F490963

General Info

Members Datasets Scaffolds Average Seq Length
1158 362 2316 379

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100054324|Ga0070660_1000543243
Length 410
Sequence MAGRRHRLGTQALLRDHLTVADDLHRFAFPTSIVFGAGARREVARHLLAAGCKRPLVVTDRGLAALPVFAGFLRELTGVAHAVFSGVQGNPVRGQVMAGAQAYRAHDADSIVGIGGGAALDVAKAIAVMATHPGDILDYAWDHPQVRPITQPLPWVVAVPTTAGTGSEVGRSSVIGDDVTHVKKIVFSPALLAKVVFADPELTLDLPAAITAATGMDALTHNVESYLSPAWHPLCDGIAVEGVRIAARALPVAVKHGHDLAARGDMLMCSMMGAIAFQKDLGAVHSCAHALSTVADLHHGLANGIMIDHVMRFNLPVAAAKLAELARVAAVPGGDRGSDEARAHAFVAWLARLKQDLGIPATLSACDAARRISVDDIARLTEIAVADICHKTNPRPCTAEDFRQIFAAAM

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
141 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
142 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
143 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
144 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
145 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
146 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
147 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
158 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
229 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
230 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
231 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
232 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
233 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
234 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
235 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
236 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
237 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
238 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
239 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
240 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
241 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
242 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
243 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
244 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
245 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
246 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
247 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
248 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
249 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
250 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
251 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
252 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
253 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
255 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
256 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
257 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
258 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
259 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
260 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
261 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
263 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
264 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
265 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
272 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
273 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
274 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
275 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
276 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
277 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
278 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
279 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
280 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
281 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
282 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
283 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
286 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
287 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
288 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
289 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
290 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
291 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
292 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
293 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
294 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
295 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
296 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
297 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
298 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
299 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
300 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
301 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
302 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
303 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
304 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
307 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
308 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
309 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
310 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
311 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
312 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
315 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
316 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
319 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
320 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
321 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
333 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
334 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
338 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
339 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
340 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
341 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
351 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
352 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
353 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
354 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
355 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
356 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
357 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
358 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
359 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
360 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
361 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
362 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.09
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.08
Nodule 0
Rhizoplane 3.11
Rhizosphere 88
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100054324 3300005339 Bacteria 3093
2 JGI25155J39150_1000184 3300002704 Bacteria 26887
3 JGI25156J39149_1000100 3300002705 Bacteria 63565
4 JGI25154J39366_1000121 3300002738 Bacteria 62887
5 JGI25157J39369_1000130 3300002741 Bacteria 63360
6 JGI25150J39212_1001463 3300002774 Bacteria 6579
7 JGI25159J45721_1000190 3300002987 Bacteria 28606
8 JGI25159J45721_1012062 3300002987 Bacteria 2081
9 JGI25151J46595_10009816 3300003187 Bacteria 4503
10 rootH1_10027120 3300003316 Bacteria 2487
11 JGI25160J50197_1000345 3300003354 Bacteria 30950
12 JGI25160J50197_1000460 3300003354 Bacteria 25318
13 JGI25161J50226_1000007 3300003374 Bacteria 256181
14 Ga0055526_1016911 3300003771 Bacteria 2820
15 Ga0055526_1022093 3300003771 Bacteria 2181
16 Ga0055537_1000254 3300003773 Bacteria 38945
17 Ga0055524_1000101 3300003775 Bacteria 106527
18 Ga0055524_1000471 3300003775 Bacteria 32322
19 Ga0055536_1019146 3300003781 Bacteria 2164
20 Ga0055534_1000846 3300003784 Bacteria 14087
21 Ga0055528_1001026 3300003790 Bacteria 18496
22 Ga0055530_10001100 3300003791 Bacteria 21173
23 Ga0055540_1000099 3300003792 Bacteria 96187
24 Ga0055540_1000670 3300003792 Bacteria 23785
25 Ga0055531_10007669 3300003794 Bacteria 5835
26 Ga0055543_1002444 3300004625 Bacteria 6139
27 Ga0065165_1018671 3300005262 Bacteria 2502
28 Ga0065165_1026396 3300005262 Bacteria 1911
29 Ga0070658_10008499 3300005327 Bacteria 8254
30 Ga0070658_10021485 3300005327 Bacteria 5172
31 Ga0070676_10000943 3300005328 Bacteria 14431
32 Ga0070676_10002226 3300005328 Bacteria 9892
33 Ga0070676_10025652 3300005328 Bacteria 3333
34 Ga0070676_10027597 3300005328 Bacteria 3220
35 Ga0070676_10030869 3300005328 Bacteria 3059
36 Ga0070676_10049025 3300005328 Bacteria 2471
37 Ga0070683_100089244 3300005329 Bacteria 2893
38 Ga0070683_100204173 3300005329 Bacteria 1877
39 Ga0070690_100010525 3300005330 Bacteria 5386
40 Ga0070690_100028919 3300005330 Bacteria 3435
41 Ga0070690_100090655 3300005330 Bacteria 2013
42 Ga0070670_100001968 3300005331 Bacteria 16801
43 Ga0070670_100002937 3300005331 Bacteria 14114
44 Ga0070670_100002946 3300005331 Bacteria 14099
45 Ga0070670_100006486 3300005331 Bacteria 9902
46 Ga0070670_100012554 3300005331 Bacteria 7252
47 Ga0070670_100014553 3300005331 Bacteria 6754
48 Ga0070670_100028425 3300005331 Bacteria 4812
49 Ga0070670_100050020 3300005331 Bacteria 3592
50 Ga0070670_100067193 3300005331 Bacteria 3077
51 Ga0070670_100067440 3300005331 Bacteria 3070
52 Ga0070670_100107326 3300005331 Bacteria 2406
53 Ga0070670_100118913 3300005331 Bacteria 2279
54 Ga0070670_100129207 3300005331 Bacteria 2181
55 Ga0070670_100162125 3300005331 Bacteria 1938
56 Ga0070670_100180771 3300005331 Bacteria 1831
57 Ga0070670_100333113 3300005331 Bacteria 1331
58 Ga0070677_10052303 3300005333 Bacteria 1657
59 Ga0068869_100001034 3300005334 Bacteria 16191
60 Ga0068869_100001799 3300005334 Bacteria 12863
61 Ga0068869_100012846 3300005334 Bacteria 5543
62 Ga0068869_100029902 3300005334 Bacteria 3820
63 Ga0068869_100034459 3300005334 Bacteria 3582
64 Ga0068869_100045142 3300005334 Bacteria 3171
65 Ga0068869_100094547 3300005334 Bacteria 2253
66 Ga0070666_10005279 3300005335 Bacteria 7917
67 Ga0070666_10009292 3300005335 Bacteria 6125
68 Ga0070666_10017819 3300005335 Bacteria 4557
69 Ga0070666_10019738 3300005335 Bacteria 4355
70 Ga0070666_10024734 3300005335 Bacteria 3914
71 Ga0070666_10036872 3300005335 Bacteria 3248
72 Ga0070666_10047964 3300005335 Bacteria 2869
73 Ga0070666_10055552 3300005335 Bacteria 2673
74 Ga0070680_100061655 3300005336 Bacteria 3070
75 Ga0070682_100008067 3300005337 Bacteria 5932
76 Ga0070682_100015302 3300005337 Bacteria 4443
77 Ga0068868_100002986 3300005338 Bacteria 11755
78 Ga0068868_100014647 3300005338 Bacteria 5784
79 Ga0068868_100018190 3300005338 Bacteria 5250
80 Ga0068868_100018451 3300005338 Bacteria 5217
81 Ga0068868_100019720 3300005338 Bacteria 5056
82 Ga0068868_100029545 3300005338 Bacteria 4198
83 Ga0068868_100049989 3300005338 Bacteria 3282
84 Ga0068868_100061036 3300005338 Bacteria 2986
85 Ga0068868_100062246 3300005338 Bacteria 2957
86 Ga0068868_100083063 3300005338 Bacteria 2570
87 Ga0068868_100116847 3300005338 Bacteria 2172
88 Ga0070660_100004244 3300005339 Bacteria 9897
89 Ga0070660_100191804 3300005339 Bacteria 1655
90 Ga0070689_100012532 3300005340 Bacteria 6111
91 Ga0070689_100066652 3300005340 Bacteria 2805
92 Ga0070689_100217924 3300005340 Bacteria 1565
93 Ga0070691_10047375 3300005341 Bacteria 2044
94 Ga0070687_100008151 3300005343 Bacteria 4418
95 Ga0070661_100001036 3300005344 Bacteria 19652
96 Ga0070692_10006369 3300005345 Bacteria 5125
97 Ga0070692_10178598 3300005345 Bacteria 1229
98 Ga0070668_100002402 3300005347 Bacteria 13778
99 Ga0070668_100007201 3300005347 Bacteria 8248
100 Ga0070668_100010557 3300005347 Bacteria 6869
101 Ga0070668_100015222 3300005347 Bacteria 5747
102 Ga0070668_100020482 3300005347 Bacteria 4992
103 Ga0070668_100038155 3300005347 Bacteria 3671
104 Ga0070668_100098102 3300005347 Bacteria 2318
105 Ga0070669_100002383 3300005353 Bacteria 13599
106 Ga0070669_100012560 3300005353 Bacteria 6006
107 Ga0070669_100033582 3300005353 Bacteria 3712
108 Ga0070669_100086405 3300005353 Bacteria 2343
109 Ga0070669_100274335 3300005353 Bacteria 1349
110 Ga0070675_100000127 3300005354 Bacteria 45462
111 Ga0070675_100001971 3300005354 Bacteria 15193
112 Ga0070675_100006731 3300005354 Bacteria 8837
113 Ga0070675_100015010 3300005354 Bacteria 6117
114 Ga0070675_100025409 3300005354 Bacteria 4749
115 Ga0070675_100039164 3300005354 Bacteria 3866
116 Ga0070675_100074087 3300005354 Bacteria 2827
117 Ga0070675_100079959 3300005354 Bacteria 2725
118 Ga0070675_100082804 3300005354 Bacteria 2677
119 Ga0070675_100144371 3300005354 Bacteria 2036
120 Ga0070675_100321320 3300005354 Bacteria 1367
121 Ga0070675_100361508 3300005354 Bacteria 1289
122 Ga0070671_100000385 3300005355 Bacteria 30358
123 Ga0070671_100001641 3300005355 Bacteria 16907
124 Ga0070671_100003515 3300005355 Bacteria 12244
125 Ga0070671_100004635 3300005355 Bacteria 10904
126 Ga0070671_100014500 3300005355 Bacteria 6370
127 Ga0070671_100014712 3300005355 Bacteria 6324
128 Ga0070671_100056883 3300005355 Bacteria 3254
129 Ga0070671_100080194 3300005355 Bacteria 2729
130 Ga0070671_100108136 3300005355 Bacteria 2335
131 Ga0070671_100149782 3300005355 Unclassified 1970
132 Ga0070671_100329472 3300005355 Bacteria 1301
133 Ga0070674_100000721 3300005356 Bacteria 16880
134 Ga0070674_100000959 3300005356 Bacteria 15042
135 Ga0070674_100020481 3300005356 Bacteria 4228
136 Ga0070674_100208749 3300005356 Bacteria 1512
137 Ga0070673_100000167 3300005364 Bacteria 31804
138 Ga0070673_100001120 3300005364 Bacteria 15374
139 Ga0070673_100007920 3300005364 Bacteria 7044
140 Ga0070673_100015192 3300005364 Bacteria 5399
141 Ga0070673_100047716 3300005364 Bacteria 3334
142 Ga0070673_100065453 3300005364 Bacteria 2899
143 Ga0070673_100073899 3300005364 Bacteria 2746
144 Ga0070673_100084228 3300005364 Bacteria 2585
145 Ga0070673_100107635 3300005364 Bacteria 2306
146 Ga0070688_100001497 3300005365 Bacteria 11642
147 Ga0070688_100073373 3300005365 Bacteria 2195
148 Ga0070688_100119178 3300005365 Bacteria 1765
149 Ga0070688_100160767 3300005365 Bacteria 1543
150 Ga0070659_100000182 3300005366 Bacteria 48054
151 Ga0070659_100009933 3300005366 Bacteria 7000
152 Ga0070659_100017045 3300005366 Bacteria 5461
153 Ga0070659_100031751 3300005366 Bacteria 4092
154 Ga0070659_100112508 3300005366 Bacteria 2198
155 Ga0070667_100004836 3300005367 Bacteria 11286
156 Ga0070667_100005678 3300005367 Bacteria 10421
157 Ga0070667_100008145 3300005367 Bacteria 8688
158 Ga0070667_100020241 3300005367 Bacteria 5524
159 Ga0070667_100050033 3300005367 Bacteria 3521
160 Ga0070667_100054977 3300005367 Bacteria 3362
161 Ga0070667_100082071 3300005367 Bacteria 2759
162 Ga0070667_100105692 3300005367 Bacteria 2436
163 Ga0070667_100203009 3300005367 Bacteria 1759
164 Ga0070709_10002358 3300005434 Bacteria 10231
165 Ga0070709_10061900 3300005434 Bacteria 2384
166 Ga0070709_10103530 3300005434 Bacteria 1901
167 Ga0070709_10105999 3300005434 Bacteria 1881
168 Ga0070714_100016001 3300005435 Bacteria 6048
169 Ga0070714_100021195 3300005435 Bacteria 5315
170 Ga0070714_100038078 3300005435 Bacteria 4043
171 Ga0070713_100000097 3300005436 Bacteria 55735
172 Ga0070713_100000757 3300005436 Bacteria 20671
173 Ga0070713_100037387 3300005436 Bacteria 3925
174 Ga0070713_100198455 3300005436 Bacteria 1811
175 Ga0070701_10016194 3300005438 Bacteria 3460
176 Ga0070701_10045169 3300005438 Bacteria 2259
177 Ga0070711_100000353 3300005439 Bacteria 23775
178 Ga0070711_100044097 3300005439 Bacteria 3025
179 Ga0070700_100047990 3300005441 Bacteria 2645
180 Ga0070708_100000315 3300005445 Bacteria 36417
181 Ga0070708_100166999 3300005445 Bacteria 2053
182 Ga0070708_100195030 3300005445 Unclassified 1895
183 Ga0070663_100029088 3300005455 Bacteria 3770
184 Ga0070678_100001077 3300005456 Bacteria 14291
185 Ga0070678_100001165 3300005456 Bacteria 13936
186 Ga0070678_100007294 3300005456 Bacteria 6546
187 Ga0070678_100014516 3300005456 Bacteria 4974
188 Ga0070678_100107420 3300005456 Bacteria 2177
189 Ga0070678_100156871 3300005456 Bacteria 1839
190 Ga0070678_100164983 3300005456 Bacteria 1799
191 Ga0070678_100206313 3300005456 Bacteria 1625
192 Ga0070678_100322037 3300005456 Bacteria 1320
193 Ga0070662_100000120 3300005457 Bacteria 43782
194 Ga0070662_100007935 3300005457 Bacteria 6905
195 Ga0070662_100047348 3300005457 Bacteria 3093
196 Ga0070662_100099003 3300005457 Bacteria 2203
197 Ga0070662_100100793 3300005457 Bacteria 2185
198 Ga0070681_10004889 3300005458 Bacteria 12854
199 Ga0070681_10012410 3300005458 Bacteria 8451
200 Ga0070681_10012501 3300005458 Bacteria 8424
201 Ga0070681_10121466 3300005458 Bacteria 2547
202 Ga0068867_100000062 3300005459 Bacteria 65188
203 Ga0068867_100001859 3300005459 Bacteria 14670
204 Ga0068867_100006992 3300005459 Bacteria 7974
205 Ga0068867_100008167 3300005459 Bacteria 7394
206 Ga0068867_100008581 3300005459 Bacteria 7213
207 Ga0068867_100028297 3300005459 Bacteria 4035
208 Ga0068867_100031007 3300005459 Bacteria 3858
209 Ga0068867_100051318 3300005459 Bacteria 3042
210 Ga0068867_100054280 3300005459 Bacteria 2960
211 Ga0068867_100156458 3300005459 Bacteria 1794
212 Ga0070685_10007416 3300005466 Bacteria 5613
213 Ga0070685_10008492 3300005466 Bacteria 5283
214 Ga0070706_100039126 3300005467 Bacteria 4379
215 Ga0070706_100170632 3300005467 Bacteria 2031
216 Ga0070706_100235224 3300005467 Bacteria 1710
217 Ga0070707_100020374 3300005468 Bacteria 6254
218 Ga0070707_100034045 3300005468 Bacteria 4859
219 Ga0070707_100056285 3300005468 Bacteria 3772
220 Ga0070698_100013851 3300005471 Bacteria 8529
221 Ga0070698_100019564 3300005471 Bacteria 7104
222 Ga0070698_100110078 3300005471 Bacteria 2720
223 Ga0070698_100230035 3300005471 Bacteria 1787
224 Ga0070698_100236869 3300005471 Bacteria 1758
225 Ga0070699_100002253 3300005518 Bacteria 17398
226 Ga0070699_100010100 3300005518 Bacteria 8174
227 Ga0070699_100060263 3300005518 Bacteria 3289
228 Ga0070679_100001334 3300005530 Bacteria 21772
229 Ga0070679_100018567 3300005530 Bacteria 6750
230 Ga0070679_100044953 3300005530 Bacteria 4400
231 Ga0070679_100055000 3300005530 Bacteria 3963
232 Ga0070679_100163213 3300005530 Bacteria 2202
233 Ga0070684_100017898 3300005535 Bacteria 5824
234 Ga0070684_100127694 3300005535 Bacteria 2291
235 Ga0070697_100021116 3300005536 Bacteria 5157
236 Ga0070697_100244060 3300005536 Bacteria 1534
237 Ga0068853_100010730 3300005539 Bacteria 7419
238 Ga0068853_100017799 3300005539 Bacteria 5867
239 Ga0068853_100027393 3300005539 Bacteria 4788
240 Ga0068853_100047410 3300005539 Bacteria 3687
241 Ga0068853_100053842 3300005539 Bacteria 3466
242 Ga0068853_100066477 3300005539 Bacteria 3131
243 Ga0068853_100109659 3300005539 Bacteria 2450
244 Ga0068853_100114704 3300005539 Bacteria 2397
245 Ga0068853_100306789 3300005539 Bacteria 1468
246 Ga0068853_100316157 3300005539 Bacteria 1447
247 Ga0070672_100001991 3300005543 Bacteria 12816
248 Ga0070672_100003372 3300005543 Bacteria 10351
249 Ga0070672_100006508 3300005543 Bacteria 7850
250 Ga0070672_100014345 3300005543 Bacteria 5615
251 Ga0070672_100016987 3300005543 Bacteria 5225
252 Ga0070672_100056037 3300005543 Bacteria 3089
253 Ga0070672_100077498 3300005543 Bacteria 2658
254 Ga0070672_100085266 3300005543 Bacteria 2538
255 Ga0070672_100107881 3300005543 Bacteria 2266
256 Ga0070672_100183772 3300005543 Bacteria 1743
257 Ga0070672_100212367 3300005543 Bacteria 1621
258 Ga0070672_100270909 3300005543 Bacteria 1434
259 Ga0070672_100328721 3300005543 Bacteria 1300
260 Ga0070695_100054746 3300005545 Bacteria 2569
261 Ga0070695_100106331 3300005545 Bacteria 1897
262 Ga0070696_100003984 3300005546 Bacteria 9844
263 Ga0070693_100024263 3300005547 Bacteria 3250
264 Ga0070693_100026617 3300005547 Bacteria 3125
265 Ga0070665_100005025 3300005548 Bacteria 13723
266 Ga0070665_100010909 3300005548 Bacteria 9191
267 Ga0070665_100012296 3300005548 Bacteria 8628
268 Ga0070665_100101908 3300005548 Bacteria 2875
269 Ga0070704_100008935 3300005549 Bacteria 6037
270 Ga0070704_100135027 3300005549 Bacteria 1918
271 Ga0068855_100001125 3300005563 Bacteria 33195
272 Ga0068855_100003748 3300005563 Bacteria 18569
273 Ga0068855_100004880 3300005563 Bacteria 16367
274 Ga0068855_100008578 3300005563 Bacteria 12358
275 Ga0068855_100025077 3300005563 Bacteria 7138
276 Ga0068855_100032601 3300005563 Bacteria 6219
277 Ga0068855_100054584 3300005563 Bacteria 4696
278 Ga0068855_100101687 3300005563 Bacteria 3309
279 Ga0068855_100140689 3300005563 Bacteria 2751
280 Ga0068855_100241966 3300005563 Bacteria 2016
281 Ga0070664_100000226 3300005564 Bacteria 40249
282 Ga0070664_100001477 3300005564 Bacteria 18724
283 Ga0070664_100032340 3300005564 Bacteria 4375
284 Ga0070664_100058916 3300005564 Bacteria 3267
285 Ga0070664_100260018 3300005564 Bacteria 1562
286 Ga0070664_100266765 3300005564 Bacteria 1541
287 Ga0070664_100276530 3300005564 Bacteria 1513
288 Ga0068857_100003262 3300005577 Bacteria 13481
289 Ga0068857_100003640 3300005577 Bacteria 12921
290 Ga0068857_100186461 3300005577 Bacteria 1889
291 Ga0068857_100244180 3300005577 Bacteria 1645
292 Ga0068854_100002997 3300005578 Bacteria 10480
293 Ga0068854_100006927 3300005578 Bacteria 7230
294 Ga0068854_100024128 3300005578 Bacteria 4161
295 Ga0068854_100087317 3300005578 Bacteria 2314
296 Ga0068854_100141851 3300005578 Bacteria 1845
297 Ga0068856_100001739 3300005614 Bacteria 22768
298 Ga0068856_100005592 3300005614 Bacteria 12370
299 Ga0068856_100006483 3300005614 Bacteria 11474
300 Ga0068856_100103480 3300005614 Bacteria 2841
301 Ga0068856_100185060 3300005614 Bacteria 2097
302 Ga0070702_100043264 3300005615 Bacteria 2537
303 Ga0068852_100000458 3300005616 Bacteria 26975
304 Ga0068852_100000500 3300005616 Bacteria 25729
305 Ga0068852_100000662 3300005616 Bacteria 22487
306 Ga0068852_100015799 3300005616 Bacteria 5869
307 Ga0068852_100036291 3300005616 Bacteria 4123
308 Ga0068852_100041890 3300005616 Bacteria 3874
309 Ga0068852_100077128 3300005616 Bacteria 2945
310 Ga0068852_100082431 3300005616 Bacteria 2858
311 Ga0068852_100128945 3300005616 Bacteria 2327
312 Ga0068852_100131576 3300005616 Bacteria 2305
313 Ga0068852_100219770 3300005616 Bacteria 1806
314 Ga0068859_100001046 3300005617 Bacteria 28371
315 Ga0068859_100003087 3300005617 Bacteria 16901
316 Ga0068859_100003577 3300005617 Bacteria 15829
317 Ga0068859_100067783 3300005617 Bacteria 3604
318 Ga0068859_100083345 3300005617 Bacteria 3240
319 Ga0068859_100108579 3300005617 Bacteria 2836
320 Ga0068859_100111214 3300005617 Bacteria 2802
321 Ga0068859_100343067 3300005617 Bacteria 1588
322 Ga0068859_100410530 3300005617 Bacteria 1450
323 Ga0068864_100000351 3300005618 Bacteria 40447
324 Ga0068864_100000942 3300005618 Bacteria 24336
325 Ga0068864_100001845 3300005618 Bacteria 17426
326 Ga0068864_100002069 3300005618 Bacteria 16579
327 Ga0068864_100046206 3300005618 Bacteria 3735
328 Ga0068864_100069347 3300005618 Bacteria 3066
329 Ga0068864_100387734 3300005618 Bacteria 1325
330 Ga0068866_10004677 3300005718 Bacteria 5617
331 Ga0068861_100005292 3300005719 Bacteria 8708
332 Ga0068861_100007550 3300005719 Bacteria 7458
333 Ga0068861_100047221 3300005719 Bacteria 3249
334 Ga0068861_100239396 3300005719 Bacteria 1543
335 Ga0068861_100291821 3300005719 Bacteria 1409
336 Ga0068851_10000412 3300005834 Bacteria 19247
337 Ga0068851_10001605 3300005834 Bacteria 9939
338 Ga0068851_10004682 3300005834 Bacteria 6184
339 Ga0068851_10007638 3300005834 Bacteria 4973
340 Ga0068870_10003842 3300005840 Bacteria 6401
341 Ga0068870_10094278 3300005840 Bacteria 1680
342 Ga0068863_100001007 3300005841 Bacteria 28209
343 Ga0068863_100002587 3300005841 Bacteria 17944
344 Ga0068863_100004932 3300005841 Bacteria 13155
345 Ga0068863_100010333 3300005841 Bacteria 9069
346 Ga0068863_100012385 3300005841 Bacteria 8235
347 Ga0068863_100021455 3300005841 Bacteria 6164
348 Ga0068863_100123818 3300005841 Bacteria 2466
349 Ga0068863_100258882 3300005841 Bacteria 1682
350 Ga0068863_100425298 3300005841 Bacteria 1301
351 Ga0068858_100000729 3300005842 Bacteria 34410
352 Ga0068858_100001611 3300005842 Bacteria 23012
353 Ga0068858_100003527 3300005842 Bacteria 15491
354 Ga0068858_100012968 3300005842 Bacteria 7859
355 Ga0068858_100023202 3300005842 Bacteria 5786
356 Ga0068858_100250041 3300005842 Bacteria 1684
357 Ga0068858_100314204 3300005842 Bacteria 1496
358 Ga0068860_100004676 3300005843 Bacteria 13977
359 Ga0068860_100016056 3300005843 Bacteria 7304
360 Ga0068860_100027890 3300005843 Bacteria 5437
361 Ga0068860_100034064 3300005843 Bacteria 4884
362 Ga0068860_100049436 3300005843 Bacteria 4005
363 Ga0068860_100050963 3300005843 Bacteria 3940
364 Ga0068860_100254545 3300005843 Bacteria 1710
365 Ga0068860_100341032 3300005843 Bacteria 1473
366 Ga0068862_100023321 3300005844 Bacteria 5184
367 Ga0068862_100149431 3300005844 Bacteria 2078
368 Ga0068862_100226368 3300005844 Bacteria 1695
369 Ga0081539_10011444 3300005985 Bacteria 7008
370 Ga0081539_10061406 3300005985 Bacteria 2059
371 Ga0075365_10019547 3300006038 Bacteria 4183
372 Ga0075364_10037695 3300006051 Bacteria 3131
373 Ga0075364_10042646 3300006051 Bacteria 2948
374 Ga0070712_100027786 3300006175 Bacteria 3781
375 Ga0070712_100043375 3300006175 Bacteria 3096
376 Ga0075362_10003797 3300006177 Bacteria 5353
377 Ga0075362_10047606 3300006177 Bacteria 1910
378 Ga0075367_10081319 3300006178 Bacteria 1960
379 Ga0075367_10116769 3300006178 Bacteria 1642
380 Ga0075366_10018128 3300006195 Bacteria 4064
381 Ga0075366_10157074 3300006195 Bacteria 1378
382 Ga0097621_100001301 3300006237 Bacteria 17184
383 Ga0097621_100002452 3300006237 Bacteria 12699
384 Ga0097621_100014377 3300006237 Bacteria 5922
385 Ga0097621_100015621 3300006237 Bacteria 5720
386 Ga0097621_100045116 3300006237 Bacteria 3559
387 Ga0097621_100093719 3300006237 Bacteria 2517
388 Ga0097621_100093937 3300006237 Bacteria 2514
389 Ga0097621_100137172 3300006237 Bacteria 2088
390 Ga0097621_100220388 3300006237 Bacteria 1653
391 Ga0075370_10000861 3300006353 Bacteria 12334
392 Ga0075370_10002560 3300006353 Bacteria 8464
393 Ga0075370_10004395 3300006353 Bacteria 6838
394 Ga0075370_10020261 3300006353 Bacteria 3633
395 Ga0075370_10063368 3300006353 Bacteria 2108
396 Ga0068871_100003319 3300006358 Bacteria 11049
397 Ga0068871_100019509 3300006358 Bacteria 5177
398 Ga0068871_100056011 3300006358 Bacteria 3203
399 Ga0068871_100075094 3300006358 Bacteria 2789
400 Ga0068871_100136455 3300006358 Bacteria 2084
401 Ga0068871_100152332 3300006358 Bacteria 1972
402 Ga0075428_100061274 3300006844 Bacteria 4120
403 Ga0075428_100300749 3300006844 Bacteria 1725
404 Ga0075431_100019118 3300006847 Bacteria 6980
405 Ga0075431_100034615 3300006847 Bacteria 5204
406 Ga0075433_10050544 3300006852 Bacteria 3619
407 Ga0075429_100000922 3300006880 Bacteria 23290
408 Ga0068865_100011641 3300006881 Bacteria 5512
409 Ga0068865_100047395 3300006881 Bacteria 2953
410 Ga0068865_100049201 3300006881 Bacteria 2904
411 Ga0068865_100104142 3300006881 Bacteria 2082
412 Ga0075436_100004769 3300006914 Bacteria 9312
413 Ga0097620_100001046 3300006931 Bacteria 28371
414 Ga0097620_100003087 3300006931 Bacteria 16901
415 Ga0097620_100003577 3300006931 Bacteria 15829
416 Ga0097620_100067784 3300006931 Bacteria 3604
417 Ga0097620_100083345 3300006931 Bacteria 3240
418 Ga0097620_100108582 3300006931 Bacteria 2836
419 Ga0097620_100111221 3300006931 Bacteria 2802
420 Ga0097620_100343032 3300006931 Bacteria 1588
421 Ga0097620_100410530 3300006931 Bacteria 1450
422 Ga0075435_100010388 3300007076 Bacteria 6808
423 Ga0105240_10003161 3300009093 Bacteria 25902
424 Ga0105240_10003767 3300009093 Bacteria 23425
425 Ga0105240_10005554 3300009093 Bacteria 18768
426 Ga0105240_10079899 3300009093 Bacteria 4023
427 Ga0105240_10144226 3300009093 Bacteria 2843
428 Ga0105240_10209153 3300009093 Bacteria 2281
429 Ga0105240_10256237 3300009093 Bacteria 2021
430 Ga0111539_10032437 3300009094 Bacteria 6342
431 Ga0111539_10084171 3300009094 Bacteria 3740
432 Ga0105245_10013244 3300009098 Bacteria 7187
433 Ga0105245_10014066 3300009098 Bacteria 6970
434 Ga0105245_10018830 3300009098 Bacteria 6041
435 Ga0105245_10093457 3300009098 Bacteria 2771
436 Ga0114129_10042449 3300009147 Bacteria 6405
437 Ga0114129_10182925 3300009147 Bacteria 2851
438 Ga0105243_10000800 3300009148 Bacteria 30075
439 Ga0105243_10071689 3300009148 Bacteria 2802
440 Ga0105243_10101047 3300009148 Bacteria 2394
441 Ga0105241_10017308 3300009174 Bacteria 5293
442 Ga0105241_10140826 3300009174 Bacteria 1963
443 Ga0105242_10001678 3300009176 Bacteria 17530
444 Ga0105242_10217866 3300009176 Bacteria 1704
445 Ga0105248_10004085 3300009177 Bacteria 16142
446 Ga0105248_10031198 3300009177 Bacteria 5956
447 Ga0105248_10031400 3300009177 Bacteria 5938
448 Ga0105248_10038460 3300009177 Bacteria 5354
449 Ga0105248_10153370 3300009177 Bacteria 2599
450 Ga0105248_10177995 3300009177 Bacteria 2397
451 Ga0105248_10381614 3300009177 Bacteria 1587
452 Ga0105248_10526707 3300009177 Bacteria 1333
453 Ga0105237_10021331 3300009545 Bacteria 6661
454 Ga0105237_10053472 3300009545 Bacteria 4050
455 Ga0105237_10065966 3300009545 Bacteria 3615
456 Ga0105237_10122700 3300009545 Bacteria 2592
457 Ga0105237_10177525 3300009545 Bacteria 2130
458 Ga0105238_10000770 3300009551 Bacteria 33391
459 Ga0105238_10020736 3300009551 Bacteria 6693
460 Ga0105238_10021155 3300009551 Bacteria 6630
461 Ga0105238_10027934 3300009551 Bacteria 5750
462 Ga0105238_10034888 3300009551 Bacteria 5117
463 Ga0105238_10076212 3300009551 Bacteria 3345
464 Ga0105238_10181607 3300009551 Bacteria 2081
465 Ga0105249_10030973 3300009553 Bacteria 4836
466 Ga0105249_10058524 3300009553 Bacteria 3532
467 Ga0105249_10074108 3300009553 Bacteria 3150
468 Ga0105249_10080323 3300009553 Bacteria 3029
469 Ga0105239_10108589 3300010375 Bacteria 3074
470 Ga0105239_10278465 3300010375 Bacteria 1883
471 Ga0105239_10295654 3300010375 Bacteria 1823
472 Ga0105246_10049225 3300011119 Bacteria 2885
473 Ga0157373_10000824 3300013100 Bacteria 24025
474 Ga0157373_10040852 3300013100 Bacteria 3319
475 Ga0157373_10054186 3300013100 Bacteria 2850
476 Ga0157371_10001585 3300013102 Bacteria 23358
477 Ga0157371_10164346 3300013102 Bacteria 1585
478 Ga0157371_10190515 3300013102 Bacteria 1468
479 Ga0157370_10000522 3300013104 Bacteria 48150
480 Ga0157370_10003726 3300013104 Bacteria 17814
481 Ga0157370_10027183 3300013104 Bacteria 5641
482 Ga0157370_10027887 3300013104 Bacteria 5563
483 Ga0157370_10207492 3300013104 Bacteria 1816
484 Ga0157369_10000281 3300013105 Bacteria 68061
485 Ga0157369_10005788 3300013105 Bacteria 14370
486 Ga0157369_10058853 3300013105 Bacteria 4144
487 Ga0157369_10067179 3300013105 Bacteria 3855
488 Ga0157374_10006780 3300013296 Bacteria 9737
489 Ga0157374_10022662 3300013296 Bacteria 5605
490 Ga0157374_10026513 3300013296 Bacteria 5215
491 Ga0157374_10068681 3300013296 Bacteria 3335
492 Ga0157374_10121948 3300013296 Bacteria 2516
493 Ga0157374_10135905 3300013296 Bacteria 2383
494 Ga0157378_10025843 3300013297 Bacteria 5173
495 Ga0157378_10064025 3300013297 Bacteria 3287
496 Ga0163162_10003894 3300013306 Bacteria 14330
497 Ga0163162_10004531 3300013306 Bacteria 13382
498 Ga0163162_10013456 3300013306 Bacteria 7986
499 Ga0163162_10070750 3300013306 Bacteria 3540
500 Ga0163162_10099205 3300013306 Bacteria 3003
501 Ga0163162_10210383 3300013306 Bacteria 2074
502 Ga0163162_10314327 3300013306 Bacteria 1699
503 Ga0163162_10359062 3300013306 Bacteria 1590
504 Ga0157372_10002024 3300013307 Bacteria 22028
505 Ga0157372_10060738 3300013307 Bacteria 4229
506 Ga0157372_10069402 3300013307 Bacteria 3964
507 Ga0157372_10077771 3300013307 Bacteria 3748
508 Ga0157372_10085796 3300013307 Bacteria 3572
509 Ga0157372_10122753 3300013307 Bacteria 2985
510 Ga0157372_10237844 3300013307 Bacteria 2113
511 Ga0157375_10002325 3300013308 Bacteria 16417
512 Ga0157375_10026357 3300013308 Bacteria 5416
513 Ga0157375_10034830 3300013308 Bacteria 4800
514 Ga0157375_10046713 3300013308 Bacteria 4224
515 Ga0157375_10049323 3300013308 Bacteria 4124
516 Ga0157375_10080539 3300013308 Bacteria 3295
517 Ga0157375_10175948 3300013308 Bacteria 2289
518 Ga0157375_10194311 3300013308 Bacteria 2184
519 Ga0163163_10000609 3300014325 Bacteria 31134
520 Ga0163163_10048865 3300014325 Bacteria 4162
521 Ga0163163_10070214 3300014325 Bacteria 3488
522 Ga0163163_10074024 3300014325 Bacteria 3397
523 Ga0163163_10086864 3300014325 Bacteria 3137
524 Ga0163163_10134291 3300014325 Bacteria 2515
525 Ga0163163_10470760 3300014325 Bacteria 1317
526 Ga0157380_10004698 3300014326 Bacteria 9511
527 Ga0157380_10034699 3300014326 Bacteria 3892
528 Ga0157380_10035617 3300014326 Bacteria 3845
529 Ga0157380_10044508 3300014326 Bacteria 3480
530 Ga0157380_10127044 3300014326 Bacteria 2169
531 Ga0182008_10060820 3300014497 Bacteria 1862
532 Ga0157377_10000027 3300014745 Bacteria 135472
533 Ga0157377_10009437 3300014745 Bacteria 4787
534 Ga0157377_10025276 3300014745 Bacteria 3166
535 Ga0157379_10000542 3300014968 Bacteria 30483
536 Ga0157379_10004055 3300014968 Bacteria 12495
537 Ga0157379_10009960 3300014968 Bacteria 8280
538 Ga0157379_10012529 3300014968 Bacteria 7406
539 Ga0157379_10021537 3300014968 Bacteria 5707
540 Ga0157379_10037579 3300014968 Bacteria 4318
541 Ga0157379_10042334 3300014968 Bacteria 4065
542 Ga0157379_10057593 3300014968 Bacteria 3473
543 Ga0157379_10111910 3300014968 Bacteria 2453
544 Ga0157379_10129937 3300014968 Bacteria 2267
545 Ga0157376_10011627 3300014969 Bacteria 6497
546 Ga0157376_10032163 3300014969 Bacteria 4209
547 Ga0157376_10063869 3300014969 Bacteria 3103
548 Ga0157376_10068170 3300014969 Bacteria 3012
549 Ga0157376_10164336 3300014969 Bacteria 2015
550 Ga0163161_10019780 3300017792 Bacteria 4723
551 Ga0163161_10031919 3300017792 Bacteria 3757
552 Ga0163161_10034083 3300017792 Bacteria 3640
553 Ga0206353_11976508 3300020082 Bacteria 2435
554 Ga0213874_10007487 3300021377 Bacteria 2623
555 Ga0209435_100008 3300025206 Bacteria 503644
556 Ga0209436_109810 3300025208 Bacteria 1795
557 Ga0207425_1000606 3300025245 Bacteria 20792
558 Ga0209646_1000079 3300025246 Bacteria 207677
559 Ga0209026_1000067 3300025250 Bacteria 207677
560 Ga0209759_1000056 3300025256 Bacteria 207677
561 Ga0209565_1000041 3300025263 Bacteria 251081
562 Ga0209565_1001982 3300025263 Bacteria 7988
563 Ga0209673_1000012 3300025273 Bacteria 579480
564 Ga0209673_1011462 3300025273 Bacteria 3653
565 Ga0209673_1018410 3300025273 Bacteria 2540
566 Ga0209130_1000014 3300025284 Bacteria 412039
567 Ga0209130_1000184 3300025284 Bacteria 87817
568 Ga0209675_1000475 3300025291 Bacteria 30742
569 Ga0209675_1004691 3300025291 Bacteria 5995
570 Ga0209676_1000013 3300025292 Bacteria 816080
571 Ga0209676_1012673 3300025292 Bacteria 3289
572 Ga0209025_1004977 3300025294 Bacteria 11114
573 Ga0209025_1008314 3300025294 Bacteria 7489
574 Ga0209564_1013506 3300025295 Bacteria 3461
575 Ga0209758_1003920 3300025297 Bacteria 12989
576 Ga0209050_1000008 3300025298 Bacteria 1144179
577 Ga0209256_1000003 3300025299 Bacteria 1661127
578 Ga0207426_1000091 3300025302 Bacteria 280561
579 Ga0207426_1000174 3300025302 Bacteria 160877
580 Ga0209051_1000005 3300025303 Bacteria 1142353
581 Ga0209051_1000351 3300025303 Bacteria 68445
582 Ga0209257_1000015 3300025304 Bacteria 908141
583 Ga0209257_1000048 3300025304 Bacteria 455536
584 Ga0207697_10002484 3300025315 Bacteria 9538
585 Ga0207697_10004215 3300025315 Bacteria 6911
586 Ga0207697_10004396 3300025315 Bacteria 6737
587 Ga0207697_10013772 3300025315 Bacteria 3369
588 Ga0207656_10012097 3300025321 Bacteria 3276
589 Ga0207656_10017476 3300025321 Bacteria 2811
590 Ga0207682_10000342 3300025893 Bacteria 21268
591 Ga0207682_10000872 3300025893 Bacteria 13986
592 Ga0207682_10003293 3300025893 Bacteria 7057
593 Ga0207682_10018186 3300025893 Bacteria 2747
594 Ga0207682_10047116 3300025893 Bacteria 1773
595 Ga0207642_10001795 3300025899 Bacteria 6644
596 Ga0207688_10036362 3300025901 Bacteria 2729
597 Ga0207688_10042167 3300025901 Bacteria 2540
598 Ga0207688_10082167 3300025901 Bacteria 1841
599 Ga0207680_10001055 3300025903 Bacteria 13024
600 Ga0207680_10020976 3300025903 Bacteria 3528
601 Ga0207685_10026204 3300025905 Bacteria 2024
602 Ga0207645_10000187 3300025907 Bacteria 49829
603 Ga0207645_10000549 3300025907 Bacteria 31247
604 Ga0207645_10001311 3300025907 Bacteria 20435
605 Ga0207645_10001481 3300025907 Bacteria 19198
606 Ga0207645_10008783 3300025907 Bacteria 7026
607 Ga0207645_10026715 3300025907 Bacteria 3729
608 Ga0207645_10031874 3300025907 Bacteria 3389
609 Ga0207645_10037131 3300025907 Bacteria 3128
610 Ga0207645_10041995 3300025907 Bacteria 2927
611 Ga0207645_10145300 3300025907 Bacteria 1546
612 Ga0207643_10008272 3300025908 Bacteria 5585
613 Ga0207643_10009896 3300025908 Bacteria 5123
614 Ga0207643_10012975 3300025908 Bacteria 4505
615 Ga0207643_10014253 3300025908 Bacteria 4317
616 Ga0207643_10130318 3300025908 Bacteria 1496
617 Ga0207684_10003796 3300025910 Bacteria 14581
618 Ga0207684_10006140 3300025910 Bacteria 10985
619 Ga0207684_10111079 3300025910 Bacteria 2346
620 Ga0207654_10017869 3300025911 Bacteria 3716
621 Ga0207654_10068080 3300025911 Bacteria 2106
622 Ga0207707_10009156 3300025912 Bacteria 8601
623 Ga0207707_10011841 3300025912 Bacteria 7586
624 Ga0207707_10059387 3300025912 Bacteria 3327
625 Ga0207695_10004522 3300025913 Bacteria 18923
626 Ga0207695_10010199 3300025913 Bacteria 11523
627 Ga0207695_10017725 3300025913 Bacteria 8267
628 Ga0207695_10031694 3300025913 Bacteria 5793
629 Ga0207695_10046968 3300025913 Bacteria 4573
630 Ga0207695_10368972 3300025913 Bacteria 1322
631 Ga0207671_10018195 3300025914 Bacteria 5399
632 Ga0207671_10231819 3300025914 Bacteria 1449
633 Ga0207693_10000760 3300025915 Bacteria 28971
634 Ga0207663_10103040 3300025916 Bacteria 1921
635 Ga0207660_10006497 3300025917 Bacteria 7586
636 Ga0207660_10084728 3300025917 Bacteria 2336
637 Ga0207662_10010356 3300025918 Bacteria 5147
638 Ga0207657_10000102 3300025919 Bacteria 82096
639 Ga0207657_10000250 3300025919 Bacteria 57310
640 Ga0207657_10002028 3300025919 Bacteria 21896
641 Ga0207657_10018911 3300025919 Bacteria 6558
642 Ga0207657_10022540 3300025919 Bacteria 5888
643 Ga0207657_10027081 3300025919 Bacteria 5255
644 Ga0207657_10072560 3300025919 Bacteria 2912
645 Ga0207657_10088335 3300025919 Bacteria 2591
646 Ga0207649_10001379 3300025920 Bacteria 14389
647 Ga0207649_10015846 3300025920 Bacteria 4238
648 Ga0207649_10037066 3300025920 Bacteria 2942
649 Ga0207652_10008684 3300025921 Bacteria 8180
650 Ga0207652_10028777 3300025921 Bacteria 4638
651 Ga0207652_10041779 3300025921 Bacteria 3900
652 Ga0207652_10055805 3300025921 Bacteria 3399
653 Ga0207652_10108492 3300025921 Bacteria 2460
654 Ga0207652_10255610 3300025921 Bacteria 1580
655 Ga0207646_10003241 3300025922 Bacteria 18549
656 Ga0207646_10198377 3300025922 Bacteria 1812
657 Ga0207681_10004744 3300025923 Bacteria 8366
658 Ga0207681_10014587 3300025923 Bacteria 4888
659 Ga0207681_10028877 3300025923 Bacteria 3596
660 Ga0207681_10050273 3300025923 Bacteria 2820
661 Ga0207681_10060027 3300025923 Bacteria 2609
662 Ga0207681_10207824 3300025923 Bacteria 1507
663 Ga0207681_10249161 3300025923 Bacteria 1386
664 Ga0207694_10002414 3300025924 Bacteria 15283
665 Ga0207694_10007634 3300025924 Bacteria 8197
666 Ga0207650_10009000 3300025925 Bacteria 6825
667 Ga0207650_10020808 3300025925 Bacteria 4632
668 Ga0207650_10022286 3300025925 Bacteria 4482
669 Ga0207650_10022544 3300025925 Bacteria 4457
670 Ga0207650_10028325 3300025925 Bacteria 4016
671 Ga0207650_10078089 3300025925 Bacteria 2504
672 Ga0207650_10087477 3300025925 Bacteria 2374
673 Ga0207650_10091257 3300025925 Bacteria 2328
674 Ga0207650_10120402 3300025925 Bacteria 2043
675 Ga0207650_10130385 3300025925 Bacteria 1967
676 Ga0207659_10000667 3300025926 Bacteria 20307
677 Ga0207659_10002664 3300025926 Bacteria 10637
678 Ga0207659_10003251 3300025926 Bacteria 9732
679 Ga0207659_10048759 3300025926 Bacteria 3002
680 Ga0207659_10062068 3300025926 Bacteria 2696
681 Ga0207659_10253636 3300025926 Bacteria 1428
682 Ga0207659_10285306 3300025926 Bacteria 1351
683 Ga0207687_10000552 3300025927 Bacteria 25163
684 Ga0207700_10019091 3300025928 Bacteria 4624
685 Ga0207664_10003534 3300025929 Bacteria 10432
686 Ga0207664_10010398 3300025929 Bacteria 6571
687 Ga0207664_10013527 3300025929 Bacteria 5862
688 Ga0207664_10052682 3300025929 Bacteria 3219
689 Ga0207644_10000896 3300025931 Bacteria 18852
690 Ga0207644_10002572 3300025931 Bacteria 11670
691 Ga0207644_10002934 3300025931 Bacteria 10986
692 Ga0207644_10008922 3300025931 Bacteria 6570
693 Ga0207644_10018118 3300025931 Bacteria 4761
694 Ga0207644_10019596 3300025931 Bacteria 4591
695 Ga0207644_10021247 3300025931 Bacteria 4419
696 Ga0207644_10024165 3300025931 Bacteria 4170
697 Ga0207644_10037870 3300025931 Bacteria 3394
698 Ga0207644_10038646 3300025931 Bacteria 3364
699 Ga0207644_10041708 3300025931 Bacteria 3248
700 Ga0207644_10049764 3300025931 Bacteria 3002
701 Ga0207644_10158327 3300025931 Bacteria 1758
702 Ga0207644_10189120 3300025931 Unclassified 1618
703 Ga0207644_10237927 3300025931 Bacteria 1449
704 Ga0207690_10000595 3300025932 Bacteria 23415
705 Ga0207690_10011539 3300025932 Bacteria 5278
706 Ga0207690_10043804 3300025932 Bacteria 2947
707 Ga0207706_10000095 3300025933 Bacteria 92378
708 Ga0207706_10008022 3300025933 Bacteria 9743
709 Ga0207706_10009183 3300025933 Bacteria 9089
710 Ga0207706_10022684 3300025933 Bacteria 5635
711 Ga0207706_10045322 3300025933 Bacteria 3897
712 Ga0207706_10146582 3300025933 Bacteria 2076
713 Ga0207686_10019685 3300025934 Bacteria 3843
714 Ga0207686_10021919 3300025934 Bacteria 3673
715 Ga0207686_10039328 3300025934 Bacteria 2870
716 Ga0207709_10001223 3300025935 Bacteria 18456
717 Ga0207670_10008604 3300025936 Bacteria 5770
718 Ga0207670_10020892 3300025936 Bacteria 4030
719 Ga0207670_10075278 3300025936 Bacteria 2346
720 Ga0207670_10219391 3300025936 Bacteria 1455
721 Ga0207669_10002060 3300025937 Bacteria 8514
722 Ga0207669_10013573 3300025937 Bacteria 4051
723 Ga0207669_10029300 3300025937 Bacteria 3042
724 Ga0207669_10055186 3300025937 Bacteria 2405
725 Ga0207669_10070658 3300025937 Bacteria 2190
726 Ga0207669_10147148 3300025937 Bacteria 1644
727 Ga0207704_10016205 3300025938 Bacteria 3823
728 Ga0207704_10059006 3300025938 Bacteria 2366
729 Ga0207665_10017332 3300025939 Bacteria 4733
730 Ga0207665_10043115 3300025939 Bacteria 3016
731 Ga0207665_10142432 3300025939 Bacteria 1711
732 Ga0207691_10000105 3300025940 Bacteria 74790
733 Ga0207691_10000714 3300025940 Bacteria 32878
734 Ga0207691_10002172 3300025940 Bacteria 19178
735 Ga0207691_10006527 3300025940 Bacteria 11259
736 Ga0207691_10013136 3300025940 Bacteria 7928
737 Ga0207691_10021256 3300025940 Bacteria 6130
738 Ga0207691_10023709 3300025940 Bacteria 5776
739 Ga0207691_10025435 3300025940 Bacteria 5558
740 Ga0207691_10030035 3300025940 Bacteria 5082
741 Ga0207691_10032460 3300025940 Bacteria 4867
742 Ga0207691_10041548 3300025940 Bacteria 4244
743 Ga0207691_10105629 3300025940 Bacteria 2509
744 Ga0207691_10129314 3300025940 Bacteria 2232
745 Ga0207691_10167395 3300025940 Bacteria 1926
746 Ga0207691_10252294 3300025940 Bacteria 1523
747 Ga0207691_10260526 3300025940 Bacteria 1495
748 Ga0207711_10001126 3300025941 Bacteria 25546
749 Ga0207711_10017801 3300025941 Bacteria 5903
750 Ga0207711_10020081 3300025941 Bacteria 5568
751 Ga0207711_10045238 3300025941 Bacteria 3762
752 Ga0207711_10278224 3300025941 Bacteria 1541
753 Ga0207689_10002780 3300025942 Bacteria 16182
754 Ga0207689_10019565 3300025942 Bacteria 5705
755 Ga0207689_10023567 3300025942 Bacteria 5163
756 Ga0207689_10023633 3300025942 Bacteria 5155
757 Ga0207689_10035073 3300025942 Bacteria 4167
758 Ga0207689_10076380 3300025942 Bacteria 2754
759 Ga0207661_10004715 3300025944 Bacteria 9547
760 Ga0207661_10050901 3300025944 Bacteria 3302
761 Ga0207661_10063313 3300025944 Bacteria 2995
762 Ga0207679_10001294 3300025945 Bacteria 15799
763 Ga0207679_10001787 3300025945 Bacteria 13382
764 Ga0207679_10006374 3300025945 Bacteria 7455
765 Ga0207679_10133344 3300025945 Bacteria 1996
766 Ga0207679_10235534 3300025945 Bacteria 1548
767 Ga0207667_10000233 3300025949 Bacteria 77272
768 Ga0207667_10000705 3300025949 Bacteria 43375
769 Ga0207667_10004358 3300025949 Bacteria 17337
770 Ga0207667_10008512 3300025949 Bacteria 12184
771 Ga0207667_10027515 3300025949 Bacteria 6187
772 Ga0207667_10036751 3300025949 Bacteria 5244
773 Ga0207667_10082074 3300025949 Bacteria 3340
774 Ga0207667_10082392 3300025949 Bacteria 3333
775 Ga0207667_10143862 3300025949 Bacteria 2455
776 Ga0207667_10152326 3300025949 Bacteria 2380
777 Ga0207667_10238693 3300025949 Bacteria 1860
778 Ga0207651_10000831 3300025960 Bacteria 13396
779 Ga0207651_10010722 3300025960 Bacteria 5092
780 Ga0207651_10012678 3300025960 Bacteria 4783
781 Ga0207651_10019863 3300025960 Bacteria 4038
782 Ga0207651_10035760 3300025960 Bacteria 3234
783 Ga0207651_10048189 3300025960 Bacteria 2878
784 Ga0207651_10049978 3300025960 Bacteria 2837
785 Ga0207651_10057304 3300025960 Bacteria 2686
786 Ga0207651_10057723 3300025960 Bacteria 2679
787 Ga0207651_10097344 3300025960 Bacteria 2172
788 Ga0207712_10033101 3300025961 Bacteria 3493
789 Ga0207668_10002236 3300025972 Bacteria 11295
790 Ga0207668_10002618 3300025972 Bacteria 10531
791 Ga0207668_10004388 3300025972 Bacteria 8288
792 Ga0207668_10007648 3300025972 Bacteria 6430
793 Ga0207668_10070196 3300025972 Bacteria 2497
794 Ga0207668_10195304 3300025972 Bacteria 1607
795 Ga0207640_10045601 3300025981 Bacteria 2816
796 Ga0207640_10072230 3300025981 Bacteria 2327
797 Ga0207640_10084294 3300025981 Bacteria 2182
798 Ga0207640_10138845 3300025981 Bacteria 1768
799 Ga0207658_10000888 3300025986 Bacteria 24911
800 Ga0207658_10019046 3300025986 Bacteria 4748
801 Ga0207658_10031367 3300025986 Bacteria 3772
802 Ga0207658_10042876 3300025986 Bacteria 3285
803 Ga0207658_10051093 3300025986 Bacteria 3045
804 Ga0207658_10060331 3300025986 Bacteria 2829
805 Ga0207658_10080544 3300025986 Bacteria 2494
806 Ga0207658_10092506 3300025986 Bacteria 2349
807 Ga0207658_10099992 3300025986 Bacteria 2270
808 Ga0207658_10156152 3300025986 Bacteria 1865
809 Ga0207677_10000920 3300026023 Bacteria 16454
810 Ga0207677_10001799 3300026023 Bacteria 11327
811 Ga0207677_10008911 3300026023 Bacteria 5627
812 Ga0207677_10016618 3300026023 Bacteria 4364
813 Ga0207677_10026668 3300026023 Bacteria 3628
814 Ga0207677_10028957 3300026023 Bacteria 3512
815 Ga0207677_10041033 3300026023 Bacteria 3057
816 Ga0207703_10000552 3300026035 Bacteria 38477
817 Ga0207703_10001926 3300026035 Bacteria 18380
818 Ga0207703_10002841 3300026035 Bacteria 14773
819 Ga0207703_10023790 3300026035 Bacteria 4818
820 Ga0207639_10016661 3300026041 Bacteria 5204
821 Ga0207639_10023193 3300026041 Bacteria 4479
822 Ga0207639_10036184 3300026041 Bacteria 3657
823 Ga0207639_10048214 3300026041 Bacteria 3223
824 Ga0207639_10074377 3300026041 Bacteria 2668
825 Ga0207639_10085263 3300026041 Bacteria 2511
826 Ga0207639_10104314 3300026041 Bacteria 2299
827 Ga0207678_10001717 3300026067 Bacteria 20059
828 Ga0207678_10003576 3300026067 Bacteria 13974
829 Ga0207678_10038426 3300026067 Bacteria 4158
830 Ga0207708_10000558 3300026075 Bacteria 28801
831 Ga0207708_10070755 3300026075 Bacteria 2671
832 Ga0207708_10132696 3300026075 Bacteria 1948
833 Ga0207708_10194323 3300026075 Bacteria 1617
834 Ga0207702_10003371 3300026078 Bacteria 14642
835 Ga0207702_10003800 3300026078 Bacteria 13634
836 Ga0207702_10010094 3300026078 Bacteria 7912
837 Ga0207702_10026920 3300026078 Bacteria 4775
838 Ga0207702_10043463 3300026078 Bacteria 3772
839 Ga0207702_10118309 3300026078 Bacteria 2367
840 Ga0207702_10214812 3300026078 Bacteria 1790
841 Ga0207641_10004175 3300026088 Bacteria 12583
842 Ga0207641_10007772 3300026088 Bacteria 8909
843 Ga0207641_10014973 3300026088 Bacteria 6358
844 Ga0207641_10019122 3300026088 Bacteria 5618
845 Ga0207641_10033691 3300026088 Bacteria 4256
846 Ga0207641_10035271 3300026088 Bacteria 4166
847 Ga0207641_10037317 3300026088 Bacteria 4057
848 Ga0207641_10041719 3300026088 Bacteria 3847
849 Ga0207641_10100996 3300026088 Bacteria 2541
850 Ga0207641_10158867 3300026088 Bacteria 2053
851 Ga0207648_10000119 3300026089 Bacteria 76875
852 Ga0207648_10000320 3300026089 Bacteria 52595
853 Ga0207648_10004062 3300026089 Bacteria 15174
854 Ga0207648_10004701 3300026089 Bacteria 13958
855 Ga0207648_10006217 3300026089 Bacteria 11901
856 Ga0207648_10007882 3300026089 Bacteria 10391
857 Ga0207648_10012586 3300026089 Bacteria 7916
858 Ga0207648_10015531 3300026089 Bacteria 6999
859 Ga0207648_10027008 3300026089 Bacteria 5098
860 Ga0207648_10044778 3300026089 Bacteria 3883
861 Ga0207648_10175059 3300026089 Bacteria 1897
862 Ga0207676_10000754 3300026095 Bacteria 25321
863 Ga0207676_10003962 3300026095 Bacteria 10452
864 Ga0207676_10004363 3300026095 Bacteria 10005
865 Ga0207676_10012830 3300026095 Bacteria 6015
866 Ga0207676_10032326 3300026095 Bacteria 3942
867 Ga0207676_10038516 3300026095 Bacteria 3650
868 Ga0207676_10048121 3300026095 Bacteria 3308
869 Ga0207676_10079621 3300026095 Bacteria 2657
870 Ga0207676_10083844 3300026095 Bacteria 2597
871 Ga0207676_10146269 3300026095 Bacteria 2030
872 Ga0207676_10167153 3300026095 Bacteria 1912
873 Ga0207676_10279818 3300026095 Bacteria 1514
874 Ga0207676_10326278 3300026095 Bacteria 1411
875 Ga0207674_10000131 3300026116 Bacteria 88017
876 Ga0207674_10000326 3300026116 Bacteria 60670
877 Ga0207674_10017466 3300026116 Bacteria 7828
878 Ga0207674_10022792 3300026116 Bacteria 6719
879 Ga0207674_10065661 3300026116 Bacteria 3657
880 Ga0207675_100002315 3300026118 Bacteria 18913
881 Ga0207675_100008094 3300026118 Bacteria 9904
882 Ga0207675_100009226 3300026118 Bacteria 9251
883 Ga0207675_100018862 3300026118 Bacteria 6437
884 Ga0207675_100026114 3300026118 Bacteria 5436
885 Ga0207675_100032329 3300026118 Bacteria 4874
886 Ga0207675_100062115 3300026118 Bacteria 3488
887 Ga0207675_100064138 3300026118 Bacteria 3433
888 Ga0207675_100090625 3300026118 Bacteria 2875
889 Ga0207675_100102799 3300026118 Bacteria 2693
890 Ga0207675_100154574 3300026118 Bacteria 2185
891 Ga0207675_100195178 3300026118 Bacteria 1943
892 Ga0207675_100309031 3300026118 Bacteria 1541
893 Ga0207683_10000012 3300026121 Bacteria 134768
894 Ga0207683_10000189 3300026121 Bacteria 52818
895 Ga0207683_10001281 3300026121 Bacteria 22746
896 Ga0207683_10001576 3300026121 Bacteria 20549
897 Ga0207683_10005513 3300026121 Bacteria 10847
898 Ga0207683_10007348 3300026121 Bacteria 9441
899 Ga0207683_10023415 3300026121 Bacteria 5313
900 Ga0207683_10065555 3300026121 Bacteria 3202
901 Ga0207683_10256520 3300026121 Bacteria 1596
902 Ga0207698_10000838 3300026142 Bacteria 17827
903 Ga0207698_10006574 3300026142 Bacteria 7267
904 Ga0207698_10017000 3300026142 Bacteria 4923
905 Ga0207698_10021702 3300026142 Bacteria 4447
906 Ga0207698_10029059 3300026142 Bacteria 3953
907 Ga0207698_10078807 3300026142 Bacteria 2647
908 Ga0207698_10091410 3300026142 Bacteria 2491
909 Ga0207698_10118509 3300026142 Bacteria 2236
910 Ga0207698_10153925 3300026142 Bacteria 2000
911 Ga0209983_1003292 3300027665 Bacteria 3468
912 Ga0209974_10001061 3300027876 Bacteria 9744
913 Ga0209974_10007612 3300027876 Bacteria 3729
914 Ga0207428_10142240 3300027907 Bacteria 1830
915 Ga0268266_10011709 3300028379 Bacteria 7610
916 Ga0268266_10018595 3300028379 Bacteria 5921
917 Ga0268266_10133824 3300028379 Bacteria 2219
918 Ga0268266_10305266 3300028379 Bacteria 1486
919 Ga0268265_10016989 3300028380 Bacteria 5010
920 Ga0268265_10078541 3300028380 Bacteria 2596
921 Ga0268265_10093071 3300028380 Bacteria 2414
922 Ga0268265_10179164 3300028380 Bacteria 1819
923 Ga0268264_10000940 3300028381 Bacteria 30212
924 Ga0268264_10002657 3300028381 Bacteria 15612
925 Ga0268264_10025198 3300028381 Bacteria 4859
926 Ga0268264_10067926 3300028381 Bacteria 3010
927 Ga0268264_10104538 3300028381 Bacteria 2468
928 Ga0268264_10151159 3300028381 Bacteria 2081
929 Ga0268264_10280841 3300028381 Bacteria 1560
930 Ga0307515_10000049 3300028794 Bacteria 278611
931 Ga0307515_10000066 3300028794 Bacteria 244076
932 Ga0307515_10059324 3300028794 Bacteria 5485
933 Ga0307515_10209939 3300028794 Bacteria 1794
934 Ga0265330_10003071 3300031235 Bacteria 8842
935 Ga0265332_10003672 3300031238 Bacteria 7352
936 Ga0265328_10025715 3300031239 Bacteria 2217
937 Ga0265325_10049461 3300031241 Bacteria 2169
938 Ga0265329_10003353 3300031242 Bacteria 7007
939 Ga0265331_10000350 3300031250 Bacteria 48905
940 Ga0265327_10004829 3300031251 Bacteria 11681
941 Ga0265316_10013413 3300031344 Bacteria 7285
942 Ga0307513_10002838 3300031456 Bacteria 23744
943 Ga0307513_10011393 3300031456 Bacteria 11054
944 Ga0307513_10019123 3300031456 Bacteria 8162
945 Ga0307513_10021758 3300031456 Bacteria 7564
946 Ga0307408_100013842 3300031548 Bacteria 5355
947 Ga0307408_100034862 3300031548 Bacteria 3528
948 Ga0307408_100220747 3300031548 Bacteria 1546
949 Ga0307408_100223794 3300031548 Bacteria 1537
950 Ga0265314_10009272 3300031711 Bacteria 8335
951 Ga0265342_10012348 3300031712 Bacteria 5788
952 Ga0307516_10000921 3300031730 Bacteria 40429
953 Ga0307405_10000621 3300031731 Bacteria 13616
954 Ga0307405_10008967 3300031731 Bacteria 5105
955 Ga0307413_10001173 3300031824 Bacteria 9644
956 Ga0307413_10052708 3300031824 Bacteria 2459
957 Ga0307413_10054170 3300031824 Bacteria 2432
958 Ga0307410_10007236 3300031852 Bacteria 6060
959 Ga0307410_10008853 3300031852 Bacteria 5612
960 Ga0307410_10011061 3300031852 Bacteria 5144
961 Ga0307410_10073292 3300031852 Bacteria 2381
962 Ga0307406_10004418 3300031901 Bacteria 7648
963 Ga0307406_10009058 3300031901 Bacteria 5567
964 Ga0307412_10006741 3300031911 Bacteria 6510
965 Ga0307412_10018324 3300031911 Bacteria 4210
966 Ga0307409_100017199 3300031995 Bacteria 4811
967 Ga0307409_100058389 3300031995 Bacteria 2996
968 Ga0307409_100081058 3300031995 Bacteria 2622
969 Ga0307409_100202891 3300031995 Bacteria 1776
970 Ga0307416_100260672 3300032002 Bacteria 1694
971 Ga0307414_10061301 3300032004 Bacteria 2664
972 Ga0307411_10001216 3300032005 Bacteria 10214
973 Ga0307411_10005304 3300032005 Bacteria 6312
974 Ga0307415_100057526 3300032126 Bacteria 2672
975 Ga0373929_0008600 3300035085 Bacteria 1883
976 Ga0373936_0011058 3300035113 Bacteria 3411
977 Ga0373945_0036077 3300035116 Bacteria 1770
978 Ga0373953_0002967 3300035117 Bacteria 5186
979 Ga0373954_0003328 3300035118 Bacteria 6797
980 Ga0373957_0023088 3300035120 Bacteria 2222
981 Ga0373943_0034515 3300035170 Bacteria 2413
982 Ga0373924_0004776 3300035410 Bacteria 4758
983 Ga0373924_0041635 3300035410 Bacteria 1882
984 Ga0373931_0067732 3300035691 Bacteria 1941
985 Ga0373935_0004177 3300035692 Bacteria 8457
986 Ga0373927_0031424 3300035695 Bacteria 3460
987 Ga0373927_0133842 3300035695 Bacteria 1620
988 Ga0373933_0011865 3300035724 Bacteria 4812
989 Ga0373933_0085424 3300035724 Bacteria 1940
990 Ga0373947_0009997 3300035725 Bacteria 5447
991 Ga0373947_0072170 3300035725 Bacteria 2119
992 Ga0373947_0168043 3300035725 Bacteria 1422
993 Ga0373937_0016249 3300036401 Bacteria 6605
994 Ga0373937_0115025 3300036401 Bacteria 2504
995 Ga0373925_0044516 3300037068 Bacteria 3295
996 Ga0373925_0081370 3300037068 Bacteria 2462
997 Ga0395899_0020711 3300037312 Bacteria 4986
998 Ga0395899_0033049 3300037312 Bacteria 3887
999 Ga0395899_0214821 3300037312 Bacteria 1335
1000 Ga0395900_0055217 3300037418 Bacteria 4090
1001 Ga0395900_0224846 3300037418 Bacteria 1890
1002 Ga0395900_0257331 3300037418 Bacteria 1744
1003 Ga0395900_0289671 3300037418 Bacteria 1626
1004 Ga0395898_0011650 3300037466 Bacteria 9123
1005 Ga0395898_0016629 3300037466 Bacteria 7518
1006 Ga0395898_0049453 3300037466 Bacteria 4119
1007 Ga0395905_0003737 3300037471 Bacteria 16126
1008 Ga0395905_0028706 3300037471 Bacteria 5243
1009 Ga0395905_0092657 3300037471 Bacteria 2833
1010 Ga0395905_0295756 3300037471 Bacteria 1506
1011 Ga0395901_0084049 3300038443 Bacteria 3327
1012 Ga0395901_0174784 3300038443 Bacteria 2252
1013 Ga0395901_0174792 3300038443 Bacteria 2252
1014 Ga0395901_0281844 3300038443 Bacteria 1726
1015 Ga0436361_1220556 3300039447 Bacteria 1880
1016 Ga0436363_1036156 3300039450 Bacteria 1607
1017 Ga0439450_032563 3300042008 Bacteria 1178
1018 Ga0450890_014151 3300042127 Bacteria 1045
1019 Ga0439464_0005719 3300042439 Bacteria 3224
1020 Ga0439464_0011936 3300042439 Bacteria 2308
1021 Ga0451577_0003299 3300042876 Bacteria 18147
1022 Ga0451577_0003837 3300042876 Bacteria 16345
1023 Ga0451577_0006775 3300042876 Bacteria 11361
1024 Ga0451577_0118292 3300042876 Bacteria 2373
1025 Ga0451577_0118605 3300042876 Bacteria 2370
1026 Ga0451577_0132250 3300042876 Bacteria 2239
1027 Ga0451577_0172583 3300042876 Bacteria 1948
1028 Ga0453683_0001373 3300044673 Bacteria 21220
1029 Ga0453683_0004216 3300044673 Bacteria 10280
1030 Ga0466966_0004622 3300044684 Bacteria 9070
1031 Ga0453684_0166848 3300044712 Bacteria 2598
1032 Ga0453684_0232487 3300044712 Bacteria 2127
1033 Ga0466970_0047613 3300044765 Bacteria 2285
1034 Ga0466959_0023359 3300045049 Bacteria 4575
1035 Ga0451576_0001355 3300045051 Bacteria 42292
1036 Ga0451576_0002571 3300045051 Bacteria 26734
1037 Ga0451576_0012222 3300045051 Bacteria 9671
1038 Ga0451576_0024684 3300045051 Bacteria 6489
1039 Ga0451576_0047462 3300045051 Bacteria 4515
1040 Ga0451576_0190814 3300045051 Bacteria 2140
1041 Ga0451576_0315109 3300045051 Bacteria 1637
1042 Ga0495629_0062279 3300046459 Bacteria 2606
1043 Ga0495651_0121203 3300046462 Bacteria 1921
1044 Ga0495653_0051053 3300046463 Bacteria 3177
1045 Ga0495580_0057026 3300046472 Bacteria 2749
1046 Ga0495662_0070256 3300046476 Bacteria 1696
1047 Ga0495628_0016698 3300046516 Bacteria 6121
1048 Ga0495630_0066960 3300046517 Bacteria 2700
1049 Ga0495631_0058082 3300046518 Bacteria 1683
1050 Ga0495632_0012921 3300046519 Bacteria 4789
1051 Ga0495665_0024006 3300046531 Bacteria 3275
1052 Ga0495640_0194737 3300046533 Bacteria 1287
1053 Ga0495621_0000666 3300046539 Bacteria 8692
1054 Ga0495621_0005684 3300046539 Bacteria 3600
1055 Ga0495597_0014519 3300046542 Bacteria 3749
1056 Ga0495634_0024414 3300046642 Bacteria 4242
1057 Ga0495611_0021986 3300046648 Bacteria 2758
1058 Ga0495635_0013743 3300046663 Bacteria 5665
1059 Ga0495647_0013330 3300046681 Bacteria 2846
1060 Ga0495658_0186213 3300046683 Bacteria 1289
1061 Ga0495613_0052440 3300046689 Bacteria 3004
1062 Ga0495624_0141822 3300046690 Bacteria 1472
1063 Ga0495649_0003733 3300046694 Bacteria 10126
1064 Ga0495600_0035360 3300046809 Bacteria 3244
1065 Ga0495660_0011718 3300046810 Bacteria 5085
1066 Ga0495687_001245 3300047443 Bacteria 24266
1067 Ga0495687_006509 3300047443 Bacteria 7139
1068 Ga0495684_0009674 3300047471 Bacteria 7433
1069 Ga0495686_0004667 3300047472 Bacteria 11120
1070 Ga0495614_0047155 3300048089 Bacteria 1848
1071 Ga0495626_0040837 3300048091 Bacteria 2189
1072 Ga0496101_0037780 3300048904 Bacteria 3427
1073 Ga0496102_0031890 3300048905 Bacteria 4731
1074 Ga0496102_0088714 3300048905 Bacteria 2860
1075 Ga0496102_0106783 3300048905 Bacteria 2606
1076 Ga0496103_0081603 3300048906 Bacteria 2034
1077 Ga0496104_0012926 3300048907 Bacteria 7517
1078 Ga0496104_0026942 3300048907 Bacteria 5314
1079 Ga0496104_0099535 3300048907 Bacteria 2783
1080 Ga0496104_0157121 3300048907 Bacteria 2182
1081 Ga0496105_0004334 3300048908 Bacteria 10691
1082 Ga0496105_0241975 3300048908 Bacteria 1464
1083 Ga0496106_0012494 3300048909 Bacteria 6272
1084 Ga0496106_0061995 3300048909 Bacteria 2839
1085 Ga0496106_0070241 3300048909 Bacteria 2674
1086 Ga0496106_0248339 3300048909 Bacteria 1422
1087 Ga0496107_0011591 3300048910 Bacteria 6145
1088 Ga0496107_0027930 3300048910 Bacteria 4008
1089 Ga0496107_0046929 3300048910 Bacteria 3110
1090 Ga0496108_0005893 3300048911 Bacteria 9933
1091 Ga0496108_0011478 3300048911 Bacteria 7201
1092 Ga0496108_0014711 3300048911 Bacteria 6385
1093 Ga0496108_0024257 3300048911 Bacteria 4994
1094 Ga0496108_0148968 3300048911 Bacteria 2019
1095 Ga0496109_0006131 3300048912 Bacteria 10102
1096 Ga0496109_0006900 3300048912 Bacteria 9579
1097 Ga0496109_0028326 3300048912 Bacteria 5009
1098 Ga0496109_0264382 3300048912 Bacteria 1621
1099 Ga0496109_0309477 3300048912 Bacteria 1490
1100 Ga0496110_0042331 3300048913 Bacteria 3975
1101 Ga0496110_0156597 3300048913 Bacteria 2064
1102 Ga0496112_0000236 3300048915 Bacteria 35432
1103 Ga0496112_0017188 3300048915 Bacteria 6793
1104 Ga0496112_0023002 3300048915 Bacteria 5947
1105 Ga0496112_0180654 3300048915 Bacteria 2074
1106 Ga0496113_0037930 3300048916 Bacteria 3540
1107 Ga0496115_0216313 3300048918 Bacteria 1582
1108 Ga0496121_0246935 3300048924 Bacteria 1240
1109 Ga0501039_0100062 3300049575 Bacteria 2263
1110 Ga0501042_0085360 3300049578 Bacteria 2264
1111 Ga0501043_0000020 3300049579 Bacteria 155270
1112 Ga0501046_0000039 3300049580 Bacteria 155237
1113 Ga0501047_0000028 3300049581 Bacteria 220279
1114 Ga0501048_0001183 3300049582 Bacteria 19737
1115 Ga0501070_0004047 3300049586 Bacteria 12597
1116 Ga0501072_0007324 3300049588 Bacteria 8370
1117 Ga0501073_0003943 3300049589 Bacteria 11129
1118 Ga0501080_0001874 3300049742 Bacteria 18084
1119 Ga0501080_0075842 3300049742 Bacteria 3127
1120 Ga0501044_0003956 3300049823 Bacteria 16593
1121 nmdc:mga03683_3376_c2 3300050489 Bacteria 4201
1122 nmdc:mga00v17_43594_c1 3300050491 Bacteria 2702
1123 nmdc:mga0k408_30992_c1 3300050493 Bacteria 3051
1124 nmdc:mga0k408_34670_c1 3300050493 Bacteria 2890
1125 nmdc:mga06z11_40159_c1 3300050494 Bacteria 2333
1126 nmdc:mga07m45_3285_c1 3300050496 Bacteria 7780
1127 nmdc:mga07m45_5070_c1 3300050496 Bacteria 6514
1128 nmdc:mga07m45_5492_c1 3300050496 Bacteria 6315
1129 nmdc:mga05p37_63610_c1 3300050507 Bacteria 4541
1130 nmdc:mga09592_1332_c1 3300050508 Bacteria 19780
1131 nmdc:mga09592_4095_c1 3300050508 Bacteria 11773
1132 nmdc:mga0qj67_64064_c1 3300050509 Bacteria 2923
1133 nmdc:mga06r32_11479_c1 3300050510 Bacteria 7979
1134 nmdc:mga06r32_267201_c1 3300050510 Bacteria 1698
1135 nmdc:mga08y16_336092_c1 3300050511 Bacteria 1553
1136 nmdc:mga08y16_53021_c1 3300050511 Bacteria 4242
1137 nmdc:mga0n895_10329_c1 3300050512 Bacteria 8236
1138 nmdc:mga0n895_5613_c1 3300050512 Bacteria 10508
1139 nmdc:mga0n895_71949_c1 3300050512 Bacteria 3429
1140 nmdc:mga0rr50_172555_c1 3300050513 Bacteria 1763
1141 nmdc:mga0rr50_47447_c1 3300050513 Bacteria 3168
1142 nmdc:mga08x19_5093_c1 3300050514 Bacteria 7772
1143 nmdc:mga0sz30_6578_c1 3300050516 Bacteria 4323
1144 Ga0495595_0060707 3300053084 Bacteria 1770
1145 Ga0495619_0020929 3300053085 Bacteria 4171
1146 Ga0500644_0009802 3300053088 Bacteria 2573
1147 Ga0500641_0050075 3300053096 Bacteria 1715
1148 Ga0500562_002164 3300053108 Bacteria 4908
1149 Ga0500593_000168 3300053117 Bacteria 26386
1150 Ga0500593_072191 3300053117 Bacteria 1496
1151 Ga0500658_0017740 3300053134 Bacteria 2662
1152 Ga0500568_0061063 3300053139 Bacteria 1459
1153 Ga0500586_002853 3300053145 Bacteria 3985
1154 Ga0500616_0021434 3300053153 Bacteria 3623
1155 Ga0500645_000333 3300053730 Bacteria 33591
1156 Ga0500645_002999 3300053730 Bacteria 7146
1157 Ga0500645_003356 3300053730 Bacteria 6556
1158 2511245444 2511231002 Bacteria 5042903
1159 Ga0070660_100054324
1160 JGI25155J39150_1000184
1161 JGI25156J39149_1000100
1162 JGI25154J39366_1000121
1163 JGI25157J39369_1000130
1164 JGI25150J39212_1001463
1165 JGI25159J45721_1000190
1166 JGI25159J45721_1012062
1167 JGI25151J46595_10009816
1168 rootH1_10027120
1169 JGI25160J50197_1000345
1170 JGI25160J50197_1000460
1171 JGI25161J50226_1000007
1172 Ga0055526_1016911
1173 Ga0055526_1022093
1174 Ga0055537_1000254
1175 Ga0055524_1000101
1176 Ga0055524_1000471
1177 Ga0055536_1019146
1178 Ga0055534_1000846
1179 Ga0055528_1001026
1180 Ga0055530_10001100
1181 Ga0055540_1000099
1182 Ga0055540_1000670
1183 Ga0055531_10007669
1184 Ga0055543_1002444
1185 Ga0065165_1018671
1186 Ga0065165_1026396
1187 Ga0070658_10008499
1188 Ga0070658_10021485
1189 Ga0070676_10000943
1190 Ga0070676_10002226
1191 Ga0070676_10025652
1192 Ga0070676_10027597
1193 Ga0070676_10030869
1194 Ga0070676_10049025
1195 Ga0070683_100089244
1196 Ga0070683_100204173
1197 Ga0070690_100010525
1198 Ga0070690_100028919
1199 Ga0070690_100090655
1200 Ga0070670_100001968
1201 Ga0070670_100002937
1202 Ga0070670_100002946
1203 Ga0070670_100006486
1204 Ga0070670_100012554
1205 Ga0070670_100014553
1206 Ga0070670_100028425
1207 Ga0070670_100050020
1208 Ga0070670_100067193
1209 Ga0070670_100067440
1210 Ga0070670_100107326
1211 Ga0070670_100118913
1212 Ga0070670_100129207
1213 Ga0070670_100162125
1214 Ga0070670_100180771
1215 Ga0070670_100333113
1216 Ga0070677_10052303
1217 Ga0068869_100001034
1218 Ga0068869_100001799
1219 Ga0068869_100012846
1220 Ga0068869_100029902
1221 Ga0068869_100034459
1222 Ga0068869_100045142
1223 Ga0068869_100094547
1224 Ga0070666_10005279
1225 Ga0070666_10009292
1226 Ga0070666_10017819
1227 Ga0070666_10019738
1228 Ga0070666_10024734
1229 Ga0070666_10036872
1230 Ga0070666_10047964
1231 Ga0070666_10055552
1232 Ga0070680_100061655
1233 Ga0070682_100008067
1234 Ga0070682_100015302
1235 Ga0068868_100002986
1236 Ga0068868_100014647
1237 Ga0068868_100018190
1238 Ga0068868_100018451
1239 Ga0068868_100019720
1240 Ga0068868_100029545
1241 Ga0068868_100049989
1242 Ga0068868_100061036
1243 Ga0068868_100062246
1244 Ga0068868_100083063
1245 Ga0068868_100116847
1246 Ga0070660_100004244
1247 Ga0070660_100191804
1248 Ga0070689_100012532
1249 Ga0070689_100066652
1250 Ga0070689_100217924
1251 Ga0070691_10047375
1252 Ga0070687_100008151
1253 Ga0070661_100001036
1254 Ga0070692_10006369
1255 Ga0070692_10178598
1256 Ga0070668_100002402
1257 Ga0070668_100007201
1258 Ga0070668_100010557
1259 Ga0070668_100015222
1260 Ga0070668_100020482
1261 Ga0070668_100038155
1262 Ga0070668_100098102
1263 Ga0070669_100002383
1264 Ga0070669_100012560
1265 Ga0070669_100033582
1266 Ga0070669_100086405
1267 Ga0070669_100274335
1268 Ga0070675_100000127
1269 Ga0070675_100001971
1270 Ga0070675_100006731
1271 Ga0070675_100015010
1272 Ga0070675_100025409
1273 Ga0070675_100039164
1274 Ga0070675_100074087
1275 Ga0070675_100079959
1276 Ga0070675_100082804
1277 Ga0070675_100144371
1278 Ga0070675_100321320
1279 Ga0070675_100361508
1280 Ga0070671_100000385
1281 Ga0070671_100001641
1282 Ga0070671_100003515
1283 Ga0070671_100004635
1284 Ga0070671_100014500
1285 Ga0070671_100014712
1286 Ga0070671_100056883
1287 Ga0070671_100080194
1288 Ga0070671_100108136
1289 Ga0070671_100149782
1290 Ga0070671_100329472
1291 Ga0070674_100000721
1292 Ga0070674_100000959
1293 Ga0070674_100020481
1294 Ga0070674_100208749
1295 Ga0070673_100000167
1296 Ga0070673_100001120
1297 Ga0070673_100007920
1298 Ga0070673_100015192
1299 Ga0070673_100047716
1300 Ga0070673_100065453
1301 Ga0070673_100073899
1302 Ga0070673_100084228
1303 Ga0070673_100107635
1304 Ga0070688_100001497
1305 Ga0070688_100073373
1306 Ga0070688_100119178
1307 Ga0070688_100160767
1308 Ga0070659_100000182
1309 Ga0070659_100009933
1310 Ga0070659_100017045
1311 Ga0070659_100031751
1312 Ga0070659_100112508
1313 Ga0070667_100004836
1314 Ga0070667_100005678
1315 Ga0070667_100008145
1316 Ga0070667_100020241
1317 Ga0070667_100050033
1318 Ga0070667_100054977
1319 Ga0070667_100082071
1320 Ga0070667_100105692
1321 Ga0070667_100203009
1322 Ga0070709_10002358
1323 Ga0070709_10061900
1324 Ga0070709_10103530
1325 Ga0070709_10105999
1326 Ga0070714_100016001
1327 Ga0070714_100021195
1328 Ga0070714_100038078
1329 Ga0070713_100000097
1330 Ga0070713_100000757
1331 Ga0070713_100037387
1332 Ga0070713_100198455
1333 Ga0070701_10016194
1334 Ga0070701_10045169
1335 Ga0070711_100000353
1336 Ga0070711_100044097
1337 Ga0070700_100047990
1338 Ga0070708_100000315
1339 Ga0070708_100166999
1340 Ga0070708_100195030
1341 Ga0070663_100029088
1342 Ga0070678_100001077
1343 Ga0070678_100001165
1344 Ga0070678_100007294
1345 Ga0070678_100014516
1346 Ga0070678_100107420
1347 Ga0070678_100156871
1348 Ga0070678_100164983
1349 Ga0070678_100206313
1350 Ga0070678_100322037
1351 Ga0070662_100000120
1352 Ga0070662_100007935
1353 Ga0070662_100047348
1354 Ga0070662_100099003
1355 Ga0070662_100100793
1356 Ga0070681_10004889
1357 Ga0070681_10012410
1358 Ga0070681_10012501
1359 Ga0070681_10121466
1360 Ga0068867_100000062
1361 Ga0068867_100001859
1362 Ga0068867_100006992
1363 Ga0068867_100008167
1364 Ga0068867_100008581
1365 Ga0068867_100028297
1366 Ga0068867_100031007
1367 Ga0068867_100051318
1368 Ga0068867_100054280
1369 Ga0068867_100156458
1370 Ga0070685_10007416
1371 Ga0070685_10008492
1372 Ga0070706_100039126
1373 Ga0070706_100170632
1374 Ga0070706_100235224
1375 Ga0070707_100020374
1376 Ga0070707_100034045
1377 Ga0070707_100056285
1378 Ga0070698_100013851
1379 Ga0070698_100019564
1380 Ga0070698_100110078
1381 Ga0070698_100230035
1382 Ga0070698_100236869
1383 Ga0070699_100002253
1384 Ga0070699_100010100
1385 Ga0070699_100060263
1386 Ga0070679_100001334
1387 Ga0070679_100018567
1388 Ga0070679_100044953
1389 Ga0070679_100055000
1390 Ga0070679_100163213
1391 Ga0070684_100017898
1392 Ga0070684_100127694
1393 Ga0070697_100021116
1394 Ga0070697_100244060
1395 Ga0068853_100010730
1396 Ga0068853_100017799
1397 Ga0068853_100027393
1398 Ga0068853_100047410
1399 Ga0068853_100053842
1400 Ga0068853_100066477
1401 Ga0068853_100109659
1402 Ga0068853_100114704
1403 Ga0068853_100306789
1404 Ga0068853_100316157
1405 Ga0070672_100001991
1406 Ga0070672_100003372
1407 Ga0070672_100006508
1408 Ga0070672_100014345
1409 Ga0070672_100016987
1410 Ga0070672_100056037
1411 Ga0070672_100077498
1412 Ga0070672_100085266
1413 Ga0070672_100107881
1414 Ga0070672_100183772
1415 Ga0070672_100212367
1416 Ga0070672_100270909
1417 Ga0070672_100328721
1418 Ga0070695_100054746
1419 Ga0070695_100106331
1420 Ga0070696_100003984
1421 Ga0070693_100024263
1422 Ga0070693_100026617
1423 Ga0070665_100005025
1424 Ga0070665_100010909
1425 Ga0070665_100012296
1426 Ga0070665_100101908
1427 Ga0070704_100008935
1428 Ga0070704_100135027
1429 Ga0068855_100001125
1430 Ga0068855_100003748
1431 Ga0068855_100004880
1432 Ga0068855_100008578
1433 Ga0068855_100025077
1434 Ga0068855_100032601
1435 Ga0068855_100054584
1436 Ga0068855_100101687
1437 Ga0068855_100140689
1438 Ga0068855_100241966
1439 Ga0070664_100000226
1440 Ga0070664_100001477
1441 Ga0070664_100032340
1442 Ga0070664_100058916
1443 Ga0070664_100260018
1444 Ga0070664_100266765
1445 Ga0070664_100276530
1446 Ga0068857_100003262
1447 Ga0068857_100003640
1448 Ga0068857_100186461
1449 Ga0068857_100244180
1450 Ga0068854_100002997
1451 Ga0068854_100006927
1452 Ga0068854_100024128
1453 Ga0068854_100087317
1454 Ga0068854_100141851
1455 Ga0068856_100001739
1456 Ga0068856_100005592
1457 Ga0068856_100006483
1458 Ga0068856_100103480
1459 Ga0068856_100185060
1460 Ga0070702_100043264
1461 Ga0068852_100000458
1462 Ga0068852_100000500
1463 Ga0068852_100000662
1464 Ga0068852_100015799
1465 Ga0068852_100036291
1466 Ga0068852_100041890
1467 Ga0068852_100077128
1468 Ga0068852_100082431
1469 Ga0068852_100128945
1470 Ga0068852_100131576
1471 Ga0068852_100219770
1472 Ga0068859_100001046
1473 Ga0068859_100003087
1474 Ga0068859_100003577
1475 Ga0068859_100067783
1476 Ga0068859_100083345
1477 Ga0068859_100108579
1478 Ga0068859_100111214
1479 Ga0068859_100343067
1480 Ga0068859_100410530
1481 Ga0068864_100000351
1482 Ga0068864_100000942
1483 Ga0068864_100001845
1484 Ga0068864_100002069
1485 Ga0068864_100046206
1486 Ga0068864_100069347
1487 Ga0068864_100387734
1488 Ga0068866_10004677
1489 Ga0068861_100005292
1490 Ga0068861_100007550
1491 Ga0068861_100047221
1492 Ga0068861_100239396
1493 Ga0068861_100291821
1494 Ga0068851_10000412
1495 Ga0068851_10001605
1496 Ga0068851_10004682
1497 Ga0068851_10007638
1498 Ga0068870_10003842
1499 Ga0068870_10094278
1500 Ga0068863_100001007
1501 Ga0068863_100002587
1502 Ga0068863_100004932
1503 Ga0068863_100010333
1504 Ga0068863_100012385
1505 Ga0068863_100021455
1506 Ga0068863_100123818
1507 Ga0068863_100258882
1508 Ga0068863_100425298
1509 Ga0068858_100000729
1510 Ga0068858_100001611
1511 Ga0068858_100003527
1512 Ga0068858_100012968
1513 Ga0068858_100023202
1514 Ga0068858_100250041
1515 Ga0068858_100314204
1516 Ga0068860_100004676
1517 Ga0068860_100016056
1518 Ga0068860_100027890
1519 Ga0068860_100034064
1520 Ga0068860_100049436
1521 Ga0068860_100050963
1522 Ga0068860_100254545
1523 Ga0068860_100341032
1524 Ga0068862_100023321
1525 Ga0068862_100149431
1526 Ga0068862_100226368
1527 Ga0081539_10011444
1528 Ga0081539_10061406
1529 Ga0075365_10019547
1530 Ga0075364_10037695
1531 Ga0075364_10042646
1532 Ga0070712_100027786
1533 Ga0070712_100043375
1534 Ga0075362_10003797
1535 Ga0075362_10047606
1536 Ga0075367_10081319
1537 Ga0075367_10116769
1538 Ga0075366_10018128
1539 Ga0075366_10157074
1540 Ga0097621_100001301
1541 Ga0097621_100002452
1542 Ga0097621_100014377
1543 Ga0097621_100015621
1544 Ga0097621_100045116
1545 Ga0097621_100093719
1546 Ga0097621_100093937
1547 Ga0097621_100137172
1548 Ga0097621_100220388
1549 Ga0075370_10000861
1550 Ga0075370_10002560
1551 Ga0075370_10004395
1552 Ga0075370_10020261
1553 Ga0075370_10063368
1554 Ga0068871_100003319
1555 Ga0068871_100019509
1556 Ga0068871_100056011
1557 Ga0068871_100075094
1558 Ga0068871_100136455
1559 Ga0068871_100152332
1560 Ga0075428_100061274
1561 Ga0075428_100300749
1562 Ga0075431_100019118
1563 Ga0075431_100034615
1564 Ga0075433_10050544
1565 Ga0075429_100000922
1566 Ga0068865_100011641
1567 Ga0068865_100047395
1568 Ga0068865_100049201
1569 Ga0068865_100104142
1570 Ga0075436_100004769
1571 Ga0097620_100001046
1572 Ga0097620_100003087
1573 Ga0097620_100003577
1574 Ga0097620_100067784
1575 Ga0097620_100083345
1576 Ga0097620_100108582
1577 Ga0097620_100111221
1578 Ga0097620_100343032
1579 Ga0097620_100410530
1580 Ga0075435_100010388
1581 Ga0105240_10003161
1582 Ga0105240_10003767
1583 Ga0105240_10005554
1584 Ga0105240_10079899
1585 Ga0105240_10144226
1586 Ga0105240_10209153
1587 Ga0105240_10256237
1588 Ga0111539_10032437
1589 Ga0111539_10084171
1590 Ga0105245_10013244
1591 Ga0105245_10014066
1592 Ga0105245_10018830
1593 Ga0105245_10093457
1594 Ga0114129_10042449
1595 Ga0114129_10182925
1596 Ga0105243_10000800
1597 Ga0105243_10071689
1598 Ga0105243_10101047
1599 Ga0105241_10017308
1600 Ga0105241_10140826
1601 Ga0105242_10001678
1602 Ga0105242_10217866
1603 Ga0105248_10004085
1604 Ga0105248_10031198
1605 Ga0105248_10031400
1606 Ga0105248_10038460
1607 Ga0105248_10153370
1608 Ga0105248_10177995
1609 Ga0105248_10381614
1610 Ga0105248_10526707
1611 Ga0105237_10021331
1612 Ga0105237_10053472
1613 Ga0105237_10065966
1614 Ga0105237_10122700
1615 Ga0105237_10177525
1616 Ga0105238_10000770
1617 Ga0105238_10020736
1618 Ga0105238_10021155
1619 Ga0105238_10027934
1620 Ga0105238_10034888
1621 Ga0105238_10076212
1622 Ga0105238_10181607
1623 Ga0105249_10030973
1624 Ga0105249_10058524
1625 Ga0105249_10074108
1626 Ga0105249_10080323
1627 Ga0105239_10108589
1628 Ga0105239_10278465
1629 Ga0105239_10295654
1630 Ga0105246_10049225
1631 Ga0157373_10000824
1632 Ga0157373_10040852
1633 Ga0157373_10054186
1634 Ga0157371_10001585
1635 Ga0157371_10164346
1636 Ga0157371_10190515
1637 Ga0157370_10000522
1638 Ga0157370_10003726
1639 Ga0157370_10027183
1640 Ga0157370_10027887
1641 Ga0157370_10207492
1642 Ga0157369_10000281
1643 Ga0157369_10005788
1644 Ga0157369_10058853
1645 Ga0157369_10067179
1646 Ga0157374_10006780
1647 Ga0157374_10022662
1648 Ga0157374_10026513
1649 Ga0157374_10068681
1650 Ga0157374_10121948
1651 Ga0157374_10135905
1652 Ga0157378_10025843
1653 Ga0157378_10064025
1654 Ga0163162_10003894
1655 Ga0163162_10004531
1656 Ga0163162_10013456
1657 Ga0163162_10070750
1658 Ga0163162_10099205
1659 Ga0163162_10210383
1660 Ga0163162_10314327
1661 Ga0163162_10359062
1662 Ga0157372_10002024
1663 Ga0157372_10060738
1664 Ga0157372_10069402
1665 Ga0157372_10077771
1666 Ga0157372_10085796
1667 Ga0157372_10122753
1668 Ga0157372_10237844
1669 Ga0157375_10002325
1670 Ga0157375_10026357
1671 Ga0157375_10034830
1672 Ga0157375_10046713
1673 Ga0157375_10049323
1674 Ga0157375_10080539
1675 Ga0157375_10175948
1676 Ga0157375_10194311
1677 Ga0163163_10000609
1678 Ga0163163_10048865
1679 Ga0163163_10070214
1680 Ga0163163_10074024
1681 Ga0163163_10086864
1682 Ga0163163_10134291
1683 Ga0163163_10470760
1684 Ga0157380_10004698
1685 Ga0157380_10034699
1686 Ga0157380_10035617
1687 Ga0157380_10044508
1688 Ga0157380_10127044
1689 Ga0182008_10060820
1690 Ga0157377_10000027
1691 Ga0157377_10009437
1692 Ga0157377_10025276
1693 Ga0157379_10000542
1694 Ga0157379_10004055
1695 Ga0157379_10009960
1696 Ga0157379_10012529
1697 Ga0157379_10021537
1698 Ga0157379_10037579
1699 Ga0157379_10042334
1700 Ga0157379_10057593
1701 Ga0157379_10111910
1702 Ga0157379_10129937
1703 Ga0157376_10011627
1704 Ga0157376_10032163
1705 Ga0157376_10063869
1706 Ga0157376_10068170
1707 Ga0157376_10164336
1708 Ga0163161_10019780
1709 Ga0163161_10031919
1710 Ga0163161_10034083
1711 Ga0206353_11976508
1712 Ga0213874_10007487
1713 Ga0209435_100008
1714 Ga0209436_109810
1715 Ga0207425_1000606
1716 Ga0209646_1000079
1717 Ga0209026_1000067
1718 Ga0209759_1000056
1719 Ga0209565_1000041
1720 Ga0209565_1001982
1721 Ga0209673_1000012
1722 Ga0209673_1011462
1723 Ga0209673_1018410
1724 Ga0209130_1000014
1725 Ga0209130_1000184
1726 Ga0209675_1000475
1727 Ga0209675_1004691
1728 Ga0209676_1000013
1729 Ga0209676_1012673
1730 Ga0209025_1004977
1731 Ga0209025_1008314
1732 Ga0209564_1013506
1733 Ga0209758_1003920
1734 Ga0209050_1000008
1735 Ga0209256_1000003
1736 Ga0207426_1000091
1737 Ga0207426_1000174
1738 Ga0209051_1000005
1739 Ga0209051_1000351
1740 Ga0209257_1000015
1741 Ga0209257_1000048
1742 Ga0207697_10002484
1743 Ga0207697_10004215
1744 Ga0207697_10004396
1745 Ga0207697_10013772
1746 Ga0207656_10012097
1747 Ga0207656_10017476
1748 Ga0207682_10000342
1749 Ga0207682_10000872
1750 Ga0207682_10003293
1751 Ga0207682_10018186
1752 Ga0207682_10047116
1753 Ga0207642_10001795
1754 Ga0207688_10036362
1755 Ga0207688_10042167
1756 Ga0207688_10082167
1757 Ga0207680_10001055
1758 Ga0207680_10020976
1759 Ga0207685_10026204
1760 Ga0207645_10000187
1761 Ga0207645_10000549
1762 Ga0207645_10001311
1763 Ga0207645_10001481
1764 Ga0207645_10008783
1765 Ga0207645_10026715
1766 Ga0207645_10031874
1767 Ga0207645_10037131
1768 Ga0207645_10041995
1769 Ga0207645_10145300
1770 Ga0207643_10008272
1771 Ga0207643_10009896
1772 Ga0207643_10012975
1773 Ga0207643_10014253
1774 Ga0207643_10130318
1775 Ga0207684_10003796
1776 Ga0207684_10006140
1777 Ga0207684_10111079
1778 Ga0207654_10017869
1779 Ga0207654_10068080
1780 Ga0207707_10009156
1781 Ga0207707_10011841
1782 Ga0207707_10059387
1783 Ga0207695_10004522
1784 Ga0207695_10010199
1785 Ga0207695_10017725
1786 Ga0207695_10031694
1787 Ga0207695_10046968
1788 Ga0207695_10368972
1789 Ga0207671_10018195
1790 Ga0207671_10231819
1791 Ga0207693_10000760
1792 Ga0207663_10103040
1793 Ga0207660_10006497
1794 Ga0207660_10084728
1795 Ga0207662_10010356
1796 Ga0207657_10000102
1797 Ga0207657_10000250
1798 Ga0207657_10002028
1799 Ga0207657_10018911
1800 Ga0207657_10022540
1801 Ga0207657_10027081
1802 Ga0207657_10072560
1803 Ga0207657_10088335
1804 Ga0207649_10001379
1805 Ga0207649_10015846
1806 Ga0207649_10037066
1807 Ga0207652_10008684
1808 Ga0207652_10028777
1809 Ga0207652_10041779
1810 Ga0207652_10055805
1811 Ga0207652_10108492
1812 Ga0207652_10255610
1813 Ga0207646_10003241
1814 Ga0207646_10198377
1815 Ga0207681_10004744
1816 Ga0207681_10014587
1817 Ga0207681_10028877
1818 Ga0207681_10050273
1819 Ga0207681_10060027
1820 Ga0207681_10207824
1821 Ga0207681_10249161
1822 Ga0207694_10002414
1823 Ga0207694_10007634
1824 Ga0207650_10009000
1825 Ga0207650_10020808
1826 Ga0207650_10022286
1827 Ga0207650_10022544
1828 Ga0207650_10028325
1829 Ga0207650_10078089
1830 Ga0207650_10087477
1831 Ga0207650_10091257
1832 Ga0207650_10120402
1833 Ga0207650_10130385
1834 Ga0207659_10000667
1835 Ga0207659_10002664
1836 Ga0207659_10003251
1837 Ga0207659_10048759
1838 Ga0207659_10062068
1839 Ga0207659_10253636
1840 Ga0207659_10285306
1841 Ga0207687_10000552
1842 Ga0207700_10019091
1843 Ga0207664_10003534
1844 Ga0207664_10010398
1845 Ga0207664_10013527
1846 Ga0207664_10052682
1847 Ga0207644_10000896
1848 Ga0207644_10002572
1849 Ga0207644_10002934
1850 Ga0207644_10008922
1851 Ga0207644_10018118
1852 Ga0207644_10019596
1853 Ga0207644_10021247
1854 Ga0207644_10024165
1855 Ga0207644_10037870
1856 Ga0207644_10038646
1857 Ga0207644_10041708
1858 Ga0207644_10049764
1859 Ga0207644_10158327
1860 Ga0207644_10189120
1861 Ga0207644_10237927
1862 Ga0207690_10000595
1863 Ga0207690_10011539
1864 Ga0207690_10043804
1865 Ga0207706_10000095
1866 Ga0207706_10008022
1867 Ga0207706_10009183
1868 Ga0207706_10022684
1869 Ga0207706_10045322
1870 Ga0207706_10146582
1871 Ga0207686_10019685
1872 Ga0207686_10021919
1873 Ga0207686_10039328
1874 Ga0207709_10001223
1875 Ga0207670_10008604
1876 Ga0207670_10020892
1877 Ga0207670_10075278
1878 Ga0207670_10219391
1879 Ga0207669_10002060
1880 Ga0207669_10013573
1881 Ga0207669_10029300
1882 Ga0207669_10055186
1883 Ga0207669_10070658
1884 Ga0207669_10147148
1885 Ga0207704_10016205
1886 Ga0207704_10059006
1887 Ga0207665_10017332
1888 Ga0207665_10043115
1889 Ga0207665_10142432
1890 Ga0207691_10000105
1891 Ga0207691_10000714
1892 Ga0207691_10002172
1893 Ga0207691_10006527
1894 Ga0207691_10013136
1895 Ga0207691_10021256
1896 Ga0207691_10023709
1897 Ga0207691_10025435
1898 Ga0207691_10030035
1899 Ga0207691_10032460
1900 Ga0207691_10041548
1901 Ga0207691_10105629
1902 Ga0207691_10129314
1903 Ga0207691_10167395
1904 Ga0207691_10252294
1905 Ga0207691_10260526
1906 Ga0207711_10001126
1907 Ga0207711_10017801
1908 Ga0207711_10020081
1909 Ga0207711_10045238
1910 Ga0207711_10278224
1911 Ga0207689_10002780
1912 Ga0207689_10019565
1913 Ga0207689_10023567
1914 Ga0207689_10023633
1915 Ga0207689_10035073
1916 Ga0207689_10076380
1917 Ga0207661_10004715
1918 Ga0207661_10050901
1919 Ga0207661_10063313
1920 Ga0207679_10001294
1921 Ga0207679_10001787
1922 Ga0207679_10006374
1923 Ga0207679_10133344
1924 Ga0207679_10235534
1925 Ga0207667_10000233
1926 Ga0207667_10000705
1927 Ga0207667_10004358
1928 Ga0207667_10008512
1929 Ga0207667_10027515
1930 Ga0207667_10036751
1931 Ga0207667_10082074
1932 Ga0207667_10082392
1933 Ga0207667_10143862
1934 Ga0207667_10152326
1935 Ga0207667_10238693
1936 Ga0207651_10000831
1937 Ga0207651_10010722
1938 Ga0207651_10012678
1939 Ga0207651_10019863
1940 Ga0207651_10035760
1941 Ga0207651_10048189
1942 Ga0207651_10049978
1943 Ga0207651_10057304
1944 Ga0207651_10057723
1945 Ga0207651_10097344
1946 Ga0207712_10033101
1947 Ga0207668_10002236
1948 Ga0207668_10002618
1949 Ga0207668_10004388
1950 Ga0207668_10007648
1951 Ga0207668_10070196
1952 Ga0207668_10195304
1953 Ga0207640_10045601
1954 Ga0207640_10072230
1955 Ga0207640_10084294
1956 Ga0207640_10138845
1957 Ga0207658_10000888
1958 Ga0207658_10019046
1959 Ga0207658_10031367
1960 Ga0207658_10042876
1961 Ga0207658_10051093
1962 Ga0207658_10060331
1963 Ga0207658_10080544
1964 Ga0207658_10092506
1965 Ga0207658_10099992
1966 Ga0207658_10156152
1967 Ga0207677_10000920
1968 Ga0207677_10001799
1969 Ga0207677_10008911
1970 Ga0207677_10016618
1971 Ga0207677_10026668
1972 Ga0207677_10028957
1973 Ga0207677_10041033
1974 Ga0207703_10000552
1975 Ga0207703_10001926
1976 Ga0207703_10002841
1977 Ga0207703_10023790
1978 Ga0207639_10016661
1979 Ga0207639_10023193
1980 Ga0207639_10036184
1981 Ga0207639_10048214
1982 Ga0207639_10074377
1983 Ga0207639_10085263
1984 Ga0207639_10104314
1985 Ga0207678_10001717
1986 Ga0207678_10003576
1987 Ga0207678_10038426
1988 Ga0207708_10000558
1989 Ga0207708_10070755
1990 Ga0207708_10132696
1991 Ga0207708_10194323
1992 Ga0207702_10003371
1993 Ga0207702_10003800
1994 Ga0207702_10010094
1995 Ga0207702_10026920
1996 Ga0207702_10043463
1997 Ga0207702_10118309
1998 Ga0207702_10214812
1999 Ga0207641_10004175
2000 Ga0207641_10007772
2001 Ga0207641_10014973
2002 Ga0207641_10019122
2003 Ga0207641_10033691
2004 Ga0207641_10035271
2005 Ga0207641_10037317
2006 Ga0207641_10041719
2007 Ga0207641_10100996
2008 Ga0207641_10158867
2009 Ga0207648_10000119
2010 Ga0207648_10000320
2011 Ga0207648_10004062
2012 Ga0207648_10004701
2013 Ga0207648_10006217
2014 Ga0207648_10007882
2015 Ga0207648_10012586
2016 Ga0207648_10015531
2017 Ga0207648_10027008
2018 Ga0207648_10044778
2019 Ga0207648_10175059
2020 Ga0207676_10000754
2021 Ga0207676_10003962
2022 Ga0207676_10004363
2023 Ga0207676_10012830
2024 Ga0207676_10032326
2025 Ga0207676_10038516
2026 Ga0207676_10048121
2027 Ga0207676_10079621
2028 Ga0207676_10083844
2029 Ga0207676_10146269
2030 Ga0207676_10167153
2031 Ga0207676_10279818
2032 Ga0207676_10326278
2033 Ga0207674_10000131
2034 Ga0207674_10000326
2035 Ga0207674_10017466
2036 Ga0207674_10022792
2037 Ga0207674_10065661
2038 Ga0207675_100002315
2039 Ga0207675_100008094
2040 Ga0207675_100009226
2041 Ga0207675_100018862
2042 Ga0207675_100026114
2043 Ga0207675_100032329
2044 Ga0207675_100062115
2045 Ga0207675_100064138
2046 Ga0207675_100090625
2047 Ga0207675_100102799
2048 Ga0207675_100154574
2049 Ga0207675_100195178
2050 Ga0207675_100309031
2051 Ga0207683_10000012
2052 Ga0207683_10000189
2053 Ga0207683_10001281
2054 Ga0207683_10001576
2055 Ga0207683_10005513
2056 Ga0207683_10007348
2057 Ga0207683_10023415
2058 Ga0207683_10065555
2059 Ga0207683_10256520
2060 Ga0207698_10000838
2061 Ga0207698_10006574
2062 Ga0207698_10017000
2063 Ga0207698_10021702
2064 Ga0207698_10029059
2065 Ga0207698_10078807
2066 Ga0207698_10091410
2067 Ga0207698_10118509
2068 Ga0207698_10153925
2069 Ga0209983_1003292
2070 Ga0209974_10001061
2071 Ga0209974_10007612
2072 Ga0207428_10142240
2073 Ga0268266_10011709
2074 Ga0268266_10018595
2075 Ga0268266_10133824
2076 Ga0268266_10305266
2077 Ga0268265_10016989
2078 Ga0268265_10078541
2079 Ga0268265_10093071
2080 Ga0268265_10179164
2081 Ga0268264_10000940
2082 Ga0268264_10002657
2083 Ga0268264_10025198
2084 Ga0268264_10067926
2085 Ga0268264_10104538
2086 Ga0268264_10151159
2087 Ga0268264_10280841
2088 Ga0307515_10000049
2089 Ga0307515_10000066
2090 Ga0307515_10059324
2091 Ga0307515_10209939
2092 Ga0265330_10003071
2093 Ga0265332_10003672
2094 Ga0265328_10025715
2095 Ga0265325_10049461
2096 Ga0265329_10003353
2097 Ga0265331_10000350
2098 Ga0265327_10004829
2099 Ga0265316_10013413
2100 Ga0307513_10002838
2101 Ga0307513_10011393
2102 Ga0307513_10019123
2103 Ga0307513_10021758
2104 Ga0307408_100013842
2105 Ga0307408_100034862
2106 Ga0307408_100220747
2107 Ga0307408_100223794
2108 Ga0265314_10009272
2109 Ga0265342_10012348
2110 Ga0307516_10000921
2111 Ga0307405_10000621
2112 Ga0307405_10008967
2113 Ga0307413_10001173
2114 Ga0307413_10052708
2115 Ga0307413_10054170
2116 Ga0307410_10007236
2117 Ga0307410_10008853
2118 Ga0307410_10011061
2119 Ga0307410_10073292
2120 Ga0307406_10004418
2121 Ga0307406_10009058
2122 Ga0307412_10006741
2123 Ga0307412_10018324
2124 Ga0307409_100017199
2125 Ga0307409_100058389
2126 Ga0307409_100081058
2127 Ga0307409_100202891
2128 Ga0307416_100260672
2129 Ga0307414_10061301
2130 Ga0307411_10001216
2131 Ga0307411_10005304
2132 Ga0307415_100057526
2133 Ga0373929_0008600
2134 Ga0373936_0011058
2135 Ga0373945_0036077
2136 Ga0373953_0002967
2137 Ga0373954_0003328
2138 Ga0373957_0023088
2139 Ga0373943_0034515
2140 Ga0373924_0004776
2141 Ga0373924_0041635
2142 Ga0373931_0067732
2143 Ga0373935_0004177
2144 Ga0373927_0031424
2145 Ga0373927_0133842
2146 Ga0373933_0011865
2147 Ga0373933_0085424
2148 Ga0373947_0009997
2149 Ga0373947_0072170
2150 Ga0373947_0168043
2151 Ga0373937_0016249
2152 Ga0373937_0115025
2153 Ga0373925_0044516
2154 Ga0373925_0081370
2155 Ga0395899_0020711
2156 Ga0395899_0033049
2157 Ga0395899_0214821
2158 Ga0395900_0055217
2159 Ga0395900_0224846
2160 Ga0395900_0257331
2161 Ga0395900_0289671
2162 Ga0395898_0011650
2163 Ga0395898_0016629
2164 Ga0395898_0049453
2165 Ga0395905_0003737
2166 Ga0395905_0028706
2167 Ga0395905_0092657
2168 Ga0395905_0295756
2169 Ga0395901_0084049
2170 Ga0395901_0174784
2171 Ga0395901_0174792
2172 Ga0395901_0281844
2173 Ga0436361_1220556
2174 Ga0436363_1036156
2175 Ga0439450_032563
2176 Ga0450890_014151
2177 Ga0439464_0005719
2178 Ga0439464_0011936
2179 Ga0451577_0003299
2180 Ga0451577_0003837
2181 Ga0451577_0006775
2182 Ga0451577_0118292
2183 Ga0451577_0118605
2184 Ga0451577_0132250
2185 Ga0451577_0172583
2186 Ga0453683_0001373
2187 Ga0453683_0004216
2188 Ga0466966_0004622
2189 Ga0453684_0166848
2190 Ga0453684_0232487
2191 Ga0466970_0047613
2192 Ga0466959_0023359
2193 Ga0451576_0001355
2194 Ga0451576_0002571
2195 Ga0451576_0012222
2196 Ga0451576_0024684
2197 Ga0451576_0047462
2198 Ga0451576_0190814
2199 Ga0451576_0315109
2200 Ga0495629_0062279
2201 Ga0495651_0121203
2202 Ga0495653_0051053
2203 Ga0495580_0057026
2204 Ga0495662_0070256
2205 Ga0495628_0016698
2206 Ga0495630_0066960
2207 Ga0495631_0058082
2208 Ga0495632_0012921
2209 Ga0495665_0024006
2210 Ga0495640_0194737
2211 Ga0495621_0000666
2212 Ga0495621_0005684
2213 Ga0495597_0014519
2214 Ga0495634_0024414
2215 Ga0495611_0021986
2216 Ga0495635_0013743
2217 Ga0495647_0013330
2218 Ga0495658_0186213
2219 Ga0495613_0052440
2220 Ga0495624_0141822
2221 Ga0495649_0003733
2222 Ga0495600_0035360
2223 Ga0495660_0011718
2224 Ga0495687_001245
2225 Ga0495687_006509
2226 Ga0495684_0009674
2227 Ga0495686_0004667
2228 Ga0495614_0047155
2229 Ga0495626_0040837
2230 Ga0496101_0037780
2231 Ga0496102_0031890
2232 Ga0496102_0088714
2233 Ga0496102_0106783
2234 Ga0496103_0081603
2235 Ga0496104_0012926
2236 Ga0496104_0026942
2237 Ga0496104_0099535
2238 Ga0496104_0157121
2239 Ga0496105_0004334
2240 Ga0496105_0241975
2241 Ga0496106_0012494
2242 Ga0496106_0061995
2243 Ga0496106_0070241
2244 Ga0496106_0248339
2245 Ga0496107_0011591
2246 Ga0496107_0027930
2247 Ga0496107_0046929
2248 Ga0496108_0005893
2249 Ga0496108_0011478
2250 Ga0496108_0014711
2251 Ga0496108_0024257
2252 Ga0496108_0148968
2253 Ga0496109_0006131
2254 Ga0496109_0006900
2255 Ga0496109_0028326
2256 Ga0496109_0264382
2257 Ga0496109_0309477
2258 Ga0496110_0042331
2259 Ga0496110_0156597
2260 Ga0496112_0000236
2261 Ga0496112_0017188
2262 Ga0496112_0023002
2263 Ga0496112_0180654
2264 Ga0496113_0037930
2265 Ga0496115_0216313
2266 Ga0496121_0246935
2267 Ga0501039_0100062
2268 Ga0501042_0085360
2269 Ga0501043_0000020
2270 Ga0501046_0000039
2271 Ga0501047_0000028
2272 Ga0501048_0001183
2273 Ga0501070_0004047
2274 Ga0501072_0007324
2275 Ga0501073_0003943
2276 Ga0501080_0001874
2277 Ga0501080_0075842
2278 Ga0501044_0003956
2279 nmdc:mga03683_3376_c2
2280 nmdc:mga00v17_43594_c1
2281 nmdc:mga0k408_30992_c1
2282 nmdc:mga0k408_34670_c1
2283 nmdc:mga06z11_40159_c1
2284 nmdc:mga07m45_3285_c1
2285 nmdc:mga07m45_5070_c1
2286 nmdc:mga07m45_5492_c1
2287 nmdc:mga05p37_63610_c1
2288 nmdc:mga09592_1332_c1
2289 nmdc:mga09592_4095_c1
2290 nmdc:mga0qj67_64064_c1
2291 nmdc:mga06r32_11479_c1
2292 nmdc:mga06r32_267201_c1
2293 nmdc:mga08y16_336092_c1
2294 nmdc:mga08y16_53021_c1
2295 nmdc:mga0n895_10329_c1
2296 nmdc:mga0n895_5613_c1
2297 nmdc:mga0n895_71949_c1
2298 nmdc:mga0rr50_172555_c1
2299 nmdc:mga0rr50_47447_c1
2300 nmdc:mga08x19_5093_c1
2301 nmdc:mga0sz30_6578_c1
2302 Ga0495595_0060707
2303 Ga0495619_0020929
2304 Ga0500644_0009802
2305 Ga0500641_0050075
2306 Ga0500562_002164
2307 Ga0500593_000168
2308 Ga0500593_072191
2309 Ga0500658_0017740
2310 Ga0500568_0061063
2311 Ga0500586_002853
2312 Ga0500616_0021434
2313 Ga0500645_000333
2314 Ga0500645_002999
2315 Ga0500645_003356
2316 2511245444

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00465

Fe-ADH

Iron-containing alcohol dehydrogenase

30

200

0.94

PF13685

Fe-ADH_2

Iron-containing alcohol dehydrogenase

34

133

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3owo-assembly2.cif.gz_D structures of iron-dependent alcohol dehydrogenase 2 from zymomonas mobilis zm4 with and without nad cofactor 0.9287 2 377
3bfj-assembly1.cif.gz_A crystal structure analysis of 1,3-propanediol oxidoreductase 0.928 1 377
4fr2-assembly1.cif.gz_A-2 alcohol dehydrogenase from oenococcus oeni 0.9259 2 377
3bfj-assembly1.cif.gz_A crystal structure analysis of 1,3-propanediol oxidoreductase 0.9256 1 377
3owo-assembly2.cif.gz_D structures of iron-dependent alcohol dehydrogenase 2 from zymomonas mobilis zm4 with and without nad cofactor 0.9239 2 377
ID Description Score Start End Superfamily
af_P76553_203_395_1.20.1090.10 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9683 188 377 1.20.1090.10
af_Q09669_229_422_1.20.1090.10 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9626 190 377 1.20.1090.10
af_P76553_203_395_1.20.1090.10 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9488 188 377 1.20.1090.10
3zdrA02 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9417 188 377 1.20.1090.10
3bfjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9313 12 186 3.40.50.1970
ID Description Score Start End GO Terms
AF-A0A4Q3N9I1-F1-model_v4 Iron-containing alcohol dehydrogenase 0.9949 93 377 GO:0004022
GO:0046872
AF-A0A4Q3N9I1-F1-model_v4 Iron-containing alcohol dehydrogenase 0.9914 93 377 GO:0004022
GO:0046872
AF-A0A4Q2LK58-F1-model_v4 deleted 0.979 4 340
AF-R6ZYV3-F1-model_v4 Alcohol dehydrogenase iron-type/glycerol dehydrogenase GldA domain-containing protein 0.9691 178 376 GO:0004022
GO:0046872
AF-A0A432MLX3-F1-model_v4 Iron-containing alcohol dehydrogenase 0.9689 148 377 GO:0004022
GO:0046872

Map