F490899
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1154 | 494 | 1121 | 132 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_10028779|Ga0105241_100287794 |
| Length | 156 |
| Sequence | MMAPTFGRLPFRLTPRTAIGSETAMPHFTIEYSANMDKRVDMAKVVDVVRKAAVETGIFPLGGIRVRAIKCEHYAIADGNPDLGFLSMVLRLGEGRDLAARKKAGEHIFKALSSHLDPVFAQSKFALSFDMQINDKETSWKRNNIHEALKAEAAHG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 3 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 4 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 5 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 6 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 7 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 8 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 9 | 2791355199 | |||
| 10 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 11 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 12 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 13 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 14 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 15 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 16 | 2904699407 | |||
| 17 | 2906610324 | |||
| 18 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 19 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 20 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 21 | 2922425934 | |||
| 22 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 23 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 24 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 25 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 26 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 27 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 28 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 29 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 30 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 95 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 98 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 101 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 104 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 105 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 106 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 113 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 116 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 117 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 118 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 119 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 120 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 138 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 155 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 156 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 220 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 221 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 222 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 229 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 230 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 232 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 233 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 235 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 236 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 237 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 239 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 240 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 242 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 243 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 244 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 246 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 247 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 248 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 249 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 250 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 251 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 252 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 253 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 254 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 255 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 256 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 257 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 258 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 260 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 263 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 265 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 266 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 267 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 268 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 269 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 272 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 273 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 274 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 275 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 276 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 277 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 279 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 281 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 282 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 283 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 284 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 285 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 286 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 287 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 289 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 290 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 291 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 292 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 293 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 294 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 295 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 296 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 297 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 298 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 299 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 379 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 380 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 381 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 382 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 383 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 384 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 387 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 388 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 389 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 390 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 391 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 392 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 393 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 394 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 395 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 396 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 397 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 398 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 399 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 429 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 430 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 431 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 432 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 433 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 434 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 440 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 446 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 447 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 448 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 449 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 450 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 451 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 452 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 453 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 454 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 455 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 456 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 457 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 458 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 459 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 460 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 461 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 462 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 463 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 464 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 465 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 466 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 467 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 468 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 469 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 470 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 471 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 472 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 473 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 474 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 475 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 476 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 477 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 478 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 479 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 480 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 481 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 482 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 483 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 484 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 485 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 488 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 489 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 490 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 491 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 492 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 493 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 494 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.04 |
| Metatranscriptomes | 0.43 |
| Isolates | 2.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.23 |
| Nodule | 2.51 |
| Rhizoplane | 5.2 |
| Rhizosphere | 77.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10009343 | 3300003203 | Bacteria | 4392 |
| 2 | JGI25165J46597_1011939 | 3300003214 | Bacteria | 1227 |
| 3 | JGI25153J46596_10051467 | 3300003215 | Bacteria | 1179 |
| 4 | JGI25404J52841_10003019 | 3300003659 | Bacteria | 3277 |
| 5 | JGI25404J52841_10010753 | 3300003659 | Bacteria | 1969 |
| 6 | JGI25404J52841_10016744 | 3300003659 | Bacteria | 1590 |
| 7 | JGI25404J52841_10041444 | 3300003659 | Bacteria | 974 |
| 8 | Ga0070658_10150878 | 3300005327 | Bacteria | 1946 |
| 9 | Ga0070658_10362781 | 3300005327 | Bacteria | 1241 |
| 10 | Ga0070676_10668089 | 3300005328 | Bacteria | 756 |
| 11 | Ga0070683_100095571 | 3300005329 | Bacteria | 2794 |
| 12 | Ga0070683_100306288 | 3300005329 | Bacteria | 1511 |
| 13 | Ga0070683_101207674 | 3300005329 | Bacteria | 727 |
| 14 | Ga0070683_101249715 | 3300005329 | Bacteria | 714 |
| 15 | Ga0068869_100283829 | 3300005334 | Bacteria | 1332 |
| 16 | Ga0068869_100411856 | 3300005334 | Bacteria | 1114 |
| 17 | Ga0068869_101378147 | 3300005334 | Bacteria | 624 |
| 18 | Ga0070680_100052018 | 3300005336 | Bacteria | 3343 |
| 19 | Ga0070680_100194884 | 3300005336 | Bacteria | 1708 |
| 20 | Ga0070680_100676728 | 3300005336 | Bacteria | 887 |
| 21 | Ga0070682_100039753 | 3300005337 | Bacteria | 2891 |
| 22 | Ga0070682_100175885 | 3300005337 | Bacteria | 1491 |
| 23 | Ga0070682_100246809 | 3300005337 | Bacteria | 1285 |
| 24 | Ga0070682_100503776 | 3300005337 | Bacteria | 939 |
| 25 | Ga0068868_100034182 | 3300005338 | Bacteria | 3924 |
| 26 | Ga0068868_100389483 | 3300005338 | Bacteria | 1200 |
| 27 | Ga0068868_100548398 | 3300005338 | Bacteria | 1019 |
| 28 | Ga0068868_100560813 | 3300005338 | Bacteria | 1008 |
| 29 | Ga0070660_100051646 | 3300005339 | Bacteria | 3167 |
| 30 | Ga0070687_100299556 | 3300005343 | Bacteria | 1020 |
| 31 | Ga0070661_100328466 | 3300005344 | Bacteria | 1196 |
| 32 | Ga0070661_100395995 | 3300005344 | Bacteria | 1091 |
| 33 | Ga0070661_100556992 | 3300005344 | Bacteria | 923 |
| 34 | Ga0070692_10391666 | 3300005345 | Bacteria | 875 |
| 35 | Ga0070668_100044248 | 3300005347 | Bacteria | 3415 |
| 36 | Ga0070668_100074675 | 3300005347 | Bacteria | 2645 |
| 37 | Ga0070668_100207755 | 3300005347 | Bacteria | 1609 |
| 38 | Ga0070668_100301249 | 3300005347 | Bacteria | 1344 |
| 39 | Ga0070668_100481665 | 3300005347 | Bacteria | 1071 |
| 40 | Ga0070668_100724073 | 3300005347 | Bacteria | 879 |
| 41 | Ga0070669_100068986 | 3300005353 | Bacteria | 2611 |
| 42 | Ga0070671_100342350 | 3300005355 | Bacteria | 1276 |
| 43 | Ga0070671_100383792 | 3300005355 | Bacteria | 1201 |
| 44 | Ga0070671_100708452 | 3300005355 | Bacteria | 873 |
| 45 | Ga0070674_100034692 | 3300005356 | Bacteria | 3372 |
| 46 | Ga0070688_100855168 | 3300005365 | Bacteria | 715 |
| 47 | Ga0070659_100053918 | 3300005366 | Bacteria | 3166 |
| 48 | Ga0070667_100236881 | 3300005367 | Bacteria | 1629 |
| 49 | Ga0070667_100569881 | 3300005367 | Bacteria | 1042 |
| 50 | Ga0070667_100623283 | 3300005367 | Bacteria | 995 |
| 51 | Ga0070667_100797903 | 3300005367 | Bacteria | 876 |
| 52 | Ga0070709_10004227 | 3300005434 | Bacteria | 7743 |
| 53 | Ga0070709_10048345 | 3300005434 | Bacteria | 2654 |
| 54 | Ga0070709_10311929 | 3300005434 | Bacteria | 1152 |
| 55 | Ga0070714_100082971 | 3300005435 | Bacteria | 2793 |
| 56 | Ga0070714_100280905 | 3300005435 | Bacteria | 1547 |
| 57 | Ga0070714_100541466 | 3300005435 | Bacteria | 1114 |
| 58 | Ga0070714_100551108 | 3300005435 | Bacteria | 1104 |
| 59 | Ga0070713_100042275 | 3300005436 | Bacteria | 3719 |
| 60 | Ga0070713_100088760 | 3300005436 | Bacteria | 2654 |
| 61 | Ga0070713_100353933 | 3300005436 | Bacteria | 1363 |
| 62 | Ga0070713_100363813 | 3300005436 | Bacteria | 1344 |
| 63 | Ga0070710_10042080 | 3300005437 | Bacteria | 2524 |
| 64 | Ga0070710_10179435 | 3300005437 | Bacteria | 1325 |
| 65 | Ga0070711_100001730 | 3300005439 | Bacteria | 12117 |
| 66 | Ga0070711_100011938 | 3300005439 | Bacteria | 5407 |
| 67 | Ga0070711_100061879 | 3300005439 | Bacteria | 2607 |
| 68 | Ga0070711_100131145 | 3300005439 | Bacteria | 1867 |
| 69 | Ga0070711_100692074 | 3300005439 | Bacteria | 858 |
| 70 | Ga0070705_100619464 | 3300005440 | Bacteria | 840 |
| 71 | Ga0070700_100046080 | 3300005441 | Bacteria | 2692 |
| 72 | Ga0070700_100755597 | 3300005441 | Bacteria | 778 |
| 73 | Ga0070694_100787580 | 3300005444 | Bacteria | 779 |
| 74 | Ga0070663_100010941 | 3300005455 | Bacteria | 5672 |
| 75 | Ga0070663_100050917 | 3300005455 | Bacteria | 2947 |
| 76 | Ga0070663_100068772 | 3300005455 | Bacteria | 2571 |
| 77 | Ga0070663_100185086 | 3300005455 | Bacteria | 1618 |
| 78 | Ga0070663_100891518 | 3300005455 | Bacteria | 768 |
| 79 | Ga0070678_100010095 | 3300005456 | Bacteria | 5749 |
| 80 | Ga0070678_100529455 | 3300005456 | Bacteria | 1044 |
| 81 | Ga0070678_100647096 | 3300005456 | Bacteria | 948 |
| 82 | Ga0070678_100700015 | 3300005456 | Bacteria | 913 |
| 83 | Ga0070662_100031971 | 3300005457 | Bacteria | 3697 |
| 84 | Ga0070662_100088266 | 3300005457 | Bacteria | 2324 |
| 85 | Ga0070662_100457978 | 3300005457 | Bacteria | 1060 |
| 86 | Ga0070662_100709265 | 3300005457 | Bacteria | 851 |
| 87 | Ga0070681_10003273 | 3300005458 | Bacteria | 15113 |
| 88 | Ga0070681_10025087 | 3300005458 | Bacteria | 6000 |
| 89 | Ga0070681_10056849 | 3300005458 | Bacteria | 3893 |
| 90 | Ga0070681_10065024 | 3300005458 | Bacteria | 3617 |
| 91 | Ga0070681_10341341 | 3300005458 | Bacteria | 1408 |
| 92 | Ga0068867_100250304 | 3300005459 | Bacteria | 1441 |
| 93 | Ga0068867_100424557 | 3300005459 | Bacteria | 1127 |
| 94 | Ga0070685_10729585 | 3300005466 | Bacteria | 725 |
| 95 | Ga0070685_10756908 | 3300005466 | Bacteria | 713 |
| 96 | Ga0070685_10911377 | 3300005466 | Bacteria | 655 |
| 97 | Ga0070698_100536537 | 3300005471 | Bacteria | 1109 |
| 98 | Ga0070698_101485996 | 3300005471 | Bacteria | 629 |
| 99 | Ga0070699_101178226 | 3300005518 | Bacteria | 703 |
| 100 | Ga0070679_100009864 | 3300005530 | Bacteria | 9035 |
| 101 | Ga0070679_100017482 | 3300005530 | Bacteria | 6941 |
| 102 | Ga0070679_100017715 | 3300005530 | Bacteria | 6896 |
| 103 | Ga0070679_100036722 | 3300005530 | Bacteria | 4863 |
| 104 | Ga0070679_100303056 | 3300005530 | Bacteria | 1548 |
| 105 | Ga0070679_100865639 | 3300005530 | Bacteria | 847 |
| 106 | Ga0070684_100013567 | 3300005535 | Bacteria | 6575 |
| 107 | Ga0070684_100231212 | 3300005535 | Bacteria | 1688 |
| 108 | Ga0070684_100338695 | 3300005535 | Bacteria | 1383 |
| 109 | Ga0070684_100481400 | 3300005535 | Bacteria | 1149 |
| 110 | Ga0070697_100328239 | 3300005536 | Bacteria | 1319 |
| 111 | Ga0070697_100350906 | 3300005536 | Bacteria | 1274 |
| 112 | Ga0068853_100040363 | 3300005539 | Bacteria | 3982 |
| 113 | Ga0068853_100130357 | 3300005539 | Bacteria | 2250 |
| 114 | Ga0068853_100286863 | 3300005539 | Bacteria | 1519 |
| 115 | Ga0068853_100372296 | 3300005539 | Bacteria | 1333 |
| 116 | Ga0068853_100411221 | 3300005539 | Bacteria | 1267 |
| 117 | Ga0070672_100191116 | 3300005543 | Bacteria | 1709 |
| 118 | Ga0070672_100191311 | 3300005543 | Bacteria | 1709 |
| 119 | Ga0070672_100431858 | 3300005543 | Bacteria | 1132 |
| 120 | Ga0070672_100895577 | 3300005543 | Bacteria | 784 |
| 121 | Ga0070686_100740264 | 3300005544 | Bacteria | 788 |
| 122 | Ga0070695_100764136 | 3300005545 | Bacteria | 772 |
| 123 | Ga0070696_100760250 | 3300005546 | Bacteria | 795 |
| 124 | Ga0070693_101383201 | 3300005547 | Bacteria | 547 |
| 125 | Ga0070665_100189047 | 3300005548 | Bacteria | 2060 |
| 126 | Ga0070665_100336297 | 3300005548 | Bacteria | 1514 |
| 127 | Ga0070665_100357790 | 3300005548 | Bacteria | 1466 |
| 128 | Ga0070665_101089130 | 3300005548 | Bacteria | 810 |
| 129 | Ga0070665_101216753 | 3300005548 | Bacteria | 764 |
| 130 | Ga0070665_101665143 | 3300005548 | Bacteria | 645 |
| 131 | Ga0070704_100517830 | 3300005549 | Bacteria | 1038 |
| 132 | Ga0068855_100010865 | 3300005563 | Bacteria | 10993 |
| 133 | Ga0068855_100067952 | 3300005563 | Bacteria | 4150 |
| 134 | Ga0068855_100116881 | 3300005563 | Bacteria | 3056 |
| 135 | Ga0068855_100142865 | 3300005563 | Bacteria | 2727 |
| 136 | Ga0070664_100089985 | 3300005564 | Bacteria | 2656 |
| 137 | Ga0070664_100363338 | 3300005564 | Bacteria | 1319 |
| 138 | Ga0068857_100016047 | 3300005577 | Bacteria | 6562 |
| 139 | Ga0068857_100106311 | 3300005577 | Bacteria | 2520 |
| 140 | Ga0068857_101483817 | 3300005577 | Bacteria | 660 |
| 141 | Ga0068857_101752540 | 3300005577 | Bacteria | 607 |
| 142 | Ga0068857_101803285 | 3300005577 | Bacteria | 599 |
| 143 | Ga0068854_100316488 | 3300005578 | Bacteria | 1267 |
| 144 | Ga0068854_100587678 | 3300005578 | Bacteria | 949 |
| 145 | Ga0068856_100731211 | 3300005614 | Bacteria | 1010 |
| 146 | Ga0070702_100130267 | 3300005615 | Bacteria | 1588 |
| 147 | Ga0068852_100036815 | 3300005616 | Bacteria | 4099 |
| 148 | Ga0068852_100249880 | 3300005616 | Bacteria | 1699 |
| 149 | Ga0068852_100254398 | 3300005616 | Bacteria | 1684 |
| 150 | Ga0068852_100477308 | 3300005616 | Bacteria | 1239 |
| 151 | Ga0068852_101247821 | 3300005616 | Bacteria | 765 |
| 152 | Ga0068852_101867233 | 3300005616 | Bacteria | 623 |
| 153 | Ga0068859_100463120 | 3300005617 | Bacteria | 1363 |
| 154 | Ga0068864_100494527 | 3300005618 | Bacteria | 1176 |
| 155 | Ga0068866_10021865 | 3300005718 | Bacteria | 2952 |
| 156 | Ga0068866_10509547 | 3300005718 | Bacteria | 798 |
| 157 | Ga0068861_100410264 | 3300005719 | Bacteria | 1204 |
| 158 | Ga0068861_100816180 | 3300005719 | Bacteria | 877 |
| 159 | Ga0068861_101639683 | 3300005719 | Bacteria | 635 |
| 160 | Ga0068851_10004825 | 3300005834 | Bacteria | 6103 |
| 161 | Ga0068870_10078252 | 3300005840 | Bacteria | 1821 |
| 162 | Ga0068863_100655952 | 3300005841 | Bacteria | 1041 |
| 163 | Ga0068863_100744625 | 3300005841 | Bacteria | 976 |
| 164 | Ga0068863_100911131 | 3300005841 | Bacteria | 880 |
| 165 | Ga0068863_101044798 | 3300005841 | Bacteria | 820 |
| 166 | Ga0068863_101352280 | 3300005841 | Bacteria | 720 |
| 167 | Ga0068858_100046102 | 3300005842 | Bacteria | 4041 |
| 168 | Ga0068858_100074580 | 3300005842 | Bacteria | 3150 |
| 169 | Ga0068858_100917487 | 3300005842 | Bacteria | 857 |
| 170 | Ga0068860_100331144 | 3300005843 | Bacteria | 1496 |
| 171 | Ga0068860_100352450 | 3300005843 | Bacteria | 1449 |
| 172 | Ga0068860_100462292 | 3300005843 | Bacteria | 1263 |
| 173 | Ga0068860_100483318 | 3300005843 | Bacteria | 1235 |
| 174 | Ga0068860_100499225 | 3300005843 | Bacteria | 1215 |
| 175 | Ga0068862_100129799 | 3300005844 | Bacteria | 2228 |
| 176 | Ga0068862_100302221 | 3300005844 | Bacteria | 1472 |
| 177 | Ga0068862_100414040 | 3300005844 | Bacteria | 1263 |
| 178 | Ga0068862_100515000 | 3300005844 | Bacteria | 1137 |
| 179 | Ga0068862_100669787 | 3300005844 | Bacteria | 1002 |
| 180 | Ga0068862_101682387 | 3300005844 | Bacteria | 643 |
| 181 | Ga0081455_10009971 | 3300005937 | Bacteria | 9713 |
| 182 | Ga0081455_10037550 | 3300005937 | Bacteria | 4300 |
| 183 | Ga0081455_10087531 | 3300005937 | Bacteria | 2534 |
| 184 | Ga0081455_10127583 | 3300005937 | Bacteria | 1994 |
| 185 | Ga0081455_10150862 | 3300005937 | Bacteria | 1792 |
| 186 | Ga0081540_1006422 | 3300005983 | Bacteria | 8558 |
| 187 | Ga0081540_1009663 | 3300005983 | Bacteria | 6629 |
| 188 | Ga0081540_1011844 | 3300005983 | Bacteria | 5796 |
| 189 | Ga0081540_1012349 | 3300005983 | Bacteria | 5635 |
| 190 | Ga0081540_1013491 | 3300005983 | Bacteria | 5308 |
| 191 | Ga0081540_1014382 | 3300005983 | Bacteria | 5071 |
| 192 | Ga0081540_1018818 | 3300005983 | Bacteria | 4222 |
| 193 | Ga0081539_10000768 | 3300005985 | Bacteria | 63055 |
| 194 | Ga0081539_10001470 | 3300005985 | Bacteria | 39952 |
| 195 | Ga0081539_10004445 | 3300005985 | Bacteria | 15477 |
| 196 | Ga0081539_10058092 | 3300005985 | Bacteria | 2137 |
| 197 | Ga0070717_10001267 | 3300006028 | Bacteria | 17258 |
| 198 | Ga0070717_10017332 | 3300006028 | Bacteria | 5603 |
| 199 | Ga0070717_10416085 | 3300006028 | Bacteria | 1209 |
| 200 | Ga0070717_10501552 | 3300006028 | Bacteria | 1097 |
| 201 | Ga0075365_10083284 | 3300006038 | Bacteria | 2169 |
| 202 | Ga0075365_10101356 | 3300006038 | Bacteria | 1971 |
| 203 | Ga0075365_10541421 | 3300006038 | Bacteria | 823 |
| 204 | Ga0075365_10770016 | 3300006038 | Bacteria | 679 |
| 205 | Ga0075363_100113059 | 3300006048 | Bacteria | 1510 |
| 206 | Ga0075363_100352030 | 3300006048 | Bacteria | 860 |
| 207 | Ga0075363_100407285 | 3300006048 | Bacteria | 800 |
| 208 | Ga0075364_10088472 | 3300006051 | Bacteria | 2053 |
| 209 | Ga0075432_10149429 | 3300006058 | Bacteria | 897 |
| 210 | Ga0070716_100107458 | 3300006173 | Bacteria | 1723 |
| 211 | Ga0070716_100189057 | 3300006173 | Bacteria | 1359 |
| 212 | Ga0070716_100666400 | 3300006173 | Bacteria | 791 |
| 213 | Ga0070716_101690869 | 3300006173 | Bacteria | 522 |
| 214 | Ga0070712_100111079 | 3300006175 | Bacteria | 2046 |
| 215 | Ga0070712_100118582 | 3300006175 | Bacteria | 1988 |
| 216 | Ga0070712_100905172 | 3300006175 | Bacteria | 761 |
| 217 | Ga0075362_10396330 | 3300006177 | Bacteria | 696 |
| 218 | Ga0075367_10142444 | 3300006178 | Bacteria | 1485 |
| 219 | Ga0075369_10127055 | 3300006186 | Bacteria | 1157 |
| 220 | Ga0075369_10247272 | 3300006186 | Bacteria | 828 |
| 221 | Ga0075369_10336005 | 3300006186 | Bacteria | 708 |
| 222 | Ga0075366_10239677 | 3300006195 | Bacteria | 1106 |
| 223 | Ga0075366_10593436 | 3300006195 | Bacteria | 686 |
| 224 | Ga0075366_10603489 | 3300006195 | Bacteria | 680 |
| 225 | Ga0075366_10853991 | 3300006195 | Bacteria | 567 |
| 226 | Ga0097621_100209156 | 3300006237 | Bacteria | 1697 |
| 227 | Ga0097621_101107206 | 3300006237 | Bacteria | 744 |
| 228 | Ga0097621_101274183 | 3300006237 | Bacteria | 694 |
| 229 | Ga0097621_101490690 | 3300006237 | Bacteria | 642 |
| 230 | Ga0075370_10219152 | 3300006353 | Bacteria | 1124 |
| 231 | Ga0075370_10380400 | 3300006353 | Bacteria | 846 |
| 232 | Ga0068871_100254458 | 3300006358 | Bacteria | 1531 |
| 233 | Ga0068871_100483860 | 3300006358 | Bacteria | 1114 |
| 234 | Ga0068871_100802604 | 3300006358 | Bacteria | 868 |
| 235 | Ga0068871_101385620 | 3300006358 | Bacteria | 663 |
| 236 | Ga0075428_100700818 | 3300006844 | Bacteria | 1079 |
| 237 | Ga0075433_10677350 | 3300006852 | Bacteria | 904 |
| 238 | Ga0075429_100967043 | 3300006880 | Bacteria | 745 |
| 239 | Ga0068865_100444871 | 3300006881 | Bacteria | 1070 |
| 240 | Ga0068865_100647710 | 3300006881 | Bacteria | 898 |
| 241 | Ga0068865_100847786 | 3300006881 | Bacteria | 791 |
| 242 | Ga0068865_101028166 | 3300006881 | Bacteria | 723 |
| 243 | Ga0097620_100463136 | 3300006931 | Bacteria | 1363 |
| 244 | Ga0099825_1034140 | 3300006941 | Bacteria | 1916 |
| 245 | Ga0099824_1007408 | 3300006942 | Bacteria | 14551 |
| 246 | Ga0099822_1006547 | 3300006943 | Bacteria | 15161 |
| 247 | Ga0099794_10013294 | 3300007265 | Bacteria | 3579 |
| 248 | Ga0099794_10298454 | 3300007265 | Bacteria | 834 |
| 249 | Ga0099794_10419992 | 3300007265 | Bacteria | 700 |
| 250 | Ga0099795_10003875 | 3300007788 | Bacteria | 3771 |
| 251 | Ga0099795_10184751 | 3300007788 | Bacteria | 872 |
| 252 | Ga0105251_10576561 | 3300009011 | Bacteria | 532 |
| 253 | Ga0105250_10539583 | 3300009092 | Bacteria | 534 |
| 254 | Ga0105240_10034221 | 3300009093 | Bacteria | 6557 |
| 255 | Ga0105240_10058690 | 3300009093 | Bacteria | 4804 |
| 256 | Ga0105240_10105395 | 3300009093 | Bacteria | 3423 |
| 257 | Ga0105240_10108708 | 3300009093 | Bacteria | 3359 |
| 258 | Ga0105240_10522672 | 3300009093 | Bacteria | 1317 |
| 259 | Ga0105240_11095681 | 3300009093 | Bacteria | 848 |
| 260 | Ga0105240_11604799 | 3300009093 | Bacteria | 680 |
| 261 | Ga0105240_12534470 | 3300009093 | Bacteria | 530 |
| 262 | Ga0111539_10144248 | 3300009094 | Bacteria | 2787 |
| 263 | Ga0111539_11656237 | 3300009094 | Bacteria | 742 |
| 264 | Ga0105245_10105057 | 3300009098 | Bacteria | 2619 |
| 265 | Ga0105245_10289341 | 3300009098 | Bacteria | 1604 |
| 266 | Ga0105245_10829319 | 3300009098 | Bacteria | 964 |
| 267 | Ga0105245_11842058 | 3300009098 | Bacteria | 658 |
| 268 | Ga0105247_10110567 | 3300009101 | Bacteria | 1768 |
| 269 | Ga0105247_10136367 | 3300009101 | Bacteria | 1604 |
| 270 | Ga0105247_10155708 | 3300009101 | Bacteria | 1509 |
| 271 | Ga0105247_10400587 | 3300009101 | Bacteria | 978 |
| 272 | Ga0114129_10191104 | 3300009147 | Bacteria | 2780 |
| 273 | Ga0105243_10078753 | 3300009148 | Bacteria | 2684 |
| 274 | Ga0105243_10929161 | 3300009148 | Bacteria | 867 |
| 275 | Ga0105243_11232577 | 3300009148 | Bacteria | 763 |
| 276 | Ga0105243_12506854 | 3300009148 | Bacteria | 555 |
| 277 | Ga0105241_10028779 | 3300009174 | Bacteria | 4140 |
| 278 | Ga0105242_10115715 | 3300009176 | Bacteria | 2293 |
| 279 | Ga0105242_10131362 | 3300009176 | Bacteria | 2162 |
| 280 | Ga0105242_11576074 | 3300009176 | Bacteria | 690 |
| 281 | Ga0105242_11936273 | 3300009176 | Bacteria | 630 |
| 282 | Ga0105248_10139917 | 3300009177 | Bacteria | 2730 |
| 283 | Ga0105248_10204152 | 3300009177 | Bacteria | 2227 |
| 284 | Ga0105248_10336933 | 3300009177 | Bacteria | 1698 |
| 285 | Ga0105248_10881040 | 3300009177 | Bacteria | 1011 |
| 286 | Ga0105237_10087664 | 3300009545 | Bacteria | 3102 |
| 287 | Ga0105237_10508977 | 3300009545 | Bacteria | 1211 |
| 288 | Ga0105237_10562761 | 3300009545 | Bacteria | 1147 |
| 289 | Ga0105237_10641091 | 3300009545 | Bacteria | 1069 |
| 290 | Ga0105237_10726224 | 3300009545 | Bacteria | 1000 |
| 291 | Ga0105237_10766119 | 3300009545 | Bacteria | 972 |
| 292 | Ga0105237_11358764 | 3300009545 | Bacteria | 717 |
| 293 | Ga0105237_11568743 | 3300009545 | Bacteria | 665 |
| 294 | Ga0105238_10017402 | 3300009551 | Bacteria | 7303 |
| 295 | Ga0105238_10140974 | 3300009551 | Bacteria | 2387 |
| 296 | Ga0105238_10358018 | 3300009551 | Bacteria | 1448 |
| 297 | Ga0105238_10360284 | 3300009551 | Bacteria | 1444 |
| 298 | Ga0105238_10598531 | 3300009551 | Bacteria | 1110 |
| 299 | Ga0105238_11028171 | 3300009551 | Bacteria | 845 |
| 300 | Ga0105249_10080447 | 3300009553 | Bacteria | 3027 |
| 301 | Ga0105249_10645237 | 3300009553 | Bacteria | 1116 |
| 302 | Ga0099796_10459180 | 3300010159 | Bacteria | 567 |
| 303 | Ga0105239_10020324 | 3300010375 | Bacteria | 7325 |
| 304 | Ga0105239_10029566 | 3300010375 | Bacteria | 6024 |
| 305 | Ga0105239_10118154 | 3300010375 | Bacteria | 2943 |
| 306 | Ga0105239_10151085 | 3300010375 | Bacteria | 2592 |
| 307 | Ga0105239_10404892 | 3300010375 | Bacteria | 1544 |
| 308 | Ga0105239_10804993 | 3300010375 | Bacteria | 1077 |
| 309 | Ga0105246_10106488 | 3300011119 | Bacteria | 2051 |
| 310 | Ga0105246_10229454 | 3300011119 | Bacteria | 1461 |
| 311 | Ga0105246_10256365 | 3300011119 | Bacteria | 1391 |
| 312 | Ga0105246_10675292 | 3300011119 | Bacteria | 902 |
| 313 | Ga0105246_11328480 | 3300011119 | Bacteria | 667 |
| 314 | Ga0157338_1036802 | 3300012515 | Bacteria | 649 |
| 315 | Ga0157371_10727887 | 3300013102 | Bacteria | 744 |
| 316 | Ga0157371_11388202 | 3300013102 | Bacteria | 545 |
| 317 | Ga0157370_10014947 | 3300013104 | Bacteria | 7918 |
| 318 | Ga0157370_10025078 | 3300013104 | Bacteria | 5903 |
| 319 | Ga0157370_10071347 | 3300013104 | Bacteria | 3277 |
| 320 | Ga0157370_10296740 | 3300013104 | Bacteria | 1492 |
| 321 | Ga0157370_10862740 | 3300013104 | Bacteria | 822 |
| 322 | Ga0157370_10950068 | 3300013104 | Bacteria | 779 |
| 323 | Ga0157369_10021190 | 3300013105 | Bacteria | 7267 |
| 324 | Ga0157369_10047353 | 3300013105 | Bacteria | 4669 |
| 325 | Ga0157369_10130028 | 3300013105 | Bacteria | 2669 |
| 326 | Ga0157369_10501429 | 3300013105 | Bacteria | 1256 |
| 327 | Ga0157369_10602033 | 3300013105 | Bacteria | 1134 |
| 328 | Ga0157374_10033305 | 3300013296 | Bacteria | 4701 |
| 329 | Ga0157374_10530713 | 3300013296 | Bacteria | 1183 |
| 330 | Ga0157378_10070080 | 3300013297 | Bacteria | 3147 |
| 331 | Ga0157378_10356319 | 3300013297 | Bacteria | 1431 |
| 332 | Ga0157378_10368636 | 3300013297 | Bacteria | 1407 |
| 333 | Ga0157378_11541203 | 3300013297 | Bacteria | 710 |
| 334 | Ga0157378_13043504 | 3300013297 | Bacteria | 520 |
| 335 | Ga0163162_10578216 | 3300013306 | Bacteria | 1250 |
| 336 | Ga0163162_11108831 | 3300013306 | Bacteria | 897 |
| 337 | Ga0163162_11309716 | 3300013306 | Bacteria | 823 |
| 338 | Ga0163162_13152751 | 3300013306 | Bacteria | 529 |
| 339 | Ga0157372_10196832 | 3300013307 | Bacteria | 2334 |
| 340 | Ga0157372_10708827 | 3300013307 | Bacteria | 1171 |
| 341 | Ga0157372_12031415 | 3300013307 | Bacteria | 661 |
| 342 | Ga0157372_12344199 | 3300013307 | Bacteria | 613 |
| 343 | Ga0157375_10009689 | 3300013308 | Bacteria | 8470 |
| 344 | Ga0157375_11105739 | 3300013308 | Bacteria | 928 |
| 345 | Ga0157375_11934839 | 3300013308 | Bacteria | 700 |
| 346 | Ga0157375_12308347 | 3300013308 | Bacteria | 641 |
| 347 | Ga0163163_10159204 | 3300014325 | Bacteria | 2303 |
| 348 | Ga0163163_10453589 | 3300014325 | Bacteria | 1342 |
| 349 | Ga0163163_10571962 | 3300014325 | Bacteria | 1193 |
| 350 | Ga0163163_11094788 | 3300014325 | Bacteria | 860 |
| 351 | Ga0163163_12257726 | 3300014325 | Bacteria | 603 |
| 352 | Ga0157380_10184873 | 3300014326 | Bacteria | 1834 |
| 353 | Ga0157380_10184912 | 3300014326 | Bacteria | 1834 |
| 354 | Ga0157380_10811873 | 3300014326 | Bacteria | 953 |
| 355 | Ga0157380_12152610 | 3300014326 | Bacteria | 621 |
| 356 | Ga0157377_10094953 | 3300014745 | Bacteria | 1767 |
| 357 | Ga0157377_10173047 | 3300014745 | Bacteria | 1352 |
| 358 | Ga0157377_11356277 | 3300014745 | Bacteria | 559 |
| 359 | Ga0157379_10085565 | 3300014968 | Bacteria | 2826 |
| 360 | Ga0157379_10341117 | 3300014968 | Bacteria | 1370 |
| 361 | Ga0157379_10659533 | 3300014968 | Bacteria | 980 |
| 362 | Ga0157376_10092020 | 3300014969 | Bacteria | 2628 |
| 363 | Ga0157376_10557471 | 3300014969 | Bacteria | 1135 |
| 364 | Ga0163161_10128231 | 3300017792 | Bacteria | 1912 |
| 365 | Ga0163161_10232435 | 3300017792 | Bacteria | 1431 |
| 366 | Ga0163161_10303939 | 3300017792 | Bacteria | 1257 |
| 367 | Ga0206356_10766524 | 3300020070 | Bacteria | 821 |
| 368 | Ga0206356_11320371 | 3300020070 | Bacteria | 1449 |
| 369 | Ga0206353_10272000 | 3300020082 | Bacteria | 539 |
| 370 | Ga0213874_10013946 | 3300021377 | Bacteria | 2092 |
| 371 | Ga0213876_10020027 | 3300021384 | Bacteria | 3534 |
| 372 | Ga0213876_10072356 | 3300021384 | Bacteria | 1821 |
| 373 | Ga0209233_1002384 | 3300025261 | Bacteria | 6957 |
| 374 | Ga0209758_1030944 | 3300025297 | Bacteria | 2205 |
| 375 | Ga0209758_1031236 | 3300025297 | Bacteria | 2189 |
| 376 | Ga0209758_1050827 | 3300025297 | Bacteria | 1449 |
| 377 | Ga0209758_1091452 | 3300025297 | Bacteria | 890 |
| 378 | Ga0207697_10085069 | 3300025315 | Bacteria | 1335 |
| 379 | Ga0207656_10034898 | 3300025321 | Bacteria | 2102 |
| 380 | Ga0207682_10212877 | 3300025893 | Bacteria | 892 |
| 381 | Ga0207642_10037371 | 3300025899 | Bacteria | 2092 |
| 382 | Ga0207642_10398319 | 3300025899 | Bacteria | 823 |
| 383 | Ga0207642_10478566 | 3300025899 | Bacteria | 759 |
| 384 | Ga0207642_10583281 | 3300025899 | Bacteria | 694 |
| 385 | Ga0207710_10176392 | 3300025900 | Bacteria | 1047 |
| 386 | Ga0207710_10384506 | 3300025900 | Bacteria | 719 |
| 387 | Ga0207710_10598127 | 3300025900 | Bacteria | 576 |
| 388 | Ga0207688_10215003 | 3300025901 | Bacteria | 1156 |
| 389 | Ga0207688_10282908 | 3300025901 | Bacteria | 1011 |
| 390 | Ga0207688_10421078 | 3300025901 | Bacteria | 830 |
| 391 | Ga0207688_10436633 | 3300025901 | Bacteria | 815 |
| 392 | Ga0207688_10518079 | 3300025901 | Bacteria | 748 |
| 393 | Ga0207680_10591542 | 3300025903 | Bacteria | 793 |
| 394 | Ga0207685_10027483 | 3300025905 | Bacteria | 1991 |
| 395 | Ga0207699_10025234 | 3300025906 | Bacteria | 3260 |
| 396 | Ga0207699_10156951 | 3300025906 | Bacteria | 1511 |
| 397 | Ga0207699_10490158 | 3300025906 | Bacteria | 886 |
| 398 | Ga0207699_10910031 | 3300025906 | Bacteria | 649 |
| 399 | Ga0207645_10058248 | 3300025907 | Bacteria | 2466 |
| 400 | Ga0207645_10172342 | 3300025907 | Bacteria | 1419 |
| 401 | Ga0207705_10269578 | 3300025909 | Bacteria | 1302 |
| 402 | Ga0207705_10295605 | 3300025909 | Bacteria | 1241 |
| 403 | Ga0207684_10216101 | 3300025910 | Bacteria | 1654 |
| 404 | Ga0207684_10558714 | 3300025910 | Bacteria | 979 |
| 405 | Ga0207684_11207051 | 3300025910 | Bacteria | 626 |
| 406 | Ga0207654_10429061 | 3300025911 | Bacteria | 924 |
| 407 | Ga0207707_10000419 | 3300025912 | Bacteria | 44410 |
| 408 | Ga0207707_10002705 | 3300025912 | Bacteria | 15850 |
| 409 | Ga0207707_10002868 | 3300025912 | Bacteria | 15401 |
| 410 | Ga0207707_10045918 | 3300025912 | Bacteria | 3804 |
| 411 | Ga0207707_10135089 | 3300025912 | Bacteria | 2156 |
| 412 | Ga0207695_10048124 | 3300025913 | Bacteria | 4506 |
| 413 | Ga0207695_10060686 | 3300025913 | Bacteria | 3913 |
| 414 | Ga0207695_10140869 | 3300025913 | Bacteria | 2360 |
| 415 | Ga0207695_10240619 | 3300025913 | Bacteria | 1711 |
| 416 | Ga0207695_10363647 | 3300025913 | Bacteria | 1333 |
| 417 | Ga0207671_10061259 | 3300025914 | Bacteria | 2792 |
| 418 | Ga0207671_10378725 | 3300025914 | Bacteria | 1124 |
| 419 | Ga0207671_10456499 | 3300025914 | Bacteria | 1018 |
| 420 | Ga0207671_10485729 | 3300025914 | Bacteria | 984 |
| 421 | Ga0207671_11174057 | 3300025914 | Bacteria | 601 |
| 422 | Ga0207693_10041850 | 3300025915 | Bacteria | 3606 |
| 423 | Ga0207693_10071447 | 3300025915 | Bacteria | 2716 |
| 424 | Ga0207693_10086606 | 3300025915 | Bacteria | 2455 |
| 425 | Ga0207693_10770161 | 3300025915 | Bacteria | 743 |
| 426 | Ga0207663_10007087 | 3300025916 | Bacteria | 5789 |
| 427 | Ga0207663_10043021 | 3300025916 | Bacteria | 2763 |
| 428 | Ga0207663_10065948 | 3300025916 | Bacteria | 2316 |
| 429 | Ga0207663_10116334 | 3300025916 | Bacteria | 1823 |
| 430 | Ga0207663_10390605 | 3300025916 | Bacteria | 1062 |
| 431 | Ga0207660_10012377 | 3300025917 | Bacteria | 5581 |
| 432 | Ga0207660_10048142 | 3300025917 | Bacteria | 3017 |
| 433 | Ga0207660_10305114 | 3300025917 | Bacteria | 1268 |
| 434 | Ga0207660_10330707 | 3300025917 | Bacteria | 1218 |
| 435 | Ga0207662_10113335 | 3300025918 | Bacteria | 1693 |
| 436 | Ga0207662_11223767 | 3300025918 | Bacteria | 534 |
| 437 | Ga0207657_10011308 | 3300025919 | Bacteria | 8865 |
| 438 | Ga0207657_10420585 | 3300025919 | Bacteria | 1050 |
| 439 | Ga0207649_10039488 | 3300025920 | Bacteria | 2862 |
| 440 | Ga0207649_10557951 | 3300025920 | Bacteria | 877 |
| 441 | Ga0207652_10001690 | 3300025921 | Bacteria | 19300 |
| 442 | Ga0207652_10009155 | 3300025921 | Bacteria | 7969 |
| 443 | Ga0207652_10011695 | 3300025921 | Bacteria | 7082 |
| 444 | Ga0207652_10047707 | 3300025921 | Bacteria | 3659 |
| 445 | Ga0207652_10055058 | 3300025921 | Bacteria | 3420 |
| 446 | Ga0207646_10826670 | 3300025922 | Bacteria | 824 |
| 447 | Ga0207681_10039022 | 3300025923 | Bacteria | 3150 |
| 448 | Ga0207681_10411264 | 3300025923 | Bacteria | 1094 |
| 449 | Ga0207681_10889286 | 3300025923 | Bacteria | 746 |
| 450 | Ga0207694_10027290 | 3300025924 | Bacteria | 4347 |
| 451 | Ga0207694_10075966 | 3300025924 | Bacteria | 2631 |
| 452 | Ga0207694_10321799 | 3300025924 | Bacteria | 1276 |
| 453 | Ga0207694_10731282 | 3300025924 | Bacteria | 835 |
| 454 | Ga0207694_11027946 | 3300025924 | Bacteria | 697 |
| 455 | Ga0207659_10101426 | 3300025926 | Bacteria | 2171 |
| 456 | Ga0207687_10157928 | 3300025927 | Bacteria | 1737 |
| 457 | Ga0207687_10395148 | 3300025927 | Bacteria | 1136 |
| 458 | Ga0207687_10641434 | 3300025927 | Bacteria | 898 |
| 459 | Ga0207700_10005544 | 3300025928 | Bacteria | 7569 |
| 460 | Ga0207700_10063406 | 3300025928 | Bacteria | 2811 |
| 461 | Ga0207700_10118805 | 3300025928 | Bacteria | 2140 |
| 462 | Ga0207700_10120991 | 3300025928 | Bacteria | 2123 |
| 463 | Ga0207700_10183800 | 3300025928 | Bacteria | 1752 |
| 464 | Ga0207700_11162919 | 3300025928 | Bacteria | 689 |
| 465 | Ga0207664_10042851 | 3300025929 | Bacteria | 3536 |
| 466 | Ga0207664_10150641 | 3300025929 | Bacteria | 1976 |
| 467 | Ga0207664_10229936 | 3300025929 | Bacteria | 1612 |
| 468 | Ga0207664_10489807 | 3300025929 | Bacteria | 1100 |
| 469 | Ga0207644_10234854 | 3300025931 | Bacteria | 1458 |
| 470 | Ga0207644_11082889 | 3300025931 | Bacteria | 673 |
| 471 | Ga0207644_11312479 | 3300025931 | Bacteria | 608 |
| 472 | Ga0207644_11400987 | 3300025931 | Bacteria | 587 |
| 473 | Ga0207690_10587430 | 3300025932 | Bacteria | 908 |
| 474 | Ga0207706_10015272 | 3300025933 | Bacteria | 6945 |
| 475 | Ga0207706_10225273 | 3300025933 | Bacteria | 1641 |
| 476 | Ga0207706_10408965 | 3300025933 | Bacteria | 1176 |
| 477 | Ga0207709_10358165 | 3300025935 | Bacteria | 1104 |
| 478 | Ga0207709_10503061 | 3300025935 | Bacteria | 946 |
| 479 | Ga0207709_10528054 | 3300025935 | Bacteria | 925 |
| 480 | Ga0207709_10862442 | 3300025935 | Bacteria | 734 |
| 481 | Ga0207709_10893438 | 3300025935 | Bacteria | 722 |
| 482 | Ga0207669_10095367 | 3300025937 | Bacteria | 1950 |
| 483 | Ga0207669_10718476 | 3300025937 | Bacteria | 822 |
| 484 | Ga0207669_11091687 | 3300025937 | Bacteria | 673 |
| 485 | Ga0207704_10666308 | 3300025938 | Bacteria | 858 |
| 486 | Ga0207704_11179898 | 3300025938 | Bacteria | 652 |
| 487 | Ga0207665_10036449 | 3300025939 | Bacteria | 3271 |
| 488 | Ga0207665_10088797 | 3300025939 | Bacteria | 2139 |
| 489 | Ga0207665_10195726 | 3300025939 | Bacteria | 1471 |
| 490 | Ga0207665_10253201 | 3300025939 | Bacteria | 1302 |
| 491 | Ga0207665_10611246 | 3300025939 | Bacteria | 852 |
| 492 | Ga0207665_10847064 | 3300025939 | Bacteria | 724 |
| 493 | Ga0207691_10054640 | 3300025940 | Bacteria | 3642 |
| 494 | Ga0207691_10168119 | 3300025940 | Bacteria | 1921 |
| 495 | Ga0207691_10426374 | 3300025940 | Bacteria | 1130 |
| 496 | Ga0207691_10505181 | 3300025940 | Bacteria | 1026 |
| 497 | Ga0207691_10765507 | 3300025940 | Bacteria | 812 |
| 498 | Ga0207711_10284242 | 3300025941 | Bacteria | 1524 |
| 499 | Ga0207689_10011785 | 3300025942 | Bacteria | 7491 |
| 500 | Ga0207689_10125319 | 3300025942 | Bacteria | 2113 |
| 501 | Ga0207689_10326522 | 3300025942 | Bacteria | 1274 |
| 502 | Ga0207661_10001270 | 3300025944 | Bacteria | 16867 |
| 503 | Ga0207661_10008213 | 3300025944 | Bacteria | 7451 |
| 504 | Ga0207661_10021058 | 3300025944 | Bacteria | 4883 |
| 505 | Ga0207679_10069235 | 3300025945 | Bacteria | 2654 |
| 506 | Ga0207679_10271615 | 3300025945 | Bacteria | 1450 |
| 507 | Ga0207679_10377220 | 3300025945 | Bacteria | 1242 |
| 508 | Ga0207679_10916061 | 3300025945 | Bacteria | 802 |
| 509 | Ga0207667_10002017 | 3300025949 | Bacteria | 25487 |
| 510 | Ga0207667_10145129 | 3300025949 | Bacteria | 2443 |
| 511 | Ga0207667_10201639 | 3300025949 | Bacteria | 2041 |
| 512 | Ga0207667_10510487 | 3300025949 | Bacteria | 1218 |
| 513 | Ga0207667_11719651 | 3300025949 | Bacteria | 593 |
| 514 | Ga0207651_10112506 | 3300025960 | Bacteria | 2047 |
| 515 | Ga0207651_10603500 | 3300025960 | Bacteria | 960 |
| 516 | Ga0207712_10128621 | 3300025961 | Bacteria | 1927 |
| 517 | Ga0207668_10150043 | 3300025972 | Bacteria | 1803 |
| 518 | Ga0207668_10241238 | 3300025972 | Bacteria | 1462 |
| 519 | Ga0207668_10335998 | 3300025972 | Bacteria | 1258 |
| 520 | Ga0207668_10471341 | 3300025972 | Bacteria | 1075 |
| 521 | Ga0207668_10481127 | 3300025972 | Bacteria | 1065 |
| 522 | Ga0207668_10558761 | 3300025972 | Bacteria | 992 |
| 523 | Ga0207640_10214238 | 3300025981 | Bacteria | 1470 |
| 524 | Ga0207640_10407822 | 3300025981 | Bacteria | 1108 |
| 525 | Ga0207640_10539537 | 3300025981 | Bacteria | 978 |
| 526 | Ga0207658_10132641 | 3300025986 | Bacteria | 2004 |
| 527 | Ga0207658_10375592 | 3300025986 | Bacteria | 1244 |
| 528 | Ga0207658_11256020 | 3300025986 | Bacteria | 677 |
| 529 | Ga0207658_11567847 | 3300025986 | Bacteria | 602 |
| 530 | Ga0207677_10005891 | 3300026023 | Bacteria | 6669 |
| 531 | Ga0207677_10532795 | 3300026023 | Bacteria | 1021 |
| 532 | Ga0207703_10394218 | 3300026035 | Bacteria | 1283 |
| 533 | Ga0207703_10999855 | 3300026035 | Bacteria | 802 |
| 534 | Ga0207703_11300422 | 3300026035 | Bacteria | 699 |
| 535 | Ga0207639_10173169 | 3300026041 | Bacteria | 1830 |
| 536 | Ga0207639_10837909 | 3300026041 | Bacteria | 858 |
| 537 | Ga0207639_10970591 | 3300026041 | Bacteria | 795 |
| 538 | Ga0207639_12227199 | 3300026041 | Bacteria | 509 |
| 539 | Ga0207678_10006479 | 3300026067 | Bacteria | 10385 |
| 540 | Ga0207678_10044766 | 3300026067 | Bacteria | 3828 |
| 541 | Ga0207678_10061454 | 3300026067 | Bacteria | 3231 |
| 542 | Ga0207678_10196905 | 3300026067 | Bacteria | 1722 |
| 543 | Ga0207678_10628445 | 3300026067 | Bacteria | 942 |
| 544 | Ga0207678_10860880 | 3300026067 | Bacteria | 801 |
| 545 | Ga0207678_11372541 | 3300026067 | Bacteria | 625 |
| 546 | Ga0207678_11916079 | 3300026067 | Bacteria | 517 |
| 547 | Ga0207708_10158521 | 3300026075 | Bacteria | 1786 |
| 548 | Ga0207708_10981793 | 3300026075 | Bacteria | 733 |
| 549 | Ga0207702_10273884 | 3300026078 | Bacteria | 1593 |
| 550 | Ga0207702_10875316 | 3300026078 | Bacteria | 890 |
| 551 | Ga0207702_10903267 | 3300026078 | Bacteria | 875 |
| 552 | Ga0207641_10606623 | 3300026088 | Bacteria | 1072 |
| 553 | Ga0207641_11251741 | 3300026088 | Bacteria | 742 |
| 554 | Ga0207641_11833036 | 3300026088 | Bacteria | 608 |
| 555 | Ga0207648_10797285 | 3300026089 | Bacteria | 879 |
| 556 | Ga0207648_10821718 | 3300026089 | Bacteria | 866 |
| 557 | Ga0207648_10936444 | 3300026089 | Bacteria | 810 |
| 558 | Ga0207676_10069328 | 3300026095 | Bacteria | 2823 |
| 559 | Ga0207674_10010575 | 3300026116 | Bacteria | 10440 |
| 560 | Ga0207674_10113295 | 3300026116 | Bacteria | 2685 |
| 561 | Ga0207674_10242397 | 3300026116 | Bacteria | 1750 |
| 562 | Ga0207674_10457616 | 3300026116 | Bacteria | 1233 |
| 563 | Ga0207674_10594400 | 3300026116 | Bacteria | 1069 |
| 564 | Ga0207674_11383866 | 3300026116 | Bacteria | 673 |
| 565 | Ga0207674_11674039 | 3300026116 | Bacteria | 604 |
| 566 | Ga0207675_100031334 | 3300026118 | Bacteria | 4954 |
| 567 | Ga0207675_100064640 | 3300026118 | Bacteria | 3420 |
| 568 | Ga0207675_100274434 | 3300026118 | Bacteria | 1637 |
| 569 | Ga0207675_100422111 | 3300026118 | Bacteria | 1317 |
| 570 | Ga0207675_101532037 | 3300026118 | Bacteria | 687 |
| 571 | Ga0207675_101742728 | 3300026118 | Bacteria | 642 |
| 572 | Ga0207675_101791882 | 3300026118 | Bacteria | 633 |
| 573 | Ga0207683_10021694 | 3300026121 | Bacteria | 5504 |
| 574 | Ga0207683_10197482 | 3300026121 | Bacteria | 1828 |
| 575 | Ga0207683_10648249 | 3300026121 | Bacteria | 978 |
| 576 | Ga0207683_10766064 | 3300026121 | Bacteria | 895 |
| 577 | Ga0207698_10226900 | 3300026142 | Bacteria | 1692 |
| 578 | Ga0207698_10295269 | 3300026142 | Bacteria | 1506 |
| 579 | Ga0207698_10317285 | 3300026142 | Bacteria | 1458 |
| 580 | Ga0207698_10501287 | 3300026142 | Bacteria | 1181 |
| 581 | Ga0207698_11430873 | 3300026142 | Bacteria | 706 |
| 582 | Ga0209589_1000014 | 3300027357 | Bacteria | 227996 |
| 583 | Ga0209489_100014 | 3300027361 | Bacteria | 227996 |
| 584 | Ga0209700_100024 | 3300027363 | Bacteria | 227996 |
| 585 | Ga0209179_1012641 | 3300027512 | Bacteria | 1520 |
| 586 | Ga0209179_1048167 | 3300027512 | Bacteria | 909 |
| 587 | Ga0209588_1002539 | 3300027671 | Bacteria | 4953 |
| 588 | Ga0268266_10147257 | 3300028379 | Bacteria | 2118 |
| 589 | Ga0268266_10201322 | 3300028379 | Bacteria | 1822 |
| 590 | Ga0268266_10391978 | 3300028379 | Bacteria | 1312 |
| 591 | Ga0268266_10570437 | 3300028379 | Bacteria | 1085 |
| 592 | Ga0268266_11270396 | 3300028379 | Bacteria | 711 |
| 593 | Ga0268265_10198420 | 3300028380 | Bacteria | 1738 |
| 594 | Ga0268265_10268121 | 3300028380 | Bacteria | 1521 |
| 595 | Ga0268265_10304954 | 3300028380 | Bacteria | 1435 |
| 596 | Ga0268265_10753171 | 3300028380 | Bacteria | 945 |
| 597 | Ga0268265_11590458 | 3300028380 | Bacteria | 658 |
| 598 | Ga0268265_11681054 | 3300028380 | Bacteria | 640 |
| 599 | Ga0268265_11964165 | 3300028380 | Bacteria | 592 |
| 600 | Ga0268265_12483165 | 3300028380 | Bacteria | 524 |
| 601 | Ga0268264_10055549 | 3300028381 | Bacteria | 3309 |
| 602 | Ga0268264_10292401 | 3300028381 | Bacteria | 1530 |
| 603 | Ga0268264_10568056 | 3300028381 | Bacteria | 1114 |
| 604 | Ga0268264_10893234 | 3300028381 | Bacteria | 891 |
| 605 | Ga0268264_11123623 | 3300028381 | Bacteria | 794 |
| 606 | Ga0268264_11758227 | 3300028381 | Bacteria | 630 |
| 607 | Ga0265337_1007001 | 3300028556 | Bacteria | 4268 |
| 608 | Ga0265326_10065353 | 3300028558 | Bacteria | 1028 |
| 609 | Ga0265319_1006536 | 3300028563 | Bacteria | 5385 |
| 610 | Ga0265334_10001696 | 3300028573 | Bacteria | 10529 |
| 611 | Ga0265318_10008197 | 3300028577 | Bacteria | 4667 |
| 612 | Ga0265323_10001106 | 3300028653 | Bacteria | 13928 |
| 613 | Ga0265322_10001590 | 3300028654 | Bacteria | 7289 |
| 614 | Ga0265336_10000135 | 3300028666 | Bacteria | 52478 |
| 615 | Ga0307517_10000634 | 3300028786 | Bacteria | 60194 |
| 616 | Ga0307517_10039620 | 3300028786 | Bacteria | 5167 |
| 617 | Ga0307517_10324896 | 3300028786 | Bacteria | 849 |
| 618 | Ga0307517_10594244 | 3300028786 | Bacteria | 546 |
| 619 | Ga0307515_10006012 | 3300028794 | Bacteria | 24419 |
| 620 | Ga0307515_10512273 | 3300028794 | Bacteria | 810 |
| 621 | Ga0265338_10000034 | 3300028800 | Bacteria | 244623 |
| 622 | Ga0265338_10361635 | 3300028800 | Bacteria | 1041 |
| 623 | Ga0265324_10001466 | 3300029957 | Bacteria | 13424 |
| 624 | Ga0265324_10156835 | 3300029957 | Bacteria | 773 |
| 625 | Ga0307511_10024264 | 3300030521 | Bacteria | 5626 |
| 626 | Ga0265332_10013209 | 3300031238 | Bacteria | 3662 |
| 627 | Ga0307513_10125438 | 3300031456 | Bacteria | 2524 |
| 628 | Ga0307513_10444506 | 3300031456 | Bacteria | 1022 |
| 629 | Ga0307513_10645174 | 3300031456 | Bacteria | 766 |
| 630 | Ga0307509_10132445 | 3300031507 | Bacteria | 2445 |
| 631 | Ga0307509_10826352 | 3300031507 | Bacteria | 591 |
| 632 | Ga0307508_10000032 | 3300031616 | Bacteria | 163293 |
| 633 | Ga0307508_10022899 | 3300031616 | Bacteria | 5677 |
| 634 | Ga0307508_10139265 | 3300031616 | Bacteria | 2030 |
| 635 | Ga0307508_10715631 | 3300031616 | Bacteria | 612 |
| 636 | Ga0265314_10195305 | 3300031711 | Bacteria | 1201 |
| 637 | Ga0307516_10005934 | 3300031730 | Bacteria | 14450 |
| 638 | Ga0307516_10039539 | 3300031730 | Bacteria | 4700 |
| 639 | Ga0307516_10300751 | 3300031730 | Bacteria | 1280 |
| 640 | Ga0307405_10879540 | 3300031731 | Bacteria | 756 |
| 641 | Ga0307413_10061917 | 3300031824 | Bacteria | 2312 |
| 642 | Ga0307413_10440005 | 3300031824 | Bacteria | 1032 |
| 643 | Ga0307410_10143713 | 3300031852 | Bacteria | 1768 |
| 644 | Ga0307406_10896882 | 3300031901 | Bacteria | 754 |
| 645 | Ga0307407_10186122 | 3300031903 | Bacteria | 1380 |
| 646 | Ga0307412_10093307 | 3300031911 | Bacteria | 2111 |
| 647 | Ga0307412_11811460 | 3300031911 | Bacteria | 562 |
| 648 | Ga0307416_100738479 | 3300032002 | Bacteria | 1076 |
| 649 | Ga0307411_10300285 | 3300032005 | Bacteria | 1287 |
| 650 | Ga0307415_100094054 | 3300032126 | Bacteria | 2178 |
| 651 | Ga0307415_100687932 | 3300032126 | Bacteria | 921 |
| 652 | Ga0307507_10011278 | 3300033179 | Bacteria | 11327 |
| 653 | Ga0307510_10016157 | 3300033180 | Bacteria | 8816 |
| 654 | Ga0307510_10091519 | 3300033180 | Bacteria | 2883 |
| 655 | Ga0373930_0001351 | 3300034816 | Bacteria | 3619 |
| 656 | Ga0373959_0055718 | 3300034820 | Bacteria | 864 |
| 657 | Ga0373926_0007554 | 3300035083 | Bacteria | 3620 |
| 658 | Ga0373934_0187215 | 3300035086 | Bacteria | 851 |
| 659 | Ga0373951_0013653 | 3300035091 | Bacteria | 1825 |
| 660 | Ga0373952_0108085 | 3300035092 | Bacteria | 741 |
| 661 | Ga0373923_0061471 | 3300035111 | Bacteria | 1596 |
| 662 | Ga0373923_0236904 | 3300035111 | Bacteria | 852 |
| 663 | Ga0373936_0061479 | 3300035113 | Bacteria | 1534 |
| 664 | Ga0373936_0068996 | 3300035113 | Bacteria | 1454 |
| 665 | Ga0373939_0227291 | 3300035114 | Bacteria | 717 |
| 666 | Ga0373939_0489452 | 3300035114 | Bacteria | 523 |
| 667 | Ga0373954_0081500 | 3300035118 | Bacteria | 1546 |
| 668 | Ga0373954_0166773 | 3300035118 | Bacteria | 1078 |
| 669 | Ga0373956_0304788 | 3300035119 | Bacteria | 759 |
| 670 | Ga0373956_0407056 | 3300035119 | Bacteria | 649 |
| 671 | Ga0373943_0083782 | 3300035170 | Bacteria | 1639 |
| 672 | Ga0373946_0026464 | 3300035171 | Bacteria | 2289 |
| 673 | Ga0373946_0058279 | 3300035171 | Bacteria | 1635 |
| 674 | Ga0373955_0040395 | 3300035172 | Bacteria | 2495 |
| 675 | Ga0373955_0058451 | 3300035172 | Bacteria | 2122 |
| 676 | Ga0373955_0880774 | 3300035172 | Bacteria | 551 |
| 677 | Ga0373924_0017175 | 3300035410 | Bacteria | 2772 |
| 678 | Ga0373931_0002187 | 3300035691 | Bacteria | 8629 |
| 679 | Ga0373931_0384182 | 3300035691 | Bacteria | 886 |
| 680 | Ga0373931_0390676 | 3300035691 | Bacteria | 879 |
| 681 | Ga0373931_0434475 | 3300035691 | Bacteria | 837 |
| 682 | Ga0373931_1246755 | 3300035691 | Bacteria | 510 |
| 683 | Ga0373935_0012923 | 3300035692 | Bacteria | 5031 |
| 684 | Ga0373935_0032924 | 3300035692 | Bacteria | 3223 |
| 685 | Ga0373935_0063455 | 3300035692 | Bacteria | 2368 |
| 686 | Ga0373935_0069468 | 3300035692 | Bacteria | 2269 |
| 687 | Ga0373935_0324990 | 3300035692 | Bacteria | 1092 |
| 688 | Ga0373935_0607081 | 3300035692 | Bacteria | 800 |
| 689 | Ga0373927_0014717 | 3300035695 | Bacteria | 5172 |
| 690 | Ga0373927_0015621 | 3300035695 | Bacteria | 5014 |
| 691 | Ga0373927_0044610 | 3300035695 | Bacteria | 2868 |
| 692 | Ga0373927_0060854 | 3300035695 | Bacteria | 2443 |
| 693 | Ga0373927_0169814 | 3300035695 | Bacteria | 1429 |
| 694 | Ga0373927_0523744 | 3300035695 | Bacteria | 783 |
| 695 | Ga0373927_0605220 | 3300035695 | Bacteria | 724 |
| 696 | Ga0373927_0732936 | 3300035695 | Bacteria | 653 |
| 697 | Ga0373933_0000182 | 3300035724 | Bacteria | 41434 |
| 698 | Ga0373933_0219645 | 3300035724 | Bacteria | 1219 |
| 699 | Ga0373933_1055597 | 3300035724 | Bacteria | 535 |
| 700 | Ga0373947_0025925 | 3300035725 | Bacteria | 3420 |
| 701 | Ga0373947_0028707 | 3300035725 | Bacteria | 3263 |
| 702 | Ga0373947_0076608 | 3300035725 | Bacteria | 2061 |
| 703 | Ga0373937_0399859 | 3300036401 | Bacteria | 1303 |
| 704 | Ga0372808_009572 | 3300036459 | Bacteria | 1355 |
| 705 | Ga0373925_0025108 | 3300037068 | Bacteria | 4351 |
| 706 | Ga0373925_0054383 | 3300037068 | Bacteria | 2994 |
| 707 | Ga0373925_0102550 | 3300037068 | Bacteria | 2201 |
| 708 | Ga0373925_0125508 | 3300037068 | Bacteria | 1996 |
| 709 | Ga0373925_0453465 | 3300037068 | Bacteria | 1050 |
| 710 | Ga0373925_0589940 | 3300037068 | Bacteria | 915 |
| 711 | Ga0395900_0017080 | 3300037418 | Bacteria | 7408 |
| 712 | Ga0395900_0082779 | 3300037418 | Bacteria | 3297 |
| 713 | Ga0395900_0200935 | 3300037418 | Bacteria | 2017 |
| 714 | Ga0395898_0099842 | 3300037466 | Bacteria | 2788 |
| 715 | Ga0395905_0996464 | 3300037471 | Bacteria | 741 |
| 716 | Ga0395901_0044477 | 3300038443 | Bacteria | 4606 |
| 717 | Ga0395901_0153963 | 3300038443 | Bacteria | 2415 |
| 718 | Ga0395901_0251715 | 3300038443 | Bacteria | 1840 |
| 719 | Ga0436365_0229539 | 3300039437 | Bacteria | 3406 |
| 720 | Ga0436365_0585470 | 3300039437 | Bacteria | 722 |
| 721 | Ga0436365_0644236 | 3300039437 | Bacteria | 1141 |
| 722 | Ga0436365_1524424 | 3300039437 | Bacteria | 1377 |
| 723 | Ga0436365_1891875 | 3300039437 | Bacteria | 1374 |
| 724 | Ga0436363_0130820 | 3300039450 | Bacteria | 640 |
| 725 | Ga0436363_0194304 | 3300039450 | Bacteria | 1684 |
| 726 | Ga0436363_0749925 | 3300039450 | Bacteria | 610 |
| 727 | Ga0436363_1284900 | 3300039450 | Bacteria | 4856 |
| 728 | Ga0439465_0026133 | 3300041413 | Bacteria | 1845 |
| 729 | Ga0451793_1610473 | 3300041452 | Bacteria | 1027 |
| 730 | Ga0451807_0104523 | 3300041486 | Bacteria | 1009 |
| 731 | Ga0451851_0290019 | 3300041507 | Bacteria | 631 |
| 732 | Ga0451855_0070536 | 3300041511 | Bacteria | 865 |
| 733 | Ga0451853_1007521 | 3300041512 | Bacteria | 854 |
| 734 | Ga0439459_0016118 | 3300042438 | Bacteria | 1378 |
| 735 | Ga0466961_0065107 | 3300044693 | Bacteria | 2316 |
| 736 | Ga0466964_0154855 | 3300044706 | Bacteria | 1066 |
| 737 | Ga0466971_0518372 | 3300044719 | Bacteria | 589 |
| 738 | Ga0466970_0232843 | 3300044765 | Bacteria | 1030 |
| 739 | Ga0466959_0778571 | 3300045049 | Bacteria | 640 |
| 740 | Ga0466967_0285270 | 3300045976 | Bacteria | 1585 |
| 741 | Ga0466967_0306657 | 3300045976 | Bacteria | 1528 |
| 742 | Ga0466967_0347873 | 3300045976 | Bacteria | 1434 |
| 743 | Ga0466967_0392747 | 3300045976 | Bacteria | 1349 |
| 744 | Ga0495617_013046 | 3300046452 | Bacteria | 2830 |
| 745 | Ga0495617_155269 | 3300046452 | Bacteria | 727 |
| 746 | Ga0495592_0022948 | 3300046454 | Bacteria | 4748 |
| 747 | Ga0495592_0068249 | 3300046454 | Bacteria | 2596 |
| 748 | Ga0495603_0003836 | 3300046455 | Bacteria | 8949 |
| 749 | Ga0495603_0023547 | 3300046455 | Bacteria | 3724 |
| 750 | Ga0495603_0043708 | 3300046455 | Bacteria | 2674 |
| 751 | Ga0495603_0080616 | 3300046455 | Bacteria | 1907 |
| 752 | Ga0495603_0622622 | 3300046455 | Bacteria | 618 |
| 753 | Ga0495629_0000862 | 3300046459 | Bacteria | 24478 |
| 754 | Ga0495629_0091399 | 3300046459 | Bacteria | 2124 |
| 755 | Ga0495629_0406317 | 3300046459 | Bacteria | 925 |
| 756 | Ga0495638_0019608 | 3300046460 | Bacteria | 4473 |
| 757 | Ga0495638_0148689 | 3300046460 | Bacteria | 1360 |
| 758 | Ga0495638_0200917 | 3300046460 | Bacteria | 1125 |
| 759 | Ga0495641_0348703 | 3300046461 | Bacteria | 669 |
| 760 | Ga0495651_0267567 | 3300046462 | Bacteria | 1160 |
| 761 | Ga0495653_0373644 | 3300046463 | Bacteria | 912 |
| 762 | Ga0495580_0010268 | 3300046472 | Bacteria | 7303 |
| 763 | Ga0495580_0037193 | 3300046472 | Bacteria | 3495 |
| 764 | Ga0495580_0059540 | 3300046472 | Bacteria | 2684 |
| 765 | Ga0495582_0006572 | 3300046473 | Bacteria | 6452 |
| 766 | Ga0495582_0025793 | 3300046473 | Bacteria | 3220 |
| 767 | Ga0495582_0107941 | 3300046473 | Bacteria | 1563 |
| 768 | Ga0495582_0187308 | 3300046473 | Bacteria | 1180 |
| 769 | Ga0495605_0194958 | 3300046474 | Bacteria | 885 |
| 770 | Ga0495639_0000544 | 3300046475 | Bacteria | 17562 |
| 771 | Ga0495639_0703245 | 3300046475 | Bacteria | 522 |
| 772 | Ga0495662_0042974 | 3300046476 | Bacteria | 2181 |
| 773 | Ga0495664_0063932 | 3300046477 | Bacteria | 2193 |
| 774 | Ga0495664_0077097 | 3300046477 | Bacteria | 1996 |
| 775 | Ga0495585_0032350 | 3300046492 | Bacteria | 2963 |
| 776 | Ga0495585_0037849 | 3300046492 | Bacteria | 2716 |
| 777 | Ga0495585_0341597 | 3300046492 | Bacteria | 729 |
| 778 | Ga0495585_0355030 | 3300046492 | Bacteria | 712 |
| 779 | Ga0495585_0388404 | 3300046492 | Bacteria | 673 |
| 780 | Ga0495594_0026789 | 3300046499 | Bacteria | 3103 |
| 781 | Ga0495594_0154774 | 3300046499 | Bacteria | 1302 |
| 782 | Ga0495594_0198833 | 3300046499 | Bacteria | 1142 |
| 783 | Ga0495596_0066425 | 3300046500 | Bacteria | 1402 |
| 784 | Ga0495606_0253460 | 3300046507 | Bacteria | 975 |
| 785 | Ga0495606_0551029 | 3300046507 | Bacteria | 574 |
| 786 | Ga0495608_0143484 | 3300046511 | Bacteria | 1523 |
| 787 | Ga0495610_0144252 | 3300046512 | Bacteria | 1022 |
| 788 | Ga0495610_0249092 | 3300046512 | Bacteria | 705 |
| 789 | Ga0495610_0337008 | 3300046512 | Bacteria | 571 |
| 790 | Ga0495616_0269497 | 3300046513 | Bacteria | 726 |
| 791 | Ga0495618_0430387 | 3300046514 | Bacteria | 803 |
| 792 | Ga0495620_0088969 | 3300046515 | Bacteria | 1240 |
| 793 | Ga0495630_0026624 | 3300046517 | Bacteria | 4283 |
| 794 | Ga0495630_0029536 | 3300046517 | Bacteria | 4075 |
| 795 | Ga0495631_0067517 | 3300046518 | Bacteria | 1547 |
| 796 | Ga0495631_0191757 | 3300046518 | Bacteria | 875 |
| 797 | Ga0495631_0215006 | 3300046518 | Bacteria | 821 |
| 798 | Ga0495631_0284483 | 3300046518 | Bacteria | 704 |
| 799 | Ga0495631_0307965 | 3300046518 | Bacteria | 674 |
| 800 | Ga0495632_0136433 | 3300046519 | Bacteria | 1140 |
| 801 | Ga0495632_0227779 | 3300046519 | Bacteria | 841 |
| 802 | Ga0495644_0073339 | 3300046523 | Bacteria | 1287 |
| 803 | Ga0495663_0081096 | 3300046525 | Bacteria | 1045 |
| 804 | Ga0495666_0051203 | 3300046526 | Bacteria | 1984 |
| 805 | Ga0495666_0502043 | 3300046526 | Bacteria | 542 |
| 806 | Ga0495652_0111297 | 3300046529 | Bacteria | 2202 |
| 807 | Ga0495652_0465025 | 3300046529 | Bacteria | 883 |
| 808 | Ga0495665_0007397 | 3300046531 | Bacteria | 5938 |
| 809 | Ga0495665_0155014 | 3300046531 | Bacteria | 1195 |
| 810 | Ga0495665_0208083 | 3300046531 | Bacteria | 1013 |
| 811 | Ga0495640_0002595 | 3300046533 | Bacteria | 14526 |
| 812 | Ga0495640_0853911 | 3300046533 | Bacteria | 541 |
| 813 | Ga0495586_0111796 | 3300046535 | Bacteria | 1521 |
| 814 | Ga0495587_0035087 | 3300046536 | Bacteria | 3022 |
| 815 | Ga0495598_0383886 | 3300046537 | Bacteria | 546 |
| 816 | Ga0495609_0135061 | 3300046538 | Bacteria | 1055 |
| 817 | Ga0495609_0318243 | 3300046538 | Bacteria | 631 |
| 818 | Ga0495597_0086925 | 3300046542 | Bacteria | 1331 |
| 819 | Ga0495645_0228866 | 3300046543 | Bacteria | 1246 |
| 820 | Ga0495645_0466904 | 3300046543 | Bacteria | 794 |
| 821 | Ga0495645_0617971 | 3300046543 | Bacteria | 665 |
| 822 | Ga0495645_0750689 | 3300046543 | Bacteria | 589 |
| 823 | Ga0495622_0012042 | 3300046557 | Bacteria | 3999 |
| 824 | Ga0495622_0064031 | 3300046557 | Bacteria | 1701 |
| 825 | Ga0495633_0267211 | 3300046558 | Bacteria | 779 |
| 826 | Ga0495667_0154776 | 3300046559 | Bacteria | 1475 |
| 827 | Ga0495667_0785131 | 3300046559 | Bacteria | 588 |
| 828 | Ga0495656_0026839 | 3300046615 | Bacteria | 2296 |
| 829 | Ga0495656_0052703 | 3300046615 | Bacteria | 1745 |
| 830 | Ga0495656_0179193 | 3300046615 | Bacteria | 1041 |
| 831 | Ga0495668_0077670 | 3300046616 | Bacteria | 1823 |
| 832 | Ga0495668_0085192 | 3300046616 | Bacteria | 1733 |
| 833 | Ga0495668_0249305 | 3300046616 | Bacteria | 972 |
| 834 | Ga0495668_0255578 | 3300046616 | Bacteria | 959 |
| 835 | Ga0495668_0282838 | 3300046616 | Bacteria | 909 |
| 836 | Ga0495634_0290709 | 3300046642 | Bacteria | 990 |
| 837 | Ga0495611_0072829 | 3300046648 | Bacteria | 1572 |
| 838 | Ga0495611_0121136 | 3300046648 | Bacteria | 1220 |
| 839 | Ga0495611_0316384 | 3300046648 | Bacteria | 718 |
| 840 | Ga0495625_0183777 | 3300046660 | Bacteria | 1388 |
| 841 | Ga0495625_0433421 | 3300046660 | Bacteria | 815 |
| 842 | Ga0495625_0484986 | 3300046660 | Bacteria | 758 |
| 843 | Ga0495625_0590184 | 3300046660 | Bacteria | 668 |
| 844 | Ga0495635_0000436 | 3300046663 | Bacteria | 26341 |
| 845 | Ga0495635_0070320 | 3300046663 | Bacteria | 2399 |
| 846 | Ga0495635_0402096 | 3300046663 | Bacteria | 910 |
| 847 | Ga0495659_0060867 | 3300046664 | Bacteria | 1394 |
| 848 | Ga0495661_0085330 | 3300046665 | Bacteria | 1810 |
| 849 | Ga0495661_0326307 | 3300046665 | Bacteria | 762 |
| 850 | Ga0495588_0013756 | 3300046674 | Bacteria | 3860 |
| 851 | Ga0495657_0827946 | 3300046675 | Bacteria | 528 |
| 852 | Ga0495599_0138845 | 3300046678 | Bacteria | 1508 |
| 853 | Ga0495599_0400473 | 3300046678 | Bacteria | 818 |
| 854 | Ga0495599_0891822 | 3300046678 | Bacteria | 504 |
| 855 | Ga0495623_0599247 | 3300046679 | Bacteria | 572 |
| 856 | Ga0495646_0078212 | 3300046680 | Bacteria | 1933 |
| 857 | Ga0495647_0474697 | 3300046681 | Bacteria | 580 |
| 858 | Ga0495658_0375563 | 3300046683 | Bacteria | 905 |
| 859 | Ga0495669_0000650 | 3300046684 | Bacteria | 15146 |
| 860 | Ga0495669_0125391 | 3300046684 | Bacteria | 1206 |
| 861 | Ga0495669_0252889 | 3300046684 | Bacteria | 846 |
| 862 | Ga0495669_0608343 | 3300046684 | Bacteria | 532 |
| 863 | Ga0495613_0013842 | 3300046689 | Bacteria | 5984 |
| 864 | Ga0495624_0023168 | 3300046690 | Bacteria | 4096 |
| 865 | Ga0495624_0044261 | 3300046690 | Bacteria | 2838 |
| 866 | Ga0495624_0312140 | 3300046690 | Bacteria | 947 |
| 867 | Ga0495670_0044258 | 3300046691 | Bacteria | 2222 |
| 868 | Ga0495670_0187388 | 3300046691 | Bacteria | 1094 |
| 869 | Ga0495670_0245510 | 3300046691 | Bacteria | 954 |
| 870 | Ga0495670_0341585 | 3300046691 | Bacteria | 805 |
| 871 | Ga0495649_0070708 | 3300046694 | Bacteria | 1871 |
| 872 | Ga0495649_0220052 | 3300046694 | Bacteria | 982 |
| 873 | Ga0495649_0505208 | 3300046694 | Bacteria | 601 |
| 874 | Ga0495649_0565877 | 3300046694 | Bacteria | 562 |
| 875 | Ga0495589_0051689 | 3300046794 | Bacteria | 2031 |
| 876 | Ga0495589_0116759 | 3300046794 | Bacteria | 1286 |
| 877 | Ga0495589_0258396 | 3300046794 | Bacteria | 813 |
| 878 | Ga0495581_0282336 | 3300047315 | Bacteria | 970 |
| 879 | Ga0495604_0323740 | 3300047317 | Bacteria | 1030 |
| 880 | Ga0495636_0041720 | 3300047318 | Bacteria | 1905 |
| 881 | Ga0495674_0008459 | 3300047319 | Bacteria | 9804 |
| 882 | Ga0495674_0213064 | 3300047319 | Bacteria | 1599 |
| 883 | Ga0495674_1290039 | 3300047319 | Bacteria | 548 |
| 884 | Ga0495672_0043612 | 3300047320 | Bacteria | 2696 |
| 885 | Ga0495672_0079874 | 3300047320 | Bacteria | 1826 |
| 886 | Ga0495672_0516335 | 3300047320 | Bacteria | 529 |
| 887 | Ga0495676_0192322 | 3300047321 | Bacteria | 1423 |
| 888 | Ga0495676_0210521 | 3300047321 | Bacteria | 1345 |
| 889 | Ga0495676_0306496 | 3300047321 | Bacteria | 1070 |
| 890 | Ga0495683_0402623 | 3300047323 | Bacteria | 569 |
| 891 | Ga0495685_145900 | 3300047447 | Bacteria | 770 |
| 892 | Ga0495685_292251 | 3300047447 | Bacteria | 513 |
| 893 | Ga0495673_0116317 | 3300047469 | Bacteria | 1063 |
| 894 | Ga0495681_0098221 | 3300047470 | Bacteria | 1284 |
| 895 | Ga0495684_0028441 | 3300047471 | Bacteria | 4292 |
| 896 | Ga0495686_0026279 | 3300047472 | Bacteria | 3810 |
| 897 | Ga0495686_0693037 | 3300047472 | Bacteria | 520 |
| 898 | Ga0495593_0021586 | 3300047673 | Bacteria | 3593 |
| 899 | Ga0495593_0133176 | 3300047673 | Bacteria | 1261 |
| 900 | Ga0495593_0522266 | 3300047673 | Bacteria | 595 |
| 901 | Ga0495614_0032035 | 3300048089 | Bacteria | 2263 |
| 902 | Ga0495615_0137137 | 3300048090 | Bacteria | 719 |
| 903 | Ga0496100_0131977 | 3300048903 | Bacteria | 1760 |
| 904 | Ga0496100_0506484 | 3300048903 | Bacteria | 931 |
| 905 | Ga0496100_1029391 | 3300048903 | Bacteria | 648 |
| 906 | Ga0496100_1096012 | 3300048903 | Bacteria | 627 |
| 907 | Ga0496101_0002052 | 3300048904 | Bacteria | 12255 |
| 908 | Ga0496101_0177563 | 3300048904 | Bacteria | 1639 |
| 909 | Ga0496101_0590416 | 3300048904 | Bacteria | 878 |
| 910 | Ga0496101_0601141 | 3300048904 | Bacteria | 869 |
| 911 | Ga0496102_0001771 | 3300048905 | Bacteria | 18745 |
| 912 | Ga0496102_0028325 | 3300048905 | Bacteria | 5002 |
| 913 | Ga0496102_0228574 | 3300048905 | Bacteria | 1754 |
| 914 | Ga0496102_0789710 | 3300048905 | Bacteria | 872 |
| 915 | Ga0496102_1180376 | 3300048905 | Bacteria | 685 |
| 916 | Ga0496102_1421870 | 3300048905 | Bacteria | 613 |
| 917 | Ga0496103_0005699 | 3300048906 | Bacteria | 7445 |
| 918 | Ga0496103_0103765 | 3300048906 | Bacteria | 1801 |
| 919 | Ga0496103_0345511 | 3300048906 | Bacteria | 957 |
| 920 | Ga0496104_0074499 | 3300048907 | Bacteria | 3231 |
| 921 | Ga0496105_0042375 | 3300048908 | Bacteria | 3752 |
| 922 | Ga0496105_0085872 | 3300048908 | Bacteria | 2600 |
| 923 | Ga0496106_0002858 | 3300048909 | Bacteria | 12824 |
| 924 | Ga0496106_0009997 | 3300048909 | Bacteria | 7007 |
| 925 | Ga0496106_0041953 | 3300048909 | Bacteria | 3430 |
| 926 | Ga0496107_0002387 | 3300048910 | Bacteria | 12152 |
| 927 | Ga0496107_0009519 | 3300048910 | Bacteria | 6741 |
| 928 | Ga0496107_0051319 | 3300048910 | Bacteria | 2975 |
| 929 | Ga0496107_0713590 | 3300048910 | Bacteria | 737 |
| 930 | Ga0496108_0016020 | 3300048911 | Bacteria | 6111 |
| 931 | Ga0496108_0524321 | 3300048911 | Bacteria | 1034 |
| 932 | Ga0496108_0735223 | 3300048911 | Bacteria | 854 |
| 933 | Ga0496108_0781677 | 3300048911 | Bacteria | 824 |
| 934 | Ga0496109_0007060 | 3300048912 | Bacteria | 9476 |
| 935 | Ga0496109_0197825 | 3300048912 | Bacteria | 1890 |
| 936 | Ga0496109_0971871 | 3300048912 | Bacteria | 787 |
| 937 | Ga0496110_0004493 | 3300048913 | Bacteria | 10817 |
| 938 | Ga0496110_0015025 | 3300048913 | Bacteria | 6438 |
| 939 | Ga0496110_0119761 | 3300048913 | Bacteria | 2371 |
| 940 | Ga0496110_0153298 | 3300048913 | Bacteria | 2087 |
| 941 | Ga0496110_0188337 | 3300048913 | Bacteria | 1874 |
| 942 | Ga0496110_0291341 | 3300048913 | Bacteria | 1487 |
| 943 | Ga0496110_0608064 | 3300048913 | Bacteria | 991 |
| 944 | Ga0496111_0117480 | 3300048914 | Bacteria | 1962 |
| 945 | Ga0496111_0459520 | 3300048914 | Bacteria | 939 |
| 946 | Ga0496112_0000017 | 3300048915 | Bacteria | 191284 |
| 947 | Ga0496112_0013582 | 3300048915 | Bacteria | 7524 |
| 948 | Ga0496112_0105142 | 3300048915 | Bacteria | 2793 |
| 949 | Ga0496112_0157337 | 3300048915 | Bacteria | 2239 |
| 950 | Ga0496112_0172126 | 3300048915 | Bacteria | 2130 |
| 951 | Ga0496112_0423891 | 3300048915 | Bacteria | 1269 |
| 952 | Ga0496113_0031143 | 3300048916 | Bacteria | 3868 |
| 953 | Ga0496113_0048870 | 3300048916 | Bacteria | 3148 |
| 954 | Ga0496114_0011547 | 3300048917 | Bacteria | 7058 |
| 955 | Ga0496114_0062101 | 3300048917 | Bacteria | 3126 |
| 956 | Ga0496114_0254127 | 3300048917 | Bacteria | 1547 |
| 957 | Ga0496115_0000535 | 3300048918 | Bacteria | 29580 |
| 958 | Ga0496115_0492551 | 3300048918 | Bacteria | 986 |
| 959 | Ga0496115_1352674 | 3300048918 | Bacteria | 528 |
| 960 | Ga0496117_0129636 | 3300048920 | Bacteria | 1531 |
| 961 | Ga0496117_0608009 | 3300048920 | Bacteria | 510 |
| 962 | Ga0496118_0003407 | 3300048921 | Bacteria | 20095 |
| 963 | Ga0496119_0269894 | 3300048922 | Bacteria | 850 |
| 964 | Ga0496119_0291385 | 3300048922 | Bacteria | 808 |
| 965 | Ga0496121_0045020 | 3300048924 | Bacteria | 3798 |
| 966 | Ga0496121_0054677 | 3300048924 | Bacteria | 3333 |
| 967 | Ga0496121_0129108 | 3300048924 | Bacteria | 1895 |
| 968 | Ga0496121_0224635 | 3300048924 | Bacteria | 1320 |
| 969 | Ga0496121_0291596 | 3300048924 | Bacteria | 1111 |
| 970 | Ga0496121_0322012 | 3300048924 | Bacteria | 1040 |
| 971 | Ga0496121_0327432 | 3300048924 | Bacteria | 1029 |
| 972 | Ga0496121_0578250 | 3300048924 | Bacteria | 697 |
| 973 | Ga0496124_0026548 | 3300048927 | Bacteria | 5219 |
| 974 | Ga0496124_0178729 | 3300048927 | Bacteria | 1635 |
| 975 | Ga0496124_0273454 | 3300048927 | Bacteria | 1236 |
| 976 | Ga0496124_0404719 | 3300048927 | Bacteria | 946 |
| 977 | Ga0496125_0051831 | 3300048928 | Bacteria | 3380 |
| 978 | Ga0496125_0265018 | 3300048928 | Bacteria | 1074 |
| 979 | Ga0496125_0303374 | 3300048928 | Bacteria | 977 |
| 980 | Ga0496126_0002483 | 3300048929 | Bacteria | 24817 |
| 981 | Ga0496126_0092604 | 3300048929 | Bacteria | 2655 |
| 982 | Ga0496126_0149771 | 3300048929 | Bacteria | 2001 |
| 983 | Ga0496126_0176947 | 3300048929 | Bacteria | 1814 |
| 984 | Ga0496126_0212828 | 3300048929 | Bacteria | 1626 |
| 985 | Ga0496126_0407184 | 3300048929 | Bacteria | 1102 |
| 986 | Ga0496126_0494497 | 3300048929 | Bacteria | 978 |
| 987 | Ga0496126_0572690 | 3300048929 | Bacteria | 893 |
| 988 | Ga0496126_0645808 | 3300048929 | Bacteria | 828 |
| 989 | Ga0496126_0758943 | 3300048929 | Bacteria | 748 |
| 990 | Ga0495678_115396 | 3300049459 | Bacteria | 910 |
| 991 | Ga0501031_0008184 | 3300049568 | Bacteria | 6805 |
| 992 | Ga0501032_0000704 | 3300049569 | Bacteria | 27243 |
| 993 | Ga0501033_0000311 | 3300049570 | Bacteria | 46039 |
| 994 | Ga0501034_0000039 | 3300049571 | Bacteria | 237357 |
| 995 | Ga0501036_0000127 | 3300049572 | Bacteria | 48559 |
| 996 | Ga0501037_0000025 | 3300049573 | Bacteria | 143276 |
| 997 | Ga0501038_0000342 | 3300049574 | Bacteria | 40148 |
| 998 | Ga0501039_0000840 | 3300049575 | Bacteria | 22181 |
| 999 | Ga0501042_0026448 | 3300049578 | Bacteria | 4078 |
| 1000 | Ga0501043_0000120 | 3300049579 | Bacteria | 72670 |
| 1001 | Ga0501046_0000359 | 3300049580 | Bacteria | 45929 |
| 1002 | Ga0501046_0048465 | 3300049580 | Bacteria | 3364 |
| 1003 | Ga0501047_0000379 | 3300049581 | Bacteria | 50147 |
| 1004 | Ga0501047_0084770 | 3300049581 | Bacteria | 3045 |
| 1005 | Ga0501047_1343705 | 3300049581 | Bacteria | 529 |
| 1006 | Ga0501048_0000352 | 3300049582 | Bacteria | 31854 |
| 1007 | Ga0501067_0000025 | 3300049583 | Bacteria | 91481 |
| 1008 | Ga0501068_0001230 | 3300049584 | Bacteria | 13601 |
| 1009 | Ga0501069_0007011 | 3300049585 | Bacteria | 5899 |
| 1010 | Ga0501069_0175721 | 3300049585 | Bacteria | 1237 |
| 1011 | Ga0501070_0002185 | 3300049586 | Bacteria | 17207 |
| 1012 | Ga0501070_0042781 | 3300049586 | Bacteria | 3772 |
| 1013 | Ga0501071_0244492 | 3300049587 | Bacteria | 1353 |
| 1014 | Ga0501072_0002767 | 3300049588 | Bacteria | 13186 |
| 1015 | Ga0501072_0624932 | 3300049588 | Bacteria | 849 |
| 1016 | Ga0501073_0000091 | 3300049589 | Bacteria | 57029 |
| 1017 | Ga0501073_0258618 | 3300049589 | Bacteria | 1201 |
| 1018 | Ga0501074_0000489 | 3300049590 | Bacteria | 24170 |
| 1019 | Ga0501074_0025368 | 3300049590 | Bacteria | 4305 |
| 1020 | Ga0501076_0228198 | 3300049592 | Bacteria | 1522 |
| 1021 | Ga0501076_0842771 | 3300049592 | Bacteria | 756 |
| 1022 | Ga0501079_0006818 | 3300049741 | Bacteria | 8597 |
| 1023 | Ga0501080_0000321 | 3300049742 | Bacteria | 36637 |
| 1024 | Ga0501080_0026275 | 3300049742 | Bacteria | 5410 |
| 1025 | Ga0501083_0000284 | 3300049744 | Bacteria | 32169 |
| 1026 | Ga0501035_0001251 | 3300049822 | Bacteria | 26410 |
| 1027 | Ga0501035_0423288 | 3300049822 | Bacteria | 1105 |
| 1028 | Ga0501044_0000274 | 3300049823 | Bacteria | 65668 |
| 1029 | Ga0501044_0144750 | 3300049823 | Bacteria | 2363 |
| 1030 | Ga0501045_0005330 | 3300049824 | Bacteria | 8907 |
| 1031 | nmdc:mga03683_309151_c1 | 3300050489 | Bacteria | 742 |
| 1032 | nmdc:mga03n38_341479_c1 | 3300050490 | Bacteria | 813 |
| 1033 | nmdc:mga00v17_465059_c1 | 3300050491 | Bacteria | 821 |
| 1034 | nmdc:mga00v17_888245_c1 | 3300050491 | Bacteria | 565 |
| 1035 | nmdc:mga0yw44_535895_c1 | 3300050492 | Bacteria | 795 |
| 1036 | nmdc:mga0yw44_706686_c1 | 3300050492 | Bacteria | 685 |
| 1037 | nmdc:mga0yw44_90407_c1 | 3300050492 | Bacteria | 1934 |
| 1038 | nmdc:mga0k408_240358_c1 | 3300050493 | Bacteria | 1081 |
| 1039 | nmdc:mga0k408_97231_c1 | 3300050493 | Bacteria | 1734 |
| 1040 | nmdc:mga06z11_103107_c1 | 3300050494 | Bacteria | 1568 |
| 1041 | nmdc:mga06z11_207023_c1 | 3300050494 | Bacteria | 1142 |
| 1042 | nmdc:mga0qj67_501630_c1 | 3300050509 | Bacteria | 975 |
| 1043 | nmdc:mga08y16_916868_c1 | 3300050511 | Bacteria | 861 |
| 1044 | nmdc:mga0n895_1812074_c1 | 3300050512 | Bacteria | 571 |
| 1045 | nmdc:mga0n895_382114_c1 | 3300050512 | Bacteria | 1425 |
| 1046 | nmdc:mga0rr50_866533_c1 | 3300050513 | Bacteria | 770 |
| 1047 | nmdc:mga0a205_622660_c1 | 3300050515 | Bacteria | 931 |
| 1048 | nmdc:mga0sz30_308756_c1 | 3300050516 | Bacteria | 705 |
| 1049 | nmdc:mga0sz30_78446_c1 | 3300050516 | Bacteria | 1126 |
| 1050 | Ga0495601_0078465 | 3300053077 | Bacteria | 2116 |
| 1051 | Ga0495601_0146773 | 3300053077 | Bacteria | 1540 |
| 1052 | Ga0495601_0252734 | 3300053077 | Bacteria | 1151 |
| 1053 | Ga0495601_0324068 | 3300053077 | Bacteria | 1003 |
| 1054 | Ga0495612_0056240 | 3300053078 | Bacteria | 1623 |
| 1055 | Ga0495612_0175279 | 3300053078 | Bacteria | 940 |
| 1056 | Ga0495612_0240040 | 3300053078 | Bacteria | 805 |
| 1057 | Ga0495612_0332974 | 3300053078 | Bacteria | 684 |
| 1058 | Ga0495655_0068994 | 3300053083 | Bacteria | 984 |
| 1059 | Ga0495655_0092691 | 3300053083 | Bacteria | 883 |
| 1060 | Ga0495595_0026236 | 3300053084 | Bacteria | 2588 |
| 1061 | Ga0495619_0209249 | 3300053085 | Bacteria | 1351 |
| 1062 | Ga0495619_0246095 | 3300053085 | Bacteria | 1239 |
| 1063 | Ga0500643_051619 | 3300053087 | Bacteria | 1174 |
| 1064 | Ga0500646_0022529 | 3300053090 | Bacteria | 1685 |
| 1065 | Ga0500646_0071361 | 3300053090 | Bacteria | 1042 |
| 1066 | Ga0500583_0072009 | 3300053092 | Bacteria | 1654 |
| 1067 | Ga0500583_0333398 | 3300053092 | Bacteria | 738 |
| 1068 | Ga0500651_0670507 | 3300053093 | Bacteria | 557 |
| 1069 | Ga0500566_0000158 | 3300053094 | Bacteria | 34495 |
| 1070 | Ga0500566_0078847 | 3300053094 | Bacteria | 1837 |
| 1071 | Ga0500566_0201394 | 3300053094 | Bacteria | 1005 |
| 1072 | Ga0500640_000568 | 3300053095 | Bacteria | 9480 |
| 1073 | Ga0500641_0008502 | 3300053096 | Bacteria | 3666 |
| 1074 | Ga0500648_057745 | 3300053097 | Bacteria | 2201 |
| 1075 | Ga0500650_0224827 | 3300053098 | Bacteria | 848 |
| 1076 | Ga0500554_007059 | 3300053102 | Bacteria | 2562 |
| 1077 | Ga0500562_063291 | 3300053108 | Bacteria | 995 |
| 1078 | Ga0500569_215176 | 3300053109 | Bacteria | 653 |
| 1079 | Ga0500569_306904 | 3300053109 | Bacteria | 533 |
| 1080 | Ga0500572_000024 | 3300053111 | Bacteria | 47391 |
| 1081 | Ga0500591_078328 | 3300053115 | Bacteria | 1477 |
| 1082 | Ga0500594_0098002 | 3300053118 | Bacteria | 899 |
| 1083 | Ga0500595_001188 | 3300053119 | Bacteria | 14372 |
| 1084 | Ga0500608_001300 | 3300053122 | Bacteria | 8888 |
| 1085 | Ga0500614_001812 | 3300053123 | Bacteria | 4949 |
| 1086 | Ga0500642_0270682 | 3300053130 | Bacteria | 775 |
| 1087 | Ga0500658_0175660 | 3300053134 | Bacteria | 974 |
| 1088 | Ga0500658_0382952 | 3300053134 | Bacteria | 644 |
| 1089 | Ga0500559_0003877 | 3300053136 | Bacteria | 7232 |
| 1090 | Ga0500559_0178998 | 3300053136 | Bacteria | 998 |
| 1091 | Ga0500561_0145643 | 3300053137 | Bacteria | 735 |
| 1092 | Ga0500568_0060565 | 3300053139 | Bacteria | 1466 |
| 1093 | Ga0500573_0032643 | 3300053140 | Bacteria | 3003 |
| 1094 | Ga0500577_0139481 | 3300053142 | Bacteria | 1022 |
| 1095 | Ga0500579_188848 | 3300053143 | Bacteria | 791 |
| 1096 | Ga0500588_0401468 | 3300053146 | Bacteria | 522 |
| 1097 | Ga0500589_025035 | 3300053147 | Bacteria | 2761 |
| 1098 | Ga0500589_313473 | 3300053147 | Bacteria | 550 |
| 1099 | Ga0500590_122838 | 3300053148 | Bacteria | 1214 |
| 1100 | Ga0500590_146250 | 3300053148 | Bacteria | 1073 |
| 1101 | Ga0500603_000465 | 3300053150 | Bacteria | 10412 |
| 1102 | Ga0500603_000801 | 3300053150 | Bacteria | 7516 |
| 1103 | Ga0500603_048017 | 3300053150 | Bacteria | 1160 |
| 1104 | Ga0500603_242973 | 3300053150 | Bacteria | 578 |
| 1105 | Ga0500622_0382782 | 3300053156 | Bacteria | 575 |
| 1106 | Ga0500627_0357681 | 3300053158 | Bacteria | 629 |
| 1107 | Ga0500630_000112 | 3300053159 | Bacteria | 26672 |
| 1108 | Ga0500634_0081721 | 3300053161 | Bacteria | 1663 |
| 1109 | Ga0500638_012135 | 3300053162 | Bacteria | 3851 |
| 1110 | Ga0500638_197823 | 3300053162 | Bacteria | 853 |
| 1111 | Ga0500639_000040 | 3300053163 | Bacteria | 63516 |
| 1112 | Ga0500636_0086872 | 3300053177 | Bacteria | 1795 |
| 1113 | Ga0500636_0184124 | 3300053177 | Bacteria | 1118 |
| 1114 | Ga0500637_0039960 | 3300053178 | Bacteria | 2647 |
| 1115 | Ga0500637_0108912 | 3300053178 | Bacteria | 1606 |
| 1116 | Ga0500609_015774 | 3300053731 | Bacteria | 1024 |
| 1117 | Ga0500596_000794 | 3300053735 | Bacteria | 6229 |
| 1118 | Ga0500596_005461 | 3300053735 | Bacteria | 2233 |
| 1119 | Ga0501084_0007045 | 3300054114 | Bacteria | 9269 |
| 1120 | Ga0587076_056219 | 3300059645 | Bacteria | 781 |
| 1121 | Ga0501082_0026885 | 3300060353 | Bacteria | 4957 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013297 | Ga0157378_11541203 | Ga0157378_115412031 | 117 |
| 2 | 3300005334 | Ga0068869_101378147 | Ga0068869_1013781471 | 127 |
| 3 | 3300037471 | Ga0395905_0996464 | Ga0395905_0996464_263_646 | 127 |
| 4 | 3300048924 | Ga0496121_0054677 | Ga0496121_0054677_1857_2240 | 127 |
| 5 | iso_pu_bacteria | 2508501128 | 2509149319 | 128 |
| 6 | iso_pu_bacteria | 2513237096 | 2513654070 | 128 |
| 7 | iso_pu_bacteria | 2513237141 | 2513891271 | 128 |
| 8 | iso_pu_bacteria | 2513237145 | 2513918410 | 128 |
| 9 | iso_pu_bacteria | 2517572143 | 2517891356 | 128 |
| 10 | iso_pu_bacteria | 2667528175 | 2671118864 | 128 |
| 11 | iso_pu_bacteria | 2728368998 | 2728750068 | 128 |
| 12 | iso_pu_bacteria | 2791355197 | 2793066724 | 128 |
| 13 | iso_pu_bacteria | 2791355199 | 2793080652 | 128 |
| 14 | iso_pu_bacteria | 2876808645 | 2876814617 | 128 |
| 15 | iso_pu_bacteria | 2879110137 | 2879114698 | 128 |
| 16 | iso_pu_bacteria | 2885374607 | 2885374989 | 128 |
| 17 | iso_pu_bacteria | 2889033259 | 2889038035 | 128 |
| 18 | iso_pu_bacteria | 2903748898 | 2903755317 | 128 |
| 19 | iso_pu_bacteria | 2904690495 | 2904691224 | 128 |
| 20 | iso_pu_bacteria | 2904699407 | 2904701310 | 128 |
| 21 | iso_pu_bacteria | 2906610324 | 2906616542 | 128 |
| 22 | iso_pu_bacteria | 2908739725 | 2908741710 | 128 |
| 23 | iso_pu_bacteria | 2908756301 | 2908759135 | 128 |
| 24 | iso_pu_bacteria | 2922386360 | 2922387369 | 128 |
| 25 | iso_pu_bacteria | 2922425934 | 2922431438 | 128 |
| 26 | iso_pu_bacteria | 2935630451 | 2935634034 | 128 |
| 27 | iso_pu_bacteria | 2941507105 | 2941510663 | 128 |
| 28 | iso_pu_bacteria | 2941515067 | 2941518047 | 128 |
| 29 | iso_pu_bacteria | 2941523033 | 2941527082 | 128 |
| 30 | iso_pu_bacteria | 3005474847 | 3005481231 | 128 |
| 31 | iso_pu_bacteria | 8006933436 | 8006939478 | 128 |
| 32 | iso_pu_bacteria | 8006964411 | 8006972136 | 128 |
| 33 | iso_pu_bacteria | 8006973647 | 8006979228 | 128 |
| 34 | iso_pu_bacteria | 8006984368 | 8006984409 | 128 |
| 35 | iso_pu_bacteria | 8019555841 | 8019565358 | 128 |
| 36 | iso_pu_bacteria | 8019565922 | 8019575456 | 128 |
| 37 | iso_pu_bacteria | 8056673599 | 8056681087 | 128 |
| 38 | 3300005536 | Ga0070697_100328239 | Ga0070697_1003282392 | 129 |
| 39 | 3300006173 | Ga0070716_101690869 | Ga0070716_1016908691 | 129 |
| 40 | 3300006048 | Ga0075363_100352030 | Ga0075363_1003520302 | 130 |
| 41 | 3300028794 | Ga0307515_10006012 | Ga0307515_1000601215 | 130 |
| 42 | 3300050516 | nmdc:mga0sz30_78446_c1 | nmdc:mga0sz30_78446_c1_264_656 | 130 |
| 43 | 3300028379 | Ga0268266_11270396 | Ga0268266_112703962 | 131 |
| 44 | 3300039450 | Ga0436363_0130820 | Ga0436363_0130820_94_489 | 131 |
| 45 | 3300053078 | Ga0495612_0332974 | Ga0495612_0332974_64_459 | 131 |
| 46 | 3300003203 | JGI25406J46586_10009343 | JGI25406J46586_100093433 | 132 |
| 47 | 3300003214 | JGI25165J46597_1011939 | JGI25165J46597_10119391 | 132 |
| 48 | 3300003215 | JGI25153J46596_10051467 | JGI25153J46596_100514672 | 132 |
| 49 | 3300003659 | JGI25404J52841_10003019 | JGI25404J52841_100030192 | 132 |
| 50 | 3300003659 | JGI25404J52841_10010753 | JGI25404J52841_100107532 | 132 |
| 51 | 3300003659 | JGI25404J52841_10016744 | JGI25404J52841_100167442 | 132 |
| 52 | 3300003659 | JGI25404J52841_10041444 | JGI25404J52841_100414442 | 132 |
| 53 | 3300005327 | Ga0070658_10150878 | Ga0070658_101508782 | 132 |
| 54 | 3300005327 | Ga0070658_10362781 | Ga0070658_103627812 | 132 |
| 55 | 3300005328 | Ga0070676_10668089 | Ga0070676_106680892 | 132 |
| 56 | 3300005329 | Ga0070683_100095571 | Ga0070683_1000955712 | 132 |
| 57 | 3300005329 | Ga0070683_100306288 | Ga0070683_1003062882 | 132 |
| 58 | 3300005329 | Ga0070683_101207674 | Ga0070683_1012076741 | 132 |
| 59 | 3300005329 | Ga0070683_101249715 | Ga0070683_1012497152 | 132 |
| 60 | 3300005334 | Ga0068869_100283829 | Ga0068869_1002838292 | 132 |
| 61 | 3300005334 | Ga0068869_100411856 | Ga0068869_1004118562 | 132 |
| 62 | 3300005336 | Ga0070680_100052018 | Ga0070680_1000520184 | 132 |
| 63 | 3300005336 | Ga0070680_100194884 | Ga0070680_1001948842 | 132 |
| 64 | 3300005336 | Ga0070680_100676728 | Ga0070680_1006767281 | 132 |
| 65 | 3300005337 | Ga0070682_100039753 | Ga0070682_1000397534 | 132 |
| 66 | 3300005337 | Ga0070682_100175885 | Ga0070682_1001758852 | 132 |
| 67 | 3300005337 | Ga0070682_100246809 | Ga0070682_1002468092 | 132 |
| 68 | 3300005337 | Ga0070682_100503776 | Ga0070682_1005037762 | 132 |
| 69 | 3300005338 | Ga0068868_100034182 | Ga0068868_1000341822 | 132 |
| 70 | 3300005338 | Ga0068868_100389483 | Ga0068868_1003894832 | 132 |
| 71 | 3300005338 | Ga0068868_100548398 | Ga0068868_1005483982 | 132 |
| 72 | 3300005338 | Ga0068868_100560813 | Ga0068868_1005608131 | 132 |
| 73 | 3300005339 | Ga0070660_100051646 | Ga0070660_1000516462 | 132 |
| 74 | 3300005343 | Ga0070687_100299556 | Ga0070687_1002995562 | 132 |
| 75 | 3300005344 | Ga0070661_100328466 | Ga0070661_1003284662 | 132 |
| 76 | 3300005344 | Ga0070661_100395995 | Ga0070661_1003959952 | 132 |
| 77 | 3300005344 | Ga0070661_100556992 | Ga0070661_1005569922 | 132 |
| 78 | 3300005345 | Ga0070692_10391666 | Ga0070692_103916662 | 132 |
| 79 | 3300005347 | Ga0070668_100044248 | Ga0070668_1000442484 | 132 |
| 80 | 3300005347 | Ga0070668_100074675 | Ga0070668_1000746754 | 132 |
| 81 | 3300005347 | Ga0070668_100207755 | Ga0070668_1002077552 | 132 |
| 82 | 3300005347 | Ga0070668_100301249 | Ga0070668_1003012492 | 132 |
| 83 | 3300005347 | Ga0070668_100481665 | Ga0070668_1004816652 | 132 |
| 84 | 3300005347 | Ga0070668_100724073 | Ga0070668_1007240732 | 132 |
| 85 | 3300005353 | Ga0070669_100068986 | Ga0070669_1000689862 | 132 |
| 86 | 3300005355 | Ga0070671_100342350 | Ga0070671_1003423502 | 132 |
| 87 | 3300005355 | Ga0070671_100383792 | Ga0070671_1003837922 | 132 |
| 88 | 3300005355 | Ga0070671_100708452 | Ga0070671_1007084522 | 132 |
| 89 | 3300005356 | Ga0070674_100034692 | Ga0070674_1000346924 | 132 |
| 90 | 3300005365 | Ga0070688_100855168 | Ga0070688_1008551681 | 132 |
| 91 | 3300005366 | Ga0070659_100053918 | Ga0070659_1000539181 | 132 |
| 92 | 3300005367 | Ga0070667_100236881 | Ga0070667_1002368811 | 132 |
| 93 | 3300005367 | Ga0070667_100569881 | Ga0070667_1005698811 | 132 |
| 94 | 3300005367 | Ga0070667_100623283 | Ga0070667_1006232832 | 132 |
| 95 | 3300005367 | Ga0070667_100797903 | Ga0070667_1007979032 | 132 |
| 96 | 3300005434 | Ga0070709_10004227 | Ga0070709_100042277 | 132 |
| 97 | 3300005434 | Ga0070709_10048345 | Ga0070709_100483453 | 132 |
| 98 | 3300005434 | Ga0070709_10311929 | Ga0070709_103119291 | 132 |
| 99 | 3300005435 | Ga0070714_100082971 | Ga0070714_1000829712 | 132 |
| 100 | 3300005435 | Ga0070714_100280905 | Ga0070714_1002809052 | 132 |
| 101 | 3300005435 | Ga0070714_100541466 | Ga0070714_1005414662 | 132 |
| 102 | 3300005435 | Ga0070714_100551108 | Ga0070714_1005511082 | 132 |
| 103 | 3300005436 | Ga0070713_100042275 | Ga0070713_1000422754 | 132 |
| 104 | 3300005436 | Ga0070713_100088760 | Ga0070713_1000887602 | 132 |
| 105 | 3300005436 | Ga0070713_100353933 | Ga0070713_1003539331 | 132 |
| 106 | 3300005436 | Ga0070713_100363813 | Ga0070713_1003638132 | 132 |
| 107 | 3300005437 | Ga0070710_10042080 | Ga0070710_100420803 | 132 |
| 108 | 3300005437 | Ga0070710_10179435 | Ga0070710_101794352 | 132 |
| 109 | 3300005439 | Ga0070711_100001730 | Ga0070711_1000017307 | 132 |
| 110 | 3300005439 | Ga0070711_100011938 | Ga0070711_1000119382 | 132 |
| 111 | 3300005439 | Ga0070711_100061879 | Ga0070711_1000618794 | 132 |
| 112 | 3300005439 | Ga0070711_100131145 | Ga0070711_1001311452 | 132 |
| 113 | 3300005439 | Ga0070711_100692074 | Ga0070711_1006920741 | 132 |
| 114 | 3300005440 | Ga0070705_100619464 | Ga0070705_1006194642 | 132 |
| 115 | 3300005441 | Ga0070700_100046080 | Ga0070700_1000460802 | 132 |
| 116 | 3300005441 | Ga0070700_100755597 | Ga0070700_1007555972 | 132 |
| 117 | 3300005444 | Ga0070694_100787580 | Ga0070694_1007875802 | 132 |
| 118 | 3300005455 | Ga0070663_100010941 | Ga0070663_1000109412 | 132 |
| 119 | 3300005455 | Ga0070663_100050917 | Ga0070663_1000509172 | 132 |
| 120 | 3300005455 | Ga0070663_100068772 | Ga0070663_1000687723 | 132 |
| 121 | 3300005455 | Ga0070663_100185086 | Ga0070663_1001850862 | 132 |
| 122 | 3300005455 | Ga0070663_100891518 | Ga0070663_1008915181 | 132 |
| 123 | 3300005456 | Ga0070678_100010095 | Ga0070678_1000100956 | 132 |
| 124 | 3300005456 | Ga0070678_100529455 | Ga0070678_1005294552 | 132 |
| 125 | 3300005456 | Ga0070678_100647096 | Ga0070678_1006470962 | 132 |
| 126 | 3300005456 | Ga0070678_100700015 | Ga0070678_1007000151 | 132 |
| 127 | 3300005457 | Ga0070662_100031971 | Ga0070662_1000319713 | 132 |
| 128 | 3300005457 | Ga0070662_100088266 | Ga0070662_1000882662 | 132 |
| 129 | 3300005457 | Ga0070662_100457978 | Ga0070662_1004579781 | 132 |
| 130 | 3300005457 | Ga0070662_100709265 | Ga0070662_1007092652 | 132 |
| 131 | 3300005458 | Ga0070681_10003273 | Ga0070681_1000327314 | 132 |
| 132 | 3300005458 | Ga0070681_10025087 | Ga0070681_100250874 | 132 |
| 133 | 3300005458 | Ga0070681_10056849 | Ga0070681_100568494 | 132 |
| 134 | 3300005458 | Ga0070681_10065024 | Ga0070681_100650244 | 132 |
| 135 | 3300005458 | Ga0070681_10341341 | Ga0070681_103413412 | 132 |
| 136 | 3300005459 | Ga0068867_100250304 | Ga0068867_1002503042 | 132 |
| 137 | 3300005459 | Ga0068867_100424557 | Ga0068867_1004245572 | 132 |
| 138 | 3300005466 | Ga0070685_10729585 | Ga0070685_107295852 | 132 |
| 139 | 3300005466 | Ga0070685_10756908 | Ga0070685_107569082 | 132 |
| 140 | 3300005466 | Ga0070685_10911377 | Ga0070685_109113771 | 132 |
| 141 | 3300005471 | Ga0070698_100536537 | Ga0070698_1005365372 | 132 |
| 142 | 3300005471 | Ga0070698_101485996 | Ga0070698_1014859961 | 132 |
| 143 | 3300005518 | Ga0070699_101178226 | Ga0070699_1011782262 | 132 |
| 144 | 3300005530 | Ga0070679_100009864 | Ga0070679_1000098647 | 132 |
| 145 | 3300005530 | Ga0070679_100017482 | Ga0070679_1000174825 | 132 |
| 146 | 3300005530 | Ga0070679_100017715 | Ga0070679_1000177155 | 132 |
| 147 | 3300005530 | Ga0070679_100036722 | Ga0070679_1000367223 | 132 |
| 148 | 3300005530 | Ga0070679_100303056 | Ga0070679_1003030561 | 132 |
| 149 | 3300005530 | Ga0070679_100865639 | Ga0070679_1008656391 | 132 |
| 150 | 3300005535 | Ga0070684_100013567 | Ga0070684_1000135674 | 132 |
| 151 | 3300005535 | Ga0070684_100231212 | Ga0070684_1002312122 | 132 |
| 152 | 3300005535 | Ga0070684_100338695 | Ga0070684_1003386952 | 132 |
| 153 | 3300005535 | Ga0070684_100481400 | Ga0070684_1004814002 | 132 |
| 154 | 3300005536 | Ga0070697_100350906 | Ga0070697_1003509062 | 132 |
| 155 | 3300005539 | Ga0068853_100040363 | Ga0068853_1000403633 | 132 |
| 156 | 3300005539 | Ga0068853_100130357 | Ga0068853_1001303571 | 132 |
| 157 | 3300005539 | Ga0068853_100286863 | Ga0068853_1002868632 | 132 |
| 158 | 3300005539 | Ga0068853_100372296 | Ga0068853_1003722962 | 132 |
| 159 | 3300005539 | Ga0068853_100411221 | Ga0068853_1004112212 | 132 |
| 160 | 3300005543 | Ga0070672_100191116 | Ga0070672_1001911162 | 132 |
| 161 | 3300005543 | Ga0070672_100191311 | Ga0070672_1001913112 | 132 |
| 162 | 3300005543 | Ga0070672_100431858 | Ga0070672_1004318582 | 132 |
| 163 | 3300005543 | Ga0070672_100895577 | Ga0070672_1008955772 | 132 |
| 164 | 3300005544 | Ga0070686_100740264 | Ga0070686_1007402641 | 132 |
| 165 | 3300005545 | Ga0070695_100764136 | Ga0070695_1007641362 | 132 |
| 166 | 3300005546 | Ga0070696_100760250 | Ga0070696_1007602501 | 132 |
| 167 | 3300005547 | Ga0070693_101383201 | Ga0070693_1013832011 | 132 |
| 168 | 3300005548 | Ga0070665_100189047 | Ga0070665_1001890472 | 132 |
| 169 | 3300005548 | Ga0070665_100336297 | Ga0070665_1003362972 | 132 |
| 170 | 3300005548 | Ga0070665_100357790 | Ga0070665_1003577902 | 132 |
| 171 | 3300005548 | Ga0070665_101089130 | Ga0070665_1010891301 | 132 |
| 172 | 3300005548 | Ga0070665_101216753 | Ga0070665_1012167532 | 132 |
| 173 | 3300005548 | Ga0070665_101665143 | Ga0070665_1016651432 | 132 |
| 174 | 3300005549 | Ga0070704_100517830 | Ga0070704_1005178302 | 132 |
| 175 | 3300005563 | Ga0068855_100010865 | Ga0068855_1000108653 | 132 |
| 176 | 3300005563 | Ga0068855_100067952 | Ga0068855_1000679524 | 132 |
| 177 | 3300005563 | Ga0068855_100116881 | Ga0068855_1001168814 | 132 |
| 178 | 3300005563 | Ga0068855_100142865 | Ga0068855_1001428654 | 132 |
| 179 | 3300005564 | Ga0070664_100089985 | Ga0070664_1000899853 | 132 |
| 180 | 3300005564 | Ga0070664_100363338 | Ga0070664_1003633382 | 132 |
| 181 | 3300005577 | Ga0068857_100016047 | Ga0068857_1000160475 | 132 |
| 182 | 3300005577 | Ga0068857_100106311 | Ga0068857_1001063114 | 132 |
| 183 | 3300005577 | Ga0068857_101483817 | Ga0068857_1014838172 | 132 |
| 184 | 3300005577 | Ga0068857_101752540 | Ga0068857_1017525401 | 132 |
| 185 | 3300005577 | Ga0068857_101803285 | Ga0068857_1018032852 | 132 |
| 186 | 3300005578 | Ga0068854_100316488 | Ga0068854_1003164881 | 132 |
| 187 | 3300005578 | Ga0068854_100587678 | Ga0068854_1005876782 | 132 |
| 188 | 3300005614 | Ga0068856_100731211 | Ga0068856_1007312112 | 132 |
| 189 | 3300005615 | Ga0070702_100130267 | Ga0070702_1001302672 | 132 |
| 190 | 3300005616 | Ga0068852_100036815 | Ga0068852_1000368153 | 132 |
| 191 | 3300005616 | Ga0068852_100249880 | Ga0068852_1002498803 | 132 |
| 192 | 3300005616 | Ga0068852_100254398 | Ga0068852_1002543983 | 132 |
| 193 | 3300005616 | Ga0068852_100477308 | Ga0068852_1004773082 | 132 |
| 194 | 3300005616 | Ga0068852_101247821 | Ga0068852_1012478212 | 132 |
| 195 | 3300005616 | Ga0068852_101867233 | Ga0068852_1018672332 | 132 |
| 196 | 3300005617 | Ga0068859_100463120 | Ga0068859_1004631202 | 132 |
| 197 | 3300005618 | Ga0068864_100494527 | Ga0068864_1004945272 | 132 |
| 198 | 3300005718 | Ga0068866_10021865 | Ga0068866_100218653 | 132 |
| 199 | 3300005718 | Ga0068866_10509547 | Ga0068866_105095472 | 132 |
| 200 | 3300005719 | Ga0068861_100410264 | Ga0068861_1004102642 | 132 |
| 201 | 3300005719 | Ga0068861_100816180 | Ga0068861_1008161801 | 132 |
| 202 | 3300005719 | Ga0068861_101639683 | Ga0068861_1016396832 | 132 |
| 203 | 3300005834 | Ga0068851_10004825 | Ga0068851_100048253 | 132 |
| 204 | 3300005840 | Ga0068870_10078252 | Ga0068870_100782523 | 132 |
| 205 | 3300005841 | Ga0068863_100655952 | Ga0068863_1006559522 | 132 |
| 206 | 3300005841 | Ga0068863_100744625 | Ga0068863_1007446252 | 132 |
| 207 | 3300005841 | Ga0068863_100911131 | Ga0068863_1009111312 | 132 |
| 208 | 3300005841 | Ga0068863_101044798 | Ga0068863_1010447982 | 132 |
| 209 | 3300005841 | Ga0068863_101352280 | Ga0068863_1013522801 | 132 |
| 210 | 3300005842 | Ga0068858_100046102 | Ga0068858_1000461022 | 132 |
| 211 | 3300005842 | Ga0068858_100074580 | Ga0068858_1000745802 | 132 |
| 212 | 3300005842 | Ga0068858_100917487 | Ga0068858_1009174872 | 132 |
| 213 | 3300005843 | Ga0068860_100331144 | Ga0068860_1003311442 | 132 |
| 214 | 3300005843 | Ga0068860_100352450 | Ga0068860_1003524502 | 132 |
| 215 | 3300005843 | Ga0068860_100462292 | Ga0068860_1004622922 | 132 |
| 216 | 3300005843 | Ga0068860_100483318 | Ga0068860_1004833182 | 132 |
| 217 | 3300005843 | Ga0068860_100499225 | Ga0068860_1004992252 | 132 |
| 218 | 3300005844 | Ga0068862_100129799 | Ga0068862_1001297992 | 132 |
| 219 | 3300005844 | Ga0068862_100302221 | Ga0068862_1003022212 | 132 |
| 220 | 3300005844 | Ga0068862_100414040 | Ga0068862_1004140402 | 132 |
| 221 | 3300005844 | Ga0068862_100515000 | Ga0068862_1005150002 | 132 |
| 222 | 3300005844 | Ga0068862_100669787 | Ga0068862_1006697871 | 132 |
| 223 | 3300005844 | Ga0068862_101682387 | Ga0068862_1016823872 | 132 |
| 224 | 3300005937 | Ga0081455_10009971 | Ga0081455_100099719 | 132 |
| 225 | 3300005937 | Ga0081455_10037550 | Ga0081455_100375502 | 132 |
| 226 | 3300005937 | Ga0081455_10087531 | Ga0081455_100875313 | 132 |
| 227 | 3300005937 | Ga0081455_10127583 | Ga0081455_101275832 | 132 |
| 228 | 3300005937 | Ga0081455_10150862 | Ga0081455_101508622 | 132 |
| 229 | 3300005983 | Ga0081540_1006422 | Ga0081540_10064225 | 132 |
| 230 | 3300005983 | Ga0081540_1009663 | Ga0081540_10096637 | 132 |
| 231 | 3300005983 | Ga0081540_1011844 | Ga0081540_10118445 | 132 |
| 232 | 3300005983 | Ga0081540_1012349 | Ga0081540_10123492 | 132 |
| 233 | 3300005983 | Ga0081540_1013491 | Ga0081540_10134915 | 132 |
| 234 | 3300005983 | Ga0081540_1014382 | Ga0081540_10143825 | 132 |
| 235 | 3300005983 | Ga0081540_1018818 | Ga0081540_10188183 | 132 |
| 236 | 3300005985 | Ga0081539_10000768 | Ga0081539_1000076841 | 132 |
| 237 | 3300005985 | Ga0081539_10001470 | Ga0081539_100014701 | 132 |
| 238 | 3300005985 | Ga0081539_10004445 | Ga0081539_100044453 | 132 |
| 239 | 3300005985 | Ga0081539_10058092 | Ga0081539_100580922 | 132 |
| 240 | 3300006028 | Ga0070717_10001267 | Ga0070717_100012673 | 132 |
| 241 | 3300006028 | Ga0070717_10017332 | Ga0070717_100173325 | 132 |
| 242 | 3300006028 | Ga0070717_10416085 | Ga0070717_104160852 | 132 |
| 243 | 3300006028 | Ga0070717_10501552 | Ga0070717_105015522 | 132 |
| 244 | 3300006038 | Ga0075365_10083284 | Ga0075365_100832842 | 132 |
| 245 | 3300006038 | Ga0075365_10101356 | Ga0075365_101013563 | 132 |
| 246 | 3300006038 | Ga0075365_10541421 | Ga0075365_105414212 | 132 |
| 247 | 3300006038 | Ga0075365_10770016 | Ga0075365_107700162 | 132 |
| 248 | 3300006048 | Ga0075363_100113059 | Ga0075363_1001130592 | 132 |
| 249 | 3300006048 | Ga0075363_100407285 | Ga0075363_1004072852 | 132 |
| 250 | 3300006051 | Ga0075364_10088472 | Ga0075364_100884722 | 132 |
| 251 | 3300006058 | Ga0075432_10149429 | Ga0075432_101494292 | 132 |
| 252 | 3300006173 | Ga0070716_100107458 | Ga0070716_1001074582 | 132 |
| 253 | 3300006173 | Ga0070716_100189057 | Ga0070716_1001890572 | 132 |
| 254 | 3300006173 | Ga0070716_100666400 | Ga0070716_1006664002 | 132 |
| 255 | 3300006175 | Ga0070712_100111079 | Ga0070712_1001110793 | 132 |
| 256 | 3300006175 | Ga0070712_100118582 | Ga0070712_1001185822 | 132 |
| 257 | 3300006175 | Ga0070712_100905172 | Ga0070712_1009051722 | 132 |
| 258 | 3300006177 | Ga0075362_10396330 | Ga0075362_103963302 | 132 |
| 259 | 3300006178 | Ga0075367_10142444 | Ga0075367_101424441 | 132 |
| 260 | 3300006186 | Ga0075369_10127055 | Ga0075369_101270552 | 132 |
| 261 | 3300006186 | Ga0075369_10247272 | Ga0075369_102472721 | 132 |
| 262 | 3300006186 | Ga0075369_10336005 | Ga0075369_103360051 | 132 |
| 263 | 3300006195 | Ga0075366_10239677 | Ga0075366_102396772 | 132 |
| 264 | 3300006195 | Ga0075366_10593436 | Ga0075366_105934362 | 132 |
| 265 | 3300006195 | Ga0075366_10603489 | Ga0075366_106034892 | 132 |
| 266 | 3300006195 | Ga0075366_10853991 | Ga0075366_108539911 | 132 |
| 267 | 3300006237 | Ga0097621_100209156 | Ga0097621_1002091562 | 132 |
| 268 | 3300006237 | Ga0097621_101107206 | Ga0097621_1011072061 | 132 |
| 269 | 3300006237 | Ga0097621_101274183 | Ga0097621_1012741832 | 132 |
| 270 | 3300006237 | Ga0097621_101490690 | Ga0097621_1014906901 | 132 |
| 271 | 3300006353 | Ga0075370_10219152 | Ga0075370_102191522 | 132 |
| 272 | 3300006353 | Ga0075370_10380400 | Ga0075370_103804002 | 132 |
| 273 | 3300006358 | Ga0068871_100254458 | Ga0068871_1002544582 | 132 |
| 274 | 3300006358 | Ga0068871_100483860 | Ga0068871_1004838602 | 132 |
| 275 | 3300006358 | Ga0068871_100802604 | Ga0068871_1008026042 | 132 |
| 276 | 3300006358 | Ga0068871_101385620 | Ga0068871_1013856202 | 132 |
| 277 | 3300006844 | Ga0075428_100700818 | Ga0075428_1007008182 | 132 |
| 278 | 3300006852 | Ga0075433_10677350 | Ga0075433_106773501 | 132 |
| 279 | 3300006880 | Ga0075429_100967043 | Ga0075429_1009670432 | 132 |
| 280 | 3300006881 | Ga0068865_100444871 | Ga0068865_1004448712 | 132 |
| 281 | 3300006881 | Ga0068865_100647710 | Ga0068865_1006477102 | 132 |
| 282 | 3300006881 | Ga0068865_100847786 | Ga0068865_1008477862 | 132 |
| 283 | 3300006881 | Ga0068865_101028166 | Ga0068865_1010281662 | 132 |
| 284 | 3300006931 | Ga0097620_100463136 | Ga0097620_1004631362 | 132 |
| 285 | 3300006941 | Ga0099825_1034140 | Ga0099825_10341403 | 132 |
| 286 | 3300006942 | Ga0099824_1007408 | Ga0099824_10074087 | 132 |
| 287 | 3300006943 | Ga0099822_1006547 | Ga0099822_100654714 | 132 |
| 288 | 3300007265 | Ga0099794_10013294 | Ga0099794_100132942 | 132 |
| 289 | 3300007265 | Ga0099794_10298454 | Ga0099794_102984542 | 132 |
| 290 | 3300007265 | Ga0099794_10419992 | Ga0099794_104199922 | 132 |
| 291 | 3300007788 | Ga0099795_10003875 | Ga0099795_100038752 | 132 |
| 292 | 3300007788 | Ga0099795_10184751 | Ga0099795_101847512 | 132 |
| 293 | 3300009011 | Ga0105251_10576561 | Ga0105251_105765611 | 132 |
| 294 | 3300009092 | Ga0105250_10539583 | Ga0105250_105395831 | 132 |
| 295 | 3300009093 | Ga0105240_10034221 | Ga0105240_100342212 | 132 |
| 296 | 3300009093 | Ga0105240_10058690 | Ga0105240_100586903 | 132 |
| 297 | 3300009093 | Ga0105240_10105395 | Ga0105240_101053952 | 132 |
| 298 | 3300009093 | Ga0105240_10108708 | Ga0105240_101087082 | 132 |
| 299 | 3300009093 | Ga0105240_10522672 | Ga0105240_105226721 | 132 |
| 300 | 3300009093 | Ga0105240_11095681 | Ga0105240_110956812 | 132 |
| 301 | 3300009093 | Ga0105240_11604799 | Ga0105240_116047992 | 132 |
| 302 | 3300009093 | Ga0105240_12534470 | Ga0105240_125344701 | 132 |
| 303 | 3300009094 | Ga0111539_10144248 | Ga0111539_101442483 | 132 |
| 304 | 3300009094 | Ga0111539_11656237 | Ga0111539_116562372 | 132 |
| 305 | 3300009098 | Ga0105245_10105057 | Ga0105245_101050572 | 132 |
| 306 | 3300009098 | Ga0105245_10289341 | Ga0105245_102893412 | 132 |
| 307 | 3300009098 | Ga0105245_10829319 | Ga0105245_108293192 | 132 |
| 308 | 3300009098 | Ga0105245_11842058 | Ga0105245_118420582 | 132 |
| 309 | 3300009101 | Ga0105247_10110567 | Ga0105247_101105672 | 132 |
| 310 | 3300009101 | Ga0105247_10136367 | Ga0105247_101363672 | 132 |
| 311 | 3300009101 | Ga0105247_10155708 | Ga0105247_101557082 | 132 |
| 312 | 3300009101 | Ga0105247_10400587 | Ga0105247_104005872 | 132 |
| 313 | 3300009147 | Ga0114129_10191104 | Ga0114129_101911042 | 132 |
| 314 | 3300009148 | Ga0105243_10078753 | Ga0105243_100787531 | 132 |
| 315 | 3300009148 | Ga0105243_10929161 | Ga0105243_109291612 | 132 |
| 316 | 3300009148 | Ga0105243_11232577 | Ga0105243_112325772 | 132 |
| 317 | 3300009148 | Ga0105243_12506854 | Ga0105243_125068541 | 132 |
| 318 | 3300009174 | Ga0105241_10028779 | Ga0105241_100287794 | 132 |
| 319 | 3300009176 | Ga0105242_10115715 | Ga0105242_101157152 | 132 |
| 320 | 3300009176 | Ga0105242_10131362 | Ga0105242_101313623 | 132 |
| 321 | 3300009176 | Ga0105242_11576074 | Ga0105242_115760742 | 132 |
| 322 | 3300009176 | Ga0105242_11936273 | Ga0105242_119362732 | 132 |
| 323 | 3300009177 | Ga0105248_10139917 | Ga0105248_101399174 | 132 |
| 324 | 3300009177 | Ga0105248_10204152 | Ga0105248_102041523 | 132 |
| 325 | 3300009177 | Ga0105248_10336933 | Ga0105248_103369333 | 132 |
| 326 | 3300009177 | Ga0105248_10881040 | Ga0105248_108810402 | 132 |
| 327 | 3300009545 | Ga0105237_10087664 | Ga0105237_100876642 | 132 |
| 328 | 3300009545 | Ga0105237_10508977 | Ga0105237_105089772 | 132 |
| 329 | 3300009545 | Ga0105237_10562761 | Ga0105237_105627612 | 132 |
| 330 | 3300009545 | Ga0105237_10641091 | Ga0105237_106410912 | 132 |
| 331 | 3300009545 | Ga0105237_10726224 | Ga0105237_107262242 | 132 |
| 332 | 3300009545 | Ga0105237_10766119 | Ga0105237_107661192 | 132 |
| 333 | 3300009545 | Ga0105237_11358764 | Ga0105237_113587641 | 132 |
| 334 | 3300009545 | Ga0105237_11568743 | Ga0105237_115687431 | 132 |
| 335 | 3300009551 | Ga0105238_10017402 | Ga0105238_100174023 | 132 |
| 336 | 3300009551 | Ga0105238_10140974 | Ga0105238_101409743 | 132 |
| 337 | 3300009551 | Ga0105238_10358018 | Ga0105238_103580182 | 132 |
| 338 | 3300009551 | Ga0105238_10360284 | Ga0105238_103602842 | 132 |
| 339 | 3300009551 | Ga0105238_10598531 | Ga0105238_105985312 | 132 |
| 340 | 3300009551 | Ga0105238_11028171 | Ga0105238_110281711 | 132 |
| 341 | 3300009553 | Ga0105249_10080447 | Ga0105249_100804473 | 132 |
| 342 | 3300009553 | Ga0105249_10645237 | Ga0105249_106452372 | 132 |
| 343 | 3300010159 | Ga0099796_10459180 | Ga0099796_104591801 | 132 |
| 344 | 3300010375 | Ga0105239_10020324 | Ga0105239_100203247 | 132 |
| 345 | 3300010375 | Ga0105239_10029566 | Ga0105239_100295662 | 132 |
| 346 | 3300010375 | Ga0105239_10118154 | Ga0105239_101181542 | 132 |
| 347 | 3300010375 | Ga0105239_10151085 | Ga0105239_101510852 | 132 |
| 348 | 3300010375 | Ga0105239_10404892 | Ga0105239_104048922 | 132 |
| 349 | 3300010375 | Ga0105239_10804993 | Ga0105239_108049932 | 132 |
| 350 | 3300011119 | Ga0105246_10106488 | Ga0105246_101064882 | 132 |
| 351 | 3300011119 | Ga0105246_10229454 | Ga0105246_102294542 | 132 |
| 352 | 3300011119 | Ga0105246_10256365 | Ga0105246_102563652 | 132 |
| 353 | 3300011119 | Ga0105246_10675292 | Ga0105246_106752922 | 132 |
| 354 | 3300011119 | Ga0105246_11328480 | Ga0105246_113284802 | 132 |
| 355 | 3300012515 | Ga0157338_1036802 | Ga0157338_10368022 | 132 |
| 356 | 3300013102 | Ga0157371_10727887 | Ga0157371_107278872 | 132 |
| 357 | 3300013102 | Ga0157371_11388202 | Ga0157371_113882022 | 132 |
| 358 | 3300013104 | Ga0157370_10014947 | Ga0157370_100149476 | 132 |
| 359 | 3300013104 | Ga0157370_10025078 | Ga0157370_100250784 | 132 |
| 360 | 3300013104 | Ga0157370_10071347 | Ga0157370_100713473 | 132 |
| 361 | 3300013104 | Ga0157370_10296740 | Ga0157370_102967402 | 132 |
| 362 | 3300013104 | Ga0157370_10862740 | Ga0157370_108627402 | 132 |
| 363 | 3300013104 | Ga0157370_10950068 | Ga0157370_109500681 | 132 |
| 364 | 3300013105 | Ga0157369_10021190 | Ga0157369_100211905 | 132 |
| 365 | 3300013105 | Ga0157369_10047353 | Ga0157369_100473535 | 132 |
| 366 | 3300013105 | Ga0157369_10130028 | Ga0157369_101300284 | 132 |
| 367 | 3300013105 | Ga0157369_10501429 | Ga0157369_105014292 | 132 |
| 368 | 3300013105 | Ga0157369_10602033 | Ga0157369_106020332 | 132 |
| 369 | 3300013296 | Ga0157374_10033305 | Ga0157374_100333052 | 132 |
| 370 | 3300013296 | Ga0157374_10530713 | Ga0157374_105307132 | 132 |
| 371 | 3300013297 | Ga0157378_10070080 | Ga0157378_100700804 | 132 |
| 372 | 3300013297 | Ga0157378_10356319 | Ga0157378_103563192 | 132 |
| 373 | 3300013297 | Ga0157378_10368636 | Ga0157378_103686362 | 132 |
| 374 | 3300013297 | Ga0157378_13043504 | Ga0157378_130435041 | 132 |
| 375 | 3300013306 | Ga0163162_10578216 | Ga0163162_105782162 | 132 |
| 376 | 3300013306 | Ga0163162_11108831 | Ga0163162_111088311 | 132 |
| 377 | 3300013306 | Ga0163162_11309716 | Ga0163162_113097161 | 132 |
| 378 | 3300013306 | Ga0163162_13152751 | Ga0163162_131527511 | 132 |
| 379 | 3300013307 | Ga0157372_10196832 | Ga0157372_101968321 | 132 |
| 380 | 3300013307 | Ga0157372_10708827 | Ga0157372_107088272 | 132 |
| 381 | 3300013307 | Ga0157372_12031415 | Ga0157372_120314152 | 132 |
| 382 | 3300013307 | Ga0157372_12344199 | Ga0157372_123441991 | 132 |
| 383 | 3300013308 | Ga0157375_10009689 | Ga0157375_100096897 | 132 |
| 384 | 3300013308 | Ga0157375_11105739 | Ga0157375_111057392 | 132 |
| 385 | 3300013308 | Ga0157375_11934839 | Ga0157375_119348392 | 132 |
| 386 | 3300013308 | Ga0157375_12308347 | Ga0157375_123083472 | 132 |
| 387 | 3300014325 | Ga0163163_10159204 | Ga0163163_101592043 | 132 |
| 388 | 3300014325 | Ga0163163_10453589 | Ga0163163_104535892 | 132 |
| 389 | 3300014325 | Ga0163163_10571962 | Ga0163163_105719622 | 132 |
| 390 | 3300014325 | Ga0163163_11094788 | Ga0163163_110947882 | 132 |
| 391 | 3300014325 | Ga0163163_12257726 | Ga0163163_122577261 | 132 |
| 392 | 3300014326 | Ga0157380_10184873 | Ga0157380_101848732 | 132 |
| 393 | 3300014326 | Ga0157380_10184912 | Ga0157380_101849122 | 132 |
| 394 | 3300014326 | Ga0157380_10811873 | Ga0157380_108118732 | 132 |
| 395 | 3300014326 | Ga0157380_12152610 | Ga0157380_121526102 | 132 |
| 396 | 3300014745 | Ga0157377_10094953 | Ga0157377_100949532 | 132 |
| 397 | 3300014745 | Ga0157377_10173047 | Ga0157377_101730472 | 132 |
| 398 | 3300014745 | Ga0157377_11356277 | Ga0157377_113562771 | 132 |
| 399 | 3300014968 | Ga0157379_10085565 | Ga0157379_100855653 | 132 |
| 400 | 3300014968 | Ga0157379_10341117 | Ga0157379_103411172 | 132 |
| 401 | 3300014968 | Ga0157379_10659533 | Ga0157379_106595331 | 132 |
| 402 | 3300014969 | Ga0157376_10092020 | Ga0157376_100920202 | 132 |
| 403 | 3300014969 | Ga0157376_10557471 | Ga0157376_105574712 | 132 |
| 404 | 3300017792 | Ga0163161_10128231 | Ga0163161_101282312 | 132 |
| 405 | 3300017792 | Ga0163161_10232435 | Ga0163161_102324353 | 132 |
| 406 | 3300017792 | Ga0163161_10303939 | Ga0163161_103039392 | 132 |
| 407 | 3300020070 | Ga0206356_10766524 | Ga0206356_107665242 | 132 |
| 408 | 3300020070 | Ga0206356_11320371 | Ga0206356_113203712 | 132 |
| 409 | 3300020082 | Ga0206353_10272000 | Ga0206353_102720001 | 132 |
| 410 | 3300021377 | Ga0213874_10013946 | Ga0213874_100139462 | 132 |
| 411 | 3300021384 | Ga0213876_10020027 | Ga0213876_100200272 | 132 |
| 412 | 3300021384 | Ga0213876_10072356 | Ga0213876_100723562 | 132 |
| 413 | 3300025261 | Ga0209233_1002384 | Ga0209233_10023846 | 132 |
| 414 | 3300025297 | Ga0209758_1030944 | Ga0209758_10309442 | 132 |
| 415 | 3300025297 | Ga0209758_1031236 | Ga0209758_10312362 | 132 |
| 416 | 3300025297 | Ga0209758_1050827 | Ga0209758_10508272 | 132 |
| 417 | 3300025297 | Ga0209758_1091452 | Ga0209758_10914522 | 132 |
| 418 | 3300025315 | Ga0207697_10085069 | Ga0207697_100850692 | 132 |
| 419 | 3300025321 | Ga0207656_10034898 | Ga0207656_100348982 | 132 |
| 420 | 3300025893 | Ga0207682_10212877 | Ga0207682_102128772 | 132 |
| 421 | 3300025899 | Ga0207642_10037371 | Ga0207642_100373712 | 132 |
| 422 | 3300025899 | Ga0207642_10398319 | Ga0207642_103983192 | 132 |
| 423 | 3300025899 | Ga0207642_10478566 | Ga0207642_104785662 | 132 |
| 424 | 3300025899 | Ga0207642_10583281 | Ga0207642_105832811 | 132 |
| 425 | 3300025900 | Ga0207710_10176392 | Ga0207710_101763922 | 132 |
| 426 | 3300025900 | Ga0207710_10384506 | Ga0207710_103845062 | 132 |
| 427 | 3300025900 | Ga0207710_10598127 | Ga0207710_105981272 | 132 |
| 428 | 3300025901 | Ga0207688_10215003 | Ga0207688_102150032 | 132 |
| 429 | 3300025901 | Ga0207688_10282908 | Ga0207688_102829082 | 132 |
| 430 | 3300025901 | Ga0207688_10421078 | Ga0207688_104210782 | 132 |
| 431 | 3300025901 | Ga0207688_10436633 | Ga0207688_104366332 | 132 |
| 432 | 3300025901 | Ga0207688_10518079 | Ga0207688_105180791 | 132 |
| 433 | 3300025903 | Ga0207680_10591542 | Ga0207680_105915421 | 132 |
| 434 | 3300025905 | Ga0207685_10027483 | Ga0207685_100274831 | 132 |
| 435 | 3300025906 | Ga0207699_10025234 | Ga0207699_100252342 | 132 |
| 436 | 3300025906 | Ga0207699_10156951 | Ga0207699_101569512 | 132 |
| 437 | 3300025906 | Ga0207699_10490158 | Ga0207699_104901581 | 132 |
| 438 | 3300025906 | Ga0207699_10910031 | Ga0207699_109100312 | 132 |
| 439 | 3300025907 | Ga0207645_10058248 | Ga0207645_100582483 | 132 |
| 440 | 3300025907 | Ga0207645_10172342 | Ga0207645_101723422 | 132 |
| 441 | 3300025909 | Ga0207705_10269578 | Ga0207705_102695782 | 132 |
| 442 | 3300025909 | Ga0207705_10295605 | Ga0207705_102956052 | 132 |
| 443 | 3300025910 | Ga0207684_10216101 | Ga0207684_102161012 | 132 |
| 444 | 3300025910 | Ga0207684_10558714 | Ga0207684_105587142 | 132 |
| 445 | 3300025910 | Ga0207684_11207051 | Ga0207684_112070511 | 132 |
| 446 | 3300025911 | Ga0207654_10429061 | Ga0207654_104290612 | 132 |
| 447 | 3300025912 | Ga0207707_10000419 | Ga0207707_1000041934 | 132 |
| 448 | 3300025912 | Ga0207707_10002705 | Ga0207707_100027054 | 132 |
| 449 | 3300025912 | Ga0207707_10002868 | Ga0207707_100028685 | 132 |
| 450 | 3300025912 | Ga0207707_10045918 | Ga0207707_100459184 | 132 |
| 451 | 3300025912 | Ga0207707_10135089 | Ga0207707_101350892 | 132 |
| 452 | 3300025913 | Ga0207695_10048124 | Ga0207695_100481242 | 132 |
| 453 | 3300025913 | Ga0207695_10060686 | Ga0207695_100606865 | 132 |
| 454 | 3300025913 | Ga0207695_10140869 | Ga0207695_101408692 | 132 |
| 455 | 3300025913 | Ga0207695_10240619 | Ga0207695_102406192 | 132 |
| 456 | 3300025913 | Ga0207695_10363647 | Ga0207695_103636472 | 132 |
| 457 | 3300025914 | Ga0207671_10061259 | Ga0207671_100612592 | 132 |
| 458 | 3300025914 | Ga0207671_10378725 | Ga0207671_103787252 | 132 |
| 459 | 3300025914 | Ga0207671_10456499 | Ga0207671_104564992 | 132 |
| 460 | 3300025914 | Ga0207671_10485729 | Ga0207671_104857292 | 132 |
| 461 | 3300025914 | Ga0207671_11174057 | Ga0207671_111740572 | 132 |
| 462 | 3300025915 | Ga0207693_10041850 | Ga0207693_100418503 | 132 |
| 463 | 3300025915 | Ga0207693_10071447 | Ga0207693_100714473 | 132 |
| 464 | 3300025915 | Ga0207693_10086606 | Ga0207693_100866062 | 132 |
| 465 | 3300025915 | Ga0207693_10770161 | Ga0207693_107701612 | 132 |
| 466 | 3300025916 | Ga0207663_10007087 | Ga0207663_100070877 | 132 |
| 467 | 3300025916 | Ga0207663_10043021 | Ga0207663_100430213 | 132 |
| 468 | 3300025916 | Ga0207663_10065948 | Ga0207663_100659482 | 132 |
| 469 | 3300025916 | Ga0207663_10116334 | Ga0207663_101163342 | 132 |
| 470 | 3300025916 | Ga0207663_10390605 | Ga0207663_103906052 | 132 |
| 471 | 3300025917 | Ga0207660_10012377 | Ga0207660_100123772 | 132 |
| 472 | 3300025917 | Ga0207660_10048142 | Ga0207660_100481422 | 132 |
| 473 | 3300025917 | Ga0207660_10305114 | Ga0207660_103051142 | 132 |
| 474 | 3300025917 | Ga0207660_10330707 | Ga0207660_103307072 | 132 |
| 475 | 3300025918 | Ga0207662_10113335 | Ga0207662_101133352 | 132 |
| 476 | 3300025918 | Ga0207662_11223767 | Ga0207662_112237672 | 132 |
| 477 | 3300025919 | Ga0207657_10011308 | Ga0207657_100113082 | 132 |
| 478 | 3300025919 | Ga0207657_10420585 | Ga0207657_104205852 | 132 |
| 479 | 3300025920 | Ga0207649_10039488 | Ga0207649_100394882 | 132 |
| 480 | 3300025920 | Ga0207649_10557951 | Ga0207649_105579512 | 132 |
| 481 | 3300025921 | Ga0207652_10001690 | Ga0207652_1000169015 | 132 |
| 482 | 3300025921 | Ga0207652_10009155 | Ga0207652_100091555 | 132 |
| 483 | 3300025921 | Ga0207652_10011695 | Ga0207652_100116955 | 132 |
| 484 | 3300025921 | Ga0207652_10047707 | Ga0207652_100477073 | 132 |
| 485 | 3300025921 | Ga0207652_10055058 | Ga0207652_100550582 | 132 |
| 486 | 3300025922 | Ga0207646_10826670 | Ga0207646_108266702 | 132 |
| 487 | 3300025923 | Ga0207681_10039022 | Ga0207681_100390222 | 132 |
| 488 | 3300025923 | Ga0207681_10411264 | Ga0207681_104112642 | 132 |
| 489 | 3300025923 | Ga0207681_10889286 | Ga0207681_108892862 | 132 |
| 490 | 3300025924 | Ga0207694_10027290 | Ga0207694_100272902 | 132 |
| 491 | 3300025924 | Ga0207694_10075966 | Ga0207694_100759662 | 132 |
| 492 | 3300025924 | Ga0207694_10321799 | Ga0207694_103217992 | 132 |
| 493 | 3300025924 | Ga0207694_10731282 | Ga0207694_107312822 | 132 |
| 494 | 3300025924 | Ga0207694_11027946 | Ga0207694_110279461 | 132 |
| 495 | 3300025926 | Ga0207659_10101426 | Ga0207659_101014262 | 132 |
| 496 | 3300025927 | Ga0207687_10157928 | Ga0207687_101579282 | 132 |
| 497 | 3300025927 | Ga0207687_10395148 | Ga0207687_103951482 | 132 |
| 498 | 3300025927 | Ga0207687_10641434 | Ga0207687_106414342 | 132 |
| 499 | 3300025928 | Ga0207700_10005544 | Ga0207700_100055442 | 132 |
| 500 | 3300025928 | Ga0207700_10063406 | Ga0207700_100634062 | 132 |
| 501 | 3300025928 | Ga0207700_10118805 | Ga0207700_101188052 | 132 |
| 502 | 3300025928 | Ga0207700_10120991 | Ga0207700_101209912 | 132 |
| 503 | 3300025928 | Ga0207700_10183800 | Ga0207700_101838002 | 132 |
| 504 | 3300025928 | Ga0207700_11162919 | Ga0207700_111629191 | 132 |
| 505 | 3300025929 | Ga0207664_10042851 | Ga0207664_100428513 | 132 |
| 506 | 3300025929 | Ga0207664_10150641 | Ga0207664_101506412 | 132 |
| 507 | 3300025929 | Ga0207664_10229936 | Ga0207664_102299362 | 132 |
| 508 | 3300025929 | Ga0207664_10489807 | Ga0207664_104898072 | 132 |
| 509 | 3300025931 | Ga0207644_10234854 | Ga0207644_102348542 | 132 |
| 510 | 3300025931 | Ga0207644_11082889 | Ga0207644_110828891 | 132 |
| 511 | 3300025931 | Ga0207644_11312479 | Ga0207644_113124791 | 132 |
| 512 | 3300025931 | Ga0207644_11400987 | Ga0207644_114009872 | 132 |
| 513 | 3300025932 | Ga0207690_10587430 | Ga0207690_105874302 | 132 |
| 514 | 3300025933 | Ga0207706_10015272 | Ga0207706_100152725 | 132 |
| 515 | 3300025933 | Ga0207706_10225273 | Ga0207706_102252732 | 132 |
| 516 | 3300025933 | Ga0207706_10408965 | Ga0207706_104089652 | 132 |
| 517 | 3300025935 | Ga0207709_10358165 | Ga0207709_103581651 | 132 |
| 518 | 3300025935 | Ga0207709_10503061 | Ga0207709_105030612 | 132 |
| 519 | 3300025935 | Ga0207709_10528054 | Ga0207709_105280542 | 132 |
| 520 | 3300025935 | Ga0207709_10862442 | Ga0207709_108624422 | 132 |
| 521 | 3300025935 | Ga0207709_10893438 | Ga0207709_108934381 | 132 |
| 522 | 3300025937 | Ga0207669_10095367 | Ga0207669_100953673 | 132 |
| 523 | 3300025937 | Ga0207669_10718476 | Ga0207669_107184761 | 132 |
| 524 | 3300025937 | Ga0207669_11091687 | Ga0207669_110916872 | 132 |
| 525 | 3300025938 | Ga0207704_10666308 | Ga0207704_106663082 | 132 |
| 526 | 3300025938 | Ga0207704_11179898 | Ga0207704_111798982 | 132 |
| 527 | 3300025939 | Ga0207665_10036449 | Ga0207665_100364493 | 132 |
| 528 | 3300025939 | Ga0207665_10088797 | Ga0207665_100887972 | 132 |
| 529 | 3300025939 | Ga0207665_10195726 | Ga0207665_101957262 | 132 |
| 530 | 3300025939 | Ga0207665_10253201 | Ga0207665_102532012 | 132 |
| 531 | 3300025939 | Ga0207665_10611246 | Ga0207665_106112463 | 132 |
| 532 | 3300025939 | Ga0207665_10847064 | Ga0207665_108470642 | 132 |
| 533 | 3300025940 | Ga0207691_10054640 | Ga0207691_100546402 | 132 |
| 534 | 3300025940 | Ga0207691_10168119 | Ga0207691_101681192 | 132 |
| 535 | 3300025940 | Ga0207691_10426374 | Ga0207691_104263742 | 132 |
| 536 | 3300025940 | Ga0207691_10505181 | Ga0207691_105051812 | 132 |
| 537 | 3300025940 | Ga0207691_10765507 | Ga0207691_107655072 | 132 |
| 538 | 3300025941 | Ga0207711_10284242 | Ga0207711_102842422 | 132 |
| 539 | 3300025942 | Ga0207689_10011785 | Ga0207689_100117853 | 132 |
| 540 | 3300025942 | Ga0207689_10125319 | Ga0207689_101253192 | 132 |
| 541 | 3300025942 | Ga0207689_10326522 | Ga0207689_103265222 | 132 |
| 542 | 3300025944 | Ga0207661_10001270 | Ga0207661_100012705 | 132 |
| 543 | 3300025944 | Ga0207661_10008213 | Ga0207661_100082135 | 132 |
| 544 | 3300025944 | Ga0207661_10021058 | Ga0207661_100210583 | 132 |
| 545 | 3300025945 | Ga0207679_10069235 | Ga0207679_100692353 | 132 |
| 546 | 3300025945 | Ga0207679_10271615 | Ga0207679_102716152 | 132 |
| 547 | 3300025945 | Ga0207679_10377220 | Ga0207679_103772202 | 132 |
| 548 | 3300025945 | Ga0207679_10916061 | Ga0207679_109160612 | 132 |
| 549 | 3300025949 | Ga0207667_10002017 | Ga0207667_1000201710 | 132 |
| 550 | 3300025949 | Ga0207667_10145129 | Ga0207667_101451294 | 132 |
| 551 | 3300025949 | Ga0207667_10201639 | Ga0207667_102016391 | 132 |
| 552 | 3300025949 | Ga0207667_10510487 | Ga0207667_105104872 | 132 |
| 553 | 3300025949 | Ga0207667_11719651 | Ga0207667_117196512 | 132 |
| 554 | 3300025960 | Ga0207651_10112506 | Ga0207651_101125062 | 132 |
| 555 | 3300025960 | Ga0207651_10603500 | Ga0207651_106035002 | 132 |
| 556 | 3300025961 | Ga0207712_10128621 | Ga0207712_101286212 | 132 |
| 557 | 3300025972 | Ga0207668_10150043 | Ga0207668_101500432 | 132 |
| 558 | 3300025972 | Ga0207668_10241238 | Ga0207668_102412382 | 132 |
| 559 | 3300025972 | Ga0207668_10335998 | Ga0207668_103359982 | 132 |
| 560 | 3300025972 | Ga0207668_10471341 | Ga0207668_104713412 | 132 |
| 561 | 3300025972 | Ga0207668_10481127 | Ga0207668_104811272 | 132 |
| 562 | 3300025972 | Ga0207668_10558761 | Ga0207668_105587612 | 132 |
| 563 | 3300025981 | Ga0207640_10214238 | Ga0207640_102142382 | 132 |
| 564 | 3300025981 | Ga0207640_10407822 | Ga0207640_104078221 | 132 |
| 565 | 3300025981 | Ga0207640_10539537 | Ga0207640_105395372 | 132 |
| 566 | 3300025986 | Ga0207658_10132641 | Ga0207658_101326412 | 132 |
| 567 | 3300025986 | Ga0207658_10375592 | Ga0207658_103755922 | 132 |
| 568 | 3300025986 | Ga0207658_11256020 | Ga0207658_112560202 | 132 |
| 569 | 3300025986 | Ga0207658_11567847 | Ga0207658_115678472 | 132 |
| 570 | 3300026023 | Ga0207677_10005891 | Ga0207677_100058912 | 132 |
| 571 | 3300026023 | Ga0207677_10532795 | Ga0207677_105327951 | 132 |
| 572 | 3300026035 | Ga0207703_10394218 | Ga0207703_103942182 | 132 |
| 573 | 3300026035 | Ga0207703_10999855 | Ga0207703_109998552 | 132 |
| 574 | 3300026035 | Ga0207703_11300422 | Ga0207703_113004222 | 132 |
| 575 | 3300026041 | Ga0207639_10173169 | Ga0207639_101731692 | 132 |
| 576 | 3300026041 | Ga0207639_10837909 | Ga0207639_108379092 | 132 |
| 577 | 3300026041 | Ga0207639_10970591 | Ga0207639_109705911 | 132 |
| 578 | 3300026041 | Ga0207639_12227199 | Ga0207639_122271991 | 132 |
| 579 | 3300026067 | Ga0207678_10006479 | Ga0207678_100064799 | 132 |
| 580 | 3300026067 | Ga0207678_10044766 | Ga0207678_100447664 | 132 |
| 581 | 3300026067 | Ga0207678_10061454 | Ga0207678_100614543 | 132 |
| 582 | 3300026067 | Ga0207678_10196905 | Ga0207678_101969052 | 132 |
| 583 | 3300026067 | Ga0207678_10628445 | Ga0207678_106284451 | 132 |
| 584 | 3300026067 | Ga0207678_10860880 | Ga0207678_108608802 | 132 |
| 585 | 3300026067 | Ga0207678_11372541 | Ga0207678_113725412 | 132 |
| 586 | 3300026067 | Ga0207678_11916079 | Ga0207678_119160791 | 132 |
| 587 | 3300026075 | Ga0207708_10158521 | Ga0207708_101585212 | 132 |
| 588 | 3300026075 | Ga0207708_10981793 | Ga0207708_109817932 | 132 |
| 589 | 3300026078 | Ga0207702_10273884 | Ga0207702_102738841 | 132 |
| 590 | 3300026078 | Ga0207702_10875316 | Ga0207702_108753162 | 132 |
| 591 | 3300026078 | Ga0207702_10903267 | Ga0207702_109032672 | 132 |
| 592 | 3300026088 | Ga0207641_10606623 | Ga0207641_106066232 | 132 |
| 593 | 3300026088 | Ga0207641_11251741 | Ga0207641_112517412 | 132 |
| 594 | 3300026088 | Ga0207641_11833036 | Ga0207641_118330362 | 132 |
| 595 | 3300026089 | Ga0207648_10797285 | Ga0207648_107972851 | 132 |
| 596 | 3300026089 | Ga0207648_10821718 | Ga0207648_108217181 | 132 |
| 597 | 3300026089 | Ga0207648_10936444 | Ga0207648_109364442 | 132 |
| 598 | 3300026095 | Ga0207676_10069328 | Ga0207676_100693281 | 132 |
| 599 | 3300026116 | Ga0207674_10010575 | Ga0207674_100105753 | 132 |
| 600 | 3300026116 | Ga0207674_10113295 | Ga0207674_101132954 | 132 |
| 601 | 3300026116 | Ga0207674_10242397 | Ga0207674_102423973 | 132 |
| 602 | 3300026116 | Ga0207674_10457616 | Ga0207674_104576162 | 132 |
| 603 | 3300026116 | Ga0207674_10594400 | Ga0207674_105944002 | 132 |
| 604 | 3300026116 | Ga0207674_11383866 | Ga0207674_113838662 | 132 |
| 605 | 3300026116 | Ga0207674_11674039 | Ga0207674_116740391 | 132 |
| 606 | 3300026118 | Ga0207675_100031334 | Ga0207675_1000313342 | 132 |
| 607 | 3300026118 | Ga0207675_100064640 | Ga0207675_1000646403 | 132 |
| 608 | 3300026118 | Ga0207675_100274434 | Ga0207675_1002744342 | 132 |
| 609 | 3300026118 | Ga0207675_100422111 | Ga0207675_1004221111 | 132 |
| 610 | 3300026118 | Ga0207675_101532037 | Ga0207675_1015320372 | 132 |
| 611 | 3300026118 | Ga0207675_101742728 | Ga0207675_1017427282 | 132 |
| 612 | 3300026118 | Ga0207675_101791882 | Ga0207675_1017918821 | 132 |
| 613 | 3300026121 | Ga0207683_10021694 | Ga0207683_100216942 | 132 |
| 614 | 3300026121 | Ga0207683_10197482 | Ga0207683_101974822 | 132 |
| 615 | 3300026121 | Ga0207683_10648249 | Ga0207683_106482492 | 132 |
| 616 | 3300026121 | Ga0207683_10766064 | Ga0207683_107660642 | 132 |
| 617 | 3300026142 | Ga0207698_10226900 | Ga0207698_102269003 | 132 |
| 618 | 3300026142 | Ga0207698_10295269 | Ga0207698_102952692 | 132 |
| 619 | 3300026142 | Ga0207698_10317285 | Ga0207698_103172852 | 132 |
| 620 | 3300026142 | Ga0207698_10501287 | Ga0207698_105012872 | 132 |
| 621 | 3300026142 | Ga0207698_11430873 | Ga0207698_114308731 | 132 |
| 622 | 3300027357 | Ga0209589_1000014 | Ga0209589_1000014167 | 132 |
| 623 | 3300027361 | Ga0209489_100014 | Ga0209489_100014167 | 132 |
| 624 | 3300027363 | Ga0209700_100024 | Ga0209700_100024167 | 132 |
| 625 | 3300027512 | Ga0209179_1012641 | Ga0209179_10126412 | 132 |
| 626 | 3300027512 | Ga0209179_1048167 | Ga0209179_10481672 | 132 |
| 627 | 3300027671 | Ga0209588_1002539 | Ga0209588_10025392 | 132 |
| 628 | 3300028379 | Ga0268266_10147257 | Ga0268266_101472572 | 132 |
| 629 | 3300028379 | Ga0268266_10201322 | Ga0268266_102013222 | 132 |
| 630 | 3300028379 | Ga0268266_10391978 | Ga0268266_103919782 | 132 |
| 631 | 3300028379 | Ga0268266_10570437 | Ga0268266_105704371 | 132 |
| 632 | 3300028380 | Ga0268265_10198420 | Ga0268265_101984201 | 132 |
| 633 | 3300028380 | Ga0268265_10268121 | Ga0268265_102681212 | 132 |
| 634 | 3300028380 | Ga0268265_10304954 | Ga0268265_103049542 | 132 |
| 635 | 3300028380 | Ga0268265_10753171 | Ga0268265_107531711 | 132 |
| 636 | 3300028380 | Ga0268265_11590458 | Ga0268265_115904582 | 132 |
| 637 | 3300028380 | Ga0268265_11681054 | Ga0268265_116810542 | 132 |
| 638 | 3300028380 | Ga0268265_11964165 | Ga0268265_119641652 | 132 |
| 639 | 3300028380 | Ga0268265_12483165 | Ga0268265_124831652 | 132 |
| 640 | 3300028381 | Ga0268264_10055549 | Ga0268264_100555493 | 132 |
| 641 | 3300028381 | Ga0268264_10292401 | Ga0268264_102924012 | 132 |
| 642 | 3300028381 | Ga0268264_10568056 | Ga0268264_105680562 | 132 |
| 643 | 3300028381 | Ga0268264_10893234 | Ga0268264_108932342 | 132 |
| 644 | 3300028381 | Ga0268264_11123623 | Ga0268264_111236232 | 132 |
| 645 | 3300028381 | Ga0268264_11758227 | Ga0268264_117582271 | 132 |
| 646 | 3300028556 | Ga0265337_1007001 | Ga0265337_10070014 | 132 |
| 647 | 3300028558 | Ga0265326_10065353 | Ga0265326_100653532 | 132 |
| 648 | 3300028563 | Ga0265319_1006536 | Ga0265319_10065364 | 132 |
| 649 | 3300028573 | Ga0265334_10001696 | Ga0265334_1000169610 | 132 |
| 650 | 3300028577 | Ga0265318_10008197 | Ga0265318_100081975 | 132 |
| 651 | 3300028653 | Ga0265323_10001106 | Ga0265323_100011063 | 132 |
| 652 | 3300028654 | Ga0265322_10001590 | Ga0265322_100015903 | 132 |
| 653 | 3300028666 | Ga0265336_10000135 | Ga0265336_1000013533 | 132 |
| 654 | 3300028786 | Ga0307517_10000634 | Ga0307517_1000063446 | 132 |
| 655 | 3300028786 | Ga0307517_10039620 | Ga0307517_100396205 | 132 |
| 656 | 3300028786 | Ga0307517_10324896 | Ga0307517_103248962 | 132 |
| 657 | 3300028786 | Ga0307517_10594244 | Ga0307517_105942441 | 132 |
| 658 | 3300028794 | Ga0307515_10512273 | Ga0307515_105122732 | 132 |
| 659 | 3300028800 | Ga0265338_10000034 | Ga0265338_10000034173 | 132 |
| 660 | 3300028800 | Ga0265338_10361635 | Ga0265338_103616351 | 132 |
| 661 | 3300029957 | Ga0265324_10001466 | Ga0265324_100014669 | 132 |
| 662 | 3300029957 | Ga0265324_10156835 | Ga0265324_101568351 | 132 |
| 663 | 3300030521 | Ga0307511_10024264 | Ga0307511_100242642 | 132 |
| 664 | 3300031238 | Ga0265332_10013209 | Ga0265332_100132094 | 132 |
| 665 | 3300031456 | Ga0307513_10125438 | Ga0307513_101254385 | 132 |
| 666 | 3300031456 | Ga0307513_10444506 | Ga0307513_104445062 | 132 |
| 667 | 3300031456 | Ga0307513_10645174 | Ga0307513_106451741 | 132 |
| 668 | 3300031507 | Ga0307509_10132445 | Ga0307509_101324452 | 132 |
| 669 | 3300031507 | Ga0307509_10826352 | Ga0307509_108263522 | 132 |
| 670 | 3300031616 | Ga0307508_10000032 | Ga0307508_1000003279 | 132 |
| 671 | 3300031616 | Ga0307508_10022899 | Ga0307508_100228995 | 132 |
| 672 | 3300031616 | Ga0307508_10139265 | Ga0307508_101392653 | 132 |
| 673 | 3300031616 | Ga0307508_10715631 | Ga0307508_107156312 | 132 |
| 674 | 3300031711 | Ga0265314_10195305 | Ga0265314_101953052 | 132 |
| 675 | 3300031730 | Ga0307516_10005934 | Ga0307516_100059343 | 132 |
| 676 | 3300031730 | Ga0307516_10039539 | Ga0307516_100395392 | 132 |
| 677 | 3300031730 | Ga0307516_10300751 | Ga0307516_103007512 | 132 |
| 678 | 3300031731 | Ga0307405_10879540 | Ga0307405_108795402 | 132 |
| 679 | 3300031824 | Ga0307413_10061917 | Ga0307413_100619172 | 132 |
| 680 | 3300031824 | Ga0307413_10440005 | Ga0307413_104400052 | 132 |
| 681 | 3300031852 | Ga0307410_10143713 | Ga0307410_101437132 | 132 |
| 682 | 3300031901 | Ga0307406_10896882 | Ga0307406_108968822 | 132 |
| 683 | 3300031903 | Ga0307407_10186122 | Ga0307407_101861222 | 132 |
| 684 | 3300031911 | Ga0307412_10093307 | Ga0307412_100933072 | 132 |
| 685 | 3300031911 | Ga0307412_11811460 | Ga0307412_118114601 | 132 |
| 686 | 3300032002 | Ga0307416_100738479 | Ga0307416_1007384792 | 132 |
| 687 | 3300032005 | Ga0307411_10300285 | Ga0307411_103002852 | 132 |
| 688 | 3300032126 | Ga0307415_100094054 | Ga0307415_1000940542 | 132 |
| 689 | 3300032126 | Ga0307415_100687932 | Ga0307415_1006879322 | 132 |
| 690 | 3300033179 | Ga0307507_10011278 | Ga0307507_1001127811 | 132 |
| 691 | 3300033180 | Ga0307510_10016157 | Ga0307510_100161576 | 132 |
| 692 | 3300033180 | Ga0307510_10091519 | Ga0307510_100915192 | 132 |
| 693 | 3300034816 | Ga0373930_0001351 | Ga0373930_0001351_1853_2251 | 132 |
| 694 | 3300034820 | Ga0373959_0055718 | Ga0373959_0055718_389_787 | 132 |
| 695 | 3300035083 | Ga0373926_0007554 | Ga0373926_0007554_2595_2993 | 132 |
| 696 | 3300035086 | Ga0373934_0187215 | Ga0373934_0187215_10_408 | 132 |
| 697 | 3300035091 | Ga0373951_0013653 | Ga0373951_0013653_944_1342 | 132 |
| 698 | 3300035092 | Ga0373952_0108085 | Ga0373952_0108085_103_501 | 132 |
| 699 | 3300035111 | Ga0373923_0061471 | Ga0373923_0061471_936_1334 | 132 |
| 700 | 3300035111 | Ga0373923_0236904 | Ga0373923_0236904_267_677 | 132 |
| 701 | 3300035113 | Ga0373936_0061479 | Ga0373936_0061479_17_415 | 132 |
| 702 | 3300035113 | Ga0373936_0068996 | Ga0373936_0068996_244_642 | 132 |
| 703 | 3300035114 | Ga0373939_0227291 | Ga0373939_0227291_207_605 | 132 |
| 704 | 3300035114 | Ga0373939_0489452 | Ga0373939_0489452_71_469 | 132 |
| 705 | 3300035118 | Ga0373954_0081500 | Ga0373954_0081500_287_685 | 132 |
| 706 | 3300035118 | Ga0373954_0166773 | Ga0373954_0166773_13_411 | 132 |
| 707 | 3300035119 | Ga0373956_0304788 | Ga0373956_0304788_239_637 | 132 |
| 708 | 3300035119 | Ga0373956_0407056 | Ga0373956_0407056_201_599 | 132 |
| 709 | 3300035170 | Ga0373943_0083782 | Ga0373943_0083782_14_412 | 132 |
| 710 | 3300035171 | Ga0373946_0026464 | Ga0373946_0026464_1065_1463 | 132 |
| 711 | 3300035171 | Ga0373946_0058279 | Ga0373946_0058279_289_687 | 132 |
| 712 | 3300035172 | Ga0373955_0040395 | Ga0373955_0040395_1358_1756 | 132 |
| 713 | 3300035172 | Ga0373955_0058451 | Ga0373955_0058451_660_1058 | 132 |
| 714 | 3300035172 | Ga0373955_0880774 | Ga0373955_0880774_34_432 | 132 |
| 715 | 3300035410 | Ga0373924_0017175 | Ga0373924_0017175_387_785 | 132 |
| 716 | 3300035691 | Ga0373931_0002187 | Ga0373931_0002187_4643_5041 | 132 |
| 717 | 3300035691 | Ga0373931_0384182 | Ga0373931_0384182_206_604 | 132 |
| 718 | 3300035691 | Ga0373931_0390676 | Ga0373931_0390676_421_819 | 132 |
| 719 | 3300035691 | Ga0373931_0434475 | Ga0373931_0434475_247_645 | 132 |
| 720 | 3300035691 | Ga0373931_1246755 | Ga0373931_1246755_72_470 | 132 |
| 721 | 3300035692 | Ga0373935_0012923 | Ga0373935_0012923_1030_1428 | 132 |
| 722 | 3300035692 | Ga0373935_0032924 | Ga0373935_0032924_2111_2509 | 132 |
| 723 | 3300035692 | Ga0373935_0063455 | Ga0373935_0063455_1801_2235 | 132 |
| 724 | 3300035692 | Ga0373935_0069468 | Ga0373935_0069468_1307_1705 | 132 |
| 725 | 3300035692 | Ga0373935_0324990 | Ga0373935_0324990_587_985 | 132 |
| 726 | 3300035692 | Ga0373935_0607081 | Ga0373935_0607081_343_741 | 132 |
| 727 | 3300035695 | Ga0373927_0014717 | Ga0373927_0014717_298_732 | 132 |
| 728 | 3300035695 | Ga0373927_0015621 | Ga0373927_0015621_1971_2369 | 132 |
| 729 | 3300035695 | Ga0373927_0044610 | Ga0373927_0044610_1253_1651 | 132 |
| 730 | 3300035695 | Ga0373927_0060854 | Ga0373927_0060854_1717_2115 | 132 |
| 731 | 3300035695 | Ga0373927_0169814 | Ga0373927_0169814_134_532 | 132 |
| 732 | 3300035695 | Ga0373927_0523744 | Ga0373927_0523744_277_675 | 132 |
| 733 | 3300035695 | Ga0373927_0605220 | Ga0373927_0605220_218_616 | 132 |
| 734 | 3300035695 | Ga0373927_0732936 | Ga0373927_0732936_193_591 | 132 |
| 735 | 3300035724 | Ga0373933_0000182 | Ga0373933_0000182_19541_19939 | 132 |
| 736 | 3300035724 | Ga0373933_0219645 | Ga0373933_0219645_307_705 | 132 |
| 737 | 3300035724 | Ga0373933_1055597 | Ga0373933_1055597_55_453 | 132 |
| 738 | 3300035725 | Ga0373947_0025925 | Ga0373947_0025925_2445_2843 | 132 |
| 739 | 3300035725 | Ga0373947_0028707 | Ga0373947_0028707_1948_2382 | 132 |
| 740 | 3300035725 | Ga0373947_0076608 | Ga0373947_0076608_1619_2017 | 132 |
| 741 | 3300036401 | Ga0373937_0399859 | Ga0373937_0399859_40_438 | 132 |
| 742 | 3300036459 | Ga0372808_009572 | Ga0372808_009572_55_453 | 132 |
| 743 | 3300037068 | Ga0373925_0025108 | Ga0373925_0025108_352_750 | 132 |
| 744 | 3300037068 | Ga0373925_0054383 | Ga0373925_0054383_437_835 | 132 |
| 745 | 3300037068 | Ga0373925_0102550 | Ga0373925_0102550_329_727 | 132 |
| 746 | 3300037068 | Ga0373925_0125508 | Ga0373925_0125508_111_509 | 132 |
| 747 | 3300037068 | Ga0373925_0453465 | Ga0373925_0453465_104_502 | 132 |
| 748 | 3300037068 | Ga0373925_0589940 | Ga0373925_0589940_34_432 | 132 |
| 749 | 3300037418 | Ga0395900_0017080 | Ga0395900_0017080_2636_3034 | 132 |
| 750 | 3300037418 | Ga0395900_0082779 | Ga0395900_0082779_95_493 | 132 |
| 751 | 3300037418 | Ga0395900_0200935 | Ga0395900_0200935_732_1130 | 132 |
| 752 | 3300037466 | Ga0395898_0099842 | Ga0395898_0099842_1513_1911 | 132 |
| 753 | 3300038443 | Ga0395901_0044477 | Ga0395901_0044477_1453_1851 | 132 |
| 754 | 3300038443 | Ga0395901_0153963 | Ga0395901_0153963_1804_2202 | 132 |
| 755 | 3300038443 | Ga0395901_0251715 | Ga0395901_0251715_395_793 | 132 |
| 756 | 3300039437 | Ga0436365_0229539 | Ga0436365_0229539_119_517 | 132 |
| 757 | 3300039437 | Ga0436365_0585470 | Ga0436365_0585470_250_648 | 132 |
| 758 | 3300039437 | Ga0436365_0644236 | Ga0436365_0644236_474_872 | 132 |
| 759 | 3300039437 | Ga0436365_1524424 | Ga0436365_1524424_206_604 | 132 |
| 760 | 3300039437 | Ga0436365_1891875 | Ga0436365_1891875_61_459 | 132 |
| 761 | 3300039450 | Ga0436363_0194304 | Ga0436363_0194304_787_1185 | 132 |
| 762 | 3300039450 | Ga0436363_0749925 | Ga0436363_0749925_60_458 | 132 |
| 763 | 3300039450 | Ga0436363_1284900 | Ga0436363_1284900_2262_2660 | 132 |
| 764 | 3300041413 | Ga0439465_0026133 | Ga0439465_0026133_213_611 | 132 |
| 765 | 3300041452 | Ga0451793_1610473 | Ga0451793_1610473_365_763 | 132 |
| 766 | 3300041486 | Ga0451807_0104523 | Ga0451807_0104523_22_432 | 132 |
| 767 | 3300041507 | Ga0451851_0290019 | Ga0451851_0290019_91_489 | 132 |
| 768 | 3300041511 | Ga0451855_0070536 | Ga0451855_0070536_453_851 | 132 |
| 769 | 3300041512 | Ga0451853_1007521 | Ga0451853_1007521_357_755 | 132 |
| 770 | 3300042438 | Ga0439459_0016118 | Ga0439459_0016118_835_1233 | 132 |
| 771 | 3300044693 | Ga0466961_0065107 | Ga0466961_0065107_10_408 | 132 |
| 772 | 3300044706 | Ga0466964_0154855 | Ga0466964_0154855_28_426 | 132 |
| 773 | 3300044719 | Ga0466971_0518372 | Ga0466971_0518372_20_418 | 132 |
| 774 | 3300044765 | Ga0466970_0232843 | Ga0466970_0232843_186_605 | 132 |
| 775 | 3300045049 | Ga0466959_0778571 | Ga0466959_0778571_46_444 | 132 |
| 776 | 3300045976 | Ga0466967_0285270 | Ga0466967_0285270_1114_1530 | 132 |
| 777 | 3300045976 | Ga0466967_0306657 | Ga0466967_0306657_784_1182 | 132 |
| 778 | 3300045976 | Ga0466967_0347873 | Ga0466967_0347873_667_1065 | 132 |
| 779 | 3300045976 | Ga0466967_0392747 | Ga0466967_0392747_71_469 | 132 |
| 780 | 3300046452 | Ga0495617_013046 | Ga0495617_013046_2025_2423 | 132 |
| 781 | 3300046452 | Ga0495617_155269 | Ga0495617_155269_165_575 | 132 |
| 782 | 3300046454 | Ga0495592_0022948 | Ga0495592_0022948_637_1035 | 132 |
| 783 | 3300046454 | Ga0495592_0068249 | Ga0495592_0068249_898_1296 | 132 |
| 784 | 3300046455 | Ga0495603_0003836 | Ga0495603_0003836_7865_8263 | 132 |
| 785 | 3300046455 | Ga0495603_0023547 | Ga0495603_0023547_1563_1973 | 132 |
| 786 | 3300046455 | Ga0495603_0043708 | Ga0495603_0043708_1665_2123 | 132 |
| 787 | 3300046455 | Ga0495603_0080616 | Ga0495603_0080616_1187_1585 | 132 |
| 788 | 3300046455 | Ga0495603_0622622 | Ga0495603_0622622_135_533 | 132 |
| 789 | 3300046459 | Ga0495629_0000862 | Ga0495629_0000862_8510_8908 | 132 |
| 790 | 3300046459 | Ga0495629_0091399 | Ga0495629_0091399_162_560 | 132 |
| 791 | 3300046459 | Ga0495629_0406317 | Ga0495629_0406317_188_598 | 132 |
| 792 | 3300046460 | Ga0495638_0019608 | Ga0495638_0019608_2575_2973 | 132 |
| 793 | 3300046460 | Ga0495638_0148689 | Ga0495638_0148689_378_788 | 132 |
| 794 | 3300046460 | Ga0495638_0200917 | Ga0495638_0200917_498_896 | 132 |
| 795 | 3300046461 | Ga0495641_0348703 | Ga0495641_0348703_164_574 | 132 |
| 796 | 3300046462 | Ga0495651_0267567 | Ga0495651_0267567_246_644 | 132 |
| 797 | 3300046463 | Ga0495653_0373644 | Ga0495653_0373644_25_423 | 132 |
| 798 | 3300046472 | Ga0495580_0010268 | Ga0495580_0010268_22_420 | 132 |
| 799 | 3300046472 | Ga0495580_0037193 | Ga0495580_0037193_2166_2564 | 132 |
| 800 | 3300046472 | Ga0495580_0059540 | Ga0495580_0059540_573_1007 | 132 |
| 801 | 3300046473 | Ga0495582_0006572 | Ga0495582_0006572_3254_3652 | 132 |
| 802 | 3300046473 | Ga0495582_0025793 | Ga0495582_0025793_735_1133 | 132 |
| 803 | 3300046473 | Ga0495582_0107941 | Ga0495582_0107941_991_1425 | 132 |
| 804 | 3300046473 | Ga0495582_0187308 | Ga0495582_0187308_518_916 | 132 |
| 805 | 3300046474 | Ga0495605_0194958 | Ga0495605_0194958_186_584 | 132 |
| 806 | 3300046475 | Ga0495639_0000544 | Ga0495639_0000544_14230_14628 | 132 |
| 807 | 3300046475 | Ga0495639_0703245 | Ga0495639_0703245_85_483 | 132 |
| 808 | 3300046476 | Ga0495662_0042974 | Ga0495662_0042974_645_1043 | 132 |
| 809 | 3300046477 | Ga0495664_0063932 | Ga0495664_0063932_337_735 | 132 |
| 810 | 3300046477 | Ga0495664_0077097 | Ga0495664_0077097_1470_1868 | 132 |
| 811 | 3300046492 | Ga0495585_0032350 | Ga0495585_0032350_1902_2300 | 132 |
| 812 | 3300046492 | Ga0495585_0037849 | Ga0495585_0037849_1303_1701 | 132 |
| 813 | 3300046492 | Ga0495585_0341597 | Ga0495585_0341597_70_468 | 132 |
| 814 | 3300046492 | Ga0495585_0355030 | Ga0495585_0355030_129_539 | 132 |
| 815 | 3300046492 | Ga0495585_0388404 | Ga0495585_0388404_142_540 | 132 |
| 816 | 3300046499 | Ga0495594_0026789 | Ga0495594_0026789_85_483 | 132 |
| 817 | 3300046499 | Ga0495594_0154774 | Ga0495594_0154774_793_1191 | 132 |
| 818 | 3300046499 | Ga0495594_0198833 | Ga0495594_0198833_108_542 | 132 |
| 819 | 3300046500 | Ga0495596_0066425 | Ga0495596_0066425_328_726 | 132 |
| 820 | 3300046507 | Ga0495606_0253460 | Ga0495606_0253460_200_598 | 132 |
| 821 | 3300046507 | Ga0495606_0551029 | Ga0495606_0551029_25_423 | 132 |
| 822 | 3300046511 | Ga0495608_0143484 | Ga0495608_0143484_194_592 | 132 |
| 823 | 3300046512 | Ga0495610_0144252 | Ga0495610_0144252_11_409 | 132 |
| 824 | 3300046512 | Ga0495610_0249092 | Ga0495610_0249092_11_409 | 132 |
| 825 | 3300046512 | Ga0495610_0337008 | Ga0495610_0337008_15_413 | 132 |
| 826 | 3300046513 | Ga0495616_0269497 | Ga0495616_0269497_237_635 | 132 |
| 827 | 3300046514 | Ga0495618_0430387 | Ga0495618_0430387_23_421 | 132 |
| 828 | 3300046515 | Ga0495620_0088969 | Ga0495620_0088969_815_1213 | 132 |
| 829 | 3300046517 | Ga0495630_0026624 | Ga0495630_0026624_825_1223 | 132 |
| 830 | 3300046517 | Ga0495630_0029536 | Ga0495630_0029536_1223_1621 | 132 |
| 831 | 3300046518 | Ga0495631_0067517 | Ga0495631_0067517_508_906 | 132 |
| 832 | 3300046518 | Ga0495631_0191757 | Ga0495631_0191757_437_847 | 132 |
| 833 | 3300046518 | Ga0495631_0215006 | Ga0495631_0215006_403_801 | 132 |
| 834 | 3300046518 | Ga0495631_0284483 | Ga0495631_0284483_177_575 | 132 |
| 835 | 3300046518 | Ga0495631_0307965 | Ga0495631_0307965_94_492 | 132 |
| 836 | 3300046519 | Ga0495632_0136433 | Ga0495632_0136433_17_415 | 132 |
| 837 | 3300046519 | Ga0495632_0227779 | Ga0495632_0227779_65_463 | 132 |
| 838 | 3300046523 | Ga0495644_0073339 | Ga0495644_0073339_62_460 | 132 |
| 839 | 3300046525 | Ga0495663_0081096 | Ga0495663_0081096_572_970 | 132 |
| 840 | 3300046526 | Ga0495666_0051203 | Ga0495666_0051203_1568_1966 | 132 |
| 841 | 3300046526 | Ga0495666_0502043 | Ga0495666_0502043_32_430 | 132 |
| 842 | 3300046529 | Ga0495652_0111297 | Ga0495652_0111297_1714_2112 | 132 |
| 843 | 3300046529 | Ga0495652_0465025 | Ga0495652_0465025_308_736 | 132 |
| 844 | 3300046531 | Ga0495665_0007397 | Ga0495665_0007397_4901_5299 | 132 |
| 845 | 3300046531 | Ga0495665_0155014 | Ga0495665_0155014_735_1133 | 132 |
| 846 | 3300046531 | Ga0495665_0208083 | Ga0495665_0208083_132_566 | 132 |
| 847 | 3300046533 | Ga0495640_0002595 | Ga0495640_0002595_1245_1643 | 132 |
| 848 | 3300046533 | Ga0495640_0853911 | Ga0495640_0853911_48_446 | 132 |
| 849 | 3300046535 | Ga0495586_0111796 | Ga0495586_0111796_818_1216 | 132 |
| 850 | 3300046536 | Ga0495587_0035087 | Ga0495587_0035087_2031_2429 | 132 |
| 851 | 3300046537 | Ga0495598_0383886 | Ga0495598_0383886_122_520 | 132 |
| 852 | 3300046538 | Ga0495609_0135061 | Ga0495609_0135061_69_467 | 132 |
| 853 | 3300046538 | Ga0495609_0318243 | Ga0495609_0318243_25_423 | 132 |
| 854 | 3300046542 | Ga0495597_0086925 | Ga0495597_0086925_385_783 | 132 |
| 855 | 3300046543 | Ga0495645_0228866 | Ga0495645_0228866_806_1204 | 132 |
| 856 | 3300046543 | Ga0495645_0466904 | Ga0495645_0466904_341_739 | 132 |
| 857 | 3300046543 | Ga0495645_0617971 | Ga0495645_0617971_40_504 | 132 |
| 858 | 3300046543 | Ga0495645_0750689 | Ga0495645_0750689_93_491 | 132 |
| 859 | 3300046557 | Ga0495622_0012042 | Ga0495622_0012042_2470_2868 | 132 |
| 860 | 3300046557 | Ga0495622_0064031 | Ga0495622_0064031_23_421 | 132 |
| 861 | 3300046558 | Ga0495633_0267211 | Ga0495633_0267211_62_460 | 132 |
| 862 | 3300046559 | Ga0495667_0154776 | Ga0495667_0154776_28_426 | 132 |
| 863 | 3300046559 | Ga0495667_0785131 | Ga0495667_0785131_81_479 | 132 |
| 864 | 3300046615 | Ga0495656_0026839 | Ga0495656_0026839_818_1216 | 132 |
| 865 | 3300046615 | Ga0495656_0052703 | Ga0495656_0052703_1187_1585 | 132 |
| 866 | 3300046615 | Ga0495656_0179193 | Ga0495656_0179193_97_495 | 132 |
| 867 | 3300046616 | Ga0495668_0077670 | Ga0495668_0077670_401_799 | 132 |
| 868 | 3300046616 | Ga0495668_0085192 | Ga0495668_0085192_599_997 | 132 |
| 869 | 3300046616 | Ga0495668_0249305 | Ga0495668_0249305_122_520 | 132 |
| 870 | 3300046616 | Ga0495668_0255578 | Ga0495668_0255578_209_607 | 132 |
| 871 | 3300046616 | Ga0495668_0282838 | Ga0495668_0282838_482_880 | 132 |
| 872 | 3300046642 | Ga0495634_0290709 | Ga0495634_0290709_494_892 | 132 |
| 873 | 3300046648 | Ga0495611_0072829 | Ga0495611_0072829_437_847 | 132 |
| 874 | 3300046648 | Ga0495611_0121136 | Ga0495611_0121136_644_1042 | 132 |
| 875 | 3300046648 | Ga0495611_0316384 | Ga0495611_0316384_302_700 | 132 |
| 876 | 3300046660 | Ga0495625_0183777 | Ga0495625_0183777_366_764 | 132 |
| 877 | 3300046660 | Ga0495625_0433421 | Ga0495625_0433421_183_581 | 132 |
| 878 | 3300046660 | Ga0495625_0484986 | Ga0495625_0484986_337_747 | 132 |
| 879 | 3300046660 | Ga0495625_0590184 | Ga0495625_0590184_46_444 | 132 |
| 880 | 3300046663 | Ga0495635_0000436 | Ga0495635_0000436_2633_3031 | 132 |
| 881 | 3300046663 | Ga0495635_0070320 | Ga0495635_0070320_561_959 | 132 |
| 882 | 3300046663 | Ga0495635_0402096 | Ga0495635_0402096_152_550 | 132 |
| 883 | 3300046664 | Ga0495659_0060867 | Ga0495659_0060867_452_850 | 132 |
| 884 | 3300046665 | Ga0495661_0085330 | Ga0495661_0085330_917_1315 | 132 |
| 885 | 3300046665 | Ga0495661_0326307 | Ga0495661_0326307_353_751 | 132 |
| 886 | 3300046674 | Ga0495588_0013756 | Ga0495588_0013756_2280_2678 | 132 |
| 887 | 3300046675 | Ga0495657_0827946 | Ga0495657_0827946_31_429 | 132 |
| 888 | 3300046678 | Ga0495599_0138845 | Ga0495599_0138845_858_1256 | 132 |
| 889 | 3300046678 | Ga0495599_0400473 | Ga0495599_0400473_268_666 | 132 |
| 890 | 3300046678 | Ga0495599_0891822 | Ga0495599_0891822_26_490 | 132 |
| 891 | 3300046679 | Ga0495623_0599247 | Ga0495623_0599247_56_454 | 132 |
| 892 | 3300046680 | Ga0495646_0078212 | Ga0495646_0078212_1371_1769 | 132 |
| 893 | 3300046681 | Ga0495647_0474697 | Ga0495647_0474697_126_524 | 132 |
| 894 | 3300046683 | Ga0495658_0375563 | Ga0495658_0375563_161_559 | 132 |
| 895 | 3300046684 | Ga0495669_0000650 | Ga0495669_0000650_6022_6420 | 132 |
| 896 | 3300046684 | Ga0495669_0125391 | Ga0495669_0125391_334_732 | 132 |
| 897 | 3300046684 | Ga0495669_0252889 | Ga0495669_0252889_294_692 | 132 |
| 898 | 3300046684 | Ga0495669_0608343 | Ga0495669_0608343_25_423 | 132 |
| 899 | 3300046689 | Ga0495613_0013842 | Ga0495613_0013842_1501_1899 | 132 |
| 900 | 3300046690 | Ga0495624_0023168 | Ga0495624_0023168_3614_4012 | 132 |
| 901 | 3300046690 | Ga0495624_0044261 | Ga0495624_0044261_720_1118 | 132 |
| 902 | 3300046690 | Ga0495624_0312140 | Ga0495624_0312140_202_636 | 132 |
| 903 | 3300046691 | Ga0495670_0044258 | Ga0495670_0044258_1368_1766 | 132 |
| 904 | 3300046691 | Ga0495670_0187388 | Ga0495670_0187388_534_932 | 132 |
| 905 | 3300046691 | Ga0495670_0245510 | Ga0495670_0245510_367_765 | 132 |
| 906 | 3300046691 | Ga0495670_0341585 | Ga0495670_0341585_62_460 | 132 |
| 907 | 3300046694 | Ga0495649_0070708 | Ga0495649_0070708_799_1197 | 132 |
| 908 | 3300046694 | Ga0495649_0220052 | Ga0495649_0220052_207_605 | 132 |
| 909 | 3300046694 | Ga0495649_0505208 | Ga0495649_0505208_26_424 | 132 |
| 910 | 3300046694 | Ga0495649_0565877 | Ga0495649_0565877_117_515 | 132 |
| 911 | 3300046794 | Ga0495589_0051689 | Ga0495589_0051689_44_442 | 132 |
| 912 | 3300046794 | Ga0495589_0116759 | Ga0495589_0116759_335_733 | 132 |
| 913 | 3300046794 | Ga0495589_0258396 | Ga0495589_0258396_117_527 | 132 |
| 914 | 3300047315 | Ga0495581_0282336 | Ga0495581_0282336_85_483 | 132 |
| 915 | 3300047317 | Ga0495604_0323740 | Ga0495604_0323740_468_866 | 132 |
| 916 | 3300047318 | Ga0495636_0041720 | Ga0495636_0041720_118_516 | 132 |
| 917 | 3300047319 | Ga0495674_0008459 | Ga0495674_0008459_3644_4042 | 132 |
| 918 | 3300047319 | Ga0495674_0213064 | Ga0495674_0213064_104_502 | 132 |
| 919 | 3300047319 | Ga0495674_1290039 | Ga0495674_1290039_99_497 | 132 |
| 920 | 3300047320 | Ga0495672_0043612 | Ga0495672_0043612_981_1379 | 132 |
| 921 | 3300047320 | Ga0495672_0079874 | Ga0495672_0079874_974_1372 | 132 |
| 922 | 3300047320 | Ga0495672_0516335 | Ga0495672_0516335_29_427 | 132 |
| 923 | 3300047321 | Ga0495676_0192322 | Ga0495676_0192322_309_707 | 132 |
| 924 | 3300047321 | Ga0495676_0210521 | Ga0495676_0210521_251_685 | 132 |
| 925 | 3300047321 | Ga0495676_0306496 | Ga0495676_0306496_296_694 | 132 |
| 926 | 3300047323 | Ga0495683_0402623 | Ga0495683_0402623_70_480 | 132 |
| 927 | 3300047447 | Ga0495685_145900 | Ga0495685_145900_92_490 | 132 |
| 928 | 3300047447 | Ga0495685_292251 | Ga0495685_292251_21_419 | 132 |
| 929 | 3300047469 | Ga0495673_0116317 | Ga0495673_0116317_376_786 | 132 |
| 930 | 3300047470 | Ga0495681_0098221 | Ga0495681_0098221_252_650 | 132 |
| 931 | 3300047471 | Ga0495684_0028441 | Ga0495684_0028441_1638_2036 | 132 |
| 932 | 3300047472 | Ga0495686_0026279 | Ga0495686_0026279_2016_2414 | 132 |
| 933 | 3300047472 | Ga0495686_0693037 | Ga0495686_0693037_50_448 | 132 |
| 934 | 3300047673 | Ga0495593_0021586 | Ga0495593_0021586_437_835 | 132 |
| 935 | 3300047673 | Ga0495593_0133176 | Ga0495593_0133176_787_1185 | 132 |
| 936 | 3300047673 | Ga0495593_0522266 | Ga0495593_0522266_128_526 | 132 |
| 937 | 3300048089 | Ga0495614_0032035 | Ga0495614_0032035_1207_1605 | 132 |
| 938 | 3300048090 | Ga0495615_0137137 | Ga0495615_0137137_20_418 | 132 |
| 939 | 3300048903 | Ga0496100_0131977 | Ga0496100_0131977_338_736 | 132 |
| 940 | 3300048903 | Ga0496100_0506484 | Ga0496100_0506484_123_521 | 132 |
| 941 | 3300048903 | Ga0496100_1029391 | Ga0496100_1029391_142_540 | 132 |
| 942 | 3300048903 | Ga0496100_1096012 | Ga0496100_1096012_101_499 | 132 |
| 943 | 3300048904 | Ga0496101_0002052 | Ga0496101_0002052_990_1388 | 132 |
| 944 | 3300048904 | Ga0496101_0177563 | Ga0496101_0177563_636_1034 | 132 |
| 945 | 3300048904 | Ga0496101_0590416 | Ga0496101_0590416_15_413 | 132 |
| 946 | 3300048904 | Ga0496101_0601141 | Ga0496101_0601141_248_646 | 132 |
| 947 | 3300048905 | Ga0496102_0001771 | Ga0496102_0001771_10086_10484 | 132 |
| 948 | 3300048905 | Ga0496102_0028325 | Ga0496102_0028325_1562_1960 | 132 |
| 949 | 3300048905 | Ga0496102_0228574 | Ga0496102_0228574_262_660 | 132 |
| 950 | 3300048905 | Ga0496102_0789710 | Ga0496102_0789710_429_827 | 132 |
| 951 | 3300048905 | Ga0496102_1180376 | Ga0496102_1180376_83_481 | 132 |
| 952 | 3300048905 | Ga0496102_1421870 | Ga0496102_1421870_67_465 | 132 |
| 953 | 3300048906 | Ga0496103_0005699 | Ga0496103_0005699_1625_2023 | 132 |
| 954 | 3300048906 | Ga0496103_0103765 | Ga0496103_0103765_208_606 | 132 |
| 955 | 3300048906 | Ga0496103_0345511 | Ga0496103_0345511_157_555 | 132 |
| 956 | 3300048907 | Ga0496104_0074499 | Ga0496104_0074499_1138_1536 | 132 |
| 957 | 3300048908 | Ga0496105_0042375 | Ga0496105_0042375_774_1172 | 132 |
| 958 | 3300048908 | Ga0496105_0085872 | Ga0496105_0085872_565_963 | 132 |
| 959 | 3300048909 | Ga0496106_0002858 | Ga0496106_0002858_10904_11302 | 132 |
| 960 | 3300048909 | Ga0496106_0009997 | Ga0496106_0009997_5353_5751 | 132 |
| 961 | 3300048909 | Ga0496106_0041953 | Ga0496106_0041953_1182_1580 | 132 |
| 962 | 3300048910 | Ga0496107_0002387 | Ga0496107_0002387_10907_11305 | 132 |
| 963 | 3300048910 | Ga0496107_0009519 | Ga0496107_0009519_1588_1986 | 132 |
| 964 | 3300048910 | Ga0496107_0051319 | Ga0496107_0051319_2208_2606 | 132 |
| 965 | 3300048910 | Ga0496107_0713590 | Ga0496107_0713590_177_575 | 132 |
| 966 | 3300048911 | Ga0496108_0016020 | Ga0496108_0016020_990_1388 | 132 |
| 967 | 3300048911 | Ga0496108_0524321 | Ga0496108_0524321_385_783 | 132 |
| 968 | 3300048911 | Ga0496108_0735223 | Ga0496108_0735223_107_505 | 132 |
| 969 | 3300048911 | Ga0496108_0781677 | Ga0496108_0781677_235_633 | 132 |
| 970 | 3300048912 | Ga0496109_0007060 | Ga0496109_0007060_355_753 | 132 |
| 971 | 3300048912 | Ga0496109_0197825 | Ga0496109_0197825_564_962 | 132 |
| 972 | 3300048912 | Ga0496109_0971871 | Ga0496109_0971871_243_641 | 132 |
| 973 | 3300048913 | Ga0496110_0004493 | Ga0496110_0004493_6277_6675 | 132 |
| 974 | 3300048913 | Ga0496110_0015025 | Ga0496110_0015025_4560_4958 | 132 |
| 975 | 3300048913 | Ga0496110_0119761 | Ga0496110_0119761_1866_2264 | 132 |
| 976 | 3300048913 | Ga0496110_0153298 | Ga0496110_0153298_1214_1612 | 132 |
| 977 | 3300048913 | Ga0496110_0188337 | Ga0496110_0188337_47_445 | 132 |
| 978 | 3300048913 | Ga0496110_0291341 | Ga0496110_0291341_534_932 | 132 |
| 979 | 3300048913 | Ga0496110_0608064 | Ga0496110_0608064_188_586 | 132 |
| 980 | 3300048914 | Ga0496111_0117480 | Ga0496111_0117480_131_529 | 132 |
| 981 | 3300048914 | Ga0496111_0459520 | Ga0496111_0459520_468_866 | 132 |
| 982 | 3300048915 | Ga0496112_0000017 | Ga0496112_0000017_131980_132378 | 132 |
| 983 | 3300048915 | Ga0496112_0013582 | Ga0496112_0013582_2649_3047 | 132 |
| 984 | 3300048915 | Ga0496112_0105142 | Ga0496112_0105142_149_547 | 132 |
| 985 | 3300048915 | Ga0496112_0157337 | Ga0496112_0157337_1554_1952 | 132 |
| 986 | 3300048915 | Ga0496112_0172126 | Ga0496112_0172126_252_650 | 132 |
| 987 | 3300048915 | Ga0496112_0423891 | Ga0496112_0423891_408_806 | 132 |
| 988 | 3300048916 | Ga0496113_0031143 | Ga0496113_0031143_3074_3472 | 132 |
| 989 | 3300048916 | Ga0496113_0048870 | Ga0496113_0048870_1761_2159 | 132 |
| 990 | 3300048917 | Ga0496114_0011547 | Ga0496114_0011547_5683_6081 | 132 |
| 991 | 3300048917 | Ga0496114_0062101 | Ga0496114_0062101_191_589 | 132 |
| 992 | 3300048917 | Ga0496114_0254127 | Ga0496114_0254127_545_943 | 132 |
| 993 | 3300048918 | Ga0496115_0000535 | Ga0496115_0000535_24451_24849 | 132 |
| 994 | 3300048918 | Ga0496115_0492551 | Ga0496115_0492551_302_700 | 132 |
| 995 | 3300048918 | Ga0496115_1352674 | Ga0496115_1352674_109_507 | 132 |
| 996 | 3300048920 | Ga0496117_0129636 | Ga0496117_0129636_909_1307 | 132 |
| 997 | 3300048920 | Ga0496117_0608009 | Ga0496117_0608009_49_459 | 132 |
| 998 | 3300048921 | Ga0496118_0003407 | Ga0496118_0003407_10718_11116 | 132 |
| 999 | 3300048922 | Ga0496119_0269894 | Ga0496119_0269894_121_519 | 132 |
| 1000 | 3300048922 | Ga0496119_0291385 | Ga0496119_0291385_22_420 | 132 |
| 1001 | 3300048924 | Ga0496121_0045020 | Ga0496121_0045020_2587_2985 | 132 |
| 1002 | 3300048924 | Ga0496121_0129108 | Ga0496121_0129108_1376_1774 | 132 |
| 1003 | 3300048924 | Ga0496121_0224635 | Ga0496121_0224635_640_1038 | 132 |
| 1004 | 3300048924 | Ga0496121_0291596 | Ga0496121_0291596_118_516 | 132 |
| 1005 | 3300048924 | Ga0496121_0322012 | Ga0496121_0322012_564_962 | 132 |
| 1006 | 3300048924 | Ga0496121_0327432 | Ga0496121_0327432_387_797 | 132 |
| 1007 | 3300048924 | Ga0496121_0578250 | Ga0496121_0578250_22_420 | 132 |
| 1008 | 3300048927 | Ga0496124_0026548 | Ga0496124_0026548_4507_4905 | 132 |
| 1009 | 3300048927 | Ga0496124_0178729 | Ga0496124_0178729_183_581 | 132 |
| 1010 | 3300048927 | Ga0496124_0273454 | Ga0496124_0273454_665_1063 | 132 |
| 1011 | 3300048927 | Ga0496124_0404719 | Ga0496124_0404719_453_851 | 132 |
| 1012 | 3300048928 | Ga0496125_0051831 | Ga0496125_0051831_681_1079 | 132 |
| 1013 | 3300048928 | Ga0496125_0265018 | Ga0496125_0265018_248_646 | 132 |
| 1014 | 3300048928 | Ga0496125_0303374 | Ga0496125_0303374_399_797 | 132 |
| 1015 | 3300048929 | Ga0496126_0002483 | Ga0496126_0002483_6178_6576 | 132 |
| 1016 | 3300048929 | Ga0496126_0092604 | Ga0496126_0092604_1335_1745 | 132 |
| 1017 | 3300048929 | Ga0496126_0149771 | Ga0496126_0149771_1283_1681 | 132 |
| 1018 | 3300048929 | Ga0496126_0176947 | Ga0496126_0176947_1344_1742 | 132 |
| 1019 | 3300048929 | Ga0496126_0212828 | Ga0496126_0212828_937_1335 | 132 |
| 1020 | 3300048929 | Ga0496126_0407184 | Ga0496126_0407184_180_578 | 132 |
| 1021 | 3300048929 | Ga0496126_0494497 | Ga0496126_0494497_115_513 | 132 |
| 1022 | 3300048929 | Ga0496126_0572690 | Ga0496126_0572690_112_510 | 132 |
| 1023 | 3300048929 | Ga0496126_0645808 | Ga0496126_0645808_146_544 | 132 |
| 1024 | 3300048929 | Ga0496126_0758943 | Ga0496126_0758943_68_466 | 132 |
| 1025 | 3300049459 | Ga0495678_115396 | Ga0495678_115396_170_568 | 132 |
| 1026 | 3300049568 | Ga0501031_0008184 | Ga0501031_0008184_513_911 | 132 |
| 1027 | 3300049569 | Ga0501032_0000704 | Ga0501032_0000704_24737_25135 | 132 |
| 1028 | 3300049570 | Ga0501033_0000311 | Ga0501033_0000311_9525_9923 | 132 |
| 1029 | 3300049571 | Ga0501034_0000039 | Ga0501034_0000039_225732_226130 | 132 |
| 1030 | 3300049572 | Ga0501036_0000127 | Ga0501036_0000127_11359_11757 | 132 |
| 1031 | 3300049573 | Ga0501037_0000025 | Ga0501037_0000025_128301_128699 | 132 |
| 1032 | 3300049574 | Ga0501038_0000342 | Ga0501038_0000342_32461_32859 | 132 |
| 1033 | 3300049575 | Ga0501039_0000840 | Ga0501039_0000840_3482_3880 | 132 |
| 1034 | 3300049578 | Ga0501042_0026448 | Ga0501042_0026448_1057_1455 | 132 |
| 1035 | 3300049579 | Ga0501043_0000120 | Ga0501043_0000120_34104_34502 | 132 |
| 1036 | 3300049580 | Ga0501046_0000359 | Ga0501046_0000359_11378_11776 | 132 |
| 1037 | 3300049580 | Ga0501046_0048465 | Ga0501046_0048465_2297_2695 | 132 |
| 1038 | 3300049581 | Ga0501047_0000379 | Ga0501047_0000379_1314_1712 | 132 |
| 1039 | 3300049581 | Ga0501047_0084770 | Ga0501047_0084770_884_1282 | 132 |
| 1040 | 3300049581 | Ga0501047_1343705 | Ga0501047_1343705_42_440 | 132 |
| 1041 | 3300049582 | Ga0501048_0000352 | Ga0501048_0000352_24280_24678 | 132 |
| 1042 | 3300049583 | Ga0501067_0000025 | Ga0501067_0000025_9941_10339 | 132 |
| 1043 | 3300049584 | Ga0501068_0001230 | Ga0501068_0001230_8911_9309 | 132 |
| 1044 | 3300049585 | Ga0501069_0007011 | Ga0501069_0007011_74_472 | 132 |
| 1045 | 3300049585 | Ga0501069_0175721 | Ga0501069_0175721_683_1081 | 132 |
| 1046 | 3300049586 | Ga0501070_0002185 | Ga0501070_0002185_4154_4552 | 132 |
| 1047 | 3300049586 | Ga0501070_0042781 | Ga0501070_0042781_2285_2683 | 132 |
| 1048 | 3300049587 | Ga0501071_0244492 | Ga0501071_0244492_223_621 | 132 |
| 1049 | 3300049588 | Ga0501072_0002767 | Ga0501072_0002767_11170_11568 | 132 |
| 1050 | 3300049588 | Ga0501072_0624932 | Ga0501072_0624932_387_785 | 132 |
| 1051 | 3300049589 | Ga0501073_0000091 | Ga0501073_0000091_15479_15877 | 132 |
| 1052 | 3300049589 | Ga0501073_0258618 | Ga0501073_0258618_280_678 | 132 |
| 1053 | 3300049590 | Ga0501074_0000489 | Ga0501074_0000489_9644_10042 | 132 |
| 1054 | 3300049590 | Ga0501074_0025368 | Ga0501074_0025368_1508_1906 | 132 |
| 1055 | 3300049592 | Ga0501076_0228198 | Ga0501076_0228198_445_843 | 132 |
| 1056 | 3300049592 | Ga0501076_0842771 | Ga0501076_0842771_329_727 | 132 |
| 1057 | 3300049741 | Ga0501079_0006818 | Ga0501079_0006818_6148_6546 | 132 |
| 1058 | 3300049742 | Ga0501080_0000321 | Ga0501080_0000321_22517_22915 | 132 |
| 1059 | 3300049742 | Ga0501080_0026275 | Ga0501080_0026275_4163_4561 | 132 |
| 1060 | 3300049744 | Ga0501083_0000284 | Ga0501083_0000284_26698_27096 | 132 |
| 1061 | 3300049822 | Ga0501035_0001251 | Ga0501035_0001251_25908_26306 | 132 |
| 1062 | 3300049822 | Ga0501035_0423288 | Ga0501035_0423288_355_753 | 132 |
| 1063 | 3300049823 | Ga0501044_0000274 | Ga0501044_0000274_45899_46297 | 132 |
| 1064 | 3300049823 | Ga0501044_0144750 | Ga0501044_0144750_319_717 | 132 |
| 1065 | 3300049824 | Ga0501045_0005330 | Ga0501045_0005330_7004_7402 | 132 |
| 1066 | 3300050489 | nmdc:mga03683_309151_c1 | nmdc:mga03683_309151_c1_206_616 | 132 |
| 1067 | 3300050490 | nmdc:mga03n38_341479_c1 | nmdc:mga03n38_341479_c1_17_415 | 132 |
| 1068 | 3300050491 | nmdc:mga00v17_465059_c1 | nmdc:mga00v17_465059_c1_179_577 | 132 |
| 1069 | 3300050491 | nmdc:mga00v17_888245_c1 | nmdc:mga00v17_888245_c1_153_551 | 132 |
| 1070 | 3300050492 | nmdc:mga0yw44_535895_c1 | nmdc:mga0yw44_535895_c1_51_449 | 132 |
| 1071 | 3300050492 | nmdc:mga0yw44_706686_c1 | nmdc:mga0yw44_706686_c1_140_538 | 132 |
| 1072 | 3300050492 | nmdc:mga0yw44_90407_c1 | nmdc:mga0yw44_90407_c1_73_471 | 132 |
| 1073 | 3300050493 | nmdc:mga0k408_240358_c1 | nmdc:mga0k408_240358_c1_211_609 | 132 |
| 1074 | 3300050493 | nmdc:mga0k408_97231_c1 | nmdc:mga0k408_97231_c1_1146_1544 | 132 |
| 1075 | 3300050494 | nmdc:mga06z11_103107_c1 | nmdc:mga06z11_103107_c1_335_733 | 132 |
| 1076 | 3300050494 | nmdc:mga06z11_207023_c1 | nmdc:mga06z11_207023_c1_668_1066 | 132 |
| 1077 | 3300050509 | nmdc:mga0qj67_501630_c1 | nmdc:mga0qj67_501630_c1_302_700 | 132 |
| 1078 | 3300050511 | nmdc:mga08y16_916868_c1 | nmdc:mga08y16_916868_c1_388_786 | 132 |
| 1079 | 3300050512 | nmdc:mga0n895_1812074_c1 | nmdc:mga0n895_1812074_c1_46_444 | 132 |
| 1080 | 3300050512 | nmdc:mga0n895_382114_c1 | nmdc:mga0n895_382114_c1_588_986 | 132 |
| 1081 | 3300050513 | nmdc:mga0rr50_866533_c1 | nmdc:mga0rr50_866533_c1_292_690 | 132 |
| 1082 | 3300050515 | nmdc:mga0a205_622660_c1 | nmdc:mga0a205_622660_c1_219_617 | 132 |
| 1083 | 3300050516 | nmdc:mga0sz30_308756_c1 | nmdc:mga0sz30_308756_c1_27_425 | 132 |
| 1084 | 3300053077 | Ga0495601_0078465 | Ga0495601_0078465_173_571 | 132 |
| 1085 | 3300053077 | Ga0495601_0146773 | Ga0495601_0146773_499_897 | 132 |
| 1086 | 3300053077 | Ga0495601_0252734 | Ga0495601_0252734_738_1136 | 132 |
| 1087 | 3300053077 | Ga0495601_0324068 | Ga0495601_0324068_32_430 | 132 |
| 1088 | 3300053078 | Ga0495612_0056240 | Ga0495612_0056240_983_1381 | 132 |
| 1089 | 3300053078 | Ga0495612_0175279 | Ga0495612_0175279_98_496 | 132 |
| 1090 | 3300053078 | Ga0495612_0240040 | Ga0495612_0240040_89_487 | 132 |
| 1091 | 3300053083 | Ga0495655_0068994 | Ga0495655_0068994_428_826 | 132 |
| 1092 | 3300053083 | Ga0495655_0092691 | Ga0495655_0092691_116_514 | 132 |
| 1093 | 3300053084 | Ga0495595_0026236 | Ga0495595_0026236_2095_2493 | 132 |
| 1094 | 3300053085 | Ga0495619_0209249 | Ga0495619_0209249_459_857 | 132 |
| 1095 | 3300053085 | Ga0495619_0246095 | Ga0495619_0246095_357_755 | 132 |
| 1096 | 3300053087 | Ga0500643_051619 | Ga0500643_051619_166_576 | 132 |
| 1097 | 3300053090 | Ga0500646_0022529 | Ga0500646_0022529_1238_1636 | 132 |
| 1098 | 3300053090 | Ga0500646_0071361 | Ga0500646_0071361_290_700 | 132 |
| 1099 | 3300053092 | Ga0500583_0072009 | Ga0500583_0072009_902_1312 | 132 |
| 1100 | 3300053092 | Ga0500583_0333398 | Ga0500583_0333398_105_515 | 132 |
| 1101 | 3300053093 | Ga0500651_0670507 | Ga0500651_0670507_62_472 | 132 |
| 1102 | 3300053094 | Ga0500566_0000158 | Ga0500566_0000158_2089_2487 | 132 |
| 1103 | 3300053094 | Ga0500566_0078847 | Ga0500566_0078847_670_1068 | 132 |
| 1104 | 3300053094 | Ga0500566_0201394 | Ga0500566_0201394_392_802 | 132 |
| 1105 | 3300053095 | Ga0500640_000568 | Ga0500640_000568_8888_9286 | 132 |
| 1106 | 3300053096 | Ga0500641_0008502 | Ga0500641_0008502_2121_2519 | 132 |
| 1107 | 3300053097 | Ga0500648_057745 | Ga0500648_057745_62_460 | 132 |
| 1108 | 3300053098 | Ga0500650_0224827 | Ga0500650_0224827_223_633 | 132 |
| 1109 | 3300053102 | Ga0500554_007059 | Ga0500554_007059_1697_2095 | 132 |
| 1110 | 3300053108 | Ga0500562_063291 | Ga0500562_063291_70_468 | 132 |
| 1111 | 3300053109 | Ga0500569_215176 | Ga0500569_215176_123_521 | 132 |
| 1112 | 3300053109 | Ga0500569_306904 | Ga0500569_306904_21_431 | 132 |
| 1113 | 3300053111 | Ga0500572_000024 | Ga0500572_000024_4936_5334 | 132 |
| 1114 | 3300053115 | Ga0500591_078328 | Ga0500591_078328_643_1041 | 132 |
| 1115 | 3300053118 | Ga0500594_0098002 | Ga0500594_0098002_72_470 | 132 |
| 1116 | 3300053119 | Ga0500595_001188 | Ga0500595_001188_793_1203 | 132 |
| 1117 | 3300053122 | Ga0500608_001300 | Ga0500608_001300_2295_2693 | 132 |
| 1118 | 3300053123 | Ga0500614_001812 | Ga0500614_001812_2342_2740 | 132 |
| 1119 | 3300053130 | Ga0500642_0270682 | Ga0500642_0270682_360_758 | 132 |
| 1120 | 3300053134 | Ga0500658_0175660 | Ga0500658_0175660_96_506 | 132 |
| 1121 | 3300053134 | Ga0500658_0382952 | Ga0500658_0382952_171_569 | 132 |
| 1122 | 3300053136 | Ga0500559_0003877 | Ga0500559_0003877_3343_3741 | 132 |
| 1123 | 3300053136 | Ga0500559_0178998 | Ga0500559_0178998_281_679 | 132 |
| 1124 | 3300053137 | Ga0500561_0145643 | Ga0500561_0145643_300_698 | 132 |
| 1125 | 3300053139 | Ga0500568_0060565 | Ga0500568_0060565_987_1385 | 132 |
| 1126 | 3300053140 | Ga0500573_0032643 | Ga0500573_0032643_2294_2692 | 132 |
| 1127 | 3300053142 | Ga0500577_0139481 | Ga0500577_0139481_106_516 | 132 |
| 1128 | 3300053143 | Ga0500579_188848 | Ga0500579_188848_200_598 | 132 |
| 1129 | 3300053146 | Ga0500588_0401468 | Ga0500588_0401468_92_490 | 132 |
| 1130 | 3300053147 | Ga0500589_025035 | Ga0500589_025035_18_416 | 132 |
| 1131 | 3300053147 | Ga0500589_313473 | Ga0500589_313473_83_481 | 132 |
| 1132 | 3300053148 | Ga0500590_122838 | Ga0500590_122838_255_653 | 132 |
| 1133 | 3300053148 | Ga0500590_146250 | Ga0500590_146250_392_790 | 132 |
| 1134 | 3300053150 | Ga0500603_000465 | Ga0500603_000465_1730_2188 | 132 |
| 1135 | 3300053150 | Ga0500603_000801 | Ga0500603_000801_6042_6440 | 132 |
| 1136 | 3300053150 | Ga0500603_048017 | Ga0500603_048017_365_763 | 132 |
| 1137 | 3300053150 | Ga0500603_242973 | Ga0500603_242973_31_429 | 132 |
| 1138 | 3300053156 | Ga0500622_0382782 | Ga0500622_0382782_28_426 | 132 |
| 1139 | 3300053158 | Ga0500627_0357681 | Ga0500627_0357681_161_559 | 132 |
| 1140 | 3300053159 | Ga0500630_000112 | Ga0500630_000112_17992_18390 | 132 |
| 1141 | 3300053161 | Ga0500634_0081721 | Ga0500634_0081721_607_1017 | 132 |
| 1142 | 3300053162 | Ga0500638_012135 | Ga0500638_012135_1848_2246 | 132 |
| 1143 | 3300053162 | Ga0500638_197823 | Ga0500638_197823_23_421 | 132 |
| 1144 | 3300053163 | Ga0500639_000040 | Ga0500639_000040_28101_28499 | 132 |
| 1145 | 3300053177 | Ga0500636_0086872 | Ga0500636_0086872_281_679 | 132 |
| 1146 | 3300053177 | Ga0500636_0184124 | Ga0500636_0184124_643_1041 | 132 |
| 1147 | 3300053178 | Ga0500637_0039960 | Ga0500637_0039960_1754_2212 | 132 |
| 1148 | 3300053178 | Ga0500637_0108912 | Ga0500637_0108912_995_1393 | 132 |
| 1149 | 3300053731 | Ga0500609_015774 | Ga0500609_015774_440_838 | 132 |
| 1150 | 3300053735 | Ga0500596_000794 | Ga0500596_000794_5598_5996 | 132 |
| 1151 | 3300053735 | Ga0500596_005461 | Ga0500596_005461_1606_2004 | 132 |
| 1152 | 3300054114 | Ga0501084_0007045 | Ga0501084_0007045_7009_7407 | 132 |
| 1153 | 3300059645 | Ga0587076_056219 | Ga0587076_056219_38_436 | 132 |
| 1154 | 3300060353 | Ga0501082_0026885 | Ga0501082_0026885_2021_2419 | 132 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1otg-assembly1.cif.gz_C | 5-carboxymethyl-2-hydroxymuconate isomerase | 0.8107 | 3 | 125 |
| 4jj9-assembly1.cif.gz_B | crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase | 0.806 | 1 | 125 |
| 1otg-assembly1.cif.gz_C | 5-carboxymethyl-2-hydroxymuconate isomerase | 0.7933 | 3 | 125 |
| 4jcu-assembly1.cif.gz_A | crystal structure of a 5-carboxymethyl-2-hydroxymuconate isomerase from deinococcus radiodurans r1 | 0.7876 | 2 | 125 |
| 4jj9-assembly1.cif.gz_B | crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase | 0.7616 | 1 | 125 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1otgC00 | Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor | 0.8107 | 3 | 125 | 3.30.429.10 |
| 1otgC00 | Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor | 0.7933 | 3 | 125 | 3.30.429.10 |
| 4jcuB00 | Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor | 0.7918 | 2 | 123 | 3.30.429.10 |
| 4jj9C00 | Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor | 0.7803 | 2 | 125 | 3.30.429.10 |
| 4jcuB00 | Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor | 0.7535 | 2 | 123 | 3.30.429.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S1ELA3-F1-model_v4 | 5-carboxymethyl-2-hydroxymuconate isomerase | 0.915 | 1 | 64 |
GO:0008704
GO:0009056 |
| AF-A0A3D0KT17-F1-model_v4 | 5-carboxymethyl-2-hydroxymuconate isomerase | 0.9115 | 1 | 64 |
GO:0008704
GO:0009056 |
| AF-A0A529P083-F1-model_v4 | 5-carboxymethyl-2-hydroxymuconate isomerase | 0.8975 | 1 | 108 |
GO:0008704
GO:0009056 |
| AF-A0A529P563-F1-model_v4 | 5-carboxymethyl-2-hydroxymuconate isomerase | 0.8901 | 1 | 72 |
GO:0008704
GO:0009056 |
| AF-A0A3D1DZK3-F1-model_v4 | 5-carboxymethyl-2-hydroxymuconate isomerase | 0.8858 | 1 | 108 |
GO:0008704
GO:0009056 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar