F490899

General Info

Members Datasets Scaffolds Average Seq Length
1154 494 1121 132

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10028779|Ga0105241_100287794
Length 156
Sequence MMAPTFGRLPFRLTPRTAIGSETAMPHFTIEYSANMDKRVDMAKVVDVVRKAAVETGIFPLGGIRVRAIKCEHYAIADGNPDLGFLSMVLRLGEGRDLAARKKAGEHIFKALSSHLDPVFAQSKFALSFDMQINDKETSWKRNNIHEALKAEAAHG

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
7 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
8 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
9 2791355199
10 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
11 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
12 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
13 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
14 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
15 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
16 2904699407
17 2906610324
18 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
19 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
20 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
21 2922425934
22 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
23 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
24 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
25 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
26 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
27 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
113 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
116 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
117 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
118 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
119 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
120 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
155 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
156 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
157 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
158 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
220 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
221 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
222 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
228 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
229 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
230 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
231 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
232 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
233 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
234 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
235 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
236 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
237 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
238 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
239 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
240 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
241 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
242 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
243 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
244 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
245 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
246 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
247 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
248 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
249 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
250 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
251 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
252 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
253 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
254 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
255 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
256 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
257 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
258 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
259 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
260 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
261 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
262 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
263 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
264 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
266 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
267 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
268 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
269 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
270 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
271 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
272 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
273 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
274 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
275 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
276 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
277 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
278 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
279 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
280 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
281 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
282 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
283 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
284 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
285 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
286 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
287 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
288 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
289 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
290 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
291 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
292 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
293 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
294 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
295 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
296 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
297 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
298 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
299 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
300 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
301 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
302 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
303 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
304 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
305 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
306 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
307 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
308 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
309 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
310 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
311 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
312 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
313 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
314 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
315 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
316 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
317 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
318 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
319 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
320 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
321 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
322 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
323 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
324 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
325 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
326 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
327 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
328 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
329 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
330 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
331 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
332 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
333 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
334 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
335 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
336 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
337 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
338 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
339 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
340 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
341 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
342 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
343 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
344 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
345 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
346 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
347 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
348 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
349 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
350 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
351 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
352 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
353 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
354 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
355 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
356 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
357 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
358 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
359 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
360 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
361 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
362 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
363 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
364 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
365 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
366 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
367 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
368 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
369 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
370 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
371 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
372 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
373 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
374 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
375 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
376 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
377 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
378 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
379 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
380 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
381 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
382 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
383 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
384 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
385 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
386 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
387 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
388 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
389 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
390 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
391 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
392 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
393 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
394 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
395 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
396 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
397 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
398 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
399 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
400 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
414 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
415 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
416 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
417 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
418 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
419 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
420 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
421 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
422 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
423 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
424 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
425 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
428 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
429 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
430 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
431 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
432 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
433 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
434 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
435 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
436 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
437 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
438 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
439 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
440 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
441 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
442 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
443 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
444 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
445 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
446 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
447 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
448 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
449 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
450 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
451 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
452 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
453 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
454 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
455 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
456 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
457 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
458 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
459 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
460 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
461 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
462 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
463 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
464 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
465 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
466 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
467 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
468 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
469 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
470 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
471 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
472 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
473 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
474 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
475 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
476 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
477 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
478 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
479 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
480 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
481 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
482 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
483 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
484 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
485 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
486 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
488 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
489 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
490 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
491 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
492 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
493 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
494 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.04
Metatranscriptomes 0.43
Isolates 2.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.23
Nodule 2.51
Rhizoplane 5.2
Rhizosphere 77.38
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10009343 3300003203 Bacteria 4392
2 JGI25165J46597_1011939 3300003214 Bacteria 1227
3 JGI25153J46596_10051467 3300003215 Bacteria 1179
4 JGI25404J52841_10003019 3300003659 Bacteria 3277
5 JGI25404J52841_10010753 3300003659 Bacteria 1969
6 JGI25404J52841_10016744 3300003659 Bacteria 1590
7 JGI25404J52841_10041444 3300003659 Bacteria 974
8 Ga0070658_10150878 3300005327 Bacteria 1946
9 Ga0070658_10362781 3300005327 Bacteria 1241
10 Ga0070676_10668089 3300005328 Bacteria 756
11 Ga0070683_100095571 3300005329 Bacteria 2794
12 Ga0070683_100306288 3300005329 Bacteria 1511
13 Ga0070683_101207674 3300005329 Bacteria 727
14 Ga0070683_101249715 3300005329 Bacteria 714
15 Ga0068869_100283829 3300005334 Bacteria 1332
16 Ga0068869_100411856 3300005334 Bacteria 1114
17 Ga0068869_101378147 3300005334 Bacteria 624
18 Ga0070680_100052018 3300005336 Bacteria 3343
19 Ga0070680_100194884 3300005336 Bacteria 1708
20 Ga0070680_100676728 3300005336 Bacteria 887
21 Ga0070682_100039753 3300005337 Bacteria 2891
22 Ga0070682_100175885 3300005337 Bacteria 1491
23 Ga0070682_100246809 3300005337 Bacteria 1285
24 Ga0070682_100503776 3300005337 Bacteria 939
25 Ga0068868_100034182 3300005338 Bacteria 3924
26 Ga0068868_100389483 3300005338 Bacteria 1200
27 Ga0068868_100548398 3300005338 Bacteria 1019
28 Ga0068868_100560813 3300005338 Bacteria 1008
29 Ga0070660_100051646 3300005339 Bacteria 3167
30 Ga0070687_100299556 3300005343 Bacteria 1020
31 Ga0070661_100328466 3300005344 Bacteria 1196
32 Ga0070661_100395995 3300005344 Bacteria 1091
33 Ga0070661_100556992 3300005344 Bacteria 923
34 Ga0070692_10391666 3300005345 Bacteria 875
35 Ga0070668_100044248 3300005347 Bacteria 3415
36 Ga0070668_100074675 3300005347 Bacteria 2645
37 Ga0070668_100207755 3300005347 Bacteria 1609
38 Ga0070668_100301249 3300005347 Bacteria 1344
39 Ga0070668_100481665 3300005347 Bacteria 1071
40 Ga0070668_100724073 3300005347 Bacteria 879
41 Ga0070669_100068986 3300005353 Bacteria 2611
42 Ga0070671_100342350 3300005355 Bacteria 1276
43 Ga0070671_100383792 3300005355 Bacteria 1201
44 Ga0070671_100708452 3300005355 Bacteria 873
45 Ga0070674_100034692 3300005356 Bacteria 3372
46 Ga0070688_100855168 3300005365 Bacteria 715
47 Ga0070659_100053918 3300005366 Bacteria 3166
48 Ga0070667_100236881 3300005367 Bacteria 1629
49 Ga0070667_100569881 3300005367 Bacteria 1042
50 Ga0070667_100623283 3300005367 Bacteria 995
51 Ga0070667_100797903 3300005367 Bacteria 876
52 Ga0070709_10004227 3300005434 Bacteria 7743
53 Ga0070709_10048345 3300005434 Bacteria 2654
54 Ga0070709_10311929 3300005434 Bacteria 1152
55 Ga0070714_100082971 3300005435 Bacteria 2793
56 Ga0070714_100280905 3300005435 Bacteria 1547
57 Ga0070714_100541466 3300005435 Bacteria 1114
58 Ga0070714_100551108 3300005435 Bacteria 1104
59 Ga0070713_100042275 3300005436 Bacteria 3719
60 Ga0070713_100088760 3300005436 Bacteria 2654
61 Ga0070713_100353933 3300005436 Bacteria 1363
62 Ga0070713_100363813 3300005436 Bacteria 1344
63 Ga0070710_10042080 3300005437 Bacteria 2524
64 Ga0070710_10179435 3300005437 Bacteria 1325
65 Ga0070711_100001730 3300005439 Bacteria 12117
66 Ga0070711_100011938 3300005439 Bacteria 5407
67 Ga0070711_100061879 3300005439 Bacteria 2607
68 Ga0070711_100131145 3300005439 Bacteria 1867
69 Ga0070711_100692074 3300005439 Bacteria 858
70 Ga0070705_100619464 3300005440 Bacteria 840
71 Ga0070700_100046080 3300005441 Bacteria 2692
72 Ga0070700_100755597 3300005441 Bacteria 778
73 Ga0070694_100787580 3300005444 Bacteria 779
74 Ga0070663_100010941 3300005455 Bacteria 5672
75 Ga0070663_100050917 3300005455 Bacteria 2947
76 Ga0070663_100068772 3300005455 Bacteria 2571
77 Ga0070663_100185086 3300005455 Bacteria 1618
78 Ga0070663_100891518 3300005455 Bacteria 768
79 Ga0070678_100010095 3300005456 Bacteria 5749
80 Ga0070678_100529455 3300005456 Bacteria 1044
81 Ga0070678_100647096 3300005456 Bacteria 948
82 Ga0070678_100700015 3300005456 Bacteria 913
83 Ga0070662_100031971 3300005457 Bacteria 3697
84 Ga0070662_100088266 3300005457 Bacteria 2324
85 Ga0070662_100457978 3300005457 Bacteria 1060
86 Ga0070662_100709265 3300005457 Bacteria 851
87 Ga0070681_10003273 3300005458 Bacteria 15113
88 Ga0070681_10025087 3300005458 Bacteria 6000
89 Ga0070681_10056849 3300005458 Bacteria 3893
90 Ga0070681_10065024 3300005458 Bacteria 3617
91 Ga0070681_10341341 3300005458 Bacteria 1408
92 Ga0068867_100250304 3300005459 Bacteria 1441
93 Ga0068867_100424557 3300005459 Bacteria 1127
94 Ga0070685_10729585 3300005466 Bacteria 725
95 Ga0070685_10756908 3300005466 Bacteria 713
96 Ga0070685_10911377 3300005466 Bacteria 655
97 Ga0070698_100536537 3300005471 Bacteria 1109
98 Ga0070698_101485996 3300005471 Bacteria 629
99 Ga0070699_101178226 3300005518 Bacteria 703
100 Ga0070679_100009864 3300005530 Bacteria 9035
101 Ga0070679_100017482 3300005530 Bacteria 6941
102 Ga0070679_100017715 3300005530 Bacteria 6896
103 Ga0070679_100036722 3300005530 Bacteria 4863
104 Ga0070679_100303056 3300005530 Bacteria 1548
105 Ga0070679_100865639 3300005530 Bacteria 847
106 Ga0070684_100013567 3300005535 Bacteria 6575
107 Ga0070684_100231212 3300005535 Bacteria 1688
108 Ga0070684_100338695 3300005535 Bacteria 1383
109 Ga0070684_100481400 3300005535 Bacteria 1149
110 Ga0070697_100328239 3300005536 Bacteria 1319
111 Ga0070697_100350906 3300005536 Bacteria 1274
112 Ga0068853_100040363 3300005539 Bacteria 3982
113 Ga0068853_100130357 3300005539 Bacteria 2250
114 Ga0068853_100286863 3300005539 Bacteria 1519
115 Ga0068853_100372296 3300005539 Bacteria 1333
116 Ga0068853_100411221 3300005539 Bacteria 1267
117 Ga0070672_100191116 3300005543 Bacteria 1709
118 Ga0070672_100191311 3300005543 Bacteria 1709
119 Ga0070672_100431858 3300005543 Bacteria 1132
120 Ga0070672_100895577 3300005543 Bacteria 784
121 Ga0070686_100740264 3300005544 Bacteria 788
122 Ga0070695_100764136 3300005545 Bacteria 772
123 Ga0070696_100760250 3300005546 Bacteria 795
124 Ga0070693_101383201 3300005547 Bacteria 547
125 Ga0070665_100189047 3300005548 Bacteria 2060
126 Ga0070665_100336297 3300005548 Bacteria 1514
127 Ga0070665_100357790 3300005548 Bacteria 1466
128 Ga0070665_101089130 3300005548 Bacteria 810
129 Ga0070665_101216753 3300005548 Bacteria 764
130 Ga0070665_101665143 3300005548 Bacteria 645
131 Ga0070704_100517830 3300005549 Bacteria 1038
132 Ga0068855_100010865 3300005563 Bacteria 10993
133 Ga0068855_100067952 3300005563 Bacteria 4150
134 Ga0068855_100116881 3300005563 Bacteria 3056
135 Ga0068855_100142865 3300005563 Bacteria 2727
136 Ga0070664_100089985 3300005564 Bacteria 2656
137 Ga0070664_100363338 3300005564 Bacteria 1319
138 Ga0068857_100016047 3300005577 Bacteria 6562
139 Ga0068857_100106311 3300005577 Bacteria 2520
140 Ga0068857_101483817 3300005577 Bacteria 660
141 Ga0068857_101752540 3300005577 Bacteria 607
142 Ga0068857_101803285 3300005577 Bacteria 599
143 Ga0068854_100316488 3300005578 Bacteria 1267
144 Ga0068854_100587678 3300005578 Bacteria 949
145 Ga0068856_100731211 3300005614 Bacteria 1010
146 Ga0070702_100130267 3300005615 Bacteria 1588
147 Ga0068852_100036815 3300005616 Bacteria 4099
148 Ga0068852_100249880 3300005616 Bacteria 1699
149 Ga0068852_100254398 3300005616 Bacteria 1684
150 Ga0068852_100477308 3300005616 Bacteria 1239
151 Ga0068852_101247821 3300005616 Bacteria 765
152 Ga0068852_101867233 3300005616 Bacteria 623
153 Ga0068859_100463120 3300005617 Bacteria 1363
154 Ga0068864_100494527 3300005618 Bacteria 1176
155 Ga0068866_10021865 3300005718 Bacteria 2952
156 Ga0068866_10509547 3300005718 Bacteria 798
157 Ga0068861_100410264 3300005719 Bacteria 1204
158 Ga0068861_100816180 3300005719 Bacteria 877
159 Ga0068861_101639683 3300005719 Bacteria 635
160 Ga0068851_10004825 3300005834 Bacteria 6103
161 Ga0068870_10078252 3300005840 Bacteria 1821
162 Ga0068863_100655952 3300005841 Bacteria 1041
163 Ga0068863_100744625 3300005841 Bacteria 976
164 Ga0068863_100911131 3300005841 Bacteria 880
165 Ga0068863_101044798 3300005841 Bacteria 820
166 Ga0068863_101352280 3300005841 Bacteria 720
167 Ga0068858_100046102 3300005842 Bacteria 4041
168 Ga0068858_100074580 3300005842 Bacteria 3150
169 Ga0068858_100917487 3300005842 Bacteria 857
170 Ga0068860_100331144 3300005843 Bacteria 1496
171 Ga0068860_100352450 3300005843 Bacteria 1449
172 Ga0068860_100462292 3300005843 Bacteria 1263
173 Ga0068860_100483318 3300005843 Bacteria 1235
174 Ga0068860_100499225 3300005843 Bacteria 1215
175 Ga0068862_100129799 3300005844 Bacteria 2228
176 Ga0068862_100302221 3300005844 Bacteria 1472
177 Ga0068862_100414040 3300005844 Bacteria 1263
178 Ga0068862_100515000 3300005844 Bacteria 1137
179 Ga0068862_100669787 3300005844 Bacteria 1002
180 Ga0068862_101682387 3300005844 Bacteria 643
181 Ga0081455_10009971 3300005937 Bacteria 9713
182 Ga0081455_10037550 3300005937 Bacteria 4300
183 Ga0081455_10087531 3300005937 Bacteria 2534
184 Ga0081455_10127583 3300005937 Bacteria 1994
185 Ga0081455_10150862 3300005937 Bacteria 1792
186 Ga0081540_1006422 3300005983 Bacteria 8558
187 Ga0081540_1009663 3300005983 Bacteria 6629
188 Ga0081540_1011844 3300005983 Bacteria 5796
189 Ga0081540_1012349 3300005983 Bacteria 5635
190 Ga0081540_1013491 3300005983 Bacteria 5308
191 Ga0081540_1014382 3300005983 Bacteria 5071
192 Ga0081540_1018818 3300005983 Bacteria 4222
193 Ga0081539_10000768 3300005985 Bacteria 63055
194 Ga0081539_10001470 3300005985 Bacteria 39952
195 Ga0081539_10004445 3300005985 Bacteria 15477
196 Ga0081539_10058092 3300005985 Bacteria 2137
197 Ga0070717_10001267 3300006028 Bacteria 17258
198 Ga0070717_10017332 3300006028 Bacteria 5603
199 Ga0070717_10416085 3300006028 Bacteria 1209
200 Ga0070717_10501552 3300006028 Bacteria 1097
201 Ga0075365_10083284 3300006038 Bacteria 2169
202 Ga0075365_10101356 3300006038 Bacteria 1971
203 Ga0075365_10541421 3300006038 Bacteria 823
204 Ga0075365_10770016 3300006038 Bacteria 679
205 Ga0075363_100113059 3300006048 Bacteria 1510
206 Ga0075363_100352030 3300006048 Bacteria 860
207 Ga0075363_100407285 3300006048 Bacteria 800
208 Ga0075364_10088472 3300006051 Bacteria 2053
209 Ga0075432_10149429 3300006058 Bacteria 897
210 Ga0070716_100107458 3300006173 Bacteria 1723
211 Ga0070716_100189057 3300006173 Bacteria 1359
212 Ga0070716_100666400 3300006173 Bacteria 791
213 Ga0070716_101690869 3300006173 Bacteria 522
214 Ga0070712_100111079 3300006175 Bacteria 2046
215 Ga0070712_100118582 3300006175 Bacteria 1988
216 Ga0070712_100905172 3300006175 Bacteria 761
217 Ga0075362_10396330 3300006177 Bacteria 696
218 Ga0075367_10142444 3300006178 Bacteria 1485
219 Ga0075369_10127055 3300006186 Bacteria 1157
220 Ga0075369_10247272 3300006186 Bacteria 828
221 Ga0075369_10336005 3300006186 Bacteria 708
222 Ga0075366_10239677 3300006195 Bacteria 1106
223 Ga0075366_10593436 3300006195 Bacteria 686
224 Ga0075366_10603489 3300006195 Bacteria 680
225 Ga0075366_10853991 3300006195 Bacteria 567
226 Ga0097621_100209156 3300006237 Bacteria 1697
227 Ga0097621_101107206 3300006237 Bacteria 744
228 Ga0097621_101274183 3300006237 Bacteria 694
229 Ga0097621_101490690 3300006237 Bacteria 642
230 Ga0075370_10219152 3300006353 Bacteria 1124
231 Ga0075370_10380400 3300006353 Bacteria 846
232 Ga0068871_100254458 3300006358 Bacteria 1531
233 Ga0068871_100483860 3300006358 Bacteria 1114
234 Ga0068871_100802604 3300006358 Bacteria 868
235 Ga0068871_101385620 3300006358 Bacteria 663
236 Ga0075428_100700818 3300006844 Bacteria 1079
237 Ga0075433_10677350 3300006852 Bacteria 904
238 Ga0075429_100967043 3300006880 Bacteria 745
239 Ga0068865_100444871 3300006881 Bacteria 1070
240 Ga0068865_100647710 3300006881 Bacteria 898
241 Ga0068865_100847786 3300006881 Bacteria 791
242 Ga0068865_101028166 3300006881 Bacteria 723
243 Ga0097620_100463136 3300006931 Bacteria 1363
244 Ga0099825_1034140 3300006941 Bacteria 1916
245 Ga0099824_1007408 3300006942 Bacteria 14551
246 Ga0099822_1006547 3300006943 Bacteria 15161
247 Ga0099794_10013294 3300007265 Bacteria 3579
248 Ga0099794_10298454 3300007265 Bacteria 834
249 Ga0099794_10419992 3300007265 Bacteria 700
250 Ga0099795_10003875 3300007788 Bacteria 3771
251 Ga0099795_10184751 3300007788 Bacteria 872
252 Ga0105251_10576561 3300009011 Bacteria 532
253 Ga0105250_10539583 3300009092 Bacteria 534
254 Ga0105240_10034221 3300009093 Bacteria 6557
255 Ga0105240_10058690 3300009093 Bacteria 4804
256 Ga0105240_10105395 3300009093 Bacteria 3423
257 Ga0105240_10108708 3300009093 Bacteria 3359
258 Ga0105240_10522672 3300009093 Bacteria 1317
259 Ga0105240_11095681 3300009093 Bacteria 848
260 Ga0105240_11604799 3300009093 Bacteria 680
261 Ga0105240_12534470 3300009093 Bacteria 530
262 Ga0111539_10144248 3300009094 Bacteria 2787
263 Ga0111539_11656237 3300009094 Bacteria 742
264 Ga0105245_10105057 3300009098 Bacteria 2619
265 Ga0105245_10289341 3300009098 Bacteria 1604
266 Ga0105245_10829319 3300009098 Bacteria 964
267 Ga0105245_11842058 3300009098 Bacteria 658
268 Ga0105247_10110567 3300009101 Bacteria 1768
269 Ga0105247_10136367 3300009101 Bacteria 1604
270 Ga0105247_10155708 3300009101 Bacteria 1509
271 Ga0105247_10400587 3300009101 Bacteria 978
272 Ga0114129_10191104 3300009147 Bacteria 2780
273 Ga0105243_10078753 3300009148 Bacteria 2684
274 Ga0105243_10929161 3300009148 Bacteria 867
275 Ga0105243_11232577 3300009148 Bacteria 763
276 Ga0105243_12506854 3300009148 Bacteria 555
277 Ga0105241_10028779 3300009174 Bacteria 4140
278 Ga0105242_10115715 3300009176 Bacteria 2293
279 Ga0105242_10131362 3300009176 Bacteria 2162
280 Ga0105242_11576074 3300009176 Bacteria 690
281 Ga0105242_11936273 3300009176 Bacteria 630
282 Ga0105248_10139917 3300009177 Bacteria 2730
283 Ga0105248_10204152 3300009177 Bacteria 2227
284 Ga0105248_10336933 3300009177 Bacteria 1698
285 Ga0105248_10881040 3300009177 Bacteria 1011
286 Ga0105237_10087664 3300009545 Bacteria 3102
287 Ga0105237_10508977 3300009545 Bacteria 1211
288 Ga0105237_10562761 3300009545 Bacteria 1147
289 Ga0105237_10641091 3300009545 Bacteria 1069
290 Ga0105237_10726224 3300009545 Bacteria 1000
291 Ga0105237_10766119 3300009545 Bacteria 972
292 Ga0105237_11358764 3300009545 Bacteria 717
293 Ga0105237_11568743 3300009545 Bacteria 665
294 Ga0105238_10017402 3300009551 Bacteria 7303
295 Ga0105238_10140974 3300009551 Bacteria 2387
296 Ga0105238_10358018 3300009551 Bacteria 1448
297 Ga0105238_10360284 3300009551 Bacteria 1444
298 Ga0105238_10598531 3300009551 Bacteria 1110
299 Ga0105238_11028171 3300009551 Bacteria 845
300 Ga0105249_10080447 3300009553 Bacteria 3027
301 Ga0105249_10645237 3300009553 Bacteria 1116
302 Ga0099796_10459180 3300010159 Bacteria 567
303 Ga0105239_10020324 3300010375 Bacteria 7325
304 Ga0105239_10029566 3300010375 Bacteria 6024
305 Ga0105239_10118154 3300010375 Bacteria 2943
306 Ga0105239_10151085 3300010375 Bacteria 2592
307 Ga0105239_10404892 3300010375 Bacteria 1544
308 Ga0105239_10804993 3300010375 Bacteria 1077
309 Ga0105246_10106488 3300011119 Bacteria 2051
310 Ga0105246_10229454 3300011119 Bacteria 1461
311 Ga0105246_10256365 3300011119 Bacteria 1391
312 Ga0105246_10675292 3300011119 Bacteria 902
313 Ga0105246_11328480 3300011119 Bacteria 667
314 Ga0157338_1036802 3300012515 Bacteria 649
315 Ga0157371_10727887 3300013102 Bacteria 744
316 Ga0157371_11388202 3300013102 Bacteria 545
317 Ga0157370_10014947 3300013104 Bacteria 7918
318 Ga0157370_10025078 3300013104 Bacteria 5903
319 Ga0157370_10071347 3300013104 Bacteria 3277
320 Ga0157370_10296740 3300013104 Bacteria 1492
321 Ga0157370_10862740 3300013104 Bacteria 822
322 Ga0157370_10950068 3300013104 Bacteria 779
323 Ga0157369_10021190 3300013105 Bacteria 7267
324 Ga0157369_10047353 3300013105 Bacteria 4669
325 Ga0157369_10130028 3300013105 Bacteria 2669
326 Ga0157369_10501429 3300013105 Bacteria 1256
327 Ga0157369_10602033 3300013105 Bacteria 1134
328 Ga0157374_10033305 3300013296 Bacteria 4701
329 Ga0157374_10530713 3300013296 Bacteria 1183
330 Ga0157378_10070080 3300013297 Bacteria 3147
331 Ga0157378_10356319 3300013297 Bacteria 1431
332 Ga0157378_10368636 3300013297 Bacteria 1407
333 Ga0157378_11541203 3300013297 Bacteria 710
334 Ga0157378_13043504 3300013297 Bacteria 520
335 Ga0163162_10578216 3300013306 Bacteria 1250
336 Ga0163162_11108831 3300013306 Bacteria 897
337 Ga0163162_11309716 3300013306 Bacteria 823
338 Ga0163162_13152751 3300013306 Bacteria 529
339 Ga0157372_10196832 3300013307 Bacteria 2334
340 Ga0157372_10708827 3300013307 Bacteria 1171
341 Ga0157372_12031415 3300013307 Bacteria 661
342 Ga0157372_12344199 3300013307 Bacteria 613
343 Ga0157375_10009689 3300013308 Bacteria 8470
344 Ga0157375_11105739 3300013308 Bacteria 928
345 Ga0157375_11934839 3300013308 Bacteria 700
346 Ga0157375_12308347 3300013308 Bacteria 641
347 Ga0163163_10159204 3300014325 Bacteria 2303
348 Ga0163163_10453589 3300014325 Bacteria 1342
349 Ga0163163_10571962 3300014325 Bacteria 1193
350 Ga0163163_11094788 3300014325 Bacteria 860
351 Ga0163163_12257726 3300014325 Bacteria 603
352 Ga0157380_10184873 3300014326 Bacteria 1834
353 Ga0157380_10184912 3300014326 Bacteria 1834
354 Ga0157380_10811873 3300014326 Bacteria 953
355 Ga0157380_12152610 3300014326 Bacteria 621
356 Ga0157377_10094953 3300014745 Bacteria 1767
357 Ga0157377_10173047 3300014745 Bacteria 1352
358 Ga0157377_11356277 3300014745 Bacteria 559
359 Ga0157379_10085565 3300014968 Bacteria 2826
360 Ga0157379_10341117 3300014968 Bacteria 1370
361 Ga0157379_10659533 3300014968 Bacteria 980
362 Ga0157376_10092020 3300014969 Bacteria 2628
363 Ga0157376_10557471 3300014969 Bacteria 1135
364 Ga0163161_10128231 3300017792 Bacteria 1912
365 Ga0163161_10232435 3300017792 Bacteria 1431
366 Ga0163161_10303939 3300017792 Bacteria 1257
367 Ga0206356_10766524 3300020070 Bacteria 821
368 Ga0206356_11320371 3300020070 Bacteria 1449
369 Ga0206353_10272000 3300020082 Bacteria 539
370 Ga0213874_10013946 3300021377 Bacteria 2092
371 Ga0213876_10020027 3300021384 Bacteria 3534
372 Ga0213876_10072356 3300021384 Bacteria 1821
373 Ga0209233_1002384 3300025261 Bacteria 6957
374 Ga0209758_1030944 3300025297 Bacteria 2205
375 Ga0209758_1031236 3300025297 Bacteria 2189
376 Ga0209758_1050827 3300025297 Bacteria 1449
377 Ga0209758_1091452 3300025297 Bacteria 890
378 Ga0207697_10085069 3300025315 Bacteria 1335
379 Ga0207656_10034898 3300025321 Bacteria 2102
380 Ga0207682_10212877 3300025893 Bacteria 892
381 Ga0207642_10037371 3300025899 Bacteria 2092
382 Ga0207642_10398319 3300025899 Bacteria 823
383 Ga0207642_10478566 3300025899 Bacteria 759
384 Ga0207642_10583281 3300025899 Bacteria 694
385 Ga0207710_10176392 3300025900 Bacteria 1047
386 Ga0207710_10384506 3300025900 Bacteria 719
387 Ga0207710_10598127 3300025900 Bacteria 576
388 Ga0207688_10215003 3300025901 Bacteria 1156
389 Ga0207688_10282908 3300025901 Bacteria 1011
390 Ga0207688_10421078 3300025901 Bacteria 830
391 Ga0207688_10436633 3300025901 Bacteria 815
392 Ga0207688_10518079 3300025901 Bacteria 748
393 Ga0207680_10591542 3300025903 Bacteria 793
394 Ga0207685_10027483 3300025905 Bacteria 1991
395 Ga0207699_10025234 3300025906 Bacteria 3260
396 Ga0207699_10156951 3300025906 Bacteria 1511
397 Ga0207699_10490158 3300025906 Bacteria 886
398 Ga0207699_10910031 3300025906 Bacteria 649
399 Ga0207645_10058248 3300025907 Bacteria 2466
400 Ga0207645_10172342 3300025907 Bacteria 1419
401 Ga0207705_10269578 3300025909 Bacteria 1302
402 Ga0207705_10295605 3300025909 Bacteria 1241
403 Ga0207684_10216101 3300025910 Bacteria 1654
404 Ga0207684_10558714 3300025910 Bacteria 979
405 Ga0207684_11207051 3300025910 Bacteria 626
406 Ga0207654_10429061 3300025911 Bacteria 924
407 Ga0207707_10000419 3300025912 Bacteria 44410
408 Ga0207707_10002705 3300025912 Bacteria 15850
409 Ga0207707_10002868 3300025912 Bacteria 15401
410 Ga0207707_10045918 3300025912 Bacteria 3804
411 Ga0207707_10135089 3300025912 Bacteria 2156
412 Ga0207695_10048124 3300025913 Bacteria 4506
413 Ga0207695_10060686 3300025913 Bacteria 3913
414 Ga0207695_10140869 3300025913 Bacteria 2360
415 Ga0207695_10240619 3300025913 Bacteria 1711
416 Ga0207695_10363647 3300025913 Bacteria 1333
417 Ga0207671_10061259 3300025914 Bacteria 2792
418 Ga0207671_10378725 3300025914 Bacteria 1124
419 Ga0207671_10456499 3300025914 Bacteria 1018
420 Ga0207671_10485729 3300025914 Bacteria 984
421 Ga0207671_11174057 3300025914 Bacteria 601
422 Ga0207693_10041850 3300025915 Bacteria 3606
423 Ga0207693_10071447 3300025915 Bacteria 2716
424 Ga0207693_10086606 3300025915 Bacteria 2455
425 Ga0207693_10770161 3300025915 Bacteria 743
426 Ga0207663_10007087 3300025916 Bacteria 5789
427 Ga0207663_10043021 3300025916 Bacteria 2763
428 Ga0207663_10065948 3300025916 Bacteria 2316
429 Ga0207663_10116334 3300025916 Bacteria 1823
430 Ga0207663_10390605 3300025916 Bacteria 1062
431 Ga0207660_10012377 3300025917 Bacteria 5581
432 Ga0207660_10048142 3300025917 Bacteria 3017
433 Ga0207660_10305114 3300025917 Bacteria 1268
434 Ga0207660_10330707 3300025917 Bacteria 1218
435 Ga0207662_10113335 3300025918 Bacteria 1693
436 Ga0207662_11223767 3300025918 Bacteria 534
437 Ga0207657_10011308 3300025919 Bacteria 8865
438 Ga0207657_10420585 3300025919 Bacteria 1050
439 Ga0207649_10039488 3300025920 Bacteria 2862
440 Ga0207649_10557951 3300025920 Bacteria 877
441 Ga0207652_10001690 3300025921 Bacteria 19300
442 Ga0207652_10009155 3300025921 Bacteria 7969
443 Ga0207652_10011695 3300025921 Bacteria 7082
444 Ga0207652_10047707 3300025921 Bacteria 3659
445 Ga0207652_10055058 3300025921 Bacteria 3420
446 Ga0207646_10826670 3300025922 Bacteria 824
447 Ga0207681_10039022 3300025923 Bacteria 3150
448 Ga0207681_10411264 3300025923 Bacteria 1094
449 Ga0207681_10889286 3300025923 Bacteria 746
450 Ga0207694_10027290 3300025924 Bacteria 4347
451 Ga0207694_10075966 3300025924 Bacteria 2631
452 Ga0207694_10321799 3300025924 Bacteria 1276
453 Ga0207694_10731282 3300025924 Bacteria 835
454 Ga0207694_11027946 3300025924 Bacteria 697
455 Ga0207659_10101426 3300025926 Bacteria 2171
456 Ga0207687_10157928 3300025927 Bacteria 1737
457 Ga0207687_10395148 3300025927 Bacteria 1136
458 Ga0207687_10641434 3300025927 Bacteria 898
459 Ga0207700_10005544 3300025928 Bacteria 7569
460 Ga0207700_10063406 3300025928 Bacteria 2811
461 Ga0207700_10118805 3300025928 Bacteria 2140
462 Ga0207700_10120991 3300025928 Bacteria 2123
463 Ga0207700_10183800 3300025928 Bacteria 1752
464 Ga0207700_11162919 3300025928 Bacteria 689
465 Ga0207664_10042851 3300025929 Bacteria 3536
466 Ga0207664_10150641 3300025929 Bacteria 1976
467 Ga0207664_10229936 3300025929 Bacteria 1612
468 Ga0207664_10489807 3300025929 Bacteria 1100
469 Ga0207644_10234854 3300025931 Bacteria 1458
470 Ga0207644_11082889 3300025931 Bacteria 673
471 Ga0207644_11312479 3300025931 Bacteria 608
472 Ga0207644_11400987 3300025931 Bacteria 587
473 Ga0207690_10587430 3300025932 Bacteria 908
474 Ga0207706_10015272 3300025933 Bacteria 6945
475 Ga0207706_10225273 3300025933 Bacteria 1641
476 Ga0207706_10408965 3300025933 Bacteria 1176
477 Ga0207709_10358165 3300025935 Bacteria 1104
478 Ga0207709_10503061 3300025935 Bacteria 946
479 Ga0207709_10528054 3300025935 Bacteria 925
480 Ga0207709_10862442 3300025935 Bacteria 734
481 Ga0207709_10893438 3300025935 Bacteria 722
482 Ga0207669_10095367 3300025937 Bacteria 1950
483 Ga0207669_10718476 3300025937 Bacteria 822
484 Ga0207669_11091687 3300025937 Bacteria 673
485 Ga0207704_10666308 3300025938 Bacteria 858
486 Ga0207704_11179898 3300025938 Bacteria 652
487 Ga0207665_10036449 3300025939 Bacteria 3271
488 Ga0207665_10088797 3300025939 Bacteria 2139
489 Ga0207665_10195726 3300025939 Bacteria 1471
490 Ga0207665_10253201 3300025939 Bacteria 1302
491 Ga0207665_10611246 3300025939 Bacteria 852
492 Ga0207665_10847064 3300025939 Bacteria 724
493 Ga0207691_10054640 3300025940 Bacteria 3642
494 Ga0207691_10168119 3300025940 Bacteria 1921
495 Ga0207691_10426374 3300025940 Bacteria 1130
496 Ga0207691_10505181 3300025940 Bacteria 1026
497 Ga0207691_10765507 3300025940 Bacteria 812
498 Ga0207711_10284242 3300025941 Bacteria 1524
499 Ga0207689_10011785 3300025942 Bacteria 7491
500 Ga0207689_10125319 3300025942 Bacteria 2113
501 Ga0207689_10326522 3300025942 Bacteria 1274
502 Ga0207661_10001270 3300025944 Bacteria 16867
503 Ga0207661_10008213 3300025944 Bacteria 7451
504 Ga0207661_10021058 3300025944 Bacteria 4883
505 Ga0207679_10069235 3300025945 Bacteria 2654
506 Ga0207679_10271615 3300025945 Bacteria 1450
507 Ga0207679_10377220 3300025945 Bacteria 1242
508 Ga0207679_10916061 3300025945 Bacteria 802
509 Ga0207667_10002017 3300025949 Bacteria 25487
510 Ga0207667_10145129 3300025949 Bacteria 2443
511 Ga0207667_10201639 3300025949 Bacteria 2041
512 Ga0207667_10510487 3300025949 Bacteria 1218
513 Ga0207667_11719651 3300025949 Bacteria 593
514 Ga0207651_10112506 3300025960 Bacteria 2047
515 Ga0207651_10603500 3300025960 Bacteria 960
516 Ga0207712_10128621 3300025961 Bacteria 1927
517 Ga0207668_10150043 3300025972 Bacteria 1803
518 Ga0207668_10241238 3300025972 Bacteria 1462
519 Ga0207668_10335998 3300025972 Bacteria 1258
520 Ga0207668_10471341 3300025972 Bacteria 1075
521 Ga0207668_10481127 3300025972 Bacteria 1065
522 Ga0207668_10558761 3300025972 Bacteria 992
523 Ga0207640_10214238 3300025981 Bacteria 1470
524 Ga0207640_10407822 3300025981 Bacteria 1108
525 Ga0207640_10539537 3300025981 Bacteria 978
526 Ga0207658_10132641 3300025986 Bacteria 2004
527 Ga0207658_10375592 3300025986 Bacteria 1244
528 Ga0207658_11256020 3300025986 Bacteria 677
529 Ga0207658_11567847 3300025986 Bacteria 602
530 Ga0207677_10005891 3300026023 Bacteria 6669
531 Ga0207677_10532795 3300026023 Bacteria 1021
532 Ga0207703_10394218 3300026035 Bacteria 1283
533 Ga0207703_10999855 3300026035 Bacteria 802
534 Ga0207703_11300422 3300026035 Bacteria 699
535 Ga0207639_10173169 3300026041 Bacteria 1830
536 Ga0207639_10837909 3300026041 Bacteria 858
537 Ga0207639_10970591 3300026041 Bacteria 795
538 Ga0207639_12227199 3300026041 Bacteria 509
539 Ga0207678_10006479 3300026067 Bacteria 10385
540 Ga0207678_10044766 3300026067 Bacteria 3828
541 Ga0207678_10061454 3300026067 Bacteria 3231
542 Ga0207678_10196905 3300026067 Bacteria 1722
543 Ga0207678_10628445 3300026067 Bacteria 942
544 Ga0207678_10860880 3300026067 Bacteria 801
545 Ga0207678_11372541 3300026067 Bacteria 625
546 Ga0207678_11916079 3300026067 Bacteria 517
547 Ga0207708_10158521 3300026075 Bacteria 1786
548 Ga0207708_10981793 3300026075 Bacteria 733
549 Ga0207702_10273884 3300026078 Bacteria 1593
550 Ga0207702_10875316 3300026078 Bacteria 890
551 Ga0207702_10903267 3300026078 Bacteria 875
552 Ga0207641_10606623 3300026088 Bacteria 1072
553 Ga0207641_11251741 3300026088 Bacteria 742
554 Ga0207641_11833036 3300026088 Bacteria 608
555 Ga0207648_10797285 3300026089 Bacteria 879
556 Ga0207648_10821718 3300026089 Bacteria 866
557 Ga0207648_10936444 3300026089 Bacteria 810
558 Ga0207676_10069328 3300026095 Bacteria 2823
559 Ga0207674_10010575 3300026116 Bacteria 10440
560 Ga0207674_10113295 3300026116 Bacteria 2685
561 Ga0207674_10242397 3300026116 Bacteria 1750
562 Ga0207674_10457616 3300026116 Bacteria 1233
563 Ga0207674_10594400 3300026116 Bacteria 1069
564 Ga0207674_11383866 3300026116 Bacteria 673
565 Ga0207674_11674039 3300026116 Bacteria 604
566 Ga0207675_100031334 3300026118 Bacteria 4954
567 Ga0207675_100064640 3300026118 Bacteria 3420
568 Ga0207675_100274434 3300026118 Bacteria 1637
569 Ga0207675_100422111 3300026118 Bacteria 1317
570 Ga0207675_101532037 3300026118 Bacteria 687
571 Ga0207675_101742728 3300026118 Bacteria 642
572 Ga0207675_101791882 3300026118 Bacteria 633
573 Ga0207683_10021694 3300026121 Bacteria 5504
574 Ga0207683_10197482 3300026121 Bacteria 1828
575 Ga0207683_10648249 3300026121 Bacteria 978
576 Ga0207683_10766064 3300026121 Bacteria 895
577 Ga0207698_10226900 3300026142 Bacteria 1692
578 Ga0207698_10295269 3300026142 Bacteria 1506
579 Ga0207698_10317285 3300026142 Bacteria 1458
580 Ga0207698_10501287 3300026142 Bacteria 1181
581 Ga0207698_11430873 3300026142 Bacteria 706
582 Ga0209589_1000014 3300027357 Bacteria 227996
583 Ga0209489_100014 3300027361 Bacteria 227996
584 Ga0209700_100024 3300027363 Bacteria 227996
585 Ga0209179_1012641 3300027512 Bacteria 1520
586 Ga0209179_1048167 3300027512 Bacteria 909
587 Ga0209588_1002539 3300027671 Bacteria 4953
588 Ga0268266_10147257 3300028379 Bacteria 2118
589 Ga0268266_10201322 3300028379 Bacteria 1822
590 Ga0268266_10391978 3300028379 Bacteria 1312
591 Ga0268266_10570437 3300028379 Bacteria 1085
592 Ga0268266_11270396 3300028379 Bacteria 711
593 Ga0268265_10198420 3300028380 Bacteria 1738
594 Ga0268265_10268121 3300028380 Bacteria 1521
595 Ga0268265_10304954 3300028380 Bacteria 1435
596 Ga0268265_10753171 3300028380 Bacteria 945
597 Ga0268265_11590458 3300028380 Bacteria 658
598 Ga0268265_11681054 3300028380 Bacteria 640
599 Ga0268265_11964165 3300028380 Bacteria 592
600 Ga0268265_12483165 3300028380 Bacteria 524
601 Ga0268264_10055549 3300028381 Bacteria 3309
602 Ga0268264_10292401 3300028381 Bacteria 1530
603 Ga0268264_10568056 3300028381 Bacteria 1114
604 Ga0268264_10893234 3300028381 Bacteria 891
605 Ga0268264_11123623 3300028381 Bacteria 794
606 Ga0268264_11758227 3300028381 Bacteria 630
607 Ga0265337_1007001 3300028556 Bacteria 4268
608 Ga0265326_10065353 3300028558 Bacteria 1028
609 Ga0265319_1006536 3300028563 Bacteria 5385
610 Ga0265334_10001696 3300028573 Bacteria 10529
611 Ga0265318_10008197 3300028577 Bacteria 4667
612 Ga0265323_10001106 3300028653 Bacteria 13928
613 Ga0265322_10001590 3300028654 Bacteria 7289
614 Ga0265336_10000135 3300028666 Bacteria 52478
615 Ga0307517_10000634 3300028786 Bacteria 60194
616 Ga0307517_10039620 3300028786 Bacteria 5167
617 Ga0307517_10324896 3300028786 Bacteria 849
618 Ga0307517_10594244 3300028786 Bacteria 546
619 Ga0307515_10006012 3300028794 Bacteria 24419
620 Ga0307515_10512273 3300028794 Bacteria 810
621 Ga0265338_10000034 3300028800 Bacteria 244623
622 Ga0265338_10361635 3300028800 Bacteria 1041
623 Ga0265324_10001466 3300029957 Bacteria 13424
624 Ga0265324_10156835 3300029957 Bacteria 773
625 Ga0307511_10024264 3300030521 Bacteria 5626
626 Ga0265332_10013209 3300031238 Bacteria 3662
627 Ga0307513_10125438 3300031456 Bacteria 2524
628 Ga0307513_10444506 3300031456 Bacteria 1022
629 Ga0307513_10645174 3300031456 Bacteria 766
630 Ga0307509_10132445 3300031507 Bacteria 2445
631 Ga0307509_10826352 3300031507 Bacteria 591
632 Ga0307508_10000032 3300031616 Bacteria 163293
633 Ga0307508_10022899 3300031616 Bacteria 5677
634 Ga0307508_10139265 3300031616 Bacteria 2030
635 Ga0307508_10715631 3300031616 Bacteria 612
636 Ga0265314_10195305 3300031711 Bacteria 1201
637 Ga0307516_10005934 3300031730 Bacteria 14450
638 Ga0307516_10039539 3300031730 Bacteria 4700
639 Ga0307516_10300751 3300031730 Bacteria 1280
640 Ga0307405_10879540 3300031731 Bacteria 756
641 Ga0307413_10061917 3300031824 Bacteria 2312
642 Ga0307413_10440005 3300031824 Bacteria 1032
643 Ga0307410_10143713 3300031852 Bacteria 1768
644 Ga0307406_10896882 3300031901 Bacteria 754
645 Ga0307407_10186122 3300031903 Bacteria 1380
646 Ga0307412_10093307 3300031911 Bacteria 2111
647 Ga0307412_11811460 3300031911 Bacteria 562
648 Ga0307416_100738479 3300032002 Bacteria 1076
649 Ga0307411_10300285 3300032005 Bacteria 1287
650 Ga0307415_100094054 3300032126 Bacteria 2178
651 Ga0307415_100687932 3300032126 Bacteria 921
652 Ga0307507_10011278 3300033179 Bacteria 11327
653 Ga0307510_10016157 3300033180 Bacteria 8816
654 Ga0307510_10091519 3300033180 Bacteria 2883
655 Ga0373930_0001351 3300034816 Bacteria 3619
656 Ga0373959_0055718 3300034820 Bacteria 864
657 Ga0373926_0007554 3300035083 Bacteria 3620
658 Ga0373934_0187215 3300035086 Bacteria 851
659 Ga0373951_0013653 3300035091 Bacteria 1825
660 Ga0373952_0108085 3300035092 Bacteria 741
661 Ga0373923_0061471 3300035111 Bacteria 1596
662 Ga0373923_0236904 3300035111 Bacteria 852
663 Ga0373936_0061479 3300035113 Bacteria 1534
664 Ga0373936_0068996 3300035113 Bacteria 1454
665 Ga0373939_0227291 3300035114 Bacteria 717
666 Ga0373939_0489452 3300035114 Bacteria 523
667 Ga0373954_0081500 3300035118 Bacteria 1546
668 Ga0373954_0166773 3300035118 Bacteria 1078
669 Ga0373956_0304788 3300035119 Bacteria 759
670 Ga0373956_0407056 3300035119 Bacteria 649
671 Ga0373943_0083782 3300035170 Bacteria 1639
672 Ga0373946_0026464 3300035171 Bacteria 2289
673 Ga0373946_0058279 3300035171 Bacteria 1635
674 Ga0373955_0040395 3300035172 Bacteria 2495
675 Ga0373955_0058451 3300035172 Bacteria 2122
676 Ga0373955_0880774 3300035172 Bacteria 551
677 Ga0373924_0017175 3300035410 Bacteria 2772
678 Ga0373931_0002187 3300035691 Bacteria 8629
679 Ga0373931_0384182 3300035691 Bacteria 886
680 Ga0373931_0390676 3300035691 Bacteria 879
681 Ga0373931_0434475 3300035691 Bacteria 837
682 Ga0373931_1246755 3300035691 Bacteria 510
683 Ga0373935_0012923 3300035692 Bacteria 5031
684 Ga0373935_0032924 3300035692 Bacteria 3223
685 Ga0373935_0063455 3300035692 Bacteria 2368
686 Ga0373935_0069468 3300035692 Bacteria 2269
687 Ga0373935_0324990 3300035692 Bacteria 1092
688 Ga0373935_0607081 3300035692 Bacteria 800
689 Ga0373927_0014717 3300035695 Bacteria 5172
690 Ga0373927_0015621 3300035695 Bacteria 5014
691 Ga0373927_0044610 3300035695 Bacteria 2868
692 Ga0373927_0060854 3300035695 Bacteria 2443
693 Ga0373927_0169814 3300035695 Bacteria 1429
694 Ga0373927_0523744 3300035695 Bacteria 783
695 Ga0373927_0605220 3300035695 Bacteria 724
696 Ga0373927_0732936 3300035695 Bacteria 653
697 Ga0373933_0000182 3300035724 Bacteria 41434
698 Ga0373933_0219645 3300035724 Bacteria 1219
699 Ga0373933_1055597 3300035724 Bacteria 535
700 Ga0373947_0025925 3300035725 Bacteria 3420
701 Ga0373947_0028707 3300035725 Bacteria 3263
702 Ga0373947_0076608 3300035725 Bacteria 2061
703 Ga0373937_0399859 3300036401 Bacteria 1303
704 Ga0372808_009572 3300036459 Bacteria 1355
705 Ga0373925_0025108 3300037068 Bacteria 4351
706 Ga0373925_0054383 3300037068 Bacteria 2994
707 Ga0373925_0102550 3300037068 Bacteria 2201
708 Ga0373925_0125508 3300037068 Bacteria 1996
709 Ga0373925_0453465 3300037068 Bacteria 1050
710 Ga0373925_0589940 3300037068 Bacteria 915
711 Ga0395900_0017080 3300037418 Bacteria 7408
712 Ga0395900_0082779 3300037418 Bacteria 3297
713 Ga0395900_0200935 3300037418 Bacteria 2017
714 Ga0395898_0099842 3300037466 Bacteria 2788
715 Ga0395905_0996464 3300037471 Bacteria 741
716 Ga0395901_0044477 3300038443 Bacteria 4606
717 Ga0395901_0153963 3300038443 Bacteria 2415
718 Ga0395901_0251715 3300038443 Bacteria 1840
719 Ga0436365_0229539 3300039437 Bacteria 3406
720 Ga0436365_0585470 3300039437 Bacteria 722
721 Ga0436365_0644236 3300039437 Bacteria 1141
722 Ga0436365_1524424 3300039437 Bacteria 1377
723 Ga0436365_1891875 3300039437 Bacteria 1374
724 Ga0436363_0130820 3300039450 Bacteria 640
725 Ga0436363_0194304 3300039450 Bacteria 1684
726 Ga0436363_0749925 3300039450 Bacteria 610
727 Ga0436363_1284900 3300039450 Bacteria 4856
728 Ga0439465_0026133 3300041413 Bacteria 1845
729 Ga0451793_1610473 3300041452 Bacteria 1027
730 Ga0451807_0104523 3300041486 Bacteria 1009
731 Ga0451851_0290019 3300041507 Bacteria 631
732 Ga0451855_0070536 3300041511 Bacteria 865
733 Ga0451853_1007521 3300041512 Bacteria 854
734 Ga0439459_0016118 3300042438 Bacteria 1378
735 Ga0466961_0065107 3300044693 Bacteria 2316
736 Ga0466964_0154855 3300044706 Bacteria 1066
737 Ga0466971_0518372 3300044719 Bacteria 589
738 Ga0466970_0232843 3300044765 Bacteria 1030
739 Ga0466959_0778571 3300045049 Bacteria 640
740 Ga0466967_0285270 3300045976 Bacteria 1585
741 Ga0466967_0306657 3300045976 Bacteria 1528
742 Ga0466967_0347873 3300045976 Bacteria 1434
743 Ga0466967_0392747 3300045976 Bacteria 1349
744 Ga0495617_013046 3300046452 Bacteria 2830
745 Ga0495617_155269 3300046452 Bacteria 727
746 Ga0495592_0022948 3300046454 Bacteria 4748
747 Ga0495592_0068249 3300046454 Bacteria 2596
748 Ga0495603_0003836 3300046455 Bacteria 8949
749 Ga0495603_0023547 3300046455 Bacteria 3724
750 Ga0495603_0043708 3300046455 Bacteria 2674
751 Ga0495603_0080616 3300046455 Bacteria 1907
752 Ga0495603_0622622 3300046455 Bacteria 618
753 Ga0495629_0000862 3300046459 Bacteria 24478
754 Ga0495629_0091399 3300046459 Bacteria 2124
755 Ga0495629_0406317 3300046459 Bacteria 925
756 Ga0495638_0019608 3300046460 Bacteria 4473
757 Ga0495638_0148689 3300046460 Bacteria 1360
758 Ga0495638_0200917 3300046460 Bacteria 1125
759 Ga0495641_0348703 3300046461 Bacteria 669
760 Ga0495651_0267567 3300046462 Bacteria 1160
761 Ga0495653_0373644 3300046463 Bacteria 912
762 Ga0495580_0010268 3300046472 Bacteria 7303
763 Ga0495580_0037193 3300046472 Bacteria 3495
764 Ga0495580_0059540 3300046472 Bacteria 2684
765 Ga0495582_0006572 3300046473 Bacteria 6452
766 Ga0495582_0025793 3300046473 Bacteria 3220
767 Ga0495582_0107941 3300046473 Bacteria 1563
768 Ga0495582_0187308 3300046473 Bacteria 1180
769 Ga0495605_0194958 3300046474 Bacteria 885
770 Ga0495639_0000544 3300046475 Bacteria 17562
771 Ga0495639_0703245 3300046475 Bacteria 522
772 Ga0495662_0042974 3300046476 Bacteria 2181
773 Ga0495664_0063932 3300046477 Bacteria 2193
774 Ga0495664_0077097 3300046477 Bacteria 1996
775 Ga0495585_0032350 3300046492 Bacteria 2963
776 Ga0495585_0037849 3300046492 Bacteria 2716
777 Ga0495585_0341597 3300046492 Bacteria 729
778 Ga0495585_0355030 3300046492 Bacteria 712
779 Ga0495585_0388404 3300046492 Bacteria 673
780 Ga0495594_0026789 3300046499 Bacteria 3103
781 Ga0495594_0154774 3300046499 Bacteria 1302
782 Ga0495594_0198833 3300046499 Bacteria 1142
783 Ga0495596_0066425 3300046500 Bacteria 1402
784 Ga0495606_0253460 3300046507 Bacteria 975
785 Ga0495606_0551029 3300046507 Bacteria 574
786 Ga0495608_0143484 3300046511 Bacteria 1523
787 Ga0495610_0144252 3300046512 Bacteria 1022
788 Ga0495610_0249092 3300046512 Bacteria 705
789 Ga0495610_0337008 3300046512 Bacteria 571
790 Ga0495616_0269497 3300046513 Bacteria 726
791 Ga0495618_0430387 3300046514 Bacteria 803
792 Ga0495620_0088969 3300046515 Bacteria 1240
793 Ga0495630_0026624 3300046517 Bacteria 4283
794 Ga0495630_0029536 3300046517 Bacteria 4075
795 Ga0495631_0067517 3300046518 Bacteria 1547
796 Ga0495631_0191757 3300046518 Bacteria 875
797 Ga0495631_0215006 3300046518 Bacteria 821
798 Ga0495631_0284483 3300046518 Bacteria 704
799 Ga0495631_0307965 3300046518 Bacteria 674
800 Ga0495632_0136433 3300046519 Bacteria 1140
801 Ga0495632_0227779 3300046519 Bacteria 841
802 Ga0495644_0073339 3300046523 Bacteria 1287
803 Ga0495663_0081096 3300046525 Bacteria 1045
804 Ga0495666_0051203 3300046526 Bacteria 1984
805 Ga0495666_0502043 3300046526 Bacteria 542
806 Ga0495652_0111297 3300046529 Bacteria 2202
807 Ga0495652_0465025 3300046529 Bacteria 883
808 Ga0495665_0007397 3300046531 Bacteria 5938
809 Ga0495665_0155014 3300046531 Bacteria 1195
810 Ga0495665_0208083 3300046531 Bacteria 1013
811 Ga0495640_0002595 3300046533 Bacteria 14526
812 Ga0495640_0853911 3300046533 Bacteria 541
813 Ga0495586_0111796 3300046535 Bacteria 1521
814 Ga0495587_0035087 3300046536 Bacteria 3022
815 Ga0495598_0383886 3300046537 Bacteria 546
816 Ga0495609_0135061 3300046538 Bacteria 1055
817 Ga0495609_0318243 3300046538 Bacteria 631
818 Ga0495597_0086925 3300046542 Bacteria 1331
819 Ga0495645_0228866 3300046543 Bacteria 1246
820 Ga0495645_0466904 3300046543 Bacteria 794
821 Ga0495645_0617971 3300046543 Bacteria 665
822 Ga0495645_0750689 3300046543 Bacteria 589
823 Ga0495622_0012042 3300046557 Bacteria 3999
824 Ga0495622_0064031 3300046557 Bacteria 1701
825 Ga0495633_0267211 3300046558 Bacteria 779
826 Ga0495667_0154776 3300046559 Bacteria 1475
827 Ga0495667_0785131 3300046559 Bacteria 588
828 Ga0495656_0026839 3300046615 Bacteria 2296
829 Ga0495656_0052703 3300046615 Bacteria 1745
830 Ga0495656_0179193 3300046615 Bacteria 1041
831 Ga0495668_0077670 3300046616 Bacteria 1823
832 Ga0495668_0085192 3300046616 Bacteria 1733
833 Ga0495668_0249305 3300046616 Bacteria 972
834 Ga0495668_0255578 3300046616 Bacteria 959
835 Ga0495668_0282838 3300046616 Bacteria 909
836 Ga0495634_0290709 3300046642 Bacteria 990
837 Ga0495611_0072829 3300046648 Bacteria 1572
838 Ga0495611_0121136 3300046648 Bacteria 1220
839 Ga0495611_0316384 3300046648 Bacteria 718
840 Ga0495625_0183777 3300046660 Bacteria 1388
841 Ga0495625_0433421 3300046660 Bacteria 815
842 Ga0495625_0484986 3300046660 Bacteria 758
843 Ga0495625_0590184 3300046660 Bacteria 668
844 Ga0495635_0000436 3300046663 Bacteria 26341
845 Ga0495635_0070320 3300046663 Bacteria 2399
846 Ga0495635_0402096 3300046663 Bacteria 910
847 Ga0495659_0060867 3300046664 Bacteria 1394
848 Ga0495661_0085330 3300046665 Bacteria 1810
849 Ga0495661_0326307 3300046665 Bacteria 762
850 Ga0495588_0013756 3300046674 Bacteria 3860
851 Ga0495657_0827946 3300046675 Bacteria 528
852 Ga0495599_0138845 3300046678 Bacteria 1508
853 Ga0495599_0400473 3300046678 Bacteria 818
854 Ga0495599_0891822 3300046678 Bacteria 504
855 Ga0495623_0599247 3300046679 Bacteria 572
856 Ga0495646_0078212 3300046680 Bacteria 1933
857 Ga0495647_0474697 3300046681 Bacteria 580
858 Ga0495658_0375563 3300046683 Bacteria 905
859 Ga0495669_0000650 3300046684 Bacteria 15146
860 Ga0495669_0125391 3300046684 Bacteria 1206
861 Ga0495669_0252889 3300046684 Bacteria 846
862 Ga0495669_0608343 3300046684 Bacteria 532
863 Ga0495613_0013842 3300046689 Bacteria 5984
864 Ga0495624_0023168 3300046690 Bacteria 4096
865 Ga0495624_0044261 3300046690 Bacteria 2838
866 Ga0495624_0312140 3300046690 Bacteria 947
867 Ga0495670_0044258 3300046691 Bacteria 2222
868 Ga0495670_0187388 3300046691 Bacteria 1094
869 Ga0495670_0245510 3300046691 Bacteria 954
870 Ga0495670_0341585 3300046691 Bacteria 805
871 Ga0495649_0070708 3300046694 Bacteria 1871
872 Ga0495649_0220052 3300046694 Bacteria 982
873 Ga0495649_0505208 3300046694 Bacteria 601
874 Ga0495649_0565877 3300046694 Bacteria 562
875 Ga0495589_0051689 3300046794 Bacteria 2031
876 Ga0495589_0116759 3300046794 Bacteria 1286
877 Ga0495589_0258396 3300046794 Bacteria 813
878 Ga0495581_0282336 3300047315 Bacteria 970
879 Ga0495604_0323740 3300047317 Bacteria 1030
880 Ga0495636_0041720 3300047318 Bacteria 1905
881 Ga0495674_0008459 3300047319 Bacteria 9804
882 Ga0495674_0213064 3300047319 Bacteria 1599
883 Ga0495674_1290039 3300047319 Bacteria 548
884 Ga0495672_0043612 3300047320 Bacteria 2696
885 Ga0495672_0079874 3300047320 Bacteria 1826
886 Ga0495672_0516335 3300047320 Bacteria 529
887 Ga0495676_0192322 3300047321 Bacteria 1423
888 Ga0495676_0210521 3300047321 Bacteria 1345
889 Ga0495676_0306496 3300047321 Bacteria 1070
890 Ga0495683_0402623 3300047323 Bacteria 569
891 Ga0495685_145900 3300047447 Bacteria 770
892 Ga0495685_292251 3300047447 Bacteria 513
893 Ga0495673_0116317 3300047469 Bacteria 1063
894 Ga0495681_0098221 3300047470 Bacteria 1284
895 Ga0495684_0028441 3300047471 Bacteria 4292
896 Ga0495686_0026279 3300047472 Bacteria 3810
897 Ga0495686_0693037 3300047472 Bacteria 520
898 Ga0495593_0021586 3300047673 Bacteria 3593
899 Ga0495593_0133176 3300047673 Bacteria 1261
900 Ga0495593_0522266 3300047673 Bacteria 595
901 Ga0495614_0032035 3300048089 Bacteria 2263
902 Ga0495615_0137137 3300048090 Bacteria 719
903 Ga0496100_0131977 3300048903 Bacteria 1760
904 Ga0496100_0506484 3300048903 Bacteria 931
905 Ga0496100_1029391 3300048903 Bacteria 648
906 Ga0496100_1096012 3300048903 Bacteria 627
907 Ga0496101_0002052 3300048904 Bacteria 12255
908 Ga0496101_0177563 3300048904 Bacteria 1639
909 Ga0496101_0590416 3300048904 Bacteria 878
910 Ga0496101_0601141 3300048904 Bacteria 869
911 Ga0496102_0001771 3300048905 Bacteria 18745
912 Ga0496102_0028325 3300048905 Bacteria 5002
913 Ga0496102_0228574 3300048905 Bacteria 1754
914 Ga0496102_0789710 3300048905 Bacteria 872
915 Ga0496102_1180376 3300048905 Bacteria 685
916 Ga0496102_1421870 3300048905 Bacteria 613
917 Ga0496103_0005699 3300048906 Bacteria 7445
918 Ga0496103_0103765 3300048906 Bacteria 1801
919 Ga0496103_0345511 3300048906 Bacteria 957
920 Ga0496104_0074499 3300048907 Bacteria 3231
921 Ga0496105_0042375 3300048908 Bacteria 3752
922 Ga0496105_0085872 3300048908 Bacteria 2600
923 Ga0496106_0002858 3300048909 Bacteria 12824
924 Ga0496106_0009997 3300048909 Bacteria 7007
925 Ga0496106_0041953 3300048909 Bacteria 3430
926 Ga0496107_0002387 3300048910 Bacteria 12152
927 Ga0496107_0009519 3300048910 Bacteria 6741
928 Ga0496107_0051319 3300048910 Bacteria 2975
929 Ga0496107_0713590 3300048910 Bacteria 737
930 Ga0496108_0016020 3300048911 Bacteria 6111
931 Ga0496108_0524321 3300048911 Bacteria 1034
932 Ga0496108_0735223 3300048911 Bacteria 854
933 Ga0496108_0781677 3300048911 Bacteria 824
934 Ga0496109_0007060 3300048912 Bacteria 9476
935 Ga0496109_0197825 3300048912 Bacteria 1890
936 Ga0496109_0971871 3300048912 Bacteria 787
937 Ga0496110_0004493 3300048913 Bacteria 10817
938 Ga0496110_0015025 3300048913 Bacteria 6438
939 Ga0496110_0119761 3300048913 Bacteria 2371
940 Ga0496110_0153298 3300048913 Bacteria 2087
941 Ga0496110_0188337 3300048913 Bacteria 1874
942 Ga0496110_0291341 3300048913 Bacteria 1487
943 Ga0496110_0608064 3300048913 Bacteria 991
944 Ga0496111_0117480 3300048914 Bacteria 1962
945 Ga0496111_0459520 3300048914 Bacteria 939
946 Ga0496112_0000017 3300048915 Bacteria 191284
947 Ga0496112_0013582 3300048915 Bacteria 7524
948 Ga0496112_0105142 3300048915 Bacteria 2793
949 Ga0496112_0157337 3300048915 Bacteria 2239
950 Ga0496112_0172126 3300048915 Bacteria 2130
951 Ga0496112_0423891 3300048915 Bacteria 1269
952 Ga0496113_0031143 3300048916 Bacteria 3868
953 Ga0496113_0048870 3300048916 Bacteria 3148
954 Ga0496114_0011547 3300048917 Bacteria 7058
955 Ga0496114_0062101 3300048917 Bacteria 3126
956 Ga0496114_0254127 3300048917 Bacteria 1547
957 Ga0496115_0000535 3300048918 Bacteria 29580
958 Ga0496115_0492551 3300048918 Bacteria 986
959 Ga0496115_1352674 3300048918 Bacteria 528
960 Ga0496117_0129636 3300048920 Bacteria 1531
961 Ga0496117_0608009 3300048920 Bacteria 510
962 Ga0496118_0003407 3300048921 Bacteria 20095
963 Ga0496119_0269894 3300048922 Bacteria 850
964 Ga0496119_0291385 3300048922 Bacteria 808
965 Ga0496121_0045020 3300048924 Bacteria 3798
966 Ga0496121_0054677 3300048924 Bacteria 3333
967 Ga0496121_0129108 3300048924 Bacteria 1895
968 Ga0496121_0224635 3300048924 Bacteria 1320
969 Ga0496121_0291596 3300048924 Bacteria 1111
970 Ga0496121_0322012 3300048924 Bacteria 1040
971 Ga0496121_0327432 3300048924 Bacteria 1029
972 Ga0496121_0578250 3300048924 Bacteria 697
973 Ga0496124_0026548 3300048927 Bacteria 5219
974 Ga0496124_0178729 3300048927 Bacteria 1635
975 Ga0496124_0273454 3300048927 Bacteria 1236
976 Ga0496124_0404719 3300048927 Bacteria 946
977 Ga0496125_0051831 3300048928 Bacteria 3380
978 Ga0496125_0265018 3300048928 Bacteria 1074
979 Ga0496125_0303374 3300048928 Bacteria 977
980 Ga0496126_0002483 3300048929 Bacteria 24817
981 Ga0496126_0092604 3300048929 Bacteria 2655
982 Ga0496126_0149771 3300048929 Bacteria 2001
983 Ga0496126_0176947 3300048929 Bacteria 1814
984 Ga0496126_0212828 3300048929 Bacteria 1626
985 Ga0496126_0407184 3300048929 Bacteria 1102
986 Ga0496126_0494497 3300048929 Bacteria 978
987 Ga0496126_0572690 3300048929 Bacteria 893
988 Ga0496126_0645808 3300048929 Bacteria 828
989 Ga0496126_0758943 3300048929 Bacteria 748
990 Ga0495678_115396 3300049459 Bacteria 910
991 Ga0501031_0008184 3300049568 Bacteria 6805
992 Ga0501032_0000704 3300049569 Bacteria 27243
993 Ga0501033_0000311 3300049570 Bacteria 46039
994 Ga0501034_0000039 3300049571 Bacteria 237357
995 Ga0501036_0000127 3300049572 Bacteria 48559
996 Ga0501037_0000025 3300049573 Bacteria 143276
997 Ga0501038_0000342 3300049574 Bacteria 40148
998 Ga0501039_0000840 3300049575 Bacteria 22181
999 Ga0501042_0026448 3300049578 Bacteria 4078
1000 Ga0501043_0000120 3300049579 Bacteria 72670
1001 Ga0501046_0000359 3300049580 Bacteria 45929
1002 Ga0501046_0048465 3300049580 Bacteria 3364
1003 Ga0501047_0000379 3300049581 Bacteria 50147
1004 Ga0501047_0084770 3300049581 Bacteria 3045
1005 Ga0501047_1343705 3300049581 Bacteria 529
1006 Ga0501048_0000352 3300049582 Bacteria 31854
1007 Ga0501067_0000025 3300049583 Bacteria 91481
1008 Ga0501068_0001230 3300049584 Bacteria 13601
1009 Ga0501069_0007011 3300049585 Bacteria 5899
1010 Ga0501069_0175721 3300049585 Bacteria 1237
1011 Ga0501070_0002185 3300049586 Bacteria 17207
1012 Ga0501070_0042781 3300049586 Bacteria 3772
1013 Ga0501071_0244492 3300049587 Bacteria 1353
1014 Ga0501072_0002767 3300049588 Bacteria 13186
1015 Ga0501072_0624932 3300049588 Bacteria 849
1016 Ga0501073_0000091 3300049589 Bacteria 57029
1017 Ga0501073_0258618 3300049589 Bacteria 1201
1018 Ga0501074_0000489 3300049590 Bacteria 24170
1019 Ga0501074_0025368 3300049590 Bacteria 4305
1020 Ga0501076_0228198 3300049592 Bacteria 1522
1021 Ga0501076_0842771 3300049592 Bacteria 756
1022 Ga0501079_0006818 3300049741 Bacteria 8597
1023 Ga0501080_0000321 3300049742 Bacteria 36637
1024 Ga0501080_0026275 3300049742 Bacteria 5410
1025 Ga0501083_0000284 3300049744 Bacteria 32169
1026 Ga0501035_0001251 3300049822 Bacteria 26410
1027 Ga0501035_0423288 3300049822 Bacteria 1105
1028 Ga0501044_0000274 3300049823 Bacteria 65668
1029 Ga0501044_0144750 3300049823 Bacteria 2363
1030 Ga0501045_0005330 3300049824 Bacteria 8907
1031 nmdc:mga03683_309151_c1 3300050489 Bacteria 742
1032 nmdc:mga03n38_341479_c1 3300050490 Bacteria 813
1033 nmdc:mga00v17_465059_c1 3300050491 Bacteria 821
1034 nmdc:mga00v17_888245_c1 3300050491 Bacteria 565
1035 nmdc:mga0yw44_535895_c1 3300050492 Bacteria 795
1036 nmdc:mga0yw44_706686_c1 3300050492 Bacteria 685
1037 nmdc:mga0yw44_90407_c1 3300050492 Bacteria 1934
1038 nmdc:mga0k408_240358_c1 3300050493 Bacteria 1081
1039 nmdc:mga0k408_97231_c1 3300050493 Bacteria 1734
1040 nmdc:mga06z11_103107_c1 3300050494 Bacteria 1568
1041 nmdc:mga06z11_207023_c1 3300050494 Bacteria 1142
1042 nmdc:mga0qj67_501630_c1 3300050509 Bacteria 975
1043 nmdc:mga08y16_916868_c1 3300050511 Bacteria 861
1044 nmdc:mga0n895_1812074_c1 3300050512 Bacteria 571
1045 nmdc:mga0n895_382114_c1 3300050512 Bacteria 1425
1046 nmdc:mga0rr50_866533_c1 3300050513 Bacteria 770
1047 nmdc:mga0a205_622660_c1 3300050515 Bacteria 931
1048 nmdc:mga0sz30_308756_c1 3300050516 Bacteria 705
1049 nmdc:mga0sz30_78446_c1 3300050516 Bacteria 1126
1050 Ga0495601_0078465 3300053077 Bacteria 2116
1051 Ga0495601_0146773 3300053077 Bacteria 1540
1052 Ga0495601_0252734 3300053077 Bacteria 1151
1053 Ga0495601_0324068 3300053077 Bacteria 1003
1054 Ga0495612_0056240 3300053078 Bacteria 1623
1055 Ga0495612_0175279 3300053078 Bacteria 940
1056 Ga0495612_0240040 3300053078 Bacteria 805
1057 Ga0495612_0332974 3300053078 Bacteria 684
1058 Ga0495655_0068994 3300053083 Bacteria 984
1059 Ga0495655_0092691 3300053083 Bacteria 883
1060 Ga0495595_0026236 3300053084 Bacteria 2588
1061 Ga0495619_0209249 3300053085 Bacteria 1351
1062 Ga0495619_0246095 3300053085 Bacteria 1239
1063 Ga0500643_051619 3300053087 Bacteria 1174
1064 Ga0500646_0022529 3300053090 Bacteria 1685
1065 Ga0500646_0071361 3300053090 Bacteria 1042
1066 Ga0500583_0072009 3300053092 Bacteria 1654
1067 Ga0500583_0333398 3300053092 Bacteria 738
1068 Ga0500651_0670507 3300053093 Bacteria 557
1069 Ga0500566_0000158 3300053094 Bacteria 34495
1070 Ga0500566_0078847 3300053094 Bacteria 1837
1071 Ga0500566_0201394 3300053094 Bacteria 1005
1072 Ga0500640_000568 3300053095 Bacteria 9480
1073 Ga0500641_0008502 3300053096 Bacteria 3666
1074 Ga0500648_057745 3300053097 Bacteria 2201
1075 Ga0500650_0224827 3300053098 Bacteria 848
1076 Ga0500554_007059 3300053102 Bacteria 2562
1077 Ga0500562_063291 3300053108 Bacteria 995
1078 Ga0500569_215176 3300053109 Bacteria 653
1079 Ga0500569_306904 3300053109 Bacteria 533
1080 Ga0500572_000024 3300053111 Bacteria 47391
1081 Ga0500591_078328 3300053115 Bacteria 1477
1082 Ga0500594_0098002 3300053118 Bacteria 899
1083 Ga0500595_001188 3300053119 Bacteria 14372
1084 Ga0500608_001300 3300053122 Bacteria 8888
1085 Ga0500614_001812 3300053123 Bacteria 4949
1086 Ga0500642_0270682 3300053130 Bacteria 775
1087 Ga0500658_0175660 3300053134 Bacteria 974
1088 Ga0500658_0382952 3300053134 Bacteria 644
1089 Ga0500559_0003877 3300053136 Bacteria 7232
1090 Ga0500559_0178998 3300053136 Bacteria 998
1091 Ga0500561_0145643 3300053137 Bacteria 735
1092 Ga0500568_0060565 3300053139 Bacteria 1466
1093 Ga0500573_0032643 3300053140 Bacteria 3003
1094 Ga0500577_0139481 3300053142 Bacteria 1022
1095 Ga0500579_188848 3300053143 Bacteria 791
1096 Ga0500588_0401468 3300053146 Bacteria 522
1097 Ga0500589_025035 3300053147 Bacteria 2761
1098 Ga0500589_313473 3300053147 Bacteria 550
1099 Ga0500590_122838 3300053148 Bacteria 1214
1100 Ga0500590_146250 3300053148 Bacteria 1073
1101 Ga0500603_000465 3300053150 Bacteria 10412
1102 Ga0500603_000801 3300053150 Bacteria 7516
1103 Ga0500603_048017 3300053150 Bacteria 1160
1104 Ga0500603_242973 3300053150 Bacteria 578
1105 Ga0500622_0382782 3300053156 Bacteria 575
1106 Ga0500627_0357681 3300053158 Bacteria 629
1107 Ga0500630_000112 3300053159 Bacteria 26672
1108 Ga0500634_0081721 3300053161 Bacteria 1663
1109 Ga0500638_012135 3300053162 Bacteria 3851
1110 Ga0500638_197823 3300053162 Bacteria 853
1111 Ga0500639_000040 3300053163 Bacteria 63516
1112 Ga0500636_0086872 3300053177 Bacteria 1795
1113 Ga0500636_0184124 3300053177 Bacteria 1118
1114 Ga0500637_0039960 3300053178 Bacteria 2647
1115 Ga0500637_0108912 3300053178 Bacteria 1606
1116 Ga0500609_015774 3300053731 Bacteria 1024
1117 Ga0500596_000794 3300053735 Bacteria 6229
1118 Ga0500596_005461 3300053735 Bacteria 2233
1119 Ga0501084_0007045 3300054114 Bacteria 9269
1120 Ga0587076_056219 3300059645 Bacteria 781
1121 Ga0501082_0026885 3300060353 Bacteria 4957

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_11541203 Ga0157378_115412031 117
2 3300005334 Ga0068869_101378147 Ga0068869_1013781471 127
3 3300037471 Ga0395905_0996464 Ga0395905_0996464_263_646 127
4 3300048924 Ga0496121_0054677 Ga0496121_0054677_1857_2240 127
5 iso_pu_bacteria 2508501128 2509149319 128
6 iso_pu_bacteria 2513237096 2513654070 128
7 iso_pu_bacteria 2513237141 2513891271 128
8 iso_pu_bacteria 2513237145 2513918410 128
9 iso_pu_bacteria 2517572143 2517891356 128
10 iso_pu_bacteria 2667528175 2671118864 128
11 iso_pu_bacteria 2728368998 2728750068 128
12 iso_pu_bacteria 2791355197 2793066724 128
13 iso_pu_bacteria 2791355199 2793080652 128
14 iso_pu_bacteria 2876808645 2876814617 128
15 iso_pu_bacteria 2879110137 2879114698 128
16 iso_pu_bacteria 2885374607 2885374989 128
17 iso_pu_bacteria 2889033259 2889038035 128
18 iso_pu_bacteria 2903748898 2903755317 128
19 iso_pu_bacteria 2904690495 2904691224 128
20 iso_pu_bacteria 2904699407 2904701310 128
21 iso_pu_bacteria 2906610324 2906616542 128
22 iso_pu_bacteria 2908739725 2908741710 128
23 iso_pu_bacteria 2908756301 2908759135 128
24 iso_pu_bacteria 2922386360 2922387369 128
25 iso_pu_bacteria 2922425934 2922431438 128
26 iso_pu_bacteria 2935630451 2935634034 128
27 iso_pu_bacteria 2941507105 2941510663 128
28 iso_pu_bacteria 2941515067 2941518047 128
29 iso_pu_bacteria 2941523033 2941527082 128
30 iso_pu_bacteria 3005474847 3005481231 128
31 iso_pu_bacteria 8006933436 8006939478 128
32 iso_pu_bacteria 8006964411 8006972136 128
33 iso_pu_bacteria 8006973647 8006979228 128
34 iso_pu_bacteria 8006984368 8006984409 128
35 iso_pu_bacteria 8019555841 8019565358 128
36 iso_pu_bacteria 8019565922 8019575456 128
37 iso_pu_bacteria 8056673599 8056681087 128
38 3300005536 Ga0070697_100328239 Ga0070697_1003282392 129
39 3300006173 Ga0070716_101690869 Ga0070716_1016908691 129
40 3300006048 Ga0075363_100352030 Ga0075363_1003520302 130
41 3300028794 Ga0307515_10006012 Ga0307515_1000601215 130
42 3300050516 nmdc:mga0sz30_78446_c1 nmdc:mga0sz30_78446_c1_264_656 130
43 3300028379 Ga0268266_11270396 Ga0268266_112703962 131
44 3300039450 Ga0436363_0130820 Ga0436363_0130820_94_489 131
45 3300053078 Ga0495612_0332974 Ga0495612_0332974_64_459 131
46 3300003203 JGI25406J46586_10009343 JGI25406J46586_100093433 132
47 3300003214 JGI25165J46597_1011939 JGI25165J46597_10119391 132
48 3300003215 JGI25153J46596_10051467 JGI25153J46596_100514672 132
49 3300003659 JGI25404J52841_10003019 JGI25404J52841_100030192 132
50 3300003659 JGI25404J52841_10010753 JGI25404J52841_100107532 132
51 3300003659 JGI25404J52841_10016744 JGI25404J52841_100167442 132
52 3300003659 JGI25404J52841_10041444 JGI25404J52841_100414442 132
53 3300005327 Ga0070658_10150878 Ga0070658_101508782 132
54 3300005327 Ga0070658_10362781 Ga0070658_103627812 132
55 3300005328 Ga0070676_10668089 Ga0070676_106680892 132
56 3300005329 Ga0070683_100095571 Ga0070683_1000955712 132
57 3300005329 Ga0070683_100306288 Ga0070683_1003062882 132
58 3300005329 Ga0070683_101207674 Ga0070683_1012076741 132
59 3300005329 Ga0070683_101249715 Ga0070683_1012497152 132
60 3300005334 Ga0068869_100283829 Ga0068869_1002838292 132
61 3300005334 Ga0068869_100411856 Ga0068869_1004118562 132
62 3300005336 Ga0070680_100052018 Ga0070680_1000520184 132
63 3300005336 Ga0070680_100194884 Ga0070680_1001948842 132
64 3300005336 Ga0070680_100676728 Ga0070680_1006767281 132
65 3300005337 Ga0070682_100039753 Ga0070682_1000397534 132
66 3300005337 Ga0070682_100175885 Ga0070682_1001758852 132
67 3300005337 Ga0070682_100246809 Ga0070682_1002468092 132
68 3300005337 Ga0070682_100503776 Ga0070682_1005037762 132
69 3300005338 Ga0068868_100034182 Ga0068868_1000341822 132
70 3300005338 Ga0068868_100389483 Ga0068868_1003894832 132
71 3300005338 Ga0068868_100548398 Ga0068868_1005483982 132
72 3300005338 Ga0068868_100560813 Ga0068868_1005608131 132
73 3300005339 Ga0070660_100051646 Ga0070660_1000516462 132
74 3300005343 Ga0070687_100299556 Ga0070687_1002995562 132
75 3300005344 Ga0070661_100328466 Ga0070661_1003284662 132
76 3300005344 Ga0070661_100395995 Ga0070661_1003959952 132
77 3300005344 Ga0070661_100556992 Ga0070661_1005569922 132
78 3300005345 Ga0070692_10391666 Ga0070692_103916662 132
79 3300005347 Ga0070668_100044248 Ga0070668_1000442484 132
80 3300005347 Ga0070668_100074675 Ga0070668_1000746754 132
81 3300005347 Ga0070668_100207755 Ga0070668_1002077552 132
82 3300005347 Ga0070668_100301249 Ga0070668_1003012492 132
83 3300005347 Ga0070668_100481665 Ga0070668_1004816652 132
84 3300005347 Ga0070668_100724073 Ga0070668_1007240732 132
85 3300005353 Ga0070669_100068986 Ga0070669_1000689862 132
86 3300005355 Ga0070671_100342350 Ga0070671_1003423502 132
87 3300005355 Ga0070671_100383792 Ga0070671_1003837922 132
88 3300005355 Ga0070671_100708452 Ga0070671_1007084522 132
89 3300005356 Ga0070674_100034692 Ga0070674_1000346924 132
90 3300005365 Ga0070688_100855168 Ga0070688_1008551681 132
91 3300005366 Ga0070659_100053918 Ga0070659_1000539181 132
92 3300005367 Ga0070667_100236881 Ga0070667_1002368811 132
93 3300005367 Ga0070667_100569881 Ga0070667_1005698811 132
94 3300005367 Ga0070667_100623283 Ga0070667_1006232832 132
95 3300005367 Ga0070667_100797903 Ga0070667_1007979032 132
96 3300005434 Ga0070709_10004227 Ga0070709_100042277 132
97 3300005434 Ga0070709_10048345 Ga0070709_100483453 132
98 3300005434 Ga0070709_10311929 Ga0070709_103119291 132
99 3300005435 Ga0070714_100082971 Ga0070714_1000829712 132
100 3300005435 Ga0070714_100280905 Ga0070714_1002809052 132
101 3300005435 Ga0070714_100541466 Ga0070714_1005414662 132
102 3300005435 Ga0070714_100551108 Ga0070714_1005511082 132
103 3300005436 Ga0070713_100042275 Ga0070713_1000422754 132
104 3300005436 Ga0070713_100088760 Ga0070713_1000887602 132
105 3300005436 Ga0070713_100353933 Ga0070713_1003539331 132
106 3300005436 Ga0070713_100363813 Ga0070713_1003638132 132
107 3300005437 Ga0070710_10042080 Ga0070710_100420803 132
108 3300005437 Ga0070710_10179435 Ga0070710_101794352 132
109 3300005439 Ga0070711_100001730 Ga0070711_1000017307 132
110 3300005439 Ga0070711_100011938 Ga0070711_1000119382 132
111 3300005439 Ga0070711_100061879 Ga0070711_1000618794 132
112 3300005439 Ga0070711_100131145 Ga0070711_1001311452 132
113 3300005439 Ga0070711_100692074 Ga0070711_1006920741 132
114 3300005440 Ga0070705_100619464 Ga0070705_1006194642 132
115 3300005441 Ga0070700_100046080 Ga0070700_1000460802 132
116 3300005441 Ga0070700_100755597 Ga0070700_1007555972 132
117 3300005444 Ga0070694_100787580 Ga0070694_1007875802 132
118 3300005455 Ga0070663_100010941 Ga0070663_1000109412 132
119 3300005455 Ga0070663_100050917 Ga0070663_1000509172 132
120 3300005455 Ga0070663_100068772 Ga0070663_1000687723 132
121 3300005455 Ga0070663_100185086 Ga0070663_1001850862 132
122 3300005455 Ga0070663_100891518 Ga0070663_1008915181 132
123 3300005456 Ga0070678_100010095 Ga0070678_1000100956 132
124 3300005456 Ga0070678_100529455 Ga0070678_1005294552 132
125 3300005456 Ga0070678_100647096 Ga0070678_1006470962 132
126 3300005456 Ga0070678_100700015 Ga0070678_1007000151 132
127 3300005457 Ga0070662_100031971 Ga0070662_1000319713 132
128 3300005457 Ga0070662_100088266 Ga0070662_1000882662 132
129 3300005457 Ga0070662_100457978 Ga0070662_1004579781 132
130 3300005457 Ga0070662_100709265 Ga0070662_1007092652 132
131 3300005458 Ga0070681_10003273 Ga0070681_1000327314 132
132 3300005458 Ga0070681_10025087 Ga0070681_100250874 132
133 3300005458 Ga0070681_10056849 Ga0070681_100568494 132
134 3300005458 Ga0070681_10065024 Ga0070681_100650244 132
135 3300005458 Ga0070681_10341341 Ga0070681_103413412 132
136 3300005459 Ga0068867_100250304 Ga0068867_1002503042 132
137 3300005459 Ga0068867_100424557 Ga0068867_1004245572 132
138 3300005466 Ga0070685_10729585 Ga0070685_107295852 132
139 3300005466 Ga0070685_10756908 Ga0070685_107569082 132
140 3300005466 Ga0070685_10911377 Ga0070685_109113771 132
141 3300005471 Ga0070698_100536537 Ga0070698_1005365372 132
142 3300005471 Ga0070698_101485996 Ga0070698_1014859961 132
143 3300005518 Ga0070699_101178226 Ga0070699_1011782262 132
144 3300005530 Ga0070679_100009864 Ga0070679_1000098647 132
145 3300005530 Ga0070679_100017482 Ga0070679_1000174825 132
146 3300005530 Ga0070679_100017715 Ga0070679_1000177155 132
147 3300005530 Ga0070679_100036722 Ga0070679_1000367223 132
148 3300005530 Ga0070679_100303056 Ga0070679_1003030561 132
149 3300005530 Ga0070679_100865639 Ga0070679_1008656391 132
150 3300005535 Ga0070684_100013567 Ga0070684_1000135674 132
151 3300005535 Ga0070684_100231212 Ga0070684_1002312122 132
152 3300005535 Ga0070684_100338695 Ga0070684_1003386952 132
153 3300005535 Ga0070684_100481400 Ga0070684_1004814002 132
154 3300005536 Ga0070697_100350906 Ga0070697_1003509062 132
155 3300005539 Ga0068853_100040363 Ga0068853_1000403633 132
156 3300005539 Ga0068853_100130357 Ga0068853_1001303571 132
157 3300005539 Ga0068853_100286863 Ga0068853_1002868632 132
158 3300005539 Ga0068853_100372296 Ga0068853_1003722962 132
159 3300005539 Ga0068853_100411221 Ga0068853_1004112212 132
160 3300005543 Ga0070672_100191116 Ga0070672_1001911162 132
161 3300005543 Ga0070672_100191311 Ga0070672_1001913112 132
162 3300005543 Ga0070672_100431858 Ga0070672_1004318582 132
163 3300005543 Ga0070672_100895577 Ga0070672_1008955772 132
164 3300005544 Ga0070686_100740264 Ga0070686_1007402641 132
165 3300005545 Ga0070695_100764136 Ga0070695_1007641362 132
166 3300005546 Ga0070696_100760250 Ga0070696_1007602501 132
167 3300005547 Ga0070693_101383201 Ga0070693_1013832011 132
168 3300005548 Ga0070665_100189047 Ga0070665_1001890472 132
169 3300005548 Ga0070665_100336297 Ga0070665_1003362972 132
170 3300005548 Ga0070665_100357790 Ga0070665_1003577902 132
171 3300005548 Ga0070665_101089130 Ga0070665_1010891301 132
172 3300005548 Ga0070665_101216753 Ga0070665_1012167532 132
173 3300005548 Ga0070665_101665143 Ga0070665_1016651432 132
174 3300005549 Ga0070704_100517830 Ga0070704_1005178302 132
175 3300005563 Ga0068855_100010865 Ga0068855_1000108653 132
176 3300005563 Ga0068855_100067952 Ga0068855_1000679524 132
177 3300005563 Ga0068855_100116881 Ga0068855_1001168814 132
178 3300005563 Ga0068855_100142865 Ga0068855_1001428654 132
179 3300005564 Ga0070664_100089985 Ga0070664_1000899853 132
180 3300005564 Ga0070664_100363338 Ga0070664_1003633382 132
181 3300005577 Ga0068857_100016047 Ga0068857_1000160475 132
182 3300005577 Ga0068857_100106311 Ga0068857_1001063114 132
183 3300005577 Ga0068857_101483817 Ga0068857_1014838172 132
184 3300005577 Ga0068857_101752540 Ga0068857_1017525401 132
185 3300005577 Ga0068857_101803285 Ga0068857_1018032852 132
186 3300005578 Ga0068854_100316488 Ga0068854_1003164881 132
187 3300005578 Ga0068854_100587678 Ga0068854_1005876782 132
188 3300005614 Ga0068856_100731211 Ga0068856_1007312112 132
189 3300005615 Ga0070702_100130267 Ga0070702_1001302672 132
190 3300005616 Ga0068852_100036815 Ga0068852_1000368153 132
191 3300005616 Ga0068852_100249880 Ga0068852_1002498803 132
192 3300005616 Ga0068852_100254398 Ga0068852_1002543983 132
193 3300005616 Ga0068852_100477308 Ga0068852_1004773082 132
194 3300005616 Ga0068852_101247821 Ga0068852_1012478212 132
195 3300005616 Ga0068852_101867233 Ga0068852_1018672332 132
196 3300005617 Ga0068859_100463120 Ga0068859_1004631202 132
197 3300005618 Ga0068864_100494527 Ga0068864_1004945272 132
198 3300005718 Ga0068866_10021865 Ga0068866_100218653 132
199 3300005718 Ga0068866_10509547 Ga0068866_105095472 132
200 3300005719 Ga0068861_100410264 Ga0068861_1004102642 132
201 3300005719 Ga0068861_100816180 Ga0068861_1008161801 132
202 3300005719 Ga0068861_101639683 Ga0068861_1016396832 132
203 3300005834 Ga0068851_10004825 Ga0068851_100048253 132
204 3300005840 Ga0068870_10078252 Ga0068870_100782523 132
205 3300005841 Ga0068863_100655952 Ga0068863_1006559522 132
206 3300005841 Ga0068863_100744625 Ga0068863_1007446252 132
207 3300005841 Ga0068863_100911131 Ga0068863_1009111312 132
208 3300005841 Ga0068863_101044798 Ga0068863_1010447982 132
209 3300005841 Ga0068863_101352280 Ga0068863_1013522801 132
210 3300005842 Ga0068858_100046102 Ga0068858_1000461022 132
211 3300005842 Ga0068858_100074580 Ga0068858_1000745802 132
212 3300005842 Ga0068858_100917487 Ga0068858_1009174872 132
213 3300005843 Ga0068860_100331144 Ga0068860_1003311442 132
214 3300005843 Ga0068860_100352450 Ga0068860_1003524502 132
215 3300005843 Ga0068860_100462292 Ga0068860_1004622922 132
216 3300005843 Ga0068860_100483318 Ga0068860_1004833182 132
217 3300005843 Ga0068860_100499225 Ga0068860_1004992252 132
218 3300005844 Ga0068862_100129799 Ga0068862_1001297992 132
219 3300005844 Ga0068862_100302221 Ga0068862_1003022212 132
220 3300005844 Ga0068862_100414040 Ga0068862_1004140402 132
221 3300005844 Ga0068862_100515000 Ga0068862_1005150002 132
222 3300005844 Ga0068862_100669787 Ga0068862_1006697871 132
223 3300005844 Ga0068862_101682387 Ga0068862_1016823872 132
224 3300005937 Ga0081455_10009971 Ga0081455_100099719 132
225 3300005937 Ga0081455_10037550 Ga0081455_100375502 132
226 3300005937 Ga0081455_10087531 Ga0081455_100875313 132
227 3300005937 Ga0081455_10127583 Ga0081455_101275832 132
228 3300005937 Ga0081455_10150862 Ga0081455_101508622 132
229 3300005983 Ga0081540_1006422 Ga0081540_10064225 132
230 3300005983 Ga0081540_1009663 Ga0081540_10096637 132
231 3300005983 Ga0081540_1011844 Ga0081540_10118445 132
232 3300005983 Ga0081540_1012349 Ga0081540_10123492 132
233 3300005983 Ga0081540_1013491 Ga0081540_10134915 132
234 3300005983 Ga0081540_1014382 Ga0081540_10143825 132
235 3300005983 Ga0081540_1018818 Ga0081540_10188183 132
236 3300005985 Ga0081539_10000768 Ga0081539_1000076841 132
237 3300005985 Ga0081539_10001470 Ga0081539_100014701 132
238 3300005985 Ga0081539_10004445 Ga0081539_100044453 132
239 3300005985 Ga0081539_10058092 Ga0081539_100580922 132
240 3300006028 Ga0070717_10001267 Ga0070717_100012673 132
241 3300006028 Ga0070717_10017332 Ga0070717_100173325 132
242 3300006028 Ga0070717_10416085 Ga0070717_104160852 132
243 3300006028 Ga0070717_10501552 Ga0070717_105015522 132
244 3300006038 Ga0075365_10083284 Ga0075365_100832842 132
245 3300006038 Ga0075365_10101356 Ga0075365_101013563 132
246 3300006038 Ga0075365_10541421 Ga0075365_105414212 132
247 3300006038 Ga0075365_10770016 Ga0075365_107700162 132
248 3300006048 Ga0075363_100113059 Ga0075363_1001130592 132
249 3300006048 Ga0075363_100407285 Ga0075363_1004072852 132
250 3300006051 Ga0075364_10088472 Ga0075364_100884722 132
251 3300006058 Ga0075432_10149429 Ga0075432_101494292 132
252 3300006173 Ga0070716_100107458 Ga0070716_1001074582 132
253 3300006173 Ga0070716_100189057 Ga0070716_1001890572 132
254 3300006173 Ga0070716_100666400 Ga0070716_1006664002 132
255 3300006175 Ga0070712_100111079 Ga0070712_1001110793 132
256 3300006175 Ga0070712_100118582 Ga0070712_1001185822 132
257 3300006175 Ga0070712_100905172 Ga0070712_1009051722 132
258 3300006177 Ga0075362_10396330 Ga0075362_103963302 132
259 3300006178 Ga0075367_10142444 Ga0075367_101424441 132
260 3300006186 Ga0075369_10127055 Ga0075369_101270552 132
261 3300006186 Ga0075369_10247272 Ga0075369_102472721 132
262 3300006186 Ga0075369_10336005 Ga0075369_103360051 132
263 3300006195 Ga0075366_10239677 Ga0075366_102396772 132
264 3300006195 Ga0075366_10593436 Ga0075366_105934362 132
265 3300006195 Ga0075366_10603489 Ga0075366_106034892 132
266 3300006195 Ga0075366_10853991 Ga0075366_108539911 132
267 3300006237 Ga0097621_100209156 Ga0097621_1002091562 132
268 3300006237 Ga0097621_101107206 Ga0097621_1011072061 132
269 3300006237 Ga0097621_101274183 Ga0097621_1012741832 132
270 3300006237 Ga0097621_101490690 Ga0097621_1014906901 132
271 3300006353 Ga0075370_10219152 Ga0075370_102191522 132
272 3300006353 Ga0075370_10380400 Ga0075370_103804002 132
273 3300006358 Ga0068871_100254458 Ga0068871_1002544582 132
274 3300006358 Ga0068871_100483860 Ga0068871_1004838602 132
275 3300006358 Ga0068871_100802604 Ga0068871_1008026042 132
276 3300006358 Ga0068871_101385620 Ga0068871_1013856202 132
277 3300006844 Ga0075428_100700818 Ga0075428_1007008182 132
278 3300006852 Ga0075433_10677350 Ga0075433_106773501 132
279 3300006880 Ga0075429_100967043 Ga0075429_1009670432 132
280 3300006881 Ga0068865_100444871 Ga0068865_1004448712 132
281 3300006881 Ga0068865_100647710 Ga0068865_1006477102 132
282 3300006881 Ga0068865_100847786 Ga0068865_1008477862 132
283 3300006881 Ga0068865_101028166 Ga0068865_1010281662 132
284 3300006931 Ga0097620_100463136 Ga0097620_1004631362 132
285 3300006941 Ga0099825_1034140 Ga0099825_10341403 132
286 3300006942 Ga0099824_1007408 Ga0099824_10074087 132
287 3300006943 Ga0099822_1006547 Ga0099822_100654714 132
288 3300007265 Ga0099794_10013294 Ga0099794_100132942 132
289 3300007265 Ga0099794_10298454 Ga0099794_102984542 132
290 3300007265 Ga0099794_10419992 Ga0099794_104199922 132
291 3300007788 Ga0099795_10003875 Ga0099795_100038752 132
292 3300007788 Ga0099795_10184751 Ga0099795_101847512 132
293 3300009011 Ga0105251_10576561 Ga0105251_105765611 132
294 3300009092 Ga0105250_10539583 Ga0105250_105395831 132
295 3300009093 Ga0105240_10034221 Ga0105240_100342212 132
296 3300009093 Ga0105240_10058690 Ga0105240_100586903 132
297 3300009093 Ga0105240_10105395 Ga0105240_101053952 132
298 3300009093 Ga0105240_10108708 Ga0105240_101087082 132
299 3300009093 Ga0105240_10522672 Ga0105240_105226721 132
300 3300009093 Ga0105240_11095681 Ga0105240_110956812 132
301 3300009093 Ga0105240_11604799 Ga0105240_116047992 132
302 3300009093 Ga0105240_12534470 Ga0105240_125344701 132
303 3300009094 Ga0111539_10144248 Ga0111539_101442483 132
304 3300009094 Ga0111539_11656237 Ga0111539_116562372 132
305 3300009098 Ga0105245_10105057 Ga0105245_101050572 132
306 3300009098 Ga0105245_10289341 Ga0105245_102893412 132
307 3300009098 Ga0105245_10829319 Ga0105245_108293192 132
308 3300009098 Ga0105245_11842058 Ga0105245_118420582 132
309 3300009101 Ga0105247_10110567 Ga0105247_101105672 132
310 3300009101 Ga0105247_10136367 Ga0105247_101363672 132
311 3300009101 Ga0105247_10155708 Ga0105247_101557082 132
312 3300009101 Ga0105247_10400587 Ga0105247_104005872 132
313 3300009147 Ga0114129_10191104 Ga0114129_101911042 132
314 3300009148 Ga0105243_10078753 Ga0105243_100787531 132
315 3300009148 Ga0105243_10929161 Ga0105243_109291612 132
316 3300009148 Ga0105243_11232577 Ga0105243_112325772 132
317 3300009148 Ga0105243_12506854 Ga0105243_125068541 132
318 3300009174 Ga0105241_10028779 Ga0105241_100287794 132
319 3300009176 Ga0105242_10115715 Ga0105242_101157152 132
320 3300009176 Ga0105242_10131362 Ga0105242_101313623 132
321 3300009176 Ga0105242_11576074 Ga0105242_115760742 132
322 3300009176 Ga0105242_11936273 Ga0105242_119362732 132
323 3300009177 Ga0105248_10139917 Ga0105248_101399174 132
324 3300009177 Ga0105248_10204152 Ga0105248_102041523 132
325 3300009177 Ga0105248_10336933 Ga0105248_103369333 132
326 3300009177 Ga0105248_10881040 Ga0105248_108810402 132
327 3300009545 Ga0105237_10087664 Ga0105237_100876642 132
328 3300009545 Ga0105237_10508977 Ga0105237_105089772 132
329 3300009545 Ga0105237_10562761 Ga0105237_105627612 132
330 3300009545 Ga0105237_10641091 Ga0105237_106410912 132
331 3300009545 Ga0105237_10726224 Ga0105237_107262242 132
332 3300009545 Ga0105237_10766119 Ga0105237_107661192 132
333 3300009545 Ga0105237_11358764 Ga0105237_113587641 132
334 3300009545 Ga0105237_11568743 Ga0105237_115687431 132
335 3300009551 Ga0105238_10017402 Ga0105238_100174023 132
336 3300009551 Ga0105238_10140974 Ga0105238_101409743 132
337 3300009551 Ga0105238_10358018 Ga0105238_103580182 132
338 3300009551 Ga0105238_10360284 Ga0105238_103602842 132
339 3300009551 Ga0105238_10598531 Ga0105238_105985312 132
340 3300009551 Ga0105238_11028171 Ga0105238_110281711 132
341 3300009553 Ga0105249_10080447 Ga0105249_100804473 132
342 3300009553 Ga0105249_10645237 Ga0105249_106452372 132
343 3300010159 Ga0099796_10459180 Ga0099796_104591801 132
344 3300010375 Ga0105239_10020324 Ga0105239_100203247 132
345 3300010375 Ga0105239_10029566 Ga0105239_100295662 132
346 3300010375 Ga0105239_10118154 Ga0105239_101181542 132
347 3300010375 Ga0105239_10151085 Ga0105239_101510852 132
348 3300010375 Ga0105239_10404892 Ga0105239_104048922 132
349 3300010375 Ga0105239_10804993 Ga0105239_108049932 132
350 3300011119 Ga0105246_10106488 Ga0105246_101064882 132
351 3300011119 Ga0105246_10229454 Ga0105246_102294542 132
352 3300011119 Ga0105246_10256365 Ga0105246_102563652 132
353 3300011119 Ga0105246_10675292 Ga0105246_106752922 132
354 3300011119 Ga0105246_11328480 Ga0105246_113284802 132
355 3300012515 Ga0157338_1036802 Ga0157338_10368022 132
356 3300013102 Ga0157371_10727887 Ga0157371_107278872 132
357 3300013102 Ga0157371_11388202 Ga0157371_113882022 132
358 3300013104 Ga0157370_10014947 Ga0157370_100149476 132
359 3300013104 Ga0157370_10025078 Ga0157370_100250784 132
360 3300013104 Ga0157370_10071347 Ga0157370_100713473 132
361 3300013104 Ga0157370_10296740 Ga0157370_102967402 132
362 3300013104 Ga0157370_10862740 Ga0157370_108627402 132
363 3300013104 Ga0157370_10950068 Ga0157370_109500681 132
364 3300013105 Ga0157369_10021190 Ga0157369_100211905 132
365 3300013105 Ga0157369_10047353 Ga0157369_100473535 132
366 3300013105 Ga0157369_10130028 Ga0157369_101300284 132
367 3300013105 Ga0157369_10501429 Ga0157369_105014292 132
368 3300013105 Ga0157369_10602033 Ga0157369_106020332 132
369 3300013296 Ga0157374_10033305 Ga0157374_100333052 132
370 3300013296 Ga0157374_10530713 Ga0157374_105307132 132
371 3300013297 Ga0157378_10070080 Ga0157378_100700804 132
372 3300013297 Ga0157378_10356319 Ga0157378_103563192 132
373 3300013297 Ga0157378_10368636 Ga0157378_103686362 132
374 3300013297 Ga0157378_13043504 Ga0157378_130435041 132
375 3300013306 Ga0163162_10578216 Ga0163162_105782162 132
376 3300013306 Ga0163162_11108831 Ga0163162_111088311 132
377 3300013306 Ga0163162_11309716 Ga0163162_113097161 132
378 3300013306 Ga0163162_13152751 Ga0163162_131527511 132
379 3300013307 Ga0157372_10196832 Ga0157372_101968321 132
380 3300013307 Ga0157372_10708827 Ga0157372_107088272 132
381 3300013307 Ga0157372_12031415 Ga0157372_120314152 132
382 3300013307 Ga0157372_12344199 Ga0157372_123441991 132
383 3300013308 Ga0157375_10009689 Ga0157375_100096897 132
384 3300013308 Ga0157375_11105739 Ga0157375_111057392 132
385 3300013308 Ga0157375_11934839 Ga0157375_119348392 132
386 3300013308 Ga0157375_12308347 Ga0157375_123083472 132
387 3300014325 Ga0163163_10159204 Ga0163163_101592043 132
388 3300014325 Ga0163163_10453589 Ga0163163_104535892 132
389 3300014325 Ga0163163_10571962 Ga0163163_105719622 132
390 3300014325 Ga0163163_11094788 Ga0163163_110947882 132
391 3300014325 Ga0163163_12257726 Ga0163163_122577261 132
392 3300014326 Ga0157380_10184873 Ga0157380_101848732 132
393 3300014326 Ga0157380_10184912 Ga0157380_101849122 132
394 3300014326 Ga0157380_10811873 Ga0157380_108118732 132
395 3300014326 Ga0157380_12152610 Ga0157380_121526102 132
396 3300014745 Ga0157377_10094953 Ga0157377_100949532 132
397 3300014745 Ga0157377_10173047 Ga0157377_101730472 132
398 3300014745 Ga0157377_11356277 Ga0157377_113562771 132
399 3300014968 Ga0157379_10085565 Ga0157379_100855653 132
400 3300014968 Ga0157379_10341117 Ga0157379_103411172 132
401 3300014968 Ga0157379_10659533 Ga0157379_106595331 132
402 3300014969 Ga0157376_10092020 Ga0157376_100920202 132
403 3300014969 Ga0157376_10557471 Ga0157376_105574712 132
404 3300017792 Ga0163161_10128231 Ga0163161_101282312 132
405 3300017792 Ga0163161_10232435 Ga0163161_102324353 132
406 3300017792 Ga0163161_10303939 Ga0163161_103039392 132
407 3300020070 Ga0206356_10766524 Ga0206356_107665242 132
408 3300020070 Ga0206356_11320371 Ga0206356_113203712 132
409 3300020082 Ga0206353_10272000 Ga0206353_102720001 132
410 3300021377 Ga0213874_10013946 Ga0213874_100139462 132
411 3300021384 Ga0213876_10020027 Ga0213876_100200272 132
412 3300021384 Ga0213876_10072356 Ga0213876_100723562 132
413 3300025261 Ga0209233_1002384 Ga0209233_10023846 132
414 3300025297 Ga0209758_1030944 Ga0209758_10309442 132
415 3300025297 Ga0209758_1031236 Ga0209758_10312362 132
416 3300025297 Ga0209758_1050827 Ga0209758_10508272 132
417 3300025297 Ga0209758_1091452 Ga0209758_10914522 132
418 3300025315 Ga0207697_10085069 Ga0207697_100850692 132
419 3300025321 Ga0207656_10034898 Ga0207656_100348982 132
420 3300025893 Ga0207682_10212877 Ga0207682_102128772 132
421 3300025899 Ga0207642_10037371 Ga0207642_100373712 132
422 3300025899 Ga0207642_10398319 Ga0207642_103983192 132
423 3300025899 Ga0207642_10478566 Ga0207642_104785662 132
424 3300025899 Ga0207642_10583281 Ga0207642_105832811 132
425 3300025900 Ga0207710_10176392 Ga0207710_101763922 132
426 3300025900 Ga0207710_10384506 Ga0207710_103845062 132
427 3300025900 Ga0207710_10598127 Ga0207710_105981272 132
428 3300025901 Ga0207688_10215003 Ga0207688_102150032 132
429 3300025901 Ga0207688_10282908 Ga0207688_102829082 132
430 3300025901 Ga0207688_10421078 Ga0207688_104210782 132
431 3300025901 Ga0207688_10436633 Ga0207688_104366332 132
432 3300025901 Ga0207688_10518079 Ga0207688_105180791 132
433 3300025903 Ga0207680_10591542 Ga0207680_105915421 132
434 3300025905 Ga0207685_10027483 Ga0207685_100274831 132
435 3300025906 Ga0207699_10025234 Ga0207699_100252342 132
436 3300025906 Ga0207699_10156951 Ga0207699_101569512 132
437 3300025906 Ga0207699_10490158 Ga0207699_104901581 132
438 3300025906 Ga0207699_10910031 Ga0207699_109100312 132
439 3300025907 Ga0207645_10058248 Ga0207645_100582483 132
440 3300025907 Ga0207645_10172342 Ga0207645_101723422 132
441 3300025909 Ga0207705_10269578 Ga0207705_102695782 132
442 3300025909 Ga0207705_10295605 Ga0207705_102956052 132
443 3300025910 Ga0207684_10216101 Ga0207684_102161012 132
444 3300025910 Ga0207684_10558714 Ga0207684_105587142 132
445 3300025910 Ga0207684_11207051 Ga0207684_112070511 132
446 3300025911 Ga0207654_10429061 Ga0207654_104290612 132
447 3300025912 Ga0207707_10000419 Ga0207707_1000041934 132
448 3300025912 Ga0207707_10002705 Ga0207707_100027054 132
449 3300025912 Ga0207707_10002868 Ga0207707_100028685 132
450 3300025912 Ga0207707_10045918 Ga0207707_100459184 132
451 3300025912 Ga0207707_10135089 Ga0207707_101350892 132
452 3300025913 Ga0207695_10048124 Ga0207695_100481242 132
453 3300025913 Ga0207695_10060686 Ga0207695_100606865 132
454 3300025913 Ga0207695_10140869 Ga0207695_101408692 132
455 3300025913 Ga0207695_10240619 Ga0207695_102406192 132
456 3300025913 Ga0207695_10363647 Ga0207695_103636472 132
457 3300025914 Ga0207671_10061259 Ga0207671_100612592 132
458 3300025914 Ga0207671_10378725 Ga0207671_103787252 132
459 3300025914 Ga0207671_10456499 Ga0207671_104564992 132
460 3300025914 Ga0207671_10485729 Ga0207671_104857292 132
461 3300025914 Ga0207671_11174057 Ga0207671_111740572 132
462 3300025915 Ga0207693_10041850 Ga0207693_100418503 132
463 3300025915 Ga0207693_10071447 Ga0207693_100714473 132
464 3300025915 Ga0207693_10086606 Ga0207693_100866062 132
465 3300025915 Ga0207693_10770161 Ga0207693_107701612 132
466 3300025916 Ga0207663_10007087 Ga0207663_100070877 132
467 3300025916 Ga0207663_10043021 Ga0207663_100430213 132
468 3300025916 Ga0207663_10065948 Ga0207663_100659482 132
469 3300025916 Ga0207663_10116334 Ga0207663_101163342 132
470 3300025916 Ga0207663_10390605 Ga0207663_103906052 132
471 3300025917 Ga0207660_10012377 Ga0207660_100123772 132
472 3300025917 Ga0207660_10048142 Ga0207660_100481422 132
473 3300025917 Ga0207660_10305114 Ga0207660_103051142 132
474 3300025917 Ga0207660_10330707 Ga0207660_103307072 132
475 3300025918 Ga0207662_10113335 Ga0207662_101133352 132
476 3300025918 Ga0207662_11223767 Ga0207662_112237672 132
477 3300025919 Ga0207657_10011308 Ga0207657_100113082 132
478 3300025919 Ga0207657_10420585 Ga0207657_104205852 132
479 3300025920 Ga0207649_10039488 Ga0207649_100394882 132
480 3300025920 Ga0207649_10557951 Ga0207649_105579512 132
481 3300025921 Ga0207652_10001690 Ga0207652_1000169015 132
482 3300025921 Ga0207652_10009155 Ga0207652_100091555 132
483 3300025921 Ga0207652_10011695 Ga0207652_100116955 132
484 3300025921 Ga0207652_10047707 Ga0207652_100477073 132
485 3300025921 Ga0207652_10055058 Ga0207652_100550582 132
486 3300025922 Ga0207646_10826670 Ga0207646_108266702 132
487 3300025923 Ga0207681_10039022 Ga0207681_100390222 132
488 3300025923 Ga0207681_10411264 Ga0207681_104112642 132
489 3300025923 Ga0207681_10889286 Ga0207681_108892862 132
490 3300025924 Ga0207694_10027290 Ga0207694_100272902 132
491 3300025924 Ga0207694_10075966 Ga0207694_100759662 132
492 3300025924 Ga0207694_10321799 Ga0207694_103217992 132
493 3300025924 Ga0207694_10731282 Ga0207694_107312822 132
494 3300025924 Ga0207694_11027946 Ga0207694_110279461 132
495 3300025926 Ga0207659_10101426 Ga0207659_101014262 132
496 3300025927 Ga0207687_10157928 Ga0207687_101579282 132
497 3300025927 Ga0207687_10395148 Ga0207687_103951482 132
498 3300025927 Ga0207687_10641434 Ga0207687_106414342 132
499 3300025928 Ga0207700_10005544 Ga0207700_100055442 132
500 3300025928 Ga0207700_10063406 Ga0207700_100634062 132
501 3300025928 Ga0207700_10118805 Ga0207700_101188052 132
502 3300025928 Ga0207700_10120991 Ga0207700_101209912 132
503 3300025928 Ga0207700_10183800 Ga0207700_101838002 132
504 3300025928 Ga0207700_11162919 Ga0207700_111629191 132
505 3300025929 Ga0207664_10042851 Ga0207664_100428513 132
506 3300025929 Ga0207664_10150641 Ga0207664_101506412 132
507 3300025929 Ga0207664_10229936 Ga0207664_102299362 132
508 3300025929 Ga0207664_10489807 Ga0207664_104898072 132
509 3300025931 Ga0207644_10234854 Ga0207644_102348542 132
510 3300025931 Ga0207644_11082889 Ga0207644_110828891 132
511 3300025931 Ga0207644_11312479 Ga0207644_113124791 132
512 3300025931 Ga0207644_11400987 Ga0207644_114009872 132
513 3300025932 Ga0207690_10587430 Ga0207690_105874302 132
514 3300025933 Ga0207706_10015272 Ga0207706_100152725 132
515 3300025933 Ga0207706_10225273 Ga0207706_102252732 132
516 3300025933 Ga0207706_10408965 Ga0207706_104089652 132
517 3300025935 Ga0207709_10358165 Ga0207709_103581651 132
518 3300025935 Ga0207709_10503061 Ga0207709_105030612 132
519 3300025935 Ga0207709_10528054 Ga0207709_105280542 132
520 3300025935 Ga0207709_10862442 Ga0207709_108624422 132
521 3300025935 Ga0207709_10893438 Ga0207709_108934381 132
522 3300025937 Ga0207669_10095367 Ga0207669_100953673 132
523 3300025937 Ga0207669_10718476 Ga0207669_107184761 132
524 3300025937 Ga0207669_11091687 Ga0207669_110916872 132
525 3300025938 Ga0207704_10666308 Ga0207704_106663082 132
526 3300025938 Ga0207704_11179898 Ga0207704_111798982 132
527 3300025939 Ga0207665_10036449 Ga0207665_100364493 132
528 3300025939 Ga0207665_10088797 Ga0207665_100887972 132
529 3300025939 Ga0207665_10195726 Ga0207665_101957262 132
530 3300025939 Ga0207665_10253201 Ga0207665_102532012 132
531 3300025939 Ga0207665_10611246 Ga0207665_106112463 132
532 3300025939 Ga0207665_10847064 Ga0207665_108470642 132
533 3300025940 Ga0207691_10054640 Ga0207691_100546402 132
534 3300025940 Ga0207691_10168119 Ga0207691_101681192 132
535 3300025940 Ga0207691_10426374 Ga0207691_104263742 132
536 3300025940 Ga0207691_10505181 Ga0207691_105051812 132
537 3300025940 Ga0207691_10765507 Ga0207691_107655072 132
538 3300025941 Ga0207711_10284242 Ga0207711_102842422 132
539 3300025942 Ga0207689_10011785 Ga0207689_100117853 132
540 3300025942 Ga0207689_10125319 Ga0207689_101253192 132
541 3300025942 Ga0207689_10326522 Ga0207689_103265222 132
542 3300025944 Ga0207661_10001270 Ga0207661_100012705 132
543 3300025944 Ga0207661_10008213 Ga0207661_100082135 132
544 3300025944 Ga0207661_10021058 Ga0207661_100210583 132
545 3300025945 Ga0207679_10069235 Ga0207679_100692353 132
546 3300025945 Ga0207679_10271615 Ga0207679_102716152 132
547 3300025945 Ga0207679_10377220 Ga0207679_103772202 132
548 3300025945 Ga0207679_10916061 Ga0207679_109160612 132
549 3300025949 Ga0207667_10002017 Ga0207667_1000201710 132
550 3300025949 Ga0207667_10145129 Ga0207667_101451294 132
551 3300025949 Ga0207667_10201639 Ga0207667_102016391 132
552 3300025949 Ga0207667_10510487 Ga0207667_105104872 132
553 3300025949 Ga0207667_11719651 Ga0207667_117196512 132
554 3300025960 Ga0207651_10112506 Ga0207651_101125062 132
555 3300025960 Ga0207651_10603500 Ga0207651_106035002 132
556 3300025961 Ga0207712_10128621 Ga0207712_101286212 132
557 3300025972 Ga0207668_10150043 Ga0207668_101500432 132
558 3300025972 Ga0207668_10241238 Ga0207668_102412382 132
559 3300025972 Ga0207668_10335998 Ga0207668_103359982 132
560 3300025972 Ga0207668_10471341 Ga0207668_104713412 132
561 3300025972 Ga0207668_10481127 Ga0207668_104811272 132
562 3300025972 Ga0207668_10558761 Ga0207668_105587612 132
563 3300025981 Ga0207640_10214238 Ga0207640_102142382 132
564 3300025981 Ga0207640_10407822 Ga0207640_104078221 132
565 3300025981 Ga0207640_10539537 Ga0207640_105395372 132
566 3300025986 Ga0207658_10132641 Ga0207658_101326412 132
567 3300025986 Ga0207658_10375592 Ga0207658_103755922 132
568 3300025986 Ga0207658_11256020 Ga0207658_112560202 132
569 3300025986 Ga0207658_11567847 Ga0207658_115678472 132
570 3300026023 Ga0207677_10005891 Ga0207677_100058912 132
571 3300026023 Ga0207677_10532795 Ga0207677_105327951 132
572 3300026035 Ga0207703_10394218 Ga0207703_103942182 132
573 3300026035 Ga0207703_10999855 Ga0207703_109998552 132
574 3300026035 Ga0207703_11300422 Ga0207703_113004222 132
575 3300026041 Ga0207639_10173169 Ga0207639_101731692 132
576 3300026041 Ga0207639_10837909 Ga0207639_108379092 132
577 3300026041 Ga0207639_10970591 Ga0207639_109705911 132
578 3300026041 Ga0207639_12227199 Ga0207639_122271991 132
579 3300026067 Ga0207678_10006479 Ga0207678_100064799 132
580 3300026067 Ga0207678_10044766 Ga0207678_100447664 132
581 3300026067 Ga0207678_10061454 Ga0207678_100614543 132
582 3300026067 Ga0207678_10196905 Ga0207678_101969052 132
583 3300026067 Ga0207678_10628445 Ga0207678_106284451 132
584 3300026067 Ga0207678_10860880 Ga0207678_108608802 132
585 3300026067 Ga0207678_11372541 Ga0207678_113725412 132
586 3300026067 Ga0207678_11916079 Ga0207678_119160791 132
587 3300026075 Ga0207708_10158521 Ga0207708_101585212 132
588 3300026075 Ga0207708_10981793 Ga0207708_109817932 132
589 3300026078 Ga0207702_10273884 Ga0207702_102738841 132
590 3300026078 Ga0207702_10875316 Ga0207702_108753162 132
591 3300026078 Ga0207702_10903267 Ga0207702_109032672 132
592 3300026088 Ga0207641_10606623 Ga0207641_106066232 132
593 3300026088 Ga0207641_11251741 Ga0207641_112517412 132
594 3300026088 Ga0207641_11833036 Ga0207641_118330362 132
595 3300026089 Ga0207648_10797285 Ga0207648_107972851 132
596 3300026089 Ga0207648_10821718 Ga0207648_108217181 132
597 3300026089 Ga0207648_10936444 Ga0207648_109364442 132
598 3300026095 Ga0207676_10069328 Ga0207676_100693281 132
599 3300026116 Ga0207674_10010575 Ga0207674_100105753 132
600 3300026116 Ga0207674_10113295 Ga0207674_101132954 132
601 3300026116 Ga0207674_10242397 Ga0207674_102423973 132
602 3300026116 Ga0207674_10457616 Ga0207674_104576162 132
603 3300026116 Ga0207674_10594400 Ga0207674_105944002 132
604 3300026116 Ga0207674_11383866 Ga0207674_113838662 132
605 3300026116 Ga0207674_11674039 Ga0207674_116740391 132
606 3300026118 Ga0207675_100031334 Ga0207675_1000313342 132
607 3300026118 Ga0207675_100064640 Ga0207675_1000646403 132
608 3300026118 Ga0207675_100274434 Ga0207675_1002744342 132
609 3300026118 Ga0207675_100422111 Ga0207675_1004221111 132
610 3300026118 Ga0207675_101532037 Ga0207675_1015320372 132
611 3300026118 Ga0207675_101742728 Ga0207675_1017427282 132
612 3300026118 Ga0207675_101791882 Ga0207675_1017918821 132
613 3300026121 Ga0207683_10021694 Ga0207683_100216942 132
614 3300026121 Ga0207683_10197482 Ga0207683_101974822 132
615 3300026121 Ga0207683_10648249 Ga0207683_106482492 132
616 3300026121 Ga0207683_10766064 Ga0207683_107660642 132
617 3300026142 Ga0207698_10226900 Ga0207698_102269003 132
618 3300026142 Ga0207698_10295269 Ga0207698_102952692 132
619 3300026142 Ga0207698_10317285 Ga0207698_103172852 132
620 3300026142 Ga0207698_10501287 Ga0207698_105012872 132
621 3300026142 Ga0207698_11430873 Ga0207698_114308731 132
622 3300027357 Ga0209589_1000014 Ga0209589_1000014167 132
623 3300027361 Ga0209489_100014 Ga0209489_100014167 132
624 3300027363 Ga0209700_100024 Ga0209700_100024167 132
625 3300027512 Ga0209179_1012641 Ga0209179_10126412 132
626 3300027512 Ga0209179_1048167 Ga0209179_10481672 132
627 3300027671 Ga0209588_1002539 Ga0209588_10025392 132
628 3300028379 Ga0268266_10147257 Ga0268266_101472572 132
629 3300028379 Ga0268266_10201322 Ga0268266_102013222 132
630 3300028379 Ga0268266_10391978 Ga0268266_103919782 132
631 3300028379 Ga0268266_10570437 Ga0268266_105704371 132
632 3300028380 Ga0268265_10198420 Ga0268265_101984201 132
633 3300028380 Ga0268265_10268121 Ga0268265_102681212 132
634 3300028380 Ga0268265_10304954 Ga0268265_103049542 132
635 3300028380 Ga0268265_10753171 Ga0268265_107531711 132
636 3300028380 Ga0268265_11590458 Ga0268265_115904582 132
637 3300028380 Ga0268265_11681054 Ga0268265_116810542 132
638 3300028380 Ga0268265_11964165 Ga0268265_119641652 132
639 3300028380 Ga0268265_12483165 Ga0268265_124831652 132
640 3300028381 Ga0268264_10055549 Ga0268264_100555493 132
641 3300028381 Ga0268264_10292401 Ga0268264_102924012 132
642 3300028381 Ga0268264_10568056 Ga0268264_105680562 132
643 3300028381 Ga0268264_10893234 Ga0268264_108932342 132
644 3300028381 Ga0268264_11123623 Ga0268264_111236232 132
645 3300028381 Ga0268264_11758227 Ga0268264_117582271 132
646 3300028556 Ga0265337_1007001 Ga0265337_10070014 132
647 3300028558 Ga0265326_10065353 Ga0265326_100653532 132
648 3300028563 Ga0265319_1006536 Ga0265319_10065364 132
649 3300028573 Ga0265334_10001696 Ga0265334_1000169610 132
650 3300028577 Ga0265318_10008197 Ga0265318_100081975 132
651 3300028653 Ga0265323_10001106 Ga0265323_100011063 132
652 3300028654 Ga0265322_10001590 Ga0265322_100015903 132
653 3300028666 Ga0265336_10000135 Ga0265336_1000013533 132
654 3300028786 Ga0307517_10000634 Ga0307517_1000063446 132
655 3300028786 Ga0307517_10039620 Ga0307517_100396205 132
656 3300028786 Ga0307517_10324896 Ga0307517_103248962 132
657 3300028786 Ga0307517_10594244 Ga0307517_105942441 132
658 3300028794 Ga0307515_10512273 Ga0307515_105122732 132
659 3300028800 Ga0265338_10000034 Ga0265338_10000034173 132
660 3300028800 Ga0265338_10361635 Ga0265338_103616351 132
661 3300029957 Ga0265324_10001466 Ga0265324_100014669 132
662 3300029957 Ga0265324_10156835 Ga0265324_101568351 132
663 3300030521 Ga0307511_10024264 Ga0307511_100242642 132
664 3300031238 Ga0265332_10013209 Ga0265332_100132094 132
665 3300031456 Ga0307513_10125438 Ga0307513_101254385 132
666 3300031456 Ga0307513_10444506 Ga0307513_104445062 132
667 3300031456 Ga0307513_10645174 Ga0307513_106451741 132
668 3300031507 Ga0307509_10132445 Ga0307509_101324452 132
669 3300031507 Ga0307509_10826352 Ga0307509_108263522 132
670 3300031616 Ga0307508_10000032 Ga0307508_1000003279 132
671 3300031616 Ga0307508_10022899 Ga0307508_100228995 132
672 3300031616 Ga0307508_10139265 Ga0307508_101392653 132
673 3300031616 Ga0307508_10715631 Ga0307508_107156312 132
674 3300031711 Ga0265314_10195305 Ga0265314_101953052 132
675 3300031730 Ga0307516_10005934 Ga0307516_100059343 132
676 3300031730 Ga0307516_10039539 Ga0307516_100395392 132
677 3300031730 Ga0307516_10300751 Ga0307516_103007512 132
678 3300031731 Ga0307405_10879540 Ga0307405_108795402 132
679 3300031824 Ga0307413_10061917 Ga0307413_100619172 132
680 3300031824 Ga0307413_10440005 Ga0307413_104400052 132
681 3300031852 Ga0307410_10143713 Ga0307410_101437132 132
682 3300031901 Ga0307406_10896882 Ga0307406_108968822 132
683 3300031903 Ga0307407_10186122 Ga0307407_101861222 132
684 3300031911 Ga0307412_10093307 Ga0307412_100933072 132
685 3300031911 Ga0307412_11811460 Ga0307412_118114601 132
686 3300032002 Ga0307416_100738479 Ga0307416_1007384792 132
687 3300032005 Ga0307411_10300285 Ga0307411_103002852 132
688 3300032126 Ga0307415_100094054 Ga0307415_1000940542 132
689 3300032126 Ga0307415_100687932 Ga0307415_1006879322 132
690 3300033179 Ga0307507_10011278 Ga0307507_1001127811 132
691 3300033180 Ga0307510_10016157 Ga0307510_100161576 132
692 3300033180 Ga0307510_10091519 Ga0307510_100915192 132
693 3300034816 Ga0373930_0001351 Ga0373930_0001351_1853_2251 132
694 3300034820 Ga0373959_0055718 Ga0373959_0055718_389_787 132
695 3300035083 Ga0373926_0007554 Ga0373926_0007554_2595_2993 132
696 3300035086 Ga0373934_0187215 Ga0373934_0187215_10_408 132
697 3300035091 Ga0373951_0013653 Ga0373951_0013653_944_1342 132
698 3300035092 Ga0373952_0108085 Ga0373952_0108085_103_501 132
699 3300035111 Ga0373923_0061471 Ga0373923_0061471_936_1334 132
700 3300035111 Ga0373923_0236904 Ga0373923_0236904_267_677 132
701 3300035113 Ga0373936_0061479 Ga0373936_0061479_17_415 132
702 3300035113 Ga0373936_0068996 Ga0373936_0068996_244_642 132
703 3300035114 Ga0373939_0227291 Ga0373939_0227291_207_605 132
704 3300035114 Ga0373939_0489452 Ga0373939_0489452_71_469 132
705 3300035118 Ga0373954_0081500 Ga0373954_0081500_287_685 132
706 3300035118 Ga0373954_0166773 Ga0373954_0166773_13_411 132
707 3300035119 Ga0373956_0304788 Ga0373956_0304788_239_637 132
708 3300035119 Ga0373956_0407056 Ga0373956_0407056_201_599 132
709 3300035170 Ga0373943_0083782 Ga0373943_0083782_14_412 132
710 3300035171 Ga0373946_0026464 Ga0373946_0026464_1065_1463 132
711 3300035171 Ga0373946_0058279 Ga0373946_0058279_289_687 132
712 3300035172 Ga0373955_0040395 Ga0373955_0040395_1358_1756 132
713 3300035172 Ga0373955_0058451 Ga0373955_0058451_660_1058 132
714 3300035172 Ga0373955_0880774 Ga0373955_0880774_34_432 132
715 3300035410 Ga0373924_0017175 Ga0373924_0017175_387_785 132
716 3300035691 Ga0373931_0002187 Ga0373931_0002187_4643_5041 132
717 3300035691 Ga0373931_0384182 Ga0373931_0384182_206_604 132
718 3300035691 Ga0373931_0390676 Ga0373931_0390676_421_819 132
719 3300035691 Ga0373931_0434475 Ga0373931_0434475_247_645 132
720 3300035691 Ga0373931_1246755 Ga0373931_1246755_72_470 132
721 3300035692 Ga0373935_0012923 Ga0373935_0012923_1030_1428 132
722 3300035692 Ga0373935_0032924 Ga0373935_0032924_2111_2509 132
723 3300035692 Ga0373935_0063455 Ga0373935_0063455_1801_2235 132
724 3300035692 Ga0373935_0069468 Ga0373935_0069468_1307_1705 132
725 3300035692 Ga0373935_0324990 Ga0373935_0324990_587_985 132
726 3300035692 Ga0373935_0607081 Ga0373935_0607081_343_741 132
727 3300035695 Ga0373927_0014717 Ga0373927_0014717_298_732 132
728 3300035695 Ga0373927_0015621 Ga0373927_0015621_1971_2369 132
729 3300035695 Ga0373927_0044610 Ga0373927_0044610_1253_1651 132
730 3300035695 Ga0373927_0060854 Ga0373927_0060854_1717_2115 132
731 3300035695 Ga0373927_0169814 Ga0373927_0169814_134_532 132
732 3300035695 Ga0373927_0523744 Ga0373927_0523744_277_675 132
733 3300035695 Ga0373927_0605220 Ga0373927_0605220_218_616 132
734 3300035695 Ga0373927_0732936 Ga0373927_0732936_193_591 132
735 3300035724 Ga0373933_0000182 Ga0373933_0000182_19541_19939 132
736 3300035724 Ga0373933_0219645 Ga0373933_0219645_307_705 132
737 3300035724 Ga0373933_1055597 Ga0373933_1055597_55_453 132
738 3300035725 Ga0373947_0025925 Ga0373947_0025925_2445_2843 132
739 3300035725 Ga0373947_0028707 Ga0373947_0028707_1948_2382 132
740 3300035725 Ga0373947_0076608 Ga0373947_0076608_1619_2017 132
741 3300036401 Ga0373937_0399859 Ga0373937_0399859_40_438 132
742 3300036459 Ga0372808_009572 Ga0372808_009572_55_453 132
743 3300037068 Ga0373925_0025108 Ga0373925_0025108_352_750 132
744 3300037068 Ga0373925_0054383 Ga0373925_0054383_437_835 132
745 3300037068 Ga0373925_0102550 Ga0373925_0102550_329_727 132
746 3300037068 Ga0373925_0125508 Ga0373925_0125508_111_509 132
747 3300037068 Ga0373925_0453465 Ga0373925_0453465_104_502 132
748 3300037068 Ga0373925_0589940 Ga0373925_0589940_34_432 132
749 3300037418 Ga0395900_0017080 Ga0395900_0017080_2636_3034 132
750 3300037418 Ga0395900_0082779 Ga0395900_0082779_95_493 132
751 3300037418 Ga0395900_0200935 Ga0395900_0200935_732_1130 132
752 3300037466 Ga0395898_0099842 Ga0395898_0099842_1513_1911 132
753 3300038443 Ga0395901_0044477 Ga0395901_0044477_1453_1851 132
754 3300038443 Ga0395901_0153963 Ga0395901_0153963_1804_2202 132
755 3300038443 Ga0395901_0251715 Ga0395901_0251715_395_793 132
756 3300039437 Ga0436365_0229539 Ga0436365_0229539_119_517 132
757 3300039437 Ga0436365_0585470 Ga0436365_0585470_250_648 132
758 3300039437 Ga0436365_0644236 Ga0436365_0644236_474_872 132
759 3300039437 Ga0436365_1524424 Ga0436365_1524424_206_604 132
760 3300039437 Ga0436365_1891875 Ga0436365_1891875_61_459 132
761 3300039450 Ga0436363_0194304 Ga0436363_0194304_787_1185 132
762 3300039450 Ga0436363_0749925 Ga0436363_0749925_60_458 132
763 3300039450 Ga0436363_1284900 Ga0436363_1284900_2262_2660 132
764 3300041413 Ga0439465_0026133 Ga0439465_0026133_213_611 132
765 3300041452 Ga0451793_1610473 Ga0451793_1610473_365_763 132
766 3300041486 Ga0451807_0104523 Ga0451807_0104523_22_432 132
767 3300041507 Ga0451851_0290019 Ga0451851_0290019_91_489 132
768 3300041511 Ga0451855_0070536 Ga0451855_0070536_453_851 132
769 3300041512 Ga0451853_1007521 Ga0451853_1007521_357_755 132
770 3300042438 Ga0439459_0016118 Ga0439459_0016118_835_1233 132
771 3300044693 Ga0466961_0065107 Ga0466961_0065107_10_408 132
772 3300044706 Ga0466964_0154855 Ga0466964_0154855_28_426 132
773 3300044719 Ga0466971_0518372 Ga0466971_0518372_20_418 132
774 3300044765 Ga0466970_0232843 Ga0466970_0232843_186_605 132
775 3300045049 Ga0466959_0778571 Ga0466959_0778571_46_444 132
776 3300045976 Ga0466967_0285270 Ga0466967_0285270_1114_1530 132
777 3300045976 Ga0466967_0306657 Ga0466967_0306657_784_1182 132
778 3300045976 Ga0466967_0347873 Ga0466967_0347873_667_1065 132
779 3300045976 Ga0466967_0392747 Ga0466967_0392747_71_469 132
780 3300046452 Ga0495617_013046 Ga0495617_013046_2025_2423 132
781 3300046452 Ga0495617_155269 Ga0495617_155269_165_575 132
782 3300046454 Ga0495592_0022948 Ga0495592_0022948_637_1035 132
783 3300046454 Ga0495592_0068249 Ga0495592_0068249_898_1296 132
784 3300046455 Ga0495603_0003836 Ga0495603_0003836_7865_8263 132
785 3300046455 Ga0495603_0023547 Ga0495603_0023547_1563_1973 132
786 3300046455 Ga0495603_0043708 Ga0495603_0043708_1665_2123 132
787 3300046455 Ga0495603_0080616 Ga0495603_0080616_1187_1585 132
788 3300046455 Ga0495603_0622622 Ga0495603_0622622_135_533 132
789 3300046459 Ga0495629_0000862 Ga0495629_0000862_8510_8908 132
790 3300046459 Ga0495629_0091399 Ga0495629_0091399_162_560 132
791 3300046459 Ga0495629_0406317 Ga0495629_0406317_188_598 132
792 3300046460 Ga0495638_0019608 Ga0495638_0019608_2575_2973 132
793 3300046460 Ga0495638_0148689 Ga0495638_0148689_378_788 132
794 3300046460 Ga0495638_0200917 Ga0495638_0200917_498_896 132
795 3300046461 Ga0495641_0348703 Ga0495641_0348703_164_574 132
796 3300046462 Ga0495651_0267567 Ga0495651_0267567_246_644 132
797 3300046463 Ga0495653_0373644 Ga0495653_0373644_25_423 132
798 3300046472 Ga0495580_0010268 Ga0495580_0010268_22_420 132
799 3300046472 Ga0495580_0037193 Ga0495580_0037193_2166_2564 132
800 3300046472 Ga0495580_0059540 Ga0495580_0059540_573_1007 132
801 3300046473 Ga0495582_0006572 Ga0495582_0006572_3254_3652 132
802 3300046473 Ga0495582_0025793 Ga0495582_0025793_735_1133 132
803 3300046473 Ga0495582_0107941 Ga0495582_0107941_991_1425 132
804 3300046473 Ga0495582_0187308 Ga0495582_0187308_518_916 132
805 3300046474 Ga0495605_0194958 Ga0495605_0194958_186_584 132
806 3300046475 Ga0495639_0000544 Ga0495639_0000544_14230_14628 132
807 3300046475 Ga0495639_0703245 Ga0495639_0703245_85_483 132
808 3300046476 Ga0495662_0042974 Ga0495662_0042974_645_1043 132
809 3300046477 Ga0495664_0063932 Ga0495664_0063932_337_735 132
810 3300046477 Ga0495664_0077097 Ga0495664_0077097_1470_1868 132
811 3300046492 Ga0495585_0032350 Ga0495585_0032350_1902_2300 132
812 3300046492 Ga0495585_0037849 Ga0495585_0037849_1303_1701 132
813 3300046492 Ga0495585_0341597 Ga0495585_0341597_70_468 132
814 3300046492 Ga0495585_0355030 Ga0495585_0355030_129_539 132
815 3300046492 Ga0495585_0388404 Ga0495585_0388404_142_540 132
816 3300046499 Ga0495594_0026789 Ga0495594_0026789_85_483 132
817 3300046499 Ga0495594_0154774 Ga0495594_0154774_793_1191 132
818 3300046499 Ga0495594_0198833 Ga0495594_0198833_108_542 132
819 3300046500 Ga0495596_0066425 Ga0495596_0066425_328_726 132
820 3300046507 Ga0495606_0253460 Ga0495606_0253460_200_598 132
821 3300046507 Ga0495606_0551029 Ga0495606_0551029_25_423 132
822 3300046511 Ga0495608_0143484 Ga0495608_0143484_194_592 132
823 3300046512 Ga0495610_0144252 Ga0495610_0144252_11_409 132
824 3300046512 Ga0495610_0249092 Ga0495610_0249092_11_409 132
825 3300046512 Ga0495610_0337008 Ga0495610_0337008_15_413 132
826 3300046513 Ga0495616_0269497 Ga0495616_0269497_237_635 132
827 3300046514 Ga0495618_0430387 Ga0495618_0430387_23_421 132
828 3300046515 Ga0495620_0088969 Ga0495620_0088969_815_1213 132
829 3300046517 Ga0495630_0026624 Ga0495630_0026624_825_1223 132
830 3300046517 Ga0495630_0029536 Ga0495630_0029536_1223_1621 132
831 3300046518 Ga0495631_0067517 Ga0495631_0067517_508_906 132
832 3300046518 Ga0495631_0191757 Ga0495631_0191757_437_847 132
833 3300046518 Ga0495631_0215006 Ga0495631_0215006_403_801 132
834 3300046518 Ga0495631_0284483 Ga0495631_0284483_177_575 132
835 3300046518 Ga0495631_0307965 Ga0495631_0307965_94_492 132
836 3300046519 Ga0495632_0136433 Ga0495632_0136433_17_415 132
837 3300046519 Ga0495632_0227779 Ga0495632_0227779_65_463 132
838 3300046523 Ga0495644_0073339 Ga0495644_0073339_62_460 132
839 3300046525 Ga0495663_0081096 Ga0495663_0081096_572_970 132
840 3300046526 Ga0495666_0051203 Ga0495666_0051203_1568_1966 132
841 3300046526 Ga0495666_0502043 Ga0495666_0502043_32_430 132
842 3300046529 Ga0495652_0111297 Ga0495652_0111297_1714_2112 132
843 3300046529 Ga0495652_0465025 Ga0495652_0465025_308_736 132
844 3300046531 Ga0495665_0007397 Ga0495665_0007397_4901_5299 132
845 3300046531 Ga0495665_0155014 Ga0495665_0155014_735_1133 132
846 3300046531 Ga0495665_0208083 Ga0495665_0208083_132_566 132
847 3300046533 Ga0495640_0002595 Ga0495640_0002595_1245_1643 132
848 3300046533 Ga0495640_0853911 Ga0495640_0853911_48_446 132
849 3300046535 Ga0495586_0111796 Ga0495586_0111796_818_1216 132
850 3300046536 Ga0495587_0035087 Ga0495587_0035087_2031_2429 132
851 3300046537 Ga0495598_0383886 Ga0495598_0383886_122_520 132
852 3300046538 Ga0495609_0135061 Ga0495609_0135061_69_467 132
853 3300046538 Ga0495609_0318243 Ga0495609_0318243_25_423 132
854 3300046542 Ga0495597_0086925 Ga0495597_0086925_385_783 132
855 3300046543 Ga0495645_0228866 Ga0495645_0228866_806_1204 132
856 3300046543 Ga0495645_0466904 Ga0495645_0466904_341_739 132
857 3300046543 Ga0495645_0617971 Ga0495645_0617971_40_504 132
858 3300046543 Ga0495645_0750689 Ga0495645_0750689_93_491 132
859 3300046557 Ga0495622_0012042 Ga0495622_0012042_2470_2868 132
860 3300046557 Ga0495622_0064031 Ga0495622_0064031_23_421 132
861 3300046558 Ga0495633_0267211 Ga0495633_0267211_62_460 132
862 3300046559 Ga0495667_0154776 Ga0495667_0154776_28_426 132
863 3300046559 Ga0495667_0785131 Ga0495667_0785131_81_479 132
864 3300046615 Ga0495656_0026839 Ga0495656_0026839_818_1216 132
865 3300046615 Ga0495656_0052703 Ga0495656_0052703_1187_1585 132
866 3300046615 Ga0495656_0179193 Ga0495656_0179193_97_495 132
867 3300046616 Ga0495668_0077670 Ga0495668_0077670_401_799 132
868 3300046616 Ga0495668_0085192 Ga0495668_0085192_599_997 132
869 3300046616 Ga0495668_0249305 Ga0495668_0249305_122_520 132
870 3300046616 Ga0495668_0255578 Ga0495668_0255578_209_607 132
871 3300046616 Ga0495668_0282838 Ga0495668_0282838_482_880 132
872 3300046642 Ga0495634_0290709 Ga0495634_0290709_494_892 132
873 3300046648 Ga0495611_0072829 Ga0495611_0072829_437_847 132
874 3300046648 Ga0495611_0121136 Ga0495611_0121136_644_1042 132
875 3300046648 Ga0495611_0316384 Ga0495611_0316384_302_700 132
876 3300046660 Ga0495625_0183777 Ga0495625_0183777_366_764 132
877 3300046660 Ga0495625_0433421 Ga0495625_0433421_183_581 132
878 3300046660 Ga0495625_0484986 Ga0495625_0484986_337_747 132
879 3300046660 Ga0495625_0590184 Ga0495625_0590184_46_444 132
880 3300046663 Ga0495635_0000436 Ga0495635_0000436_2633_3031 132
881 3300046663 Ga0495635_0070320 Ga0495635_0070320_561_959 132
882 3300046663 Ga0495635_0402096 Ga0495635_0402096_152_550 132
883 3300046664 Ga0495659_0060867 Ga0495659_0060867_452_850 132
884 3300046665 Ga0495661_0085330 Ga0495661_0085330_917_1315 132
885 3300046665 Ga0495661_0326307 Ga0495661_0326307_353_751 132
886 3300046674 Ga0495588_0013756 Ga0495588_0013756_2280_2678 132
887 3300046675 Ga0495657_0827946 Ga0495657_0827946_31_429 132
888 3300046678 Ga0495599_0138845 Ga0495599_0138845_858_1256 132
889 3300046678 Ga0495599_0400473 Ga0495599_0400473_268_666 132
890 3300046678 Ga0495599_0891822 Ga0495599_0891822_26_490 132
891 3300046679 Ga0495623_0599247 Ga0495623_0599247_56_454 132
892 3300046680 Ga0495646_0078212 Ga0495646_0078212_1371_1769 132
893 3300046681 Ga0495647_0474697 Ga0495647_0474697_126_524 132
894 3300046683 Ga0495658_0375563 Ga0495658_0375563_161_559 132
895 3300046684 Ga0495669_0000650 Ga0495669_0000650_6022_6420 132
896 3300046684 Ga0495669_0125391 Ga0495669_0125391_334_732 132
897 3300046684 Ga0495669_0252889 Ga0495669_0252889_294_692 132
898 3300046684 Ga0495669_0608343 Ga0495669_0608343_25_423 132
899 3300046689 Ga0495613_0013842 Ga0495613_0013842_1501_1899 132
900 3300046690 Ga0495624_0023168 Ga0495624_0023168_3614_4012 132
901 3300046690 Ga0495624_0044261 Ga0495624_0044261_720_1118 132
902 3300046690 Ga0495624_0312140 Ga0495624_0312140_202_636 132
903 3300046691 Ga0495670_0044258 Ga0495670_0044258_1368_1766 132
904 3300046691 Ga0495670_0187388 Ga0495670_0187388_534_932 132
905 3300046691 Ga0495670_0245510 Ga0495670_0245510_367_765 132
906 3300046691 Ga0495670_0341585 Ga0495670_0341585_62_460 132
907 3300046694 Ga0495649_0070708 Ga0495649_0070708_799_1197 132
908 3300046694 Ga0495649_0220052 Ga0495649_0220052_207_605 132
909 3300046694 Ga0495649_0505208 Ga0495649_0505208_26_424 132
910 3300046694 Ga0495649_0565877 Ga0495649_0565877_117_515 132
911 3300046794 Ga0495589_0051689 Ga0495589_0051689_44_442 132
912 3300046794 Ga0495589_0116759 Ga0495589_0116759_335_733 132
913 3300046794 Ga0495589_0258396 Ga0495589_0258396_117_527 132
914 3300047315 Ga0495581_0282336 Ga0495581_0282336_85_483 132
915 3300047317 Ga0495604_0323740 Ga0495604_0323740_468_866 132
916 3300047318 Ga0495636_0041720 Ga0495636_0041720_118_516 132
917 3300047319 Ga0495674_0008459 Ga0495674_0008459_3644_4042 132
918 3300047319 Ga0495674_0213064 Ga0495674_0213064_104_502 132
919 3300047319 Ga0495674_1290039 Ga0495674_1290039_99_497 132
920 3300047320 Ga0495672_0043612 Ga0495672_0043612_981_1379 132
921 3300047320 Ga0495672_0079874 Ga0495672_0079874_974_1372 132
922 3300047320 Ga0495672_0516335 Ga0495672_0516335_29_427 132
923 3300047321 Ga0495676_0192322 Ga0495676_0192322_309_707 132
924 3300047321 Ga0495676_0210521 Ga0495676_0210521_251_685 132
925 3300047321 Ga0495676_0306496 Ga0495676_0306496_296_694 132
926 3300047323 Ga0495683_0402623 Ga0495683_0402623_70_480 132
927 3300047447 Ga0495685_145900 Ga0495685_145900_92_490 132
928 3300047447 Ga0495685_292251 Ga0495685_292251_21_419 132
929 3300047469 Ga0495673_0116317 Ga0495673_0116317_376_786 132
930 3300047470 Ga0495681_0098221 Ga0495681_0098221_252_650 132
931 3300047471 Ga0495684_0028441 Ga0495684_0028441_1638_2036 132
932 3300047472 Ga0495686_0026279 Ga0495686_0026279_2016_2414 132
933 3300047472 Ga0495686_0693037 Ga0495686_0693037_50_448 132
934 3300047673 Ga0495593_0021586 Ga0495593_0021586_437_835 132
935 3300047673 Ga0495593_0133176 Ga0495593_0133176_787_1185 132
936 3300047673 Ga0495593_0522266 Ga0495593_0522266_128_526 132
937 3300048089 Ga0495614_0032035 Ga0495614_0032035_1207_1605 132
938 3300048090 Ga0495615_0137137 Ga0495615_0137137_20_418 132
939 3300048903 Ga0496100_0131977 Ga0496100_0131977_338_736 132
940 3300048903 Ga0496100_0506484 Ga0496100_0506484_123_521 132
941 3300048903 Ga0496100_1029391 Ga0496100_1029391_142_540 132
942 3300048903 Ga0496100_1096012 Ga0496100_1096012_101_499 132
943 3300048904 Ga0496101_0002052 Ga0496101_0002052_990_1388 132
944 3300048904 Ga0496101_0177563 Ga0496101_0177563_636_1034 132
945 3300048904 Ga0496101_0590416 Ga0496101_0590416_15_413 132
946 3300048904 Ga0496101_0601141 Ga0496101_0601141_248_646 132
947 3300048905 Ga0496102_0001771 Ga0496102_0001771_10086_10484 132
948 3300048905 Ga0496102_0028325 Ga0496102_0028325_1562_1960 132
949 3300048905 Ga0496102_0228574 Ga0496102_0228574_262_660 132
950 3300048905 Ga0496102_0789710 Ga0496102_0789710_429_827 132
951 3300048905 Ga0496102_1180376 Ga0496102_1180376_83_481 132
952 3300048905 Ga0496102_1421870 Ga0496102_1421870_67_465 132
953 3300048906 Ga0496103_0005699 Ga0496103_0005699_1625_2023 132
954 3300048906 Ga0496103_0103765 Ga0496103_0103765_208_606 132
955 3300048906 Ga0496103_0345511 Ga0496103_0345511_157_555 132
956 3300048907 Ga0496104_0074499 Ga0496104_0074499_1138_1536 132
957 3300048908 Ga0496105_0042375 Ga0496105_0042375_774_1172 132
958 3300048908 Ga0496105_0085872 Ga0496105_0085872_565_963 132
959 3300048909 Ga0496106_0002858 Ga0496106_0002858_10904_11302 132
960 3300048909 Ga0496106_0009997 Ga0496106_0009997_5353_5751 132
961 3300048909 Ga0496106_0041953 Ga0496106_0041953_1182_1580 132
962 3300048910 Ga0496107_0002387 Ga0496107_0002387_10907_11305 132
963 3300048910 Ga0496107_0009519 Ga0496107_0009519_1588_1986 132
964 3300048910 Ga0496107_0051319 Ga0496107_0051319_2208_2606 132
965 3300048910 Ga0496107_0713590 Ga0496107_0713590_177_575 132
966 3300048911 Ga0496108_0016020 Ga0496108_0016020_990_1388 132
967 3300048911 Ga0496108_0524321 Ga0496108_0524321_385_783 132
968 3300048911 Ga0496108_0735223 Ga0496108_0735223_107_505 132
969 3300048911 Ga0496108_0781677 Ga0496108_0781677_235_633 132
970 3300048912 Ga0496109_0007060 Ga0496109_0007060_355_753 132
971 3300048912 Ga0496109_0197825 Ga0496109_0197825_564_962 132
972 3300048912 Ga0496109_0971871 Ga0496109_0971871_243_641 132
973 3300048913 Ga0496110_0004493 Ga0496110_0004493_6277_6675 132
974 3300048913 Ga0496110_0015025 Ga0496110_0015025_4560_4958 132
975 3300048913 Ga0496110_0119761 Ga0496110_0119761_1866_2264 132
976 3300048913 Ga0496110_0153298 Ga0496110_0153298_1214_1612 132
977 3300048913 Ga0496110_0188337 Ga0496110_0188337_47_445 132
978 3300048913 Ga0496110_0291341 Ga0496110_0291341_534_932 132
979 3300048913 Ga0496110_0608064 Ga0496110_0608064_188_586 132
980 3300048914 Ga0496111_0117480 Ga0496111_0117480_131_529 132
981 3300048914 Ga0496111_0459520 Ga0496111_0459520_468_866 132
982 3300048915 Ga0496112_0000017 Ga0496112_0000017_131980_132378 132
983 3300048915 Ga0496112_0013582 Ga0496112_0013582_2649_3047 132
984 3300048915 Ga0496112_0105142 Ga0496112_0105142_149_547 132
985 3300048915 Ga0496112_0157337 Ga0496112_0157337_1554_1952 132
986 3300048915 Ga0496112_0172126 Ga0496112_0172126_252_650 132
987 3300048915 Ga0496112_0423891 Ga0496112_0423891_408_806 132
988 3300048916 Ga0496113_0031143 Ga0496113_0031143_3074_3472 132
989 3300048916 Ga0496113_0048870 Ga0496113_0048870_1761_2159 132
990 3300048917 Ga0496114_0011547 Ga0496114_0011547_5683_6081 132
991 3300048917 Ga0496114_0062101 Ga0496114_0062101_191_589 132
992 3300048917 Ga0496114_0254127 Ga0496114_0254127_545_943 132
993 3300048918 Ga0496115_0000535 Ga0496115_0000535_24451_24849 132
994 3300048918 Ga0496115_0492551 Ga0496115_0492551_302_700 132
995 3300048918 Ga0496115_1352674 Ga0496115_1352674_109_507 132
996 3300048920 Ga0496117_0129636 Ga0496117_0129636_909_1307 132
997 3300048920 Ga0496117_0608009 Ga0496117_0608009_49_459 132
998 3300048921 Ga0496118_0003407 Ga0496118_0003407_10718_11116 132
999 3300048922 Ga0496119_0269894 Ga0496119_0269894_121_519 132
1000 3300048922 Ga0496119_0291385 Ga0496119_0291385_22_420 132
1001 3300048924 Ga0496121_0045020 Ga0496121_0045020_2587_2985 132
1002 3300048924 Ga0496121_0129108 Ga0496121_0129108_1376_1774 132
1003 3300048924 Ga0496121_0224635 Ga0496121_0224635_640_1038 132
1004 3300048924 Ga0496121_0291596 Ga0496121_0291596_118_516 132
1005 3300048924 Ga0496121_0322012 Ga0496121_0322012_564_962 132
1006 3300048924 Ga0496121_0327432 Ga0496121_0327432_387_797 132
1007 3300048924 Ga0496121_0578250 Ga0496121_0578250_22_420 132
1008 3300048927 Ga0496124_0026548 Ga0496124_0026548_4507_4905 132
1009 3300048927 Ga0496124_0178729 Ga0496124_0178729_183_581 132
1010 3300048927 Ga0496124_0273454 Ga0496124_0273454_665_1063 132
1011 3300048927 Ga0496124_0404719 Ga0496124_0404719_453_851 132
1012 3300048928 Ga0496125_0051831 Ga0496125_0051831_681_1079 132
1013 3300048928 Ga0496125_0265018 Ga0496125_0265018_248_646 132
1014 3300048928 Ga0496125_0303374 Ga0496125_0303374_399_797 132
1015 3300048929 Ga0496126_0002483 Ga0496126_0002483_6178_6576 132
1016 3300048929 Ga0496126_0092604 Ga0496126_0092604_1335_1745 132
1017 3300048929 Ga0496126_0149771 Ga0496126_0149771_1283_1681 132
1018 3300048929 Ga0496126_0176947 Ga0496126_0176947_1344_1742 132
1019 3300048929 Ga0496126_0212828 Ga0496126_0212828_937_1335 132
1020 3300048929 Ga0496126_0407184 Ga0496126_0407184_180_578 132
1021 3300048929 Ga0496126_0494497 Ga0496126_0494497_115_513 132
1022 3300048929 Ga0496126_0572690 Ga0496126_0572690_112_510 132
1023 3300048929 Ga0496126_0645808 Ga0496126_0645808_146_544 132
1024 3300048929 Ga0496126_0758943 Ga0496126_0758943_68_466 132
1025 3300049459 Ga0495678_115396 Ga0495678_115396_170_568 132
1026 3300049568 Ga0501031_0008184 Ga0501031_0008184_513_911 132
1027 3300049569 Ga0501032_0000704 Ga0501032_0000704_24737_25135 132
1028 3300049570 Ga0501033_0000311 Ga0501033_0000311_9525_9923 132
1029 3300049571 Ga0501034_0000039 Ga0501034_0000039_225732_226130 132
1030 3300049572 Ga0501036_0000127 Ga0501036_0000127_11359_11757 132
1031 3300049573 Ga0501037_0000025 Ga0501037_0000025_128301_128699 132
1032 3300049574 Ga0501038_0000342 Ga0501038_0000342_32461_32859 132
1033 3300049575 Ga0501039_0000840 Ga0501039_0000840_3482_3880 132
1034 3300049578 Ga0501042_0026448 Ga0501042_0026448_1057_1455 132
1035 3300049579 Ga0501043_0000120 Ga0501043_0000120_34104_34502 132
1036 3300049580 Ga0501046_0000359 Ga0501046_0000359_11378_11776 132
1037 3300049580 Ga0501046_0048465 Ga0501046_0048465_2297_2695 132
1038 3300049581 Ga0501047_0000379 Ga0501047_0000379_1314_1712 132
1039 3300049581 Ga0501047_0084770 Ga0501047_0084770_884_1282 132
1040 3300049581 Ga0501047_1343705 Ga0501047_1343705_42_440 132
1041 3300049582 Ga0501048_0000352 Ga0501048_0000352_24280_24678 132
1042 3300049583 Ga0501067_0000025 Ga0501067_0000025_9941_10339 132
1043 3300049584 Ga0501068_0001230 Ga0501068_0001230_8911_9309 132
1044 3300049585 Ga0501069_0007011 Ga0501069_0007011_74_472 132
1045 3300049585 Ga0501069_0175721 Ga0501069_0175721_683_1081 132
1046 3300049586 Ga0501070_0002185 Ga0501070_0002185_4154_4552 132
1047 3300049586 Ga0501070_0042781 Ga0501070_0042781_2285_2683 132
1048 3300049587 Ga0501071_0244492 Ga0501071_0244492_223_621 132
1049 3300049588 Ga0501072_0002767 Ga0501072_0002767_11170_11568 132
1050 3300049588 Ga0501072_0624932 Ga0501072_0624932_387_785 132
1051 3300049589 Ga0501073_0000091 Ga0501073_0000091_15479_15877 132
1052 3300049589 Ga0501073_0258618 Ga0501073_0258618_280_678 132
1053 3300049590 Ga0501074_0000489 Ga0501074_0000489_9644_10042 132
1054 3300049590 Ga0501074_0025368 Ga0501074_0025368_1508_1906 132
1055 3300049592 Ga0501076_0228198 Ga0501076_0228198_445_843 132
1056 3300049592 Ga0501076_0842771 Ga0501076_0842771_329_727 132
1057 3300049741 Ga0501079_0006818 Ga0501079_0006818_6148_6546 132
1058 3300049742 Ga0501080_0000321 Ga0501080_0000321_22517_22915 132
1059 3300049742 Ga0501080_0026275 Ga0501080_0026275_4163_4561 132
1060 3300049744 Ga0501083_0000284 Ga0501083_0000284_26698_27096 132
1061 3300049822 Ga0501035_0001251 Ga0501035_0001251_25908_26306 132
1062 3300049822 Ga0501035_0423288 Ga0501035_0423288_355_753 132
1063 3300049823 Ga0501044_0000274 Ga0501044_0000274_45899_46297 132
1064 3300049823 Ga0501044_0144750 Ga0501044_0144750_319_717 132
1065 3300049824 Ga0501045_0005330 Ga0501045_0005330_7004_7402 132
1066 3300050489 nmdc:mga03683_309151_c1 nmdc:mga03683_309151_c1_206_616 132
1067 3300050490 nmdc:mga03n38_341479_c1 nmdc:mga03n38_341479_c1_17_415 132
1068 3300050491 nmdc:mga00v17_465059_c1 nmdc:mga00v17_465059_c1_179_577 132
1069 3300050491 nmdc:mga00v17_888245_c1 nmdc:mga00v17_888245_c1_153_551 132
1070 3300050492 nmdc:mga0yw44_535895_c1 nmdc:mga0yw44_535895_c1_51_449 132
1071 3300050492 nmdc:mga0yw44_706686_c1 nmdc:mga0yw44_706686_c1_140_538 132
1072 3300050492 nmdc:mga0yw44_90407_c1 nmdc:mga0yw44_90407_c1_73_471 132
1073 3300050493 nmdc:mga0k408_240358_c1 nmdc:mga0k408_240358_c1_211_609 132
1074 3300050493 nmdc:mga0k408_97231_c1 nmdc:mga0k408_97231_c1_1146_1544 132
1075 3300050494 nmdc:mga06z11_103107_c1 nmdc:mga06z11_103107_c1_335_733 132
1076 3300050494 nmdc:mga06z11_207023_c1 nmdc:mga06z11_207023_c1_668_1066 132
1077 3300050509 nmdc:mga0qj67_501630_c1 nmdc:mga0qj67_501630_c1_302_700 132
1078 3300050511 nmdc:mga08y16_916868_c1 nmdc:mga08y16_916868_c1_388_786 132
1079 3300050512 nmdc:mga0n895_1812074_c1 nmdc:mga0n895_1812074_c1_46_444 132
1080 3300050512 nmdc:mga0n895_382114_c1 nmdc:mga0n895_382114_c1_588_986 132
1081 3300050513 nmdc:mga0rr50_866533_c1 nmdc:mga0rr50_866533_c1_292_690 132
1082 3300050515 nmdc:mga0a205_622660_c1 nmdc:mga0a205_622660_c1_219_617 132
1083 3300050516 nmdc:mga0sz30_308756_c1 nmdc:mga0sz30_308756_c1_27_425 132
1084 3300053077 Ga0495601_0078465 Ga0495601_0078465_173_571 132
1085 3300053077 Ga0495601_0146773 Ga0495601_0146773_499_897 132
1086 3300053077 Ga0495601_0252734 Ga0495601_0252734_738_1136 132
1087 3300053077 Ga0495601_0324068 Ga0495601_0324068_32_430 132
1088 3300053078 Ga0495612_0056240 Ga0495612_0056240_983_1381 132
1089 3300053078 Ga0495612_0175279 Ga0495612_0175279_98_496 132
1090 3300053078 Ga0495612_0240040 Ga0495612_0240040_89_487 132
1091 3300053083 Ga0495655_0068994 Ga0495655_0068994_428_826 132
1092 3300053083 Ga0495655_0092691 Ga0495655_0092691_116_514 132
1093 3300053084 Ga0495595_0026236 Ga0495595_0026236_2095_2493 132
1094 3300053085 Ga0495619_0209249 Ga0495619_0209249_459_857 132
1095 3300053085 Ga0495619_0246095 Ga0495619_0246095_357_755 132
1096 3300053087 Ga0500643_051619 Ga0500643_051619_166_576 132
1097 3300053090 Ga0500646_0022529 Ga0500646_0022529_1238_1636 132
1098 3300053090 Ga0500646_0071361 Ga0500646_0071361_290_700 132
1099 3300053092 Ga0500583_0072009 Ga0500583_0072009_902_1312 132
1100 3300053092 Ga0500583_0333398 Ga0500583_0333398_105_515 132
1101 3300053093 Ga0500651_0670507 Ga0500651_0670507_62_472 132
1102 3300053094 Ga0500566_0000158 Ga0500566_0000158_2089_2487 132
1103 3300053094 Ga0500566_0078847 Ga0500566_0078847_670_1068 132
1104 3300053094 Ga0500566_0201394 Ga0500566_0201394_392_802 132
1105 3300053095 Ga0500640_000568 Ga0500640_000568_8888_9286 132
1106 3300053096 Ga0500641_0008502 Ga0500641_0008502_2121_2519 132
1107 3300053097 Ga0500648_057745 Ga0500648_057745_62_460 132
1108 3300053098 Ga0500650_0224827 Ga0500650_0224827_223_633 132
1109 3300053102 Ga0500554_007059 Ga0500554_007059_1697_2095 132
1110 3300053108 Ga0500562_063291 Ga0500562_063291_70_468 132
1111 3300053109 Ga0500569_215176 Ga0500569_215176_123_521 132
1112 3300053109 Ga0500569_306904 Ga0500569_306904_21_431 132
1113 3300053111 Ga0500572_000024 Ga0500572_000024_4936_5334 132
1114 3300053115 Ga0500591_078328 Ga0500591_078328_643_1041 132
1115 3300053118 Ga0500594_0098002 Ga0500594_0098002_72_470 132
1116 3300053119 Ga0500595_001188 Ga0500595_001188_793_1203 132
1117 3300053122 Ga0500608_001300 Ga0500608_001300_2295_2693 132
1118 3300053123 Ga0500614_001812 Ga0500614_001812_2342_2740 132
1119 3300053130 Ga0500642_0270682 Ga0500642_0270682_360_758 132
1120 3300053134 Ga0500658_0175660 Ga0500658_0175660_96_506 132
1121 3300053134 Ga0500658_0382952 Ga0500658_0382952_171_569 132
1122 3300053136 Ga0500559_0003877 Ga0500559_0003877_3343_3741 132
1123 3300053136 Ga0500559_0178998 Ga0500559_0178998_281_679 132
1124 3300053137 Ga0500561_0145643 Ga0500561_0145643_300_698 132
1125 3300053139 Ga0500568_0060565 Ga0500568_0060565_987_1385 132
1126 3300053140 Ga0500573_0032643 Ga0500573_0032643_2294_2692 132
1127 3300053142 Ga0500577_0139481 Ga0500577_0139481_106_516 132
1128 3300053143 Ga0500579_188848 Ga0500579_188848_200_598 132
1129 3300053146 Ga0500588_0401468 Ga0500588_0401468_92_490 132
1130 3300053147 Ga0500589_025035 Ga0500589_025035_18_416 132
1131 3300053147 Ga0500589_313473 Ga0500589_313473_83_481 132
1132 3300053148 Ga0500590_122838 Ga0500590_122838_255_653 132
1133 3300053148 Ga0500590_146250 Ga0500590_146250_392_790 132
1134 3300053150 Ga0500603_000465 Ga0500603_000465_1730_2188 132
1135 3300053150 Ga0500603_000801 Ga0500603_000801_6042_6440 132
1136 3300053150 Ga0500603_048017 Ga0500603_048017_365_763 132
1137 3300053150 Ga0500603_242973 Ga0500603_242973_31_429 132
1138 3300053156 Ga0500622_0382782 Ga0500622_0382782_28_426 132
1139 3300053158 Ga0500627_0357681 Ga0500627_0357681_161_559 132
1140 3300053159 Ga0500630_000112 Ga0500630_000112_17992_18390 132
1141 3300053161 Ga0500634_0081721 Ga0500634_0081721_607_1017 132
1142 3300053162 Ga0500638_012135 Ga0500638_012135_1848_2246 132
1143 3300053162 Ga0500638_197823 Ga0500638_197823_23_421 132
1144 3300053163 Ga0500639_000040 Ga0500639_000040_28101_28499 132
1145 3300053177 Ga0500636_0086872 Ga0500636_0086872_281_679 132
1146 3300053177 Ga0500636_0184124 Ga0500636_0184124_643_1041 132
1147 3300053178 Ga0500637_0039960 Ga0500637_0039960_1754_2212 132
1148 3300053178 Ga0500637_0108912 Ga0500637_0108912_995_1393 132
1149 3300053731 Ga0500609_015774 Ga0500609_015774_440_838 132
1150 3300053735 Ga0500596_000794 Ga0500596_000794_5598_5996 132
1151 3300053735 Ga0500596_005461 Ga0500596_005461_1606_2004 132
1152 3300054114 Ga0501084_0007045 Ga0501084_0007045_7009_7407 132
1153 3300059645 Ga0587076_056219 Ga0587076_056219_38_436 132
1154 3300060353 Ga0501082_0026885 Ga0501082_0026885_2021_2419 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02962

CHMI

5-carboxymethyl-2-hydroxymuconate isomerase

26

149

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1otg-assembly1.cif.gz_C 5-carboxymethyl-2-hydroxymuconate isomerase 0.8107 3 125
4jj9-assembly1.cif.gz_B crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase 0.806 1 125
1otg-assembly1.cif.gz_C 5-carboxymethyl-2-hydroxymuconate isomerase 0.7933 3 125
4jcu-assembly1.cif.gz_A crystal structure of a 5-carboxymethyl-2-hydroxymuconate isomerase from deinococcus radiodurans r1 0.7876 2 125
4jj9-assembly1.cif.gz_B crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase 0.7616 1 125
ID Description Score Start End Superfamily
1otgC00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.8107 3 125 3.30.429.10
1otgC00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.7933 3 125 3.30.429.10
4jcuB00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.7918 2 123 3.30.429.10
4jj9C00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.7803 2 125 3.30.429.10
4jcuB00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.7535 2 123 3.30.429.10
ID Description Score Start End GO Terms
AF-A0A3S1ELA3-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.915 1 64 GO:0008704
GO:0009056
AF-A0A3D0KT17-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.9115 1 64 GO:0008704
GO:0009056
AF-A0A529P083-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.8975 1 108 GO:0008704
GO:0009056
AF-A0A529P563-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.8901 1 72 GO:0008704
GO:0009056
AF-A0A3D1DZK3-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.8858 1 108 GO:0008704
GO:0009056

Feature Viewer

pLDDT pTM Quality
89.91 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map