 nmdc:mga0yw44_2963_c1 nmdc:mga0yw44_2963_c1_6380_7225 278
283 3300050496 nmdc:mga07m45_111607_c1 nmdc:mga07m45_111607_c1_361_1206 278
284 iso_pu_bacteria 2582581866 2585396266 278
285 iso_pu_bacteria 2917699015 2917703762 278
286 3300001979 JGI24740J21852_10000431 JGI24740J21852_100004319 279
287 3300002704 JGI25155J39150_1000003 JGI25155J39150_1000003196 279
288 3300002705 JGI25156J39149_1000004 JGI25156J39149_1000004190 279
289 3300002737 JGI25162J39368_1000069 JGI25162J39368_100006990 279
290 3300002738 JGI25154J39366_1000013 JGI25154J39366_1000013273 279
291 3300002741 JGI25157J39369_1000004 JGI25157J39369_100000487 279
292 3300003214 JGI25165J46597_1000018 JGI25165J46597_100001859 279
293 3300003320 rootH2_10010113 rootH2_100101138 279
294 3300003323 rootH1_10024239 rootH1_100242392 279
295 3300003856 Ga0058692_1003239 Ga0058692_10032393 279
296 3300005331 Ga0070670_100153761 Ga0070670_1001537612 279
297 3300005614 Ga0068856_100022697 Ga0068856_1000226972 279
298 3300006028 Ga0070717_10319571 Ga0070717_103195712 279
299 3300009094 Ga0111539_10424519 Ga0111539_104245192 279
300 3300013250 Ga0171462_1012 Ga0171462_101226 279
301 3300025206 Ga0209435_100006 Ga0209435_10000686 279
302 3300025233 Ga0209437_100022 Ga0209437_100022124 279
303 3300025246 Ga0209646_1000015 Ga0209646_1000015448 279
304 3300025250 Ga0209026_1000039 Ga0209026_100003986 279
305 3300025256 Ga0209759_1000005 Ga0209759_100000586 279
306 3300025261 Ga0209233_1000031 Ga0209233_1000031124 279
307 3300026078 Ga0207702_10015730 Ga0207702_100157305 279
308 3300027312 Ga0209371_1002664 Ga0209371_10026645 279
309 3300030500 Ga0268256_1002375 Ga0268256_10023755 279
310 3300037471 Ga0395905_0000321 Ga0395905_0000321_43149_44003 279
311 3300044684 Ga0466966_0163249 Ga0466966_0163249_64_915 279
312 3300044694 Ga0466963_0146701 Ga0466963_0146701_769_1620 279
313 3300044765 Ga0466970_0000136 Ga0466970_0000136_16036_16887 279
314 3300044842 Ga0466957_0002082 Ga0466957_0002082_8854_9705 279
315 3300045051 Ga0451576_0008472 Ga0451576_0008472_566_1408 279
316 3300045836 Ga0466958_0229106 Ga0466958_0229106_312_1163 279
317 3300046515 Ga0495620_0099673 Ga0495620_0099673_120_968 279
318 3300048920 Ga0496117_0101080 Ga0496117_0101080_117_968 279
319 3300048922 Ga0496119_0007331 Ga0496119_0007331_2406_3257 279
320 3300048925 Ga0496122_0007371 Ga0496122_0007371_1135_1986 279
321 3300049823 Ga0501044_0525071 Ga0501044_0525071_16_867 279
322 3300053125 Ga0500618_000605 Ga0500618_000605_2129_2980 279
323 3300053151 Ga0500604_0011363 Ga0500604_0011363_904_1752 279
324 3300053177 Ga0500636_0066000 Ga0500636_0066000_799_1650 279
325 iso_pu_bacteria 2511231028 2511393546 279
326 iso_pu_bacteria 2511231221 2512036704 279
327 iso_pu_bacteria 2513237104 2513721682 279
328 iso_pu_bacteria 2517093001 2517105001 279
329 iso_pu_bacteria 2537561587 2537877491 279
330 iso_pu_bacteria 2554235003 2554245476 279
331 iso_pu_bacteria 2558860242 2559296694 279
332 iso_pu_bacteria 2582581299 2585232688 279
333 iso_pu_bacteria 2599185210 2599602802 279
334 iso_pu_bacteria 2600255279 2601610435 279
335 iso_pu_bacteria 2600255308 2601747235 279
336 iso_pu_bacteria 2643221582 2643917325 279
337 iso_pu_bacteria 2643221693 2644520822 279
338 iso_pu_bacteria 2643221734 2644732950 279
339 iso_pu_bacteria 2721755755 2723846765 279
340 iso_pu_bacteria 2791355264 2793345743 279
341 iso_pu_bacteria 2808606387 2808987147 279
342 iso_pu_bacteria 2818991439 2819557515 279
343 iso_pu_bacteria 2838016132 2838020499 279
344 iso_pu_bacteria 2838048938 2838049940 279
345 iso_pu_bacteria 2838675328 2838677972 279
346 iso_pu_bacteria 2838714209 2838717122 279
347 iso_pu_bacteria 2838719591 2838722267 279
348 iso_pu_bacteria 2838724970 2838727871 279
349 iso_pu_bacteria 2841859092 2841861431 279
350 iso_pu_bacteria 2841957949 2841960421 279
351 iso_pu_bacteria 2842124991 2842127723 279
352 iso_pu_bacteria 2842130223 2842132865 279
353 iso_pu_bacteria 2842152218 2842154858 279
354 iso_pu_bacteria 2842170452 2842173357 279
355 iso_pu_bacteria 2842175837 2842178479 279
356 iso_pu_bacteria 2842187318 2842190230 279
357 iso_pu_bacteria 2842211629 2842214544 279
358 iso_pu_bacteria 2842224351 2842227263 279
359 iso_pu_bacteria 2842515876 2842518302 279
360 iso_pu_bacteria 2881665667 2881668917 279
361 iso_pu_bacteria 2899792073 2899796474 279
362 iso_pu_bacteria 2919114240 2919117380 279
363 iso_pu_bacteria 2926754445 2926758827 279
364 iso_pu_bacteria 2933006813 2933009760 279
365 iso_pu_bacteria 2933011516 2933013931 279
366 iso_pu_bacteria 2933594066 2933595741 279
367 iso_pu_bacteria 2935694250 2935702555 279
368 iso_pu_bacteria 2979089926 2979091312 279
369 iso_pu_bacteria 2979095461 2979096836 279
370 iso_pu_bacteria 2979100975 2979102556 279
371 iso_pu_bacteria 2984509177 2984509559 279
372 iso_pu_bacteria 2984518228 2984519743 279
373 iso_pu_bacteria 2984537506 2984537894 279
374 iso_pu_bacteria 2984601300 2984604639 279
375 iso_pu_bacteria 3000017691 3000020408 279
376 iso_pu_bacteria 3005594810 3005596780 279
377 iso_pu_bacteria 650716007 650843116 279
378 iso_pu_bacteria 8003570095 8003575462 279
379 iso_pu_bacteria 8005430974 8005436578 279
380 iso_pu_bacteria 8005619151 8005624243 279
381 iso_pu_bacteria 8005626139 8005629509 279
382 iso_pu_bacteria 8006964411 8006970410 279
383 iso_pu_bacteria 8054002106 8054005278 279
384 3300003214 JGI25165J46597_1000372 JGI25165J46597_100037212 280
385 3300003214 JGI25165J46597_1007625 JGI25165J46597_10076252 280
386 3300005459 Ga0068867_100090481 Ga0068867_1000904812 280
387 3300005548 Ga0070665_100083416 Ga0070665_1000834162 280
388 3300005563 Ga0068855_100133933 Ga0068855_1001339332 280
389 3300005616 Ga0068852_100403498 Ga0068852_1004034982 280
390 3300006042 Ga0075368_10050824 Ga0075368_100508242 280
391 3300006051 Ga0075364_10033420 Ga0075364_100334202 280
392 3300006051 Ga0075364_10185728 Ga0075364_101857282 280
393 3300006178 Ga0075367_10011472 Ga0075367_100114725 280
394 3300006195 Ga0075366_10137917 Ga0075366_101379172 280
395 3300009093 Ga0105240_10000217 Ga0105240_1000021729 280
396 3300009148 Ga0105243_10425834 Ga0105243_104258342 280
397 3300009545 Ga0105237_10000978 Ga0105237_100009789 280
398 3300010375 Ga0105239_10009668 Ga0105239_100096685 280
399 3300011119 Ga0105246_10160270 Ga0105246_101602702 280
400 3300013104 Ga0157370_10005183 Ga0157370_100051837 280
401 3300013105 Ga0157369_10021904 Ga0157369_100219045 280
402 3300013306 Ga0163162_10229727 Ga0163162_102297272 280
403 3300015261 Ga0182006_1090140 Ga0182006_10901402 280
404 3300015262 Ga0182007_10011070 Ga0182007_100110702 280
405 3300021361 Ga0213872_10058442 Ga0213872_100584422 280
406 3300025253 Ga0209677_100826 Ga0209677_10082615 280
407 3300025261 Ga0209233_1000324 Ga0209233_100032411 280
408 3300025261 Ga0209233_1000330 Ga0209233_100033022 280
409 3300025261 Ga0209233_1008499 Ga0209233_10084992 280
410 3300025297 Ga0209758_1054707 Ga0209758_10547072 280
411 3300025904 Ga0207647_10081616 Ga0207647_100816162 280
412 3300025907 Ga0207645_10081588 Ga0207645_100815882 280
413 3300025911 Ga0207654_10155102 Ga0207654_101551022 280
414 3300025913 Ga0207695_10001205 Ga0207695_1000120529 280
415 3300025914 Ga0207671_10000793 Ga0207671_1000079313 280
416 3300025933 Ga0207706_10129092 Ga0207706_101290922 280
417 3300025941 Ga0207711_10463525 Ga0207711_104635252 280
418 3300025949 Ga0207667_10146494 Ga0207667_101464942 280
419 3300025972 Ga0207668_10089600 Ga0207668_100896002 280
420 3300025981 Ga0207640_10048081 Ga0207640_100480812 280
421 3300026089 Ga0207648_10134408 Ga0207648_101344082 280
422 3300026116 Ga0207674_10082312 Ga0207674_100823124 280
423 3300026118 Ga0207675_100247727 Ga0207675_1002477272 280
424 3300026121 Ga0207683_10068199 Ga0207683_100681993 280
425 3300026142 Ga0207698_10456296 Ga0207698_104562962 280
426 3300028379 Ga0268266_10082713 Ga0268266_100827133 280
427 3300028794 Ga0307515_10009236 Ga0307515_1000923612 280
428 3300031456 Ga0307513_10003915 Ga0307513_1000391514 280
429 3300035171 Ga0373946_0181048 Ga0373946_0181048_73_918 280
430 3300035692 Ga0373935_0142994 Ga0373935_0142994_317_1162 280
431 3300035695 Ga0373927_0000581 Ga0373927_0000581_4071_4916 280
432 3300037418 Ga0395900_0039934 Ga0395900_0039934_76_927 280
433 3300037418 Ga0395900_0041420 Ga0395900_0041420_3268_4119 280
434 3300037466 Ga0395898_0247312 Ga0395898_0247312_708_1559 280
435 3300037471 Ga0395905_0047480 Ga0395905_0047480_2691_3542 280
436 3300038443 Ga0395901_0011805 Ga0395901_0011805_1938_2789 280
437 3300039447 Ga0436361_1160430 Ga0436361_1160430_1853_2731 280
438 3300044658 Ga0466972_0018693 Ga0466972_0018693_384_1235 280
439 3300046459 Ga0495629_0009432 Ga0495629_0009432_388_1230 280
440 3300046460 Ga0495638_0029107 Ga0495638_0029107_2687_3538 280
441 3300046476 Ga0495662_0004214 Ga0495662_0004214_1981_2823 280
442 3300046512 Ga0495610_0078559 Ga0495610_0078559_124_975 280
443 3300046524 Ga0495648_0085494 Ga0495648_0085494_64_906 280
444 3300046557 Ga0495622_0001480 Ga0495622_0001480_10912_11754 280
445 3300046616 Ga0495668_0229121 Ga0495668_0229121_19_870 280
446 3300046660 Ga0495625_0041169 Ga0495625_0041169_1812_2654 280
447 3300046675 Ga0495657_0055012 Ga0495657_0055012_1194_2036 280
448 3300046809 Ga0495600_0177183 Ga0495600_0177183_148_990 280
449 3300047317 Ga0495604_0000886 Ga0495604_0000886_10406_11248 280
450 3300048920 Ga0496117_0002969 Ga0496117_0002969_1707_2549 280
451 3300048921 Ga0496118_0013244 Ga0496118_0013244_5091_5933 280
452 3300048922 Ga0496119_0008586 Ga0496119_0008586_4851_5693 280
453 3300048923 Ga0496120_0004196 Ga0496120_0004196_5012_5854 280
454 3300048924 Ga0496121_0001476 Ga0496121_0001476_28844_29686 280
455 3300048925 Ga0496122_0003859 Ga0496122_0003859_4733_5575 280
456 3300048925 Ga0496122_0007025 Ga0496122_0007025_10436_11278 280
457 3300048926 Ga0496123_0021255 Ga0496123_0021255_2211_3053 280
458 3300048927 Ga0496124_0025190 Ga0496124_0025190_2171_3013 280
459 3300049573 Ga0501037_0072493 Ga0501037_0072493_1027_1881 280
460 3300050490 nmdc:mga03n38_90357_c1 nmdc:mga03n38_90357_c1_212_1063 280
461 3300053142 Ga0500577_0087440 Ga0500577_0087440_289_1140 280
462 3300053148 Ga0500590_030908 Ga0500590_030908_668_1510 280
463 3300053158 Ga0500627_0008746 Ga0500627_0008746_2648_3499 280
464 3300053177 Ga0500636_0000001 Ga0500636_0000001_67718_68560 280
465 3300053177 Ga0500636_0001623 Ga0500636_0001623_7482_8324 280
466 iso_pu_bacteria 2513237144 2513910746 280
467 iso_pu_bacteria 2516143018 2516207165 280
468 iso_pu_bacteria 2519899620 2520377720 280
469 iso_pu_bacteria 2690316117 2692318302 280
470 iso_pu_bacteria 2718217882 2719184854 280
471 iso_pu_bacteria 2718218009 2719728874 280
472 iso_pu_bacteria 2718218232 2720610222 280
473 iso_pu_bacteria 2718218233 2720617646 280
474 iso_pu_bacteria 2718218235 2720628788 280
475 iso_pu_bacteria 2718218269 2720772737 280
476 iso_pu_bacteria 2718218363 2721144565 280
477 iso_pu_bacteria 2718218365 2721156057 280
478 iso_pu_bacteria 2718218366 2721161935 280
479 iso_pu_bacteria 2721755514 2722843080 280
480 iso_pu_bacteria 2721755556 2723030177 280
481 iso_pu_bacteria 2721755685 2723569776 280
482 iso_pu_bacteria 2721755810 2724041899 280
483 iso_pu_bacteria 2721755819 2724092766 280
484 iso_pu_bacteria 2721755822 2724101323 280
485 iso_pu_bacteria 2721755823 2724113153 280
486 iso_pu_bacteria 2728369352 2730110710 280
487 iso_pu_bacteria 2728369365 2730160969 280
488 iso_pu_bacteria 2728369397 2730295590 280
489 iso_pu_bacteria 2751185821 2753462806 280
490 iso_pu_bacteria 2765235802 2765468811 280
491 iso_pu_bacteria 2767802442 2770198475 280
492 iso_pu_bacteria 2775507049 2776910701 280
493 iso_pu_bacteria 2791355094 2792640927 280
494 iso_pu_bacteria 2791355261 2793329900 280
495 iso_pu_bacteria 2791355265 2793354434 280
496 iso_pu_bacteria 2802429605 2805928354 280
497 iso_pu_bacteria 2802429606 2805935165 280
498 iso_pu_bacteria 2818991467 2819717336 280
499 iso_pu_bacteria 2838668709 2838669287 280
500 iso_pu_bacteria 2838701080 2838701659 280
501 iso_pu_bacteria 2842192696 2842195927 280
502 iso_pu_bacteria 2842205361 2842209910 280
503 iso_pu_bacteria 2842250916 2842251917 280
504 iso_pu_bacteria 2842264693 2842264811 280
505 iso_pu_bacteria 2842278818 2842283364 280
506 iso_pu_bacteria 2842317721 2842320319 280
507 iso_pu_bacteria 2842402390 2842405949 280
508 iso_pu_bacteria 2842409023 2842412533 280
509 iso_pu_bacteria 2842415677 2842419177 280
510 iso_pu_bacteria 2842428310 2842429136 280
511 iso_pu_bacteria 2842434925 2842435749 280
512 iso_pu_bacteria 2842441272 2842441389 280
513 iso_pu_bacteria 2842469257 2842470079 280
514 iso_pu_bacteria 2842489311 2842489896 280
515 iso_pu_bacteria 2842495871 2842498060 280
516 iso_pu_bacteria 2847417321 2847423194 280
517 iso_pu_bacteria 2848992105 2848997410 280
518 iso_pu_bacteria 2855872281 2855874183 280
519 iso_pu_bacteria 2996893221 2996894512 280
520 iso_pu_bacteria 3000405567 3000406295 280
521 iso_pu_bacteria 643692032 643822487 280
522 iso_pu_bacteria 8005258706 8005263786 280
523 iso_pu_bacteria 8005289223 8005290845 280
524 iso_pu_bacteria 8005382845 8005383385 280
525 iso_pu_bacteria 8005395548 8005398979 280
526 iso_pu_bacteria 8024501048 8024504197 280
527 iso_pu_bacteria 8056382006 8056382177 280
528 2010549000 RicEn_C2804 RicEn_51530 281
529 3300001989 JGI24739J22299_10041822 JGI24739J22299_100418222 281
530 3300002773 JGI25152J39213_1011381 JGI25152J39213_10113812 281
531 3300003187 JGI25151J46595_10000867 JGI25151J46595_1000086710 281
532 3300003187 JGI25151J46595_10031432 JGI25151J46595_100314322 281
533 3300003215 JGI25153J46596_10011736 JGI25153J46596_100117362 281
534 3300003354 JGI25160J50197_1000203 JGI25160J50197_100020311 281
535 3300003354 JGI25160J50197_1002223 JGI25160J50197_10022236 281
536 3300003374 JGI25161J50226_1000570 JGI25161J50226_10005708 281
537 3300003771 Ga0055526_1000308 Ga0055526_100030813 281
538 3300003771 Ga0055526_1002146 Ga0055526_10021466 281
539 3300003771 Ga0055526_1009056 Ga0055526_10090565 281
540 3300003775 Ga0055524_1004129 Ga0055524_10041295 281
541 3300003781 Ga0055536_1000640 Ga0055536_10006405 281
542 3300003790 Ga0055528_1000054 Ga0055528_100005438 281
543 3300003790 Ga0055528_1001635 Ga0055528_10016355 281
544 3300003791 Ga0055530_10026839 Ga0055530_100268392 281
545 3300003792 Ga0055540_1008780 Ga0055540_10087802 281
546 3300003792 Ga0055540_1032064 Ga0055540_10320642 281
547 3300003794 Ga0055531_10004096 Ga0055531_1000409610 281
548 3300003856 Ga0058692_1001981 Ga0058692_10019814 281
549 3300003856 Ga0058692_1006050 Ga0058692_10060502 281
550 3300004625 Ga0055543_1000558 Ga0055543_10005582 281
551 3300004625 Ga0055543_1001165 Ga0055543_10011655 281
552 3300005262 Ga0065165_1000672 Ga0065165_100067211 281
553 3300005262 Ga0065165_1008544 Ga0065165_10085442 281
554 3300005331 Ga0070670_100076245 Ga0070670_1000762452 281
555 3300005335 Ga0070666_10025758 Ga0070666_100257581 281
556 3300005338 Ga0068868_100254226 Ga0068868_1002542262 281
557 3300005344 Ga0070661_100215985 Ga0070661_1002159852 281
558 3300005347 Ga0070668_100012960 Ga0070668_1000129602 281
559 3300005353 Ga0070669_100013332 Ga0070669_1000133323 281
560 3300005367 Ga0070667_100081761 Ga0070667_1000817612 281
561 3300005455 Ga0070663_100316409 Ga0070663_1003164092 281
562 3300005456 Ga0070678_100292621 Ga0070678_1002926212 281
563 3300005457 Ga0070662_100035439 Ga0070662_1000354392 281
564 3300005539 Ga0068853_100014109 Ga0068853_1000141093 281
565 3300005548 Ga0070665_100023970 Ga0070665_1000239703 281
566 3300005548 Ga0070665_100026871 Ga0070665_1000268715 281
567 3300005563 Ga0068855_100248883 Ga0068855_1002488832 281
568 3300005577 Ga0068857_100080305 Ga0068857_1000803052 281
569 3300005578 Ga0068854_100079341 Ga0068854_1000793413 281
570 3300005614 Ga0068856_100226958 Ga0068856_1002269582 281
571 3300005616 Ga0068852_100000915 Ga0068852_1000009157 281
572 3300005617 Ga0068859_100336297 Ga0068859_1003362972 281
573 3300005719 Ga0068861_100131658 Ga0068861_1001316582 281
574 3300005842 Ga0068858_100059748 Ga0068858_1000597482 281
575 3300005843 Ga0068860_100000223 Ga0068860_10000022360 281
576 3300005843 Ga0068860_100357463 Ga0068860_1003574632 281
577 3300006038 Ga0075365_10013583 Ga0075365_100135834 281
578 3300006038 Ga0075365_10114102 Ga0075365_101141022 281
579 3300006038 Ga0075365_10280843 Ga0075365_102808432 281
580 3300006042 Ga0075368_10024453 Ga0075368_100244532 281
581 3300006048 Ga0075363_100017924 Ga0075363_1000179243 281
582 3300006051 Ga0075364_10005543 Ga0075364_100055434 281
583 3300006177 Ga0075362_10006562 Ga0075362_100065622 281
584 3300006177 Ga0075362_10018491 Ga0075362_100184912 281
585 3300006177 Ga0075362_10126842 Ga0075362_101268421 281
586 3300006178 Ga0075367_10000241 Ga0075367_1000024116 281
587 3300006178 Ga0075367_10004266 Ga0075367_100042663 281
588 3300006178 Ga0075367_10019149 Ga0075367_100191493 281
589 3300006178 Ga0075367_10078466 Ga0075367_100784662 281
590 3300006178 Ga0075367_10148372 Ga0075367_101483722 281
591 3300006178 Ga0075367_10198256 Ga0075367_101982562 281
592 3300006186 Ga0075369_10009321 Ga0075369_100093212 281
593 3300006186 Ga0075369_10015713 Ga0075369_100157132 281
594 3300006186 Ga0075369_10025405 Ga0075369_100254052 281
595 3300006186 Ga0075369_10044681 Ga0075369_100446812 281
596 3300006186 Ga0075369_10059305 Ga0075369_100593052 281
597 3300006195 Ga0075366_10038290 Ga0075366_100382902 281
598 3300006195 Ga0075366_10050002 Ga0075366_100500022 281
599 3300006195 Ga0075366_10078718 Ga0075366_100787182 281
600 3300006353 Ga0075370_10006474 Ga0075370_100064742 281
601 3300006931 Ga0097620_100336301 Ga0097620_1003363012 281
602 3300006942 Ga0099824_1032205 Ga0099824_10322052 281
603 3300006946 Ga0079104_1003957 Ga0079104_10039575 281
604 3300006948 Ga0099826_10000665 Ga0099826_100006659 281
605 3300006948 Ga0099826_10171592 Ga0099826_101715922 281
606 3300009148 Ga0105243_10009663 Ga0105243_100096634 281
607 3300009148 Ga0105243_10025719 Ga0105243_100257192 281
608 3300009174 Ga0105241_10011661 Ga0105241_100116614 281
609 3300009177 Ga0105248_10002569 Ga0105248_1000256914 281
610 3300009551 Ga0105238_10007717 Ga0105238_100077173 281
611 3300010375 Ga0105239_10024076 Ga0105239_100240762 281
612 3300011119 Ga0105246_10004096 Ga0105246_100040963 281
613 3300011119 Ga0105246_10156773 Ga0105246_101567732 281
614 3300013100 Ga0157373_10004938 Ga0157373_100049389 281
615 3300013102 Ga0157371_10000002 Ga0157371_10000002354 281
616 3300013104 Ga0157370_10003627 Ga0157370_1000362711 281
617 3300013296 Ga0157374_10119829 Ga0157374_101198292 281
618 3300013297 Ga0157378_10039964 Ga0157378_100399644 281
619 3300013297 Ga0157378_10325447 Ga0157378_103254472 281
620 3300013306 Ga0163162_10085820 Ga0163162_100858202 281
621 3300014325 Ga0163163_10007929 Ga0163163_100079292 281
622 3300021320 Ga0214544_1000018 Ga0214544_1000018170 281
623 3300021321 Ga0214542_1000307 Ga0214542_100030773 281
624 3300021327 Ga0214543_1000195 Ga0214543_100019514 281
625 3300021327 Ga0214543_1011326 Ga0214543_10113266 281
626 3300022739 Ga0228711_1004587 Ga0228711_100458716 281
627 3300022740 Ga0228710_1004744 Ga0228710_100474417 281
628 3300025208 Ga0209436_102573 Ga0209436_1025734 281
629 3300025245 Ga0207425_1022250 Ga0207425_10222501 281
630 3300025253 Ga0209677_102046 Ga0209677_1020464 281
631 3300025254 Ga0209148_1000260 Ga0209148_100026057 281
632 3300025258 Ga0209129_1000669 Ga0209129_100066913 281
633 3300025258 Ga0209129_1014747 Ga0209129_10147472 281
634 3300025261 Ga0209233_1005862 Ga0209233_10058622 281
635 3300025273 Ga0209673_1000067 Ga0209673_1000067195 281
636 3300025273 Ga0209673_1000291 Ga0209673_100029146 281
637 3300025273 Ga0209673_1007600 Ga0209673_10076002 281
638 3300025273 Ga0209673_1013841 Ga0209673_10138412 281
639 3300025284 Ga0209130_1000242 Ga0209130_100024230 281
640 3300025292 Ga0209676_1001988 Ga0209676_10019886 281
641 3300025292 Ga0209676_1051477 Ga0209676_10514771 281
642 3300025294 Ga0209025_1000240 Ga0209025_1000240149 281
643 3300025294 Ga0209025_1000430 Ga0209025_100043034 281
644 3300025294 Ga0209025_1001534 Ga0209025_10015348 281
645 3300025295 Ga0209564_1000092 Ga0209564_1000092195 281
646 3300025295 Ga0209564_1000338 Ga0209564_100033879 281
647 3300025295 Ga0209564_1000876 Ga0209564_10008769 281
648 3300025297 Ga0209758_1000490 Ga0209758_100049017 281
649 3300025297 Ga0209758_1008376 Ga0209758_10083766 281
650 3300025298 Ga0209050_1004950 Ga0209050_10049504 281
651 3300025298 Ga0209050_1010402 Ga0209050_10104022 281
652 3300025299 Ga0209256_1000788 Ga0209256_10007883 281
653 3300025299 Ga0209256_1001843 Ga0209256_10018432 281
654 3300025299 Ga0209256_1002067 Ga0209256_10020678 281
655 3300025299 Ga0209256_1019508 Ga0209256_10195082 281
656 3300025302 Ga0207426_1000075 Ga0207426_1000075249 281
657 3300025302 Ga0207426_1000483 Ga0207426_100048350 281
658 3300025303 Ga0209051_1000502 Ga0209051_100050228 281
659 3300025303 Ga0209051_1002802 Ga0209051_10028027 281
660 3300025303 Ga0209051_1008011 Ga0209051_10080115 281
661 3300025304 Ga0209257_1003568 Ga0209257_10035686 281
662 3300025304 Ga0209257_1003646 Ga0209257_10036466 281
663 3300025304 Ga0209257_1004238 Ga0209257_10042385 281
664 3300025304 Ga0209257_1004771 Ga0209257_10047714 281
665 3300025903 Ga0207680_10422073 Ga0207680_104220731 281
666 3300025904 Ga0207647_10001845 Ga0207647_1000184514 281
667 3300025911 Ga0207654_10008209 Ga0207654_100082093 281
668 3300025911 Ga0207654_10014807 Ga0207654_100148072 281
669 3300025913 Ga0207695_10000163 Ga0207695_10000163172 281
670 3300025914 Ga0207671_10006375 Ga0207671_100063755 281
671 3300025914 Ga0207671_10169932 Ga0207671_101699322 281
672 3300025923 Ga0207681_10038709 Ga0207681_100387092 281
673 3300025924 Ga0207694_10046666 Ga0207694_100466663 281
674 3300025925 Ga0207650_10193811 Ga0207650_101938112 281
675 3300025931 Ga0207644_10126543 Ga0207644_101265432 281
676 3300025935 Ga0207709_10030401 Ga0207709_100304012 281
677 3300025949 Ga0207667_10230708 Ga0207667_102307082 281
678 3300025972 Ga0207668_10159844 Ga0207668_101598442 281
679 3300025981 Ga0207640_10018951 Ga0207640_100189514 281
680 3300026023 Ga0207677_10025782 Ga0207677_100257824 281
681 3300026035 Ga0207703_10395554 Ga0207703_103955542 281
682 3300026041 Ga0207639_10033648 Ga0207639_100336482 281
683 3300026067 Ga0207678_10035731 Ga0207678_100357314 281
684 3300026116 Ga0207674_10027216 Ga0207674_100272164 281
685 3300026118 Ga0207675_100126661 Ga0207675_1001266613 281
686 3300027111 Ga0209281_1000491 Ga0209281_100049132 281
687 3300027111 Ga0209281_1000981 Ga0209281_10009818 281
688 3300027296 Ga0209389_1000075 Ga0209389_100007540 281
689 3300027312 Ga0209371_1000003 Ga0209371_1000003458 281
690 3300027312 Ga0209371_1000324 Ga0209371_100032440 281
691 3300027357 Ga0209589_1000085 Ga0209589_100008539 281
692 3300027361 Ga0209489_100062 Ga0209489_10006271 281
693 3300027666 Ga0209282_1000108 Ga0209282_100010826 281
694 3300027666 Ga0209282_1000604 Ga0209282_10006049 281
695 3300027666 Ga0209282_1145924 Ga0209282_11459242 281
696 3300028379 Ga0268266_10109122 Ga0268266_101091222 281
697 3300028379 Ga0268266_10315994 Ga0268266_103159942 281
698 3300028380 Ga0268265_10034463 Ga0268265_100344632 281
699 3300028381 Ga0268264_10000119 Ga0268264_10000119142 281
700 3300028381 Ga0268264_10360012 Ga0268264_103600122 281
701 3300028794 Ga0307515_10001999 Ga0307515_1000199939 281
702 3300030500 Ga0268256_1000004 Ga0268256_1000004592 281
703 3300030500 Ga0268256_1001615 Ga0268256_10016158 281
704 3300030745 Ga0316182_1446202 Ga0316182_14462022 281
705 3300031507 Ga0307509_10216605 Ga0307509_102166052 281
706 3300031507 Ga0307509_10266616 Ga0307509_102666162 281
707 3300031616 Ga0307508_10001261 Ga0307508_100012617 281
708 3300031616 Ga0307508_10108467 Ga0307508_101084671 281
709 3300031730 Ga0307516_10085368 Ga0307516_100853683 281
710 3300031967 Ga0315914_1000427 Ga0315914_100042729 281
711 3300032002 Ga0307416_100579733 Ga0307416_1005797331 281
712 3300033430 Ga0315913_1001358 Ga0315913_100135815 281
713 3300033464 Ga0315915_1000032 Ga0315915_100003271 281
714 3300035692 Ga0373935_0007083 Ga0373935_0007083_3518_4372 281
715 3300035695 Ga0373927_0008059 Ga0373927_0008059_2981_3835 281
716 3300039447 Ga0436361_0117844 Ga0436361_0117844_1419_2267 281
717 3300041413 Ga0439465_0001132 Ga0439465_0001132_4594_5448 281
718 3300041498 Ga0451841_0655033 Ga0451841_0655033_162_1028 281
719 3300041511 Ga0451855_1487574 Ga0451855_1487574_35_901 281
720 3300045051 Ga0451576_0027482 Ga0451576_0027482_1928_2800 281
721 3300046474 Ga0495605_0005741 Ga0495605_0005741_4300_5166 281
722 3300046492 Ga0495585_0027986 Ga0495585_0027986_1297_2160 281
723 3300046501 Ga0495607_0025260 Ga0495607_0025260_274_1140 281
724 3300046506 Ga0495583_0001811 Ga0495583_0001811_4951_5802 281
725 3300046507 Ga0495606_0010507 Ga0495606_0010507_4942_5808 281
726 3300046507 Ga0495606_0026163 Ga0495606_0026163_365_1219 281
727 3300046512 Ga0495610_0037467 Ga0495610_0037467_1096_1962 281
728 3300046513 Ga0495616_0122478 Ga0495616_0122478_65_919 281
729 3300046515 Ga0495620_0001877 Ga0495620_0001877_6546_7412 281
730 3300046518 Ga0495631_0022769 Ga0495631_0022769_1017_1880 281
731 3300046518 Ga0495631_0059438 Ga0495631_0059438_610_1476 281
732 3300046519 Ga0495632_0037014 Ga0495632_0037014_1519_2382 281
733 3300046522 Ga0495643_0006040 Ga0495643_0006040_3643_4509 281
734 3300046523 Ga0495644_0047166 Ga0495644_0047166_85_951 281
735 3300046524 Ga0495648_0015554 Ga0495648_0015554_4396_5262 281
736 3300046530 Ga0495654_0048553 Ga0495654_0048553_238_1104 281
737 3300046538 Ga0495609_0056542 Ga0495609_0056542_797_1663 281
738 3300046542 Ga0495597_0011739 Ga0495597_0011739_193_1047 281
739 3300046542 Ga0495597_0031607 Ga0495597_0031607_1070_1936 281
740 3300046616 Ga0495668_0006776 Ga0495668_0006776_4867_5733 281
741 3300046616 Ga0495668_0033505 Ga0495668_0033505_94_957 281
742 3300046616 Ga0495668_0054192 Ga0495668_0054192_1167_2021 281
743 3300046660 Ga0495625_0003205 Ga0495625_0003205_15485_16348 281
744 3300046660 Ga0495625_0010911 Ga0495625_0010911_4253_5119 281
745 3300046691 Ga0495670_0007464 Ga0495670_0007464_1760_2626 281
746 3300046694 Ga0495649_0008058 Ga0495649_0008058_883_1749 281
747 3300046694 Ga0495649_0093027 Ga0495649_0093027_364_1218 281
748 3300046810 Ga0495660_0008181 Ga0495660_0008181_4569_5435 281
749 3300047318 Ga0495636_0088757 Ga0495636_0088757_438_1304 281
750 3300047323 Ga0495683_0030310 Ga0495683_0030310_608_1462 281
751 3300047323 Ga0495683_0103540 Ga0495683_0103540_253_1119 281
752 3300047443 Ga0495687_010309 Ga0495687_010309_447_1301 281
753 3300047443 Ga0495687_102321 Ga0495687_102321_190_1056 281
754 3300047470 Ga0495681_0128145 Ga0495681_0128145_88_954 281
755 3300047472 Ga0495686_0008180 Ga0495686_0008180_1933_2799 281
756 3300048090 Ga0495615_0003234 Ga0495615_0003234_1298_2164 281
757 3300048091 Ga0495626_0024458 Ga0495626_0024458_192_1058 281
758 3300048091 Ga0495626_0082107 Ga0495626_0082107_360_1214 281
759 3300048904 Ga0496101_0130822 Ga0496101_0130822_336_1190 281
760 3300048905 Ga0496102_0248885 Ga0496102_0248885_577_1431 281
761 3300048906 Ga0496103_0004367 Ga0496103_0004367_3495_4349 281
762 3300048909 Ga0496106_0251004 Ga0496106_0251004_244_1098 281
763 3300048910 Ga0496107_0160238 Ga0496107_0160238_647_1501 281
764 3300048911 Ga0496108_0090757 Ga0496108_0090757_840_1694 281
765 3300048915 Ga0496112_0056209 Ga0496112_0056209_741_1595 281
766 3300048916 Ga0496113_0093919 Ga0496113_0093919_772_1626 281
767 3300048918 Ga0496115_0345506 Ga0496115_0345506_225_1079 281
768 3300048919 Ga0496116_0015008 Ga0496116_0015008_337_1188 281
769 3300048920 Ga0496117_0000016 Ga0496117_0000016_221234_222085 281
770 3300048920 Ga0496117_0017101 Ga0496117_0017101_3326_4180 281
771 3300048920 Ga0496117_0031041 Ga0496117_0031041_1894_2751 281
772 3300048921 Ga0496118_0000153 Ga0496118_0000153_38340_39191 281
773 3300048921 Ga0496118_0011952 Ga0496118_0011952_1892_2746 281
774 3300048921 Ga0496118_0041916 Ga0496118_0041916_583_1437 281
775 3300048921 Ga0496118_0083641 Ga0496118_0083641_1044_1895 281
776 3300048922 Ga0496119_0018968 Ga0496119_0018968_1802_2659 281
777 3300048922 Ga0496119_0040903 Ga0496119_0040903_2036_2887 281
778 3300048922 Ga0496119_0085742 Ga0496119_0085742_599_1453 281
779 3300048923 Ga0496120_0000660 Ga0496120_0000660_42580_43431 281
780 3300048923 Ga0496120_0106802 Ga0496120_0106802_384_1235 281
781 3300048924 Ga0496121_0135546 Ga0496121_0135546_859_1713 281
782 3300048925 Ga0496122_0000002 Ga0496122_0000002_221895_222746 281
783 3300048925 Ga0496122_0002358 Ga0496122_0002358_25101_25958 281
784 3300048925 Ga0496122_0026867 Ga0496122_0026867_3706_4596 281
785 3300048925 Ga0496122_0042303 Ga0496122_0042303_816_1673 281
786 3300048926 Ga0496123_0000002 Ga0496123_0000002_1588937_1589788 281
787 3300048926 Ga0496123_0000002 Ga0496123_0000002_221895_222746 281
788 3300048926 Ga0496123_0017939 Ga0496123_0017939_3170_4027 281
789 3300048927 Ga0496124_0035680 Ga0496124_0035680_1541_2395 281
790 3300048927 Ga0496124_0405016 Ga0496124_0405016_72_923 281
791 3300048927 Ga0496124_0405026 Ga0496124_0405026_23_874 281
792 3300048928 Ga0496125_0020431 Ga0496125_0020431_3461_4312 281
793 3300048928 Ga0496125_0058623 Ga0496125_0058623_2016_2870 281
794 3300048928 Ga0496125_0080584 Ga0496125_0080584_1208_2065 281
795 3300048929 Ga0496126_0096902 Ga0496126_0096902_223_1077 281
796 3300050489 nmdc:mga03683_183910_c1 nmdc:mga03683_183910_c1_54_908 281
797 3300050489 nmdc:mga03683_78992_c1 nmdc:mga03683_78992_c1_385_1236 281
798 3300050490 nmdc:mga03n38_5449_c1 nmdc:mga03n38_5449_c1_386_1237 281
799 3300050491 nmdc:mga00v17_290130_c1 nmdc:mga00v17_290130_c1_80_931 281
800 3300050491 nmdc:mga00v17_3_c1 nmdc:mga00v17_3_c1_1108_1959 281
801 3300050492 nmdc:mga0yw44_53397_c1 nmdc:mga0yw44_53397_c1_1250_2110 281
802 3300050492 nmdc:mga0yw44_9622_c1 nmdc:mga0yw44_9622_c1_23_874 281
803 3300050493 nmdc:mga0k408_25554_c1 nmdc:mga0k408_25554_c1_343_1203 281
804 3300050494 nmdc:mga06z11_113912_c1 nmdc:mga06z11_113912_c1_333_1187 281
805 3300050494 nmdc:mga06z11_147689_c1 nmdc:mga06z11_147689_c1_327_1178 281
806 3300050494 nmdc:mga06z11_15769_c1 nmdc:mga06z11_15769_c1_1884_2744 281
807 3300050494 nmdc:mga06z11_7336_c1 nmdc:mga06z11_7336_c1_3360_4217 281
808 3300050495 nmdc:mga04h51_2441_c1 nmdc:mga04h51_2441_c1_3324_4178 281
809 3300050496 nmdc:mga07m45_131581_c1 nmdc:mga07m45_131581_c1_312_1163 281
810 3300050496 nmdc:mga07m45_17763_c1 nmdc:mga07m45_17763_c1_284_1144 281
811 3300050516 nmdc:mga0sz30_20499_c1 nmdc:mga0sz30_20499_c1_1078_1935 281
812 3300050516 nmdc:mga0sz30_514_c1 nmdc:mga0sz30_514_c1_2431_3282 281
813 3300050516 nmdc:mga0sz30_54581_c1 nmdc:mga0sz30_54581_c1_463_1323 281
814 3300050516 nmdc:mga0sz30_57866_c1 nmdc:mga0sz30_57866_c1_121_972 281
815 3300053080 Ga0500635_0001856 Ga0500635_0001856_3140_3994 281
816 3300053083 Ga0495655_0041962 Ga0495655_0041962_54_908 281
817 3300053086 Ga0500578_0008264 Ga0500578_0008264_2664_3530 281
818 3300053086 Ga0500578_0102719 Ga0500578_0102719_568_1422 281
819 3300053107 Ga0500560_000351 Ga0500560_000351_286_1137 281
820 3300053109 Ga0500569_004067 Ga0500569_004067_1701_2567 281
821 3300053111 Ga0500572_004796 Ga0500572_004796_2119_2973 281
822 3300053118 Ga0500594_0005184 Ga0500594_0005184_88_951 281
823 3300053118 Ga0500594_0010645 Ga0500594_0010645_979_1845 281
824 3300053134 Ga0500658_0000280 Ga0500658_0000280_707_1573 281
825 3300053136 Ga0500559_0001421 Ga0500559_0001421_11688_12542 281
826 3300053137 Ga0500561_0000632 Ga0500561_0000632_944_1795 281
827 3300053153 Ga0500616_0005247 Ga0500616_0005247_699_1559 281
828 3300053153 Ga0500616_0005811 Ga0500616_0005811_1701_2567 281
829 3300053157 Ga0500624_000337 Ga0500624_000337_5412_6263 281
830 3300053163 Ga0500639_063128 Ga0500639_063128_1039_1893 281
831 3300053177 Ga0500636_0001440 Ga0500636_0001440_9270_10124 281
832 iso_pu_bacteria 2508501050 2508731296 281
833 iso_pu_bacteria 2509276021 2509390524 281
834 iso_pu_bacteria 2509276033 2509442278 281
835 iso_pu_bacteria 2510065019 2510136127 281
836 iso_pu_bacteria 2510065057 2510306058 281
837 iso_pu_bacteria 2510461076 2510892870 281
838 iso_pu_bacteria 2510917028 2511184943 281
839 iso_pu_bacteria 2511231052 2511500088 281
840 iso_pu_bacteria 2512047086 2512530311 281
841 iso_pu_bacteria 2512875026 2512975255 281
842 iso_pu_bacteria 2513237084 2513568428 281
843 iso_pu_bacteria 2513237085 2513579473 281
844 iso_pu_bacteria 2513237086 2513584461 281
845 iso_pu_bacteria 2513237089 2513606798 281
846 iso_pu_bacteria 2513237091 2513619599 281
847 iso_pu_bacteria 2513237093 2513630715 281
848 iso_pu_bacteria 2513237103 2513711933 281
849 iso_pu_bacteria 2513237138 2513867675 281
850 iso_pu_bacteria 2513237140 2513883177 281
851 iso_pu_bacteria 2513237143 2513904259 281
852 iso_pu_bacteria 2513237146 2513929322 281
853 iso_pu_bacteria 2513237160 2514006992 281
854 iso_pu_bacteria 2513237162 2514018262 281
855 iso_pu_bacteria 2515075009 2515108946 281
856 iso_pu_bacteria 2515154113 2515633049 281
857 iso_pu_bacteria 2515154114 2515640254 281
858 iso_pu_bacteria 2515154116 2515656335 281
859 iso_pu_bacteria 2515154134 2515738481 281
860 iso_pu_bacteria 2516653046 2516897619 281
861 iso_pu_bacteria 2516653077 2517040887 281
862 iso_pu_bacteria 2516653085 2517080518 281
863 iso_pu_bacteria 2517093000 2517098487 281
864 iso_pu_bacteria 2517287029 2517409971 281
865 iso_pu_bacteria 2517487022 2517566659 281
866 iso_pu_bacteria 2524023207 2524453365 281
867 iso_pu_bacteria 2529292951 2530649113 281
868 iso_pu_bacteria 2551306084 2551674844 281
869 iso_pu_bacteria 2551306085 2551687096 281
870 iso_pu_bacteria 2551306086 2551692314 281
871 iso_pu_bacteria 2551306087 2551697284 281
872 iso_pu_bacteria 2551306089 2551714293 281
873 iso_pu_bacteria 2551306090 2551720038 281
874 iso_pu_bacteria 2551306090 2551723545 281
875 iso_pu_bacteria 2551306091 2551725208 281
876 iso_pu_bacteria 2551306092 2551737645 281
877 iso_pu_bacteria 2551306093 2551739931 281
878 iso_pu_bacteria 2558860100 2558864942 281
879 iso_pu_bacteria 2582581867 2585403796 281
880 iso_pu_bacteria 2585427526 2585526842 281
881 iso_pu_bacteria 2585427528 2585542396 281
882 iso_pu_bacteria 2585427590 2585823287 281
883 iso_pu_bacteria 2585427593 2585841868 281
884 iso_pu_bacteria 2599185170 2599419315 281
885 iso_pu_bacteria 2599185352 2600197377 281
886 iso_pu_bacteria 2615840624 2616298021 281
887 iso_pu_bacteria 2643221723 2644673430 281
888 iso_pu_bacteria 2718217927 2719389546 281
889 iso_pu_bacteria 2718217997 2719668854 281
890 iso_pu_bacteria 2718218199 2720489547 281
891 iso_pu_bacteria 2718218423 2721402314 281
892 iso_pu_bacteria 2721755684 2723564582 281
893 iso_pu_bacteria 2721755809 2724036147 281
894 iso_pu_bacteria 2724679232 2725949396 281
895 iso_pu_bacteria 2738541333 2739038470 281
896 iso_pu_bacteria 2751185800 2753357768 281
897 iso_pu_bacteria 2758568016 2758638016 281
898 iso_pu_bacteria 2758568016 2758638027 281
899 iso_pu_bacteria 2765235942 2766068866 281
900 iso_pu_bacteria 2773857925 2774873150 281
901 iso_pu_bacteria 2791355082 2792583718 281
902 iso_pu_bacteria 2791355091 2792619359 281
903 iso_pu_bacteria 2791355092 2792627131 281
904 iso_pu_bacteria 2791355256 2793299125 281
905 iso_pu_bacteria 2791355259 2793315026 281
906 iso_pu_bacteria 2791355262 2793333867 281
907 iso_pu_bacteria 2791355263 2793342279 281
908 iso_pu_bacteria 2791355266 2793360284 281
909 iso_pu_bacteria 2791355267 2793370863 281
910 iso_pu_bacteria 2802428858 2802720141 281
911 iso_pu_bacteria 2802428859 2802723828 281
912 iso_pu_bacteria 2802428860 2802734153 281
913 iso_pu_bacteria 2802428861 2802739615 281
914 iso_pu_bacteria 2802428862 2802745999 281
915 iso_pu_bacteria 2802428863 2802753398 281
916 iso_pu_bacteria 2802429268 2804754993 281
917 iso_pu_bacteria 2802429633 2806048813 281
918 iso_pu_bacteria 2802429634 2806056016 281
919 iso_pu_bacteria 2802429635 2806062837 281
920 iso_pu_bacteria 2802429636 2806070267 281
921 iso_pu_bacteria 2802429637 2806077253 281
922 iso_pu_bacteria 2838022645 2838025116 281
923 iso_pu_bacteria 2838035591 2838040152 281
924 iso_pu_bacteria 2838042994 2838044094 281
925 iso_pu_bacteria 2838061910 2838062208 281
926 iso_pu_bacteria 2838068647 2838069434 281
927 iso_pu_bacteria 2838074704 2838078640 281
928 iso_pu_bacteria 2838661181 2838665916 281
929 iso_pu_bacteria 2838680041 2838684723 281
930 iso_pu_bacteria 2838686498 2838690470 281
931 iso_pu_bacteria 2838694306 2838698885 281
932 iso_pu_bacteria 2838707686 2838712235 281
933 iso_pu_bacteria 2838729681 2838733173 281
934 iso_pu_bacteria 2838742623 2838747238 281
935 iso_pu_bacteria 2841851746 2841855391 281
936 iso_pu_bacteria 2841864319 2841866163 281
937 iso_pu_bacteria 2842110456 2842116971 281
938 iso_pu_bacteria 2842118031 2842122634 281
939 iso_pu_bacteria 2842156927 2842160902 281
940 iso_pu_bacteria 2842163707 2842164431 281
941 iso_pu_bacteria 2842180545 2842184518 281
942 iso_pu_bacteria 2842198810 2842200682 281
943 iso_pu_bacteria 2842217011 2842219656 281
944 iso_pu_bacteria 2842229732 2842232101 281
945 iso_pu_bacteria 2842237096 2842241647 281
946 iso_pu_bacteria 2842243621 2842248497 281
947 iso_pu_bacteria 2842257432 2842262695 281
948 iso_pu_bacteria 2842271015 2842275216 281
949 iso_pu_bacteria 2842291075 2842295843 281
950 iso_pu_bacteria 2842304105 2842307348 281
951 iso_pu_bacteria 2842311132 2842312954 281
952 iso_pu_bacteria 2842341865 2842342058 281
953 iso_pu_bacteria 2842363717 2842365962 281
954 iso_pu_bacteria 2842370503 2842374276 281
955 iso_pu_bacteria 2842377471 2842382247 281
956 iso_pu_bacteria 2842384541 2842389182 281
957 iso_pu_bacteria 2842395702 2842396946 281
958 iso_pu_bacteria 2842422224 2842422625 281
959 iso_pu_bacteria 2842447887 2842449786 281
960 iso_pu_bacteria 2842462802 2842463562 281
961 iso_pu_bacteria 2844454524 2844460126 281
962 iso_pu_bacteria 2850079185 2850084665 281
963 iso_pu_bacteria 2855825444 2855830467 281
964 iso_pu_bacteria 2855839649 2855845761 281
965 iso_pu_bacteria 2857516855 2857517692 281
966 iso_pu_bacteria 2858800743 2858805153 281
967 iso_pu_bacteria 2882456835 2882463171 281
968 iso_pu_bacteria 2896384573 2896387525 281
969 iso_pu_bacteria 2913295892 2913297010 281
970 iso_pu_bacteria 2915980308 2915984314 281
971 iso_pu_bacteria 2915986958 2915987016 281
972 iso_pu_bacteria 2915993759 2915995577 281
973 iso_pu_bacteria 2916000859 2916004075 281
974 iso_pu_bacteria 2916007675 2916012472 281
975 iso_pu_bacteria 2916014648 2916014700 281
976 iso_pu_bacteria 2916021584 2916026933 281
977 iso_pu_bacteria 2916028427 2916034044 281
978 iso_pu_bacteria 2916035215 2916038593 281
979 iso_pu_bacteria 2916041962 2916046322 281
980 iso_pu_bacteria 2916048683 2916050821 281
981 iso_pu_bacteria 2916055098 2916060596 281
982 iso_pu_bacteria 2916061851 2916066633 281
983 iso_pu_bacteria 2916068649 2916071646 281
984 iso_pu_bacteria 2916076590 2916079561 281
985 iso_pu_bacteria 2920760137 2920763335 281
986 iso_pu_bacteria 2920822456 2920827231 281
987 iso_pu_bacteria 2921201388 2921205391 281
988 iso_pu_bacteria 2921208531 2921210713 281
989 iso_pu_bacteria 2921237296 2921240623 281
990 iso_pu_bacteria 2921244191 2921249607 281
991 iso_pu_bacteria 2921250672 2921254270 281
992 iso_pu_bacteria 2921257292 2921261701 281
993 iso_pu_bacteria 2921263974 2921269612 281
994 iso_pu_bacteria 2921282425 2921285048 281
995 iso_pu_bacteria 2921289301 2921294216 281
996 iso_pu_bacteria 2921296804 2921299004 281
997 iso_pu_bacteria 2923556063 2923559808 281
998 iso_pu_bacteria 2924144063 2924144375 281
999 iso_pu_bacteria 2924150972 2924151609 281
1000 iso_pu_bacteria 2924158325 2924159485 281
1001 iso_pu_bacteria 2924165586 2924172614 281
1002 iso_pu_bacteria 2924172951 2924178726 281
1003 iso_pu_bacteria 2924179722 2924185775 281
1004 iso_pu_bacteria 2924193448 2924196066 281
1005 iso_pu_bacteria 2924200457 2924201324 281
1006 iso_pu_bacteria 2924207177 2924210164 281
1007 iso_pu_bacteria 2924214083 2924218917 281
1008 iso_pu_bacteria 2924221636 2924227621 281
1009 iso_pu_bacteria 2924228884 2924230881 281
1010 iso_pu_bacteria 2933570622 2933573996 281
1011 iso_pu_bacteria 2933586486 2933593279 281
1012 iso_pu_bacteria 2933599457 2933600097 281
1013 iso_pu_bacteria 2935894831 2935898802 281
1014 iso_pu_bacteria 2935901341 2935906108 281
1015 iso_pu_bacteria 2936367885 2936374687 281
1016 iso_pu_bacteria 2936375103 2936375879 281
1017 iso_pu_bacteria 2936381700 2936385417 281
1018 iso_pu_bacteria 2937002841 2937005419 281
1019 iso_pu_bacteria 2937009748 2937012996 281
1020 iso_pu_bacteria 2937016420 2937018018 281
1021 iso_pu_bacteria 2937023124 2937029540 281
1022 iso_pu_bacteria 2937029754 2937033948 281
1023 iso_pu_bacteria 2937036028 2937037255 281
1024 iso_pu_bacteria 2937042894 2937043402 281
1025 iso_pu_bacteria 2937049772 2937051947 281
1026 iso_pu_bacteria 2937063883 2937066245 281
1027 iso_pu_bacteria 2937071275 2937077050 281
1028 iso_pu_bacteria 2937078374 2937080484 281
1029 iso_pu_bacteria 2937084907 2937091505 281
1030 iso_pu_bacteria 2937091812 2937096439 281
1031 iso_pu_bacteria 2937098957 2937105704 281
1032 iso_pu_bacteria 2937106411 2937110943 281
1033 iso_pu_bacteria 2937113482 2937116810 281
1034 iso_pu_bacteria 2937119839 2937125025 281
1035 iso_pu_bacteria 2937126314 2937132856 281
1036 iso_pu_bacteria 2941499720 2941505437 281
1037 iso_pu_bacteria 2957375807 2957379793 281
1038 iso_pu_bacteria 2957382221 2957385593 281
1039 iso_pu_bacteria 2957388812 2957390220 281
1040 iso_pu_bacteria 2957395598 2957398848 281
1041 iso_pu_bacteria 2957402308 2957405752 281
1042 iso_pu_bacteria 2957408893 2957412881 281
1043 iso_pu_bacteria 2957415311 2957420490 281
1044 iso_pu_bacteria 2957422303 2957427572 281
1045 iso_pu_bacteria 2957430029 2957430294 281
1046 iso_pu_bacteria 2957437181 2957442725 281
1047 iso_pu_bacteria 2957443900 2957445363 281
1048 iso_pu_bacteria 2957450854 2957453804 281
1049 iso_pu_bacteria 2957457609 2957459979 281
1050 iso_pu_bacteria 2957464669 2957464992 281
1051 iso_pu_bacteria 2957471148 2957475228 281
1052 iso_pu_bacteria 2957478035 2957483526 281
1053 iso_pu_bacteria 2957484790 2957486862 281
1054 iso_pu_bacteria 2957491536 2957492912 281
1055 iso_pu_bacteria 2957498199 2957500196 281
1056 iso_pu_bacteria 2957505466 2957506063 281
1057 iso_pu_bacteria 2960584000 2960585362 281
1058 iso_pu_bacteria 2960591022 2960591742 281
1059 iso_pu_bacteria 2960597568 2960601436 281
1060 iso_pu_bacteria 2960603979 2960608265 281
1061 iso_pu_bacteria 2960610863 2960615944 281
1062 iso_pu_bacteria 2960617483 2960619142 281
1063 iso_pu_bacteria 2960624210 2960627020 281
1064 iso_pu_bacteria 2960631154 2960637796 281
1065 iso_pu_bacteria 2960637947 2960641163 281
1066 iso_pu_bacteria 2960645483 2960652613 281
1067 iso_pu_bacteria 2960652885 2960658448 281
1068 iso_pu_bacteria 2960660292 2960662092 281
1069 iso_pu_bacteria 2960667422 2960668923 281
1070 iso_pu_bacteria 2960680706 2960685176 281
1071 iso_pu_bacteria 2960687367 2960691029 281
1072 iso_pu_bacteria 2960693952 2960700904 281
1073 iso_pu_bacteria 2964615318 2964619235 281
1074 iso_pu_bacteria 2964621998 2964624583 281
1075 iso_pu_bacteria 2964628898 2964634163 281
1076 iso_pu_bacteria 2964636051 2964641396 281
1077 iso_pu_bacteria 2964643177 2964649765 281
1078 iso_pu_bacteria 2964649959 2964655633 281
1079 iso_pu_bacteria 2964656573 2964658339 281
1080 iso_pu_bacteria 2964663802 2964666740 281
1081 iso_pu_bacteria 2964670856 2964673337 281
1082 iso_pu_bacteria 2964678106 2964678906 281
1083 iso_pu_bacteria 2964685014 2964690227 281
1084 iso_pu_bacteria 2964691889 2964695382 281
1085 iso_pu_bacteria 2964698721 2964701846 281
1086 iso_pu_bacteria 2964705432 2964708435 281
1087 iso_pu_bacteria 2964712639 2964715928 281
1088 iso_pu_bacteria 2964719344 2964725589 281
1089 iso_pu_bacteria 2967664464 2967670126 281
1090 iso_pu_bacteria 2967671571 2967675022 281
1091 iso_pu_bacteria 2967678726 2967685505 281
1092 iso_pu_bacteria 2967686174 2967690721 281
1093 iso_pu_bacteria 2967693043 2967694128 281
1094 iso_pu_bacteria 2967699805 2967704378 281
1095 iso_pu_bacteria 2967706974 2967709658 281
1096 iso_pu_bacteria 2967714385 2967715926 281
1097 iso_pu_bacteria 2967721400 2967722774 281
1098 iso_pu_bacteria 2967728569 2967728672 281
1099 iso_pu_bacteria 2967735183 2967739734 281
1100 iso_pu_bacteria 2967742019 2967744231 281
1101 iso_pu_bacteria 2967748971 2967750249 281
1102 iso_pu_bacteria 2967755722 2967760382 281
1103 iso_pu_bacteria 2967762386 2967764757 281
1104 iso_pu_bacteria 2967769361 2967770070 281
1105 iso_pu_bacteria 2967775926 2967781911 281
1106 iso_pu_bacteria 2970019648 2970025212 281
1107 iso_pu_bacteria 2970026789 2970033063 281
1108 iso_pu_bacteria 2970033650 2970035859 281
1109 iso_pu_bacteria 2970040964 2970043232 281
1110 iso_pu_bacteria 2970047711 2970050317 281
1111 iso_pu_bacteria 2970054988 2970060713 281
1112 iso_pu_bacteria 2970061556 2970063000 281
1113 iso_pu_bacteria 2970068827 2970072414 281
1114 iso_pu_bacteria 2970076120 2970077771 281
1115 iso_pu_bacteria 2970088815 2970095083 281
1116 iso_pu_bacteria 2970095765 2970099559 281
1117 iso_pu_bacteria 2970102677 2970109070 281
1118 iso_pu_bacteria 2970109326 2970113996 281
1119 iso_pu_bacteria 2970116247 2970119858 281
1120 iso_pu_bacteria 2970122695 2970129084 281
1121 iso_pu_bacteria 2970129317 2970130763 281
1122 iso_pu_bacteria 2970136068 2970139249 281
1123 iso_pu_bacteria 2970143518 2970147208 281
1124 iso_pu_bacteria 2970149975 2970152700 281
1125 iso_pu_bacteria 2970156795 2970161245 281
1126 iso_pu_bacteria 2970164137 2970165154 281
1127 iso_pu_bacteria 2970170962 2970176296 281
1128 iso_pu_bacteria 2970184632 2970184725 281
1129 iso_pu_bacteria 2970191845 2970194051 281
1130 iso_pu_bacteria 2977516862 2977519921 281
1131 iso_pu_bacteria 2977523885 2977525245 281
1132 iso_pu_bacteria 2977530762 2977536919 281
1133 iso_pu_bacteria 2977537788 2977539332 281
1134 iso_pu_bacteria 2977544691 2977546572 281
1135 iso_pu_bacteria 2977551784 2977558706 281
1136 iso_pu_bacteria 2977558990 2977564275 281
1137 iso_pu_bacteria 2977565890 2977568655 281
1138 iso_pu_bacteria 2977572785 2977575068 281
1139 iso_pu_bacteria 2977579622 2977580660 281
1140 iso_pu_bacteria 639633055 639645368 281
1141 iso_pu_bacteria 648276728 648738622 281
1142 iso_pu_bacteria 8003992118 8003997745 281
1143 iso_pu_bacteria 8003999396 8004005440 281
1144 iso_pu_bacteria 8005275841 8005277890 281
1145 iso_pu_bacteria 8005282627 8005285837 281
1146 iso_pu_bacteria 8005301065 8005301278 281
1147 iso_pu_bacteria 8005307578 8005308302 281
1148 iso_pu_bacteria 8005376324 8005380552 281
1149 iso_pu_bacteria 8005460587 8005467563 281
1150 iso_pu_bacteria 8005497431 8005502001 281
1151 iso_pu_bacteria 8005556819 8005559478 281
1152 iso_pu_bacteria 8005563573 8005566475 281
1153 iso_pu_bacteria 8005570704 8005571146 281
1154 iso_pu_bacteria 8005668836 8005673423 281
1155 iso_pu_bacteria 8005688590 8005688907 281
1156 iso_pu_bacteria 8005695170 8005697032 281
1157 iso_pu_bacteria 8018127388 8018132290 281
1158 iso_pu_bacteria 8018163183 8018163749 281
1159 iso_pu_bacteria 8018176218 8018176446 281
1160 iso_pu_bacteria 8023680758 8023681563 281
1161 iso_pu_bacteria 8024479707 8024481435 281
1162 iso_pu_bacteria 8056375014 8056379525 281
1163 iso_pu_bacteria 8057874678 8057881296 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

109

289

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.5935 71 270
3rlf-assembly1.cif.gz_F crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.582 82 270
4jbw-assembly1.cif.gz_F crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.5781 66 272
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.5709 26 272
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.5597 71 270
ID Description Score Start End Superfamily
af_Q2FVE9_63_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8055 70 270 1.10.3720.10
af_P0AGH5_85_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.794 70 270 1.10.3720.10
af_Q2FVE9_63_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7811 70 270 1.10.3720.10
af_Q2G1F6_179_383_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7755 74 270 1.10.3720.10
af_Q2FZR6_145_349_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7724 71 270 1.10.3720.10
ID Description Score Start End GO Terms
AF-J9E358-F1-model_v4 deleted 0.8749 17 271
AF-R7KLC0-F1-model_v4 Binding-protein-dependent transport system inner membrane component 0.8537 17 271 GO:0005886
GO:0055085
AF-A0A7Y7IZV0-F1-model_v4 ABC transporter permease 0.8514 18 271 GO:0005886
GO:0055085
AF-A0A7Y8UAW6-F1-model_v4 deleted 0.8489 17 271
AF-A0A372NEC5-F1-model_v4 ABC transporter permease 0.847 15 271 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
83.11 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map