F490869
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1151 | 826 | 592 | 156 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2791355253|2793282283 |
| Length | 174 |
| Sequence | QNELLSGGCQCGAVRFRASHLGRPSICHCRMCQKQFGSFFGAFVTADPAHLEWTRGAPALYRSSNKVRRGFCQRCGTPLTYHHPGGVELAIGAFDHPEKLEPEIQVNHHKRLPWIDRLFDKPVLVSEEADAFFASIDSYQHPDHDTAVWPPEDDGAPAPRSRHGRHGSGEGVEE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 7 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 8 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 9 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 10 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 11 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 12 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 13 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 14 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 15 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 16 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 17 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 18 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 19 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 20 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 21 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 22 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 23 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 24 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 25 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 26 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 27 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 28 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 29 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 30 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 31 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 32 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 33 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 34 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 35 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 36 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 37 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 38 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 39 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 40 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 41 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 42 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 43 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 44 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 45 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 46 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 47 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 48 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 49 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 50 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 51 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 52 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 53 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 54 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 55 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 56 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 57 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 58 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 59 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 60 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 61 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 62 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 63 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 64 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 65 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 66 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 67 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 68 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 69 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 70 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 71 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 72 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 73 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 74 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 75 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 76 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 77 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 78 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 79 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 80 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 81 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 82 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 83 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 84 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 85 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 86 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 87 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 88 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 89 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 90 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 91 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 92 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 93 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 94 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 95 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 96 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 97 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 98 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 99 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 100 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 101 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 102 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 103 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 104 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 105 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 106 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 107 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 108 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 109 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 110 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 111 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 112 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 113 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 114 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 115 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 116 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 117 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 118 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 119 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 120 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 121 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 122 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 123 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 124 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 125 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 126 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 127 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 128 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 129 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 130 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 131 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 132 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 133 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 134 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 135 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 136 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 137 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 138 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 139 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 140 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 141 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 142 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 143 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 144 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 145 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 146 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 147 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 148 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 149 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 150 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 151 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 152 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 153 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 154 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 155 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 156 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 157 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 158 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 159 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 160 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 161 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 162 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 163 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 164 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 165 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 166 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 167 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 168 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 169 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 170 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 171 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 172 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 173 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 174 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 175 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 176 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 177 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 178 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 179 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 180 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 181 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 182 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 183 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 184 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 185 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 186 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 187 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 188 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 189 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 190 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 191 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 192 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 193 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 194 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 195 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 196 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 197 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 198 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 199 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 200 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 201 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 202 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 203 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 204 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 205 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 206 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 207 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 208 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 209 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 210 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 211 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 212 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 213 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 214 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 215 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 216 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 217 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 218 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 219 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 220 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 221 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 222 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 223 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 224 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 225 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 226 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 227 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 228 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 229 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 230 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 231 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 232 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 233 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 234 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 235 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 236 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 237 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 238 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 239 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 240 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 241 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 242 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 243 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 244 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 245 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 246 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 247 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 248 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 249 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 250 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 251 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 252 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 253 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 254 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 255 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 256 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 257 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 258 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 259 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 260 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 261 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 262 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 263 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 264 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 265 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 266 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 267 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 268 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 269 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 270 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 271 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 272 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 273 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 274 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 275 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 276 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 277 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 278 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 279 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 280 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 281 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 282 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 283 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 284 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 285 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 286 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 287 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 288 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 289 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 290 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 291 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 292 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 293 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 294 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 295 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 296 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 297 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 298 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 299 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 300 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 301 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 302 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 303 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 304 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 305 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 306 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 307 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 308 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 309 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 310 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 311 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 312 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 313 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 314 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 315 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 316 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 317 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 318 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 319 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 320 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 321 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 322 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 323 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 324 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 325 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 326 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 327 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 328 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 329 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 330 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 331 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 332 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 333 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 334 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 335 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 336 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 337 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 338 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 339 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 340 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 341 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 342 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 343 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 344 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 345 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 346 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 347 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 348 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 349 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 350 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 351 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 352 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 353 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 354 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 355 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 356 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 357 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 358 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 359 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 360 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 361 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 362 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 363 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 364 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 365 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 366 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 367 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 368 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 369 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 370 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 371 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 372 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 373 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 374 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 375 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 376 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 377 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 378 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 379 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 380 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 381 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 382 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 383 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 384 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 385 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 386 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 387 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 388 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 389 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 390 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 391 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 392 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 393 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 394 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 395 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 396 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 397 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 398 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 399 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 400 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 401 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 402 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 403 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 404 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 405 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 406 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 407 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 408 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 409 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 410 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 411 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 412 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 413 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 414 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 415 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 416 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 417 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 418 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 419 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 420 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 421 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 422 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 423 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 424 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 425 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 426 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 427 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 428 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 429 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 430 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 431 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 432 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 433 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 434 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 435 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 436 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 437 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 438 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 439 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 440 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 441 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 442 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 443 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 444 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 445 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 446 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 447 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 448 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 449 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 450 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 451 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 452 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 453 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 454 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 455 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 456 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 457 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 458 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 459 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 460 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 461 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 462 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 463 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 464 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 465 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 466 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 467 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 468 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 469 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 470 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 471 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 472 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 473 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 474 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 475 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 476 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 477 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 478 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 479 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 480 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 481 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 482 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 483 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 484 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 485 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 486 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 487 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 488 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 489 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 490 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 491 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 492 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 493 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 494 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 495 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 496 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 497 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 498 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 499 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 500 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 501 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 502 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 503 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 504 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 505 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 506 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 507 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 508 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 509 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 510 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 511 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 512 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 513 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 514 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 515 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 516 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 517 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 518 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 519 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 520 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 521 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 522 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 523 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 524 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 525 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 526 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 527 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 528 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 529 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 530 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 531 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 532 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 533 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 534 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 535 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 536 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 537 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 538 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 539 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 540 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 541 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 542 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 543 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 544 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 545 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 546 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 547 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 548 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 549 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 550 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 551 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 552 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 553 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 554 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 555 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 556 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 557 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 558 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 559 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 560 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 561 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 562 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 563 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 564 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 565 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 566 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 567 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 568 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 569 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 570 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 571 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 572 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 573 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 574 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 575 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 576 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 577 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 578 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 579 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 580 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 581 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 582 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 583 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 584 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 585 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 586 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 587 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 588 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 589 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 590 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 591 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 592 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 593 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 594 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 595 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 596 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 597 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 598 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 599 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 600 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 601 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 602 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 603 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 604 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 605 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 606 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 607 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 608 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 609 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 610 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 611 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 612 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 613 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 614 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 615 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 616 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 617 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 618 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 619 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 620 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 621 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 622 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 623 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 624 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 625 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 626 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 627 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 628 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 629 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 630 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 631 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 632 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 633 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 634 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 635 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 636 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 637 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 638 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 639 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 640 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 641 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 642 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 643 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 644 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 645 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 646 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 647 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 648 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 649 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 650 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 651 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 652 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 653 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 654 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 655 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 656 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 657 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 658 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 659 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 660 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 661 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 662 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 663 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 664 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 665 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 666 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 667 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 668 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 669 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 670 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 671 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 672 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 673 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 674 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 675 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 676 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 677 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 678 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 679 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 680 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 681 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 682 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 683 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 684 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 685 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 686 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 687 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 688 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 689 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 690 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 691 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 692 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 693 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 694 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 695 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 696 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 697 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 698 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 699 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 700 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 701 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 702 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 703 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 704 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 705 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 706 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 707 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 708 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 709 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 710 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 711 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 712 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 713 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 714 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 715 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 716 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 717 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 718 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 719 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 720 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 721 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 722 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 723 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 724 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 725 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 726 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 727 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 728 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 729 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 730 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 731 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 732 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 733 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 734 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 735 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 736 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 737 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 738 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 739 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 740 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 741 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 742 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 743 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 744 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 745 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 746 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 747 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 748 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 749 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 750 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 751 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 752 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 753 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 754 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 755 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 756 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 757 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 758 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 759 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 760 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 761 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 762 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 763 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 764 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 765 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 766 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 767 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 768 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 769 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 770 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 771 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 772 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 773 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 774 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 775 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 776 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 777 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 778 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 779 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 780 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 781 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 782 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 783 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 784 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 785 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 786 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 787 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 788 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 789 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 790 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 791 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 792 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 793 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 794 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 795 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 796 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 797 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 798 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 799 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 800 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 801 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 802 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 803 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 804 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 805 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 806 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 807 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 808 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 809 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 810 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 811 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 812 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 813 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 814 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 815 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 816 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 817 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 818 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 819 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 820 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 821 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 822 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 823 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 824 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 825 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 826 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 51.52 |
| Metatranscriptomes | 0 |
| Isolates | 48.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.94 |
| Nodule | 39.44 |
| Rhizoplane | 1.48 |
| Rhizosphere | 24.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10022684 | 3300001979 | Bacteria | 2156 |
| 2 | JGI25156J39149_1008029 | 3300002705 | Bacteria | 2702 |
| 3 | JGI25158J39367_1001006 | 3300002739 | Bacteria | 5165 |
| 4 | JGI25157J39369_1001043 | 3300002741 | Bacteria | 12662 |
| 5 | JGI25152J39213_1000489 | 3300002773 | Bacteria | 22488 |
| 6 | JGI25152J39213_1000613 | 3300002773 | Bacteria | 19217 |
| 7 | JGI25152J39213_1003002 | 3300002773 | Bacteria | 5975 |
| 8 | JGI25152J39213_1003200 | 3300002773 | Bacteria | 5695 |
| 9 | JGI25152J39213_1005384 | 3300002773 | Bacteria | 3748 |
| 10 | JGI25152J39213_1006798 | 3300002773 | Bacteria | 3042 |
| 11 | JGI25152J39213_1009132 | 3300002773 | Bacteria | 2383 |
| 12 | JGI25150J39212_1000033 | 3300002774 | Bacteria | 96269 |
| 13 | JGI25150J39212_1006735 | 3300002774 | Bacteria | 2350 |
| 14 | JGI25150J39212_1006851 | 3300002774 | Bacteria | 2323 |
| 15 | JGI25150J39212_1026697 | 3300002774 | Bacteria | 833 |
| 16 | JGI25159J45721_1000002 | 3300002987 | Bacteria | 289163 |
| 17 | JGI25159J45721_1000299 | 3300002987 | Bacteria | 23242 |
| 18 | JGI25151J46595_10000062 | 3300003187 | Bacteria | 146687 |
| 19 | JGI25151J46595_10001325 | 3300003187 | Bacteria | 17313 |
| 20 | JGI25151J46595_10002042 | 3300003187 | Bacteria | 12612 |
| 21 | JGI25151J46595_10002593 | 3300003187 | Bacteria | 10668 |
| 22 | JGI25151J46595_10011784 | 3300003187 | Bacteria | 4006 |
| 23 | JGI25151J46595_10017797 | 3300003187 | Bacteria | 3069 |
| 24 | JGI25165J46597_1000028 | 3300003214 | Bacteria | 325146 |
| 25 | JGI25165J46597_1011001 | 3300003214 | Bacteria | 1303 |
| 26 | JGI25153J46596_10005408 | 3300003215 | Bacteria | 6706 |
| 27 | JGI25153J46596_10006589 | 3300003215 | Bacteria | 5851 |
| 28 | JGI25153J46596_10007464 | 3300003215 | Bacteria | 5373 |
| 29 | JGI25153J46596_10029503 | 3300003215 | Bacteria | 1882 |
| 30 | JGI25160J50197_1000008 | 3300003354 | Bacteria | 289163 |
| 31 | JGI25160J50197_1008183 | 3300003354 | Bacteria | 4008 |
| 32 | JGI25160J50197_1010532 | 3300003354 | Bacteria | 3336 |
| 33 | JGI25160J50197_1015293 | 3300003354 | Bacteria | 2526 |
| 34 | JGI25161J50226_1000133 | 3300003374 | Bacteria | 52508 |
| 35 | JGI25161J50226_1000527 | 3300003374 | Bacteria | 16442 |
| 36 | JGI25161J50226_1011868 | 3300003374 | Bacteria | 1073 |
| 37 | Ga0055542_1001076 | 3300003762 | Bacteria | 16735 |
| 38 | Ga0055542_1001152 | 3300003762 | Bacteria | 15471 |
| 39 | Ga0055529_1004622 | 3300003763 | Bacteria | 2072 |
| 40 | Ga0055526_1002912 | 3300003771 | Bacteria | 11251 |
| 41 | Ga0055526_1005297 | 3300003771 | Bacteria | 7469 |
| 42 | Ga0055526_1010461 | 3300003771 | Bacteria | 4312 |
| 43 | Ga0055526_1010634 | 3300003771 | Bacteria | 4255 |
| 44 | Ga0055526_1013070 | 3300003771 | Bacteria | 3549 |
| 45 | Ga0055524_1001918 | 3300003775 | Bacteria | 11229 |
| 46 | Ga0055524_1008684 | 3300003775 | Bacteria | 4201 |
| 47 | Ga0055524_1014462 | 3300003775 | Bacteria | 2923 |
| 48 | Ga0055524_1015539 | 3300003775 | Bacteria | 2769 |
| 49 | Ga0055524_1018673 | 3300003775 | Bacteria | 2399 |
| 50 | Ga0055524_1020377 | 3300003775 | Bacteria | 2235 |
| 51 | Ga0055524_1020565 | 3300003775 | Bacteria | 2219 |
| 52 | Ga0055524_1035008 | 3300003775 | Bacteria | 1377 |
| 53 | Ga0055528_1000149 | 3300003790 | Bacteria | 57620 |
| 54 | Ga0055528_1004949 | 3300003790 | Bacteria | 6291 |
| 55 | Ga0055528_1006210 | 3300003790 | Bacteria | 5442 |
| 56 | Ga0055528_1019412 | 3300003790 | Bacteria | 2254 |
| 57 | Ga0055528_1028634 | 3300003790 | Bacteria | 1531 |
| 58 | Ga0055528_1030824 | 3300003790 | Bacteria | 1411 |
| 59 | Ga0055528_1044220 | 3300003790 | Bacteria | 961 |
| 60 | Ga0055530_10048270 | 3300003791 | Bacteria | 1001 |
| 61 | Ga0055540_1001764 | 3300003792 | Bacteria | 12339 |
| 62 | Ga0055540_1002583 | 3300003792 | Bacteria | 9430 |
| 63 | Ga0055540_1017412 | 3300003792 | Bacteria | 2007 |
| 64 | Ga0055540_1021002 | 3300003792 | Bacteria | 1710 |
| 65 | Ga0055531_10048480 | 3300003794 | Bacteria | 1145 |
| 66 | Ga0055543_1000040 | 3300004625 | Bacteria | 122485 |
| 67 | Ga0055543_1000048 | 3300004625 | Bacteria | 109807 |
| 68 | Ga0055543_1003720 | 3300004625 | Bacteria | 4365 |
| 69 | Ga0065165_1000015 | 3300005262 | Bacteria | 289201 |
| 70 | Ga0065165_1006738 | 3300005262 | Bacteria | 5891 |
| 71 | Ga0065165_1012418 | 3300005262 | Bacteria | 3468 |
| 72 | Ga0070658_10187688 | 3300005327 | Bacteria | 1742 |
| 73 | Ga0070670_100002600 | 3300005331 | Bacteria | 14919 |
| 74 | Ga0070668_100154878 | 3300005347 | Bacteria | 1856 |
| 75 | Ga0070668_100774398 | 3300005347 | Bacteria | 851 |
| 76 | Ga0070668_100783679 | 3300005347 | Bacteria | 846 |
| 77 | Ga0070671_100083420 | 3300005355 | Bacteria | 2672 |
| 78 | Ga0070674_100128790 | 3300005356 | Bacteria | 1884 |
| 79 | Ga0070667_100912721 | 3300005367 | Bacteria | 818 |
| 80 | Ga0070708_100338798 | 3300005445 | Bacteria | 1417 |
| 81 | Ga0070663_100274643 | 3300005455 | Bacteria | 1341 |
| 82 | Ga0070663_100650142 | 3300005455 | Bacteria | 892 |
| 83 | Ga0070662_101300743 | 3300005457 | Bacteria | 626 |
| 84 | Ga0068867_100189684 | 3300005459 | Bacteria | 1640 |
| 85 | Ga0068853_100070932 | 3300005539 | Bacteria | 3033 |
| 86 | Ga0068853_100427759 | 3300005539 | Bacteria | 1242 |
| 87 | Ga0070672_100821548 | 3300005543 | Bacteria | 818 |
| 88 | Ga0070686_101526876 | 3300005544 | Bacteria | 563 |
| 89 | Ga0070665_100033875 | 3300005548 | Bacteria | 5138 |
| 90 | Ga0070665_100281328 | 3300005548 | Bacteria | 1666 |
| 91 | Ga0068855_100315987 | 3300005563 | Bacteria | 1727 |
| 92 | Ga0068855_100558333 | 3300005563 | Bacteria | 1239 |
| 93 | Ga0068855_100571357 | 3300005563 | Bacteria | 1222 |
| 94 | Ga0068857_101023395 | 3300005577 | Bacteria | 796 |
| 95 | Ga0068854_100090229 | 3300005578 | Bacteria | 2279 |
| 96 | Ga0068856_100300925 | 3300005614 | Bacteria | 1621 |
| 97 | Ga0068852_100734426 | 3300005616 | Bacteria | 999 |
| 98 | Ga0068866_10244873 | 3300005718 | Bacteria | 1094 |
| 99 | Ga0075365_10017666 | 3300006038 | Bacteria | 4370 |
| 100 | Ga0075365_10068542 | 3300006038 | Bacteria | 2383 |
| 101 | Ga0075365_10114595 | 3300006038 | Bacteria | 1855 |
| 102 | Ga0075365_10270810 | 3300006038 | Bacteria | 1194 |
| 103 | Ga0075365_10307324 | 3300006038 | Bacteria | 1116 |
| 104 | Ga0075368_10017680 | 3300006042 | Bacteria | 2671 |
| 105 | Ga0075368_10041467 | 3300006042 | Bacteria | 1808 |
| 106 | Ga0075368_10119913 | 3300006042 | Bacteria | 1089 |
| 107 | Ga0075363_100055331 | 3300006048 | Bacteria | 2125 |
| 108 | Ga0075363_100079110 | 3300006048 | Bacteria | 1796 |
| 109 | Ga0075363_100132813 | 3300006048 | Bacteria | 1397 |
| 110 | Ga0075363_100367440 | 3300006048 | Bacteria | 842 |
| 111 | Ga0075364_10074936 | 3300006051 | Bacteria | 2232 |
| 112 | Ga0075364_10182629 | 3300006051 | Bacteria | 1420 |
| 113 | Ga0075364_10456967 | 3300006051 | Bacteria | 872 |
| 114 | Ga0075362_10001294 | 3300006177 | Bacteria | 7929 |
| 115 | Ga0075362_10017051 | 3300006177 | Bacteria | 2986 |
| 116 | Ga0075367_10003380 | 3300006178 | Bacteria | 7597 |
| 117 | Ga0075367_10050221 | 3300006178 | Bacteria | 2462 |
| 118 | Ga0075367_10063595 | 3300006178 | Bacteria | 2206 |
| 119 | Ga0075367_10077631 | 3300006178 | Bacteria | 2005 |
| 120 | Ga0075367_10133647 | 3300006178 | Bacteria | 1534 |
| 121 | Ga0075367_10190304 | 3300006178 | Bacteria | 1280 |
| 122 | Ga0075369_10000715 | 3300006186 | Bacteria | 10691 |
| 123 | Ga0075369_10001441 | 3300006186 | Bacteria | 8117 |
| 124 | Ga0075369_10023990 | 3300006186 | Bacteria | 2525 |
| 125 | Ga0075369_10120044 | 3300006186 | Bacteria | 1189 |
| 126 | Ga0075366_10008659 | 3300006195 | Bacteria | 5664 |
| 127 | Ga0075366_10082331 | 3300006195 | Bacteria | 1923 |
| 128 | Ga0075366_10224384 | 3300006195 | Bacteria | 1145 |
| 129 | Ga0075370_10010914 | 3300006353 | Bacteria | 4762 |
| 130 | Ga0075370_10061958 | 3300006353 | Bacteria | 2131 |
| 131 | Ga0075370_10278133 | 3300006353 | Bacteria | 994 |
| 132 | Ga0075370_10531535 | 3300006353 | Bacteria | 711 |
| 133 | Ga0075370_10538892 | 3300006353 | Bacteria | 705 |
| 134 | Ga0068871_100662265 | 3300006358 | Bacteria | 954 |
| 135 | Ga0079104_1002273 | 3300006946 | Bacteria | 10662 |
| 136 | Ga0079104_1005092 | 3300006946 | Bacteria | 5353 |
| 137 | Ga0105251_10008511 | 3300009011 | Bacteria | 6160 |
| 138 | Ga0105244_10117097 | 3300009036 | Bacteria | 1292 |
| 139 | Ga0105250_10108155 | 3300009092 | Bacteria | 1137 |
| 140 | Ga0105240_10605453 | 3300009093 | Bacteria | 1206 |
| 141 | Ga0105245_10544602 | 3300009098 | Bacteria | 1182 |
| 142 | Ga0105241_10109885 | 3300009174 | Bacteria | 2205 |
| 143 | Ga0105241_10223107 | 3300009174 | Bacteria | 1585 |
| 144 | Ga0105241_10611519 | 3300009174 | Bacteria | 986 |
| 145 | Ga0105242_11531386 | 3300009176 | Bacteria | 698 |
| 146 | Ga0105248_10057126 | 3300009177 | Bacteria | 4380 |
| 147 | Ga0105248_10177749 | 3300009177 | Bacteria | 2398 |
| 148 | Ga0105237_10018053 | 3300009545 | Bacteria | 7307 |
| 149 | Ga0105237_10538977 | 3300009545 | Bacteria | 1174 |
| 150 | Ga0105238_10198943 | 3300009551 | Bacteria | 1979 |
| 151 | Ga0105238_10570887 | 3300009551 | Bacteria | 1137 |
| 152 | Ga0105249_10758749 | 3300009553 | Bacteria | 1032 |
| 153 | Ga0123341_1012981 | 3300009765 | Bacteria | 7522 |
| 154 | Ga0105239_10131477 | 3300010375 | Bacteria | 2784 |
| 155 | Ga0105239_10655701 | 3300010375 | Bacteria | 1199 |
| 156 | Ga0105239_10772903 | 3300010375 | Bacteria | 1100 |
| 157 | Ga0105239_11191159 | 3300010375 | Bacteria | 878 |
| 158 | Ga0105239_11422805 | 3300010375 | Bacteria | 801 |
| 159 | Ga0105246_10992580 | 3300011119 | Bacteria | 760 |
| 160 | Ga0157322_1004632 | 3300012490 | Bacteria | 907 |
| 161 | Ga0157319_1002016 | 3300012497 | Bacteria | 1120 |
| 162 | Ga0157373_10391332 | 3300013100 | Bacteria | 995 |
| 163 | Ga0157370_10196562 | 3300013104 | Bacteria | 1872 |
| 164 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 165 | Ga0157374_10681521 | 3300013296 | Bacteria | 1040 |
| 166 | Ga0157372_12209991 | 3300013307 | Bacteria | 632 |
| 167 | Ga0163163_10418466 | 3300014325 | Bacteria | 1399 |
| 168 | Ga0182008_10182930 | 3300014497 | Bacteria | 1061 |
| 169 | Ga0157376_10574220 | 3300014969 | Bacteria | 1119 |
| 170 | Ga0182007_10001216 | 3300015262 | Bacteria | 13977 |
| 171 | Ga0183363_1336 | 3300015690 | Bacteria | 5813 |
| 172 | Ga0214544_1008762 | 3300021320 | Bacteria | 16495 |
| 173 | Ga0214542_1000006 | 3300021321 | Bacteria | 345164 |
| 174 | Ga0214542_1016338 | 3300021321 | Bacteria | 7243 |
| 175 | Ga0214543_1000003 | 3300021327 | Bacteria | 692327 |
| 176 | Ga0214543_1000014 | 3300021327 | Bacteria | 324986 |
| 177 | Ga0228711_1000001 | 3300022739 | Bacteria | 357377 |
| 178 | Ga0228710_1000001 | 3300022740 | Bacteria | 314328 |
| 179 | Ga0209435_100042 | 3300025206 | Bacteria | 105563 |
| 180 | Ga0209436_100064 | 3300025208 | Bacteria | 56015 |
| 181 | Ga0209436_102030 | 3300025208 | Bacteria | 6388 |
| 182 | Ga0207425_1000031 | 3300025245 | Bacteria | 261181 |
| 183 | Ga0207425_1000671 | 3300025245 | Bacteria | 18714 |
| 184 | Ga0207425_1002445 | 3300025245 | Bacteria | 6535 |
| 185 | Ga0207425_1018724 | 3300025245 | Bacteria | 1499 |
| 186 | Ga0207425_1029317 | 3300025245 | Bacteria | 1110 |
| 187 | Ga0209646_1000145 | 3300025246 | Bacteria | 105563 |
| 188 | Ga0209026_1000160 | 3300025250 | Bacteria | 105563 |
| 189 | Ga0209026_1000215 | 3300025250 | Bacteria | 80382 |
| 190 | Ga0209148_1000056 | 3300025254 | Bacteria | 363380 |
| 191 | Ga0209759_1000177 | 3300025256 | Bacteria | 105563 |
| 192 | Ga0209759_1000591 | 3300025256 | Bacteria | 35218 |
| 193 | Ga0209129_1000053 | 3300025258 | Bacteria | 262823 |
| 194 | Ga0209129_1000362 | 3300025258 | Bacteria | 37617 |
| 195 | Ga0209129_1000592 | 3300025258 | Bacteria | 24759 |
| 196 | Ga0209129_1002000 | 3300025258 | Bacteria | 10596 |
| 197 | Ga0209129_1003332 | 3300025258 | Bacteria | 7079 |
| 198 | Ga0209129_1003827 | 3300025258 | Bacteria | 6287 |
| 199 | Ga0209129_1028176 | 3300025258 | Bacteria | 957 |
| 200 | Ga0209233_1000087 | 3300025261 | Bacteria | 325225 |
| 201 | Ga0209233_1000209 | 3300025261 | Bacteria | 115124 |
| 202 | Ga0209233_1004639 | 3300025261 | Bacteria | 4644 |
| 203 | Ga0209565_1032250 | 3300025263 | Bacteria | 1014 |
| 204 | Ga0209455_1000137 | 3300025272 | Bacteria | 142099 |
| 205 | Ga0209673_1000041 | 3300025273 | Bacteria | 307397 |
| 206 | Ga0209673_1000254 | 3300025273 | Bacteria | 101508 |
| 207 | Ga0209673_1001371 | 3300025273 | Bacteria | 23980 |
| 208 | Ga0209673_1001660 | 3300025273 | Bacteria | 19205 |
| 209 | Ga0209673_1001767 | 3300025273 | Bacteria | 17949 |
| 210 | Ga0209673_1006511 | 3300025273 | Bacteria | 5620 |
| 211 | Ga0209673_1009724 | 3300025273 | Bacteria | 4130 |
| 212 | Ga0209673_1010174 | 3300025273 | Bacteria | 3991 |
| 213 | Ga0209673_1012400 | 3300025273 | Bacteria | 3435 |
| 214 | Ga0209673_1031104 | 3300025273 | Bacteria | 1668 |
| 215 | Ga0209130_1000006 | 3300025284 | Bacteria | 596528 |
| 216 | Ga0209130_1000007 | 3300025284 | Bacteria | 591584 |
| 217 | Ga0209130_1025430 | 3300025284 | Bacteria | 1282 |
| 218 | Ga0209676_1009408 | 3300025292 | Bacteria | 4219 |
| 219 | Ga0209025_1000087 | 3300025294 | Bacteria | 261181 |
| 220 | Ga0209025_1000100 | 3300025294 | Bacteria | 229182 |
| 221 | Ga0209025_1000149 | 3300025294 | Bacteria | 173393 |
| 222 | Ga0209025_1000284 | 3300025294 | Bacteria | 114754 |
| 223 | Ga0209025_1001310 | 3300025294 | Bacteria | 33978 |
| 224 | Ga0209025_1007344 | 3300025294 | Bacteria | 8246 |
| 225 | Ga0209025_1015697 | 3300025294 | Bacteria | 4540 |
| 226 | Ga0209025_1020918 | 3300025294 | Bacteria | 3549 |
| 227 | Ga0209025_1053139 | 3300025294 | Bacteria | 1593 |
| 228 | Ga0209564_1000233 | 3300025295 | Bacteria | 121692 |
| 229 | Ga0209564_1000425 | 3300025295 | Bacteria | 74279 |
| 230 | Ga0209564_1000439 | 3300025295 | Bacteria | 71637 |
| 231 | Ga0209564_1001684 | 3300025295 | Bacteria | 21000 |
| 232 | Ga0209564_1002798 | 3300025295 | Bacteria | 13010 |
| 233 | Ga0209564_1015377 | 3300025295 | Bacteria | 3117 |
| 234 | Ga0209564_1019775 | 3300025295 | Bacteria | 2501 |
| 235 | Ga0209758_1000081 | 3300025297 | Bacteria | 261181 |
| 236 | Ga0209758_1000737 | 3300025297 | Bacteria | 47765 |
| 237 | Ga0209758_1002088 | 3300025297 | Bacteria | 21248 |
| 238 | Ga0209758_1002164 | 3300025297 | Bacteria | 20648 |
| 239 | Ga0209758_1002288 | 3300025297 | Bacteria | 19817 |
| 240 | Ga0209758_1003671 | 3300025297 | Bacteria | 13657 |
| 241 | Ga0209758_1016828 | 3300025297 | Bacteria | 3687 |
| 242 | Ga0209050_1001222 | 3300025298 | Bacteria | 29857 |
| 243 | Ga0209256_1001044 | 3300025299 | Bacteria | 32321 |
| 244 | Ga0209256_1002554 | 3300025299 | Bacteria | 14564 |
| 245 | Ga0209256_1002658 | 3300025299 | Bacteria | 14031 |
| 246 | Ga0209256_1002838 | 3300025299 | Bacteria | 13211 |
| 247 | Ga0209256_1002860 | 3300025299 | Bacteria | 13140 |
| 248 | Ga0209256_1007676 | 3300025299 | Bacteria | 5241 |
| 249 | Ga0209256_1008783 | 3300025299 | Bacteria | 4595 |
| 250 | Ga0209256_1011782 | 3300025299 | Bacteria | 3446 |
| 251 | Ga0209256_1018967 | 3300025299 | Bacteria | 2210 |
| 252 | Ga0207426_1000064 | 3300025302 | Bacteria | 358276 |
| 253 | Ga0207426_1000106 | 3300025302 | Bacteria | 244368 |
| 254 | Ga0207426_1000265 | 3300025302 | Bacteria | 110545 |
| 255 | Ga0207426_1000652 | 3300025302 | Bacteria | 42638 |
| 256 | Ga0209051_1000514 | 3300025303 | Bacteria | 48877 |
| 257 | Ga0209051_1006315 | 3300025303 | Bacteria | 6714 |
| 258 | Ga0209051_1009158 | 3300025303 | Bacteria | 5136 |
| 259 | Ga0209051_1010723 | 3300025303 | Bacteria | 4590 |
| 260 | Ga0209051_1012051 | 3300025303 | Bacteria | 4213 |
| 261 | Ga0209051_1035661 | 3300025303 | Bacteria | 1846 |
| 262 | Ga0209257_1001514 | 3300025304 | Bacteria | 27239 |
| 263 | Ga0209257_1003433 | 3300025304 | Bacteria | 13603 |
| 264 | Ga0209257_1007276 | 3300025304 | Bacteria | 6752 |
| 265 | Ga0207647_10136275 | 3300025904 | Bacteria | 1441 |
| 266 | Ga0207645_10381329 | 3300025907 | Bacteria | 946 |
| 267 | Ga0207705_10494451 | 3300025909 | Bacteria | 950 |
| 268 | Ga0207705_10507774 | 3300025909 | Bacteria | 936 |
| 269 | Ga0207654_10195106 | 3300025911 | Bacteria | 1330 |
| 270 | Ga0207695_10000024 | 3300025913 | Bacteria | 632311 |
| 271 | Ga0207695_10204177 | 3300025913 | Bacteria | 1889 |
| 272 | Ga0207695_10893348 | 3300025913 | Bacteria | 768 |
| 273 | Ga0207671_10000548 | 3300025914 | Bacteria | 50646 |
| 274 | Ga0207671_10278982 | 3300025914 | Bacteria | 1318 |
| 275 | Ga0207671_10442674 | 3300025914 | Bacteria | 1035 |
| 276 | Ga0207657_10314739 | 3300025919 | Bacteria | 1238 |
| 277 | Ga0207649_10264276 | 3300025920 | Bacteria | 1245 |
| 278 | Ga0207694_10422646 | 3300025924 | Bacteria | 1110 |
| 279 | Ga0207650_10081813 | 3300025925 | Bacteria | 2450 |
| 280 | Ga0207650_10533838 | 3300025925 | Bacteria | 983 |
| 281 | Ga0207709_10153168 | 3300025935 | Bacteria | 1599 |
| 282 | Ga0207691_10654793 | 3300025940 | Bacteria | 887 |
| 283 | Ga0207711_10184523 | 3300025941 | Bacteria | 1899 |
| 284 | Ga0207711_10668304 | 3300025941 | Bacteria | 969 |
| 285 | Ga0207711_11106698 | 3300025941 | Bacteria | 733 |
| 286 | Ga0207667_10592290 | 3300025949 | Bacteria | 1119 |
| 287 | Ga0207667_11073160 | 3300025949 | Bacteria | 790 |
| 288 | Ga0207712_10870052 | 3300025961 | Bacteria | 795 |
| 289 | Ga0207668_10127330 | 3300025972 | Bacteria | 1939 |
| 290 | Ga0207658_10817774 | 3300025986 | Bacteria | 846 |
| 291 | Ga0207639_10483918 | 3300026041 | Bacteria | 1128 |
| 292 | Ga0207678_10292975 | 3300026067 | Bacteria | 1398 |
| 293 | Ga0207678_10395227 | 3300026067 | Bacteria | 1196 |
| 294 | Ga0207678_10624394 | 3300026067 | Bacteria | 946 |
| 295 | Ga0207678_10698046 | 3300026067 | Bacteria | 893 |
| 296 | Ga0207702_10339629 | 3300026078 | Bacteria | 1434 |
| 297 | Ga0207648_10048598 | 3300026089 | Bacteria | 3713 |
| 298 | Ga0207676_10908409 | 3300026095 | Bacteria | 864 |
| 299 | Ga0207674_10620286 | 3300026116 | Bacteria | 1044 |
| 300 | Ga0207674_11228247 | 3300026116 | Bacteria | 719 |
| 301 | Ga0207698_10071975 | 3300026142 | Bacteria | 2746 |
| 302 | Ga0207698_11460869 | 3300026142 | Bacteria | 699 |
| 303 | Ga0207698_11920988 | 3300026142 | Bacteria | 607 |
| 304 | Ga0209281_1000266 | 3300027111 | Bacteria | 100574 |
| 305 | Ga0209281_1000332 | 3300027111 | Bacteria | 81534 |
| 306 | Ga0209371_1006525 | 3300027312 | Bacteria | 4299 |
| 307 | Ga0209282_1000007 | 3300027666 | Bacteria | 254917 |
| 308 | Ga0209813_10096417 | 3300027866 | Bacteria | 1000 |
| 309 | Ga0209813_10098778 | 3300027866 | Bacteria | 991 |
| 310 | Ga0268266_10197576 | 3300028379 | Bacteria | 1839 |
| 311 | Ga0307517_10189616 | 3300028786 | Bacteria | 1308 |
| 312 | Ga0307515_10005751 | 3300028794 | Bacteria | 25053 |
| 313 | Ga0307515_10035625 | 3300028794 | Bacteria | 8086 |
| 314 | Ga0307515_10584617 | 3300028794 | Bacteria | 727 |
| 315 | Ga0265340_10000501 | 3300031247 | Bacteria | 21465 |
| 316 | Ga0265339_10003493 | 3300031249 | Bacteria | 10989 |
| 317 | Ga0265331_10124673 | 3300031250 | Bacteria | 1177 |
| 318 | Ga0265316_10005614 | 3300031344 | Bacteria | 12140 |
| 319 | Ga0307513_10007830 | 3300031456 | Bacteria | 13779 |
| 320 | Ga0307513_10519529 | 3300031456 | Bacteria | 906 |
| 321 | Ga0307408_100222233 | 3300031548 | Bacteria | 1542 |
| 322 | Ga0307408_101963377 | 3300031548 | Bacteria | 562 |
| 323 | Ga0265313_10001319 | 3300031595 | Bacteria | 23394 |
| 324 | Ga0265342_10004425 | 3300031712 | Bacteria | 11079 |
| 325 | Ga0307405_10156070 | 3300031731 | Bacteria | 1611 |
| 326 | Ga0307410_11417569 | 3300031852 | Bacteria | 610 |
| 327 | Ga0307406_10180703 | 3300031901 | Bacteria | 1535 |
| 328 | Ga0307412_10007614 | 3300031911 | Bacteria | 6148 |
| 329 | Ga0307412_10226708 | 3300031911 | Bacteria | 1436 |
| 330 | Ga0315914_1000006 | 3300031967 | Bacteria | 239817 |
| 331 | Ga0307414_10836656 | 3300032004 | Bacteria | 841 |
| 332 | Ga0307411_11734411 | 3300032005 | Bacteria | 579 |
| 333 | Ga0307415_100732409 | 3300032126 | Bacteria | 896 |
| 334 | Ga0315913_1000002 | 3300033430 | Bacteria | 241452 |
| 335 | Ga0315915_1000001 | 3300033464 | Bacteria | 481518 |
| 336 | Ga0395899_0606124 | 3300037312 | Bacteria | 697 |
| 337 | Ga0395900_0137569 | 3300037418 | Bacteria | 2502 |
| 338 | Ga0395900_1214023 | 3300037418 | Bacteria | 669 |
| 339 | Ga0395900_1770937 | 3300037418 | Bacteria | 528 |
| 340 | Ga0395905_0071155 | 3300037471 | Bacteria | 3261 |
| 341 | Ga0395905_0152536 | 3300037471 | Bacteria | 2173 |
| 342 | Ga0395905_1037070 | 3300037471 | Bacteria | 723 |
| 343 | Ga0395901_0085966 | 3300038443 | Bacteria | 3288 |
| 344 | Ga0395901_0310835 | 3300038443 | Bacteria | 1632 |
| 345 | Ga0395901_0360412 | 3300038443 | Bacteria | 1499 |
| 346 | Ga0439465_0159451 | 3300041413 | Bacteria | 809 |
| 347 | Ga0451800_0535748 | 3300041459 | Bacteria | 749 |
| 348 | Ga0451807_1582717 | 3300041486 | Bacteria | 841 |
| 349 | Ga0451845_0248020 | 3300041501 | Bacteria | 609 |
| 350 | Ga0439449_0024873 | 3300042007 | Bacteria | 2239 |
| 351 | Ga0439458_0065109 | 3300042157 | Bacteria | 915 |
| 352 | Ga0466972_0017014 | 3300044658 | Bacteria | 3637 |
| 353 | Ga0466972_0053763 | 3300044658 | Bacteria | 1939 |
| 354 | Ga0466965_0507163 | 3300044683 | Bacteria | 677 |
| 355 | Ga0466968_0133356 | 3300044735 | Bacteria | 1132 |
| 356 | Ga0495638_0000353 | 3300046460 | Bacteria | 57451 |
| 357 | Ga0495650_0029385 | 3300046471 | Bacteria | 2506 |
| 358 | Ga0495650_0067074 | 3300046471 | Bacteria | 1419 |
| 359 | Ga0495605_0007427 | 3300046474 | Bacteria | 6219 |
| 360 | Ga0495584_0379935 | 3300046491 | Bacteria | 718 |
| 361 | Ga0495585_0006433 | 3300046492 | Bacteria | 7289 |
| 362 | Ga0495607_0026537 | 3300046501 | Bacteria | 3593 |
| 363 | Ga0495583_0008191 | 3300046506 | Bacteria | 6423 |
| 364 | Ga0495583_0052157 | 3300046506 | Bacteria | 1862 |
| 365 | Ga0495583_0246509 | 3300046506 | Bacteria | 717 |
| 366 | Ga0495606_0010611 | 3300046507 | Bacteria | 7624 |
| 367 | Ga0495606_0053589 | 3300046507 | Bacteria | 2617 |
| 368 | Ga0495606_0266217 | 3300046507 | Bacteria | 943 |
| 369 | Ga0495606_0361752 | 3300046507 | Bacteria | 767 |
| 370 | Ga0495610_0002493 | 3300046512 | Bacteria | 15389 |
| 371 | Ga0495610_0041836 | 3300046512 | Bacteria | 2296 |
| 372 | Ga0495620_0031635 | 3300046515 | Bacteria | 2422 |
| 373 | Ga0495631_0027247 | 3300046518 | Bacteria | 2617 |
| 374 | Ga0495631_0051597 | 3300046518 | Bacteria | 1797 |
| 375 | Ga0495632_0007287 | 3300046519 | Bacteria | 6973 |
| 376 | Ga0495632_0048475 | 3300046519 | Bacteria | 2103 |
| 377 | Ga0495632_0077562 | 3300046519 | Bacteria | 1588 |
| 378 | Ga0495643_0032728 | 3300046522 | Bacteria | 2883 |
| 379 | Ga0495643_0048443 | 3300046522 | Bacteria | 2297 |
| 380 | Ga0495643_0073423 | 3300046522 | Bacteria | 1792 |
| 381 | Ga0495648_0054864 | 3300046524 | Bacteria | 2405 |
| 382 | Ga0495654_0170477 | 3300046530 | Bacteria | 949 |
| 383 | Ga0495609_0263297 | 3300046538 | Bacteria | 708 |
| 384 | Ga0495597_0020027 | 3300046542 | Bacteria | 3122 |
| 385 | Ga0495668_0012552 | 3300046616 | Bacteria | 5023 |
| 386 | Ga0495668_0017902 | 3300046616 | Bacteria | 4104 |
| 387 | Ga0495668_0208060 | 3300046616 | Bacteria | 1071 |
| 388 | Ga0495668_0376928 | 3300046616 | Bacteria | 779 |
| 389 | Ga0495611_0017639 | 3300046648 | Bacteria | 3056 |
| 390 | Ga0495625_0001623 | 3300046660 | Bacteria | 26508 |
| 391 | Ga0495625_0012480 | 3300046660 | Bacteria | 6882 |
| 392 | Ga0495625_0495380 | 3300046660 | Bacteria | 748 |
| 393 | Ga0495661_0319278 | 3300046665 | Bacteria | 772 |
| 394 | Ga0495670_0251093 | 3300046691 | Bacteria | 943 |
| 395 | Ga0495649_0037909 | 3300046694 | Bacteria | 2645 |
| 396 | Ga0495649_0138817 | 3300046694 | Bacteria | 1280 |
| 397 | Ga0495660_0033898 | 3300046810 | Bacteria | 2860 |
| 398 | Ga0495660_0043125 | 3300046810 | Bacteria | 2489 |
| 399 | Ga0495660_0096574 | 3300046810 | Bacteria | 1527 |
| 400 | Ga0495636_0053564 | 3300047318 | Bacteria | 1694 |
| 401 | Ga0495636_0054551 | 3300047318 | Bacteria | 1680 |
| 402 | Ga0495672_0011740 | 3300047320 | Bacteria | 6160 |
| 403 | Ga0495683_0272747 | 3300047323 | Bacteria | 735 |
| 404 | Ga0495687_040495 | 3300047443 | Bacteria | 2052 |
| 405 | Ga0495687_107672 | 3300047443 | Bacteria | 1032 |
| 406 | Ga0495686_0010459 | 3300047472 | Bacteria | 6597 |
| 407 | Ga0495686_0011085 | 3300047472 | Bacteria | 6373 |
| 408 | Ga0495686_0061215 | 3300047472 | Bacteria | 2338 |
| 409 | Ga0495686_0071177 | 3300047472 | Bacteria | 2141 |
| 410 | Ga0495686_0249930 | 3300047472 | Bacteria | 997 |
| 411 | Ga0495686_0269012 | 3300047472 | Bacteria | 951 |
| 412 | Ga0495686_0332664 | 3300047472 | Bacteria | 830 |
| 413 | Ga0495686_0365231 | 3300047472 | Bacteria | 782 |
| 414 | Ga0495626_0228138 | 3300048091 | Bacteria | 754 |
| 415 | Ga0496101_0459728 | 3300048904 | Bacteria | 1004 |
| 416 | Ga0496101_0485489 | 3300048904 | Bacteria | 976 |
| 417 | Ga0496102_0375020 | 3300048905 | Bacteria | 1339 |
| 418 | Ga0496103_0279087 | 3300048906 | Bacteria | 1075 |
| 419 | Ga0496105_0263058 | 3300048908 | Bacteria | 1395 |
| 420 | Ga0496106_0018110 | 3300048909 | Bacteria | 5208 |
| 421 | Ga0496108_1210510 | 3300048911 | Bacteria | 638 |
| 422 | Ga0496109_0430614 | 3300048912 | Bacteria | 1246 |
| 423 | Ga0496112_0154436 | 3300048915 | Bacteria | 2262 |
| 424 | Ga0496112_0240994 | 3300048915 | Bacteria | 1761 |
| 425 | Ga0496115_0052156 | 3300048918 | Bacteria | 3281 |
| 426 | Ga0496115_1086062 | 3300048918 | Bacteria | 607 |
| 427 | Ga0496116_0007220 | 3300048919 | Bacteria | 9912 |
| 428 | Ga0496116_0009103 | 3300048919 | Bacteria | 8512 |
| 429 | Ga0496116_0015251 | 3300048919 | Bacteria | 6082 |
| 430 | Ga0496116_0018933 | 3300048919 | Bacteria | 5287 |
| 431 | Ga0496116_0051522 | 3300048919 | Bacteria | 2734 |
| 432 | Ga0496116_0115594 | 3300048919 | Bacteria | 1565 |
| 433 | Ga0496117_0003176 | 3300048920 | Bacteria | 19539 |
| 434 | Ga0496117_0026761 | 3300048920 | Bacteria | 4506 |
| 435 | Ga0496117_0061050 | 3300048920 | Bacteria | 2593 |
| 436 | Ga0496117_0066338 | 3300048920 | Bacteria | 2449 |
| 437 | Ga0496117_0241822 | 3300048920 | Bacteria | 990 |
| 438 | Ga0496117_0340261 | 3300048920 | Bacteria | 779 |
| 439 | Ga0496118_0046838 | 3300048921 | Bacteria | 3358 |
| 440 | Ga0496118_0081627 | 3300048921 | Bacteria | 2269 |
| 441 | Ga0496118_0093731 | 3300048921 | Bacteria | 2056 |
| 442 | Ga0496119_0043400 | 3300048922 | Bacteria | 2841 |
| 443 | Ga0496119_0078325 | 3300048922 | Bacteria | 1912 |
| 444 | Ga0496119_0145859 | 3300048922 | Bacteria | 1273 |
| 445 | Ga0496119_0214718 | 3300048922 | Bacteria | 988 |
| 446 | Ga0496119_0252069 | 3300048922 | Bacteria | 890 |
| 447 | Ga0496119_0547788 | 3300048922 | Bacteria | 532 |
| 448 | Ga0496119_0568823 | 3300048922 | Bacteria | 519 |
| 449 | Ga0496120_0000860 | 3300048923 | Bacteria | 42971 |
| 450 | Ga0496121_0008689 | 3300048924 | Bacteria | 11858 |
| 451 | Ga0496121_0010436 | 3300048924 | Bacteria | 10479 |
| 452 | Ga0496121_0016167 | 3300048924 | Bacteria | 7725 |
| 453 | Ga0496121_0017218 | 3300048924 | Bacteria | 7400 |
| 454 | Ga0496121_0210637 | 3300048924 | Bacteria | 1377 |
| 455 | Ga0496121_0220364 | 3300048924 | Bacteria | 1337 |
| 456 | Ga0496121_0340235 | 3300048924 | Bacteria | 1003 |
| 457 | Ga0496122_0000492 | 3300048925 | Bacteria | 82125 |
| 458 | Ga0496122_0010176 | 3300048925 | Bacteria | 9745 |
| 459 | Ga0496122_0032451 | 3300048925 | Bacteria | 4318 |
| 460 | Ga0496122_0046163 | 3300048925 | Bacteria | 3377 |
| 461 | Ga0496122_0152169 | 3300048925 | Bacteria | 1426 |
| 462 | Ga0496123_0000460 | 3300048926 | Bacteria | 71476 |
| 463 | Ga0496123_0008658 | 3300048926 | Bacteria | 9300 |
| 464 | Ga0496123_0030918 | 3300048926 | Bacteria | 3909 |
| 465 | Ga0496123_0055898 | 3300048926 | Bacteria | 2585 |
| 466 | Ga0496123_0077128 | 3300048926 | Bacteria | 2048 |
| 467 | Ga0496124_0000679 | 3300048927 | Bacteria | 55901 |
| 468 | Ga0496124_0008621 | 3300048927 | Bacteria | 10629 |
| 469 | Ga0496124_0023070 | 3300048927 | Bacteria | 5692 |
| 470 | Ga0496124_0035244 | 3300048927 | Bacteria | 4380 |
| 471 | Ga0496124_0274342 | 3300048927 | Bacteria | 1233 |
| 472 | Ga0496124_0351007 | 3300048927 | Bacteria | 1043 |
| 473 | Ga0496124_0353882 | 3300048927 | Bacteria | 1038 |
| 474 | Ga0496124_0386900 | 3300048927 | Bacteria | 976 |
| 475 | Ga0496124_0505504 | 3300048927 | Bacteria | 809 |
| 476 | Ga0496125_0000912 | 3300048928 | Bacteria | 46601 |
| 477 | Ga0496125_0005687 | 3300048928 | Bacteria | 13749 |
| 478 | Ga0496125_0067235 | 3300048928 | Bacteria | 2825 |
| 479 | Ga0496125_0193125 | 3300048928 | Bacteria | 1342 |
| 480 | Ga0496125_0313219 | 3300048928 | Bacteria | 955 |
| 481 | Ga0496125_0529709 | 3300048928 | Bacteria | 657 |
| 482 | Ga0496126_0000811 | 3300048929 | Bacteria | 55747 |
| 483 | Ga0496126_0042355 | 3300048929 | Bacteria | 4206 |
| 484 | Ga0496126_0058039 | 3300048929 | Bacteria | 3490 |
| 485 | Ga0496126_0063975 | 3300048929 | Bacteria | 3296 |
| 486 | Ga0496126_0064123 | 3300048929 | Bacteria | 3292 |
| 487 | Ga0496126_0556629 | 3300048929 | Bacteria | 909 |
| 488 | Ga0496126_0577823 | 3300048929 | Bacteria | 888 |
| 489 | Ga0495678_042285 | 3300049459 | Bacteria | 1817 |
| 490 | Ga0495678_084516 | 3300049459 | Bacteria | 1132 |
| 491 | Ga0501031_0264111 | 3300049568 | Bacteria | 1118 |
| 492 | Ga0501033_0160706 | 3300049570 | Bacteria | 1617 |
| 493 | Ga0501034_0094492 | 3300049571 | Bacteria | 2986 |
| 494 | Ga0501034_0198137 | 3300049571 | Bacteria | 1967 |
| 495 | Ga0501034_0259846 | 3300049571 | Bacteria | 1679 |
| 496 | Ga0501034_0295098 | 3300049571 | Bacteria | 1558 |
| 497 | Ga0501034_0345362 | 3300049571 | Bacteria | 1417 |
| 498 | Ga0501034_1710748 | 3300049571 | Bacteria | 501 |
| 499 | Ga0501036_0078466 | 3300049572 | Bacteria | 2793 |
| 500 | Ga0501036_0456669 | 3300049572 | Bacteria | 1064 |
| 501 | Ga0501037_0133340 | 3300049573 | Bacteria | 1780 |
| 502 | Ga0501038_0099928 | 3300049574 | Bacteria | 2418 |
| 503 | Ga0501038_0296287 | 3300049574 | Bacteria | 1270 |
| 504 | Ga0501043_0065320 | 3300049579 | Bacteria | 2857 |
| 505 | Ga0501046_0369144 | 3300049580 | Bacteria | 1040 |
| 506 | Ga0501046_0622939 | 3300049580 | Bacteria | 764 |
| 507 | Ga0501047_0065217 | 3300049581 | Bacteria | 3510 |
| 508 | Ga0501047_0111102 | 3300049581 | Bacteria | 2623 |
| 509 | Ga0501047_0197521 | 3300049581 | Bacteria | 1873 |
| 510 | Ga0501047_0900762 | 3300049581 | Bacteria | 698 |
| 511 | Ga0501047_0979782 | 3300049581 | Bacteria | 659 |
| 512 | Ga0501067_0023007 | 3300049583 | Bacteria | 3451 |
| 513 | Ga0501068_0292612 | 3300049584 | Bacteria | 1042 |
| 514 | Ga0501069_0214667 | 3300049585 | Bacteria | 1117 |
| 515 | Ga0501070_0869177 | 3300049586 | Bacteria | 705 |
| 516 | Ga0501070_0910576 | 3300049586 | Bacteria | 686 |
| 517 | Ga0501070_0922812 | 3300049586 | Bacteria | 680 |
| 518 | Ga0501072_0640867 | 3300049588 | Bacteria | 837 |
| 519 | Ga0501073_0079190 | 3300049589 | Bacteria | 2287 |
| 520 | Ga0501073_0200642 | 3300049589 | Bacteria | 1379 |
| 521 | Ga0501073_0339623 | 3300049589 | Bacteria | 1037 |
| 522 | Ga0501074_0012831 | 3300049590 | Bacteria | 6092 |
| 523 | Ga0501076_0773633 | 3300049592 | Bacteria | 792 |
| 524 | Ga0501076_1730454 | 3300049592 | Bacteria | 513 |
| 525 | Ga0501080_0181495 | 3300049742 | Bacteria | 1936 |
| 526 | Ga0501083_0009805 | 3300049744 | Bacteria | 6761 |
| 527 | Ga0501083_0039640 | 3300049744 | Bacteria | 3198 |
| 528 | Ga0501035_0057961 | 3300049822 | Bacteria | 3452 |
| 529 | Ga0501035_0132077 | 3300049822 | Bacteria | 2176 |
| 530 | Ga0501044_0167742 | 3300049823 | Bacteria | 2169 |
| 531 | Ga0501044_0237335 | 3300049823 | Bacteria | 1768 |
| 532 | Ga0501044_0481942 | 3300049823 | Bacteria | 1143 |
| 533 | nmdc:mga03683_11535_c1 | 3300050489 | Bacteria | 3202 |
| 534 | nmdc:mga03683_22372_c1 | 3300050489 | Bacteria | 2450 |
| 535 | nmdc:mga03683_47539_c1 | 3300050489 | Bacteria | 1781 |
| 536 | nmdc:mga03n38_124021_c1 | 3300050490 | Bacteria | 1273 |
| 537 | nmdc:mga03n38_35795_c1 | 3300050490 | Bacteria | 2130 |
| 538 | nmdc:mga03n38_631065_c1 | 3300050490 | Bacteria | 613 |
| 539 | nmdc:mga03n38_87203_c1 | 3300050490 | Bacteria | 1479 |
| 540 | nmdc:mga00v17_117063_c1 | 3300050491 | Bacteria | 1694 |
| 541 | nmdc:mga00v17_202522_c1 | 3300050491 | Bacteria | 1283 |
| 542 | nmdc:mga00v17_569844_c1 | 3300050491 | Bacteria | 731 |
| 543 | nmdc:mga00v17_9680_c1 | 3300050491 | Bacteria | 5228 |
| 544 | nmdc:mga0yw44_12368_c1 | 3300050492 | Bacteria | 4446 |
| 545 | nmdc:mga0yw44_132598_c1 | 3300050492 | Bacteria | 1614 |
| 546 | nmdc:mga0yw44_319901_c1 | 3300050492 | Bacteria | 1042 |
| 547 | nmdc:mga0yw44_474748_c1 | 3300050492 | Bacteria | 848 |
| 548 | nmdc:mga0k408_379304_c1 | 3300050493 | Bacteria | 842 |
| 549 | nmdc:mga0k408_575918_c1 | 3300050493 | Bacteria | 665 |
| 550 | nmdc:mga06z11_14207_c1 | 3300050494 | Bacteria | 3521 |
| 551 | nmdc:mga06z11_145082_c1 | 3300050494 | Bacteria | 1345 |
| 552 | nmdc:mga06z11_20079_c1 | 3300050494 | Bacteria | 3083 |
| 553 | nmdc:mga04h51_115056_c1 | 3300050495 | Bacteria | 996 |
| 554 | nmdc:mga04h51_246638_c1 | 3300050495 | Bacteria | 715 |
| 555 | nmdc:mga07m45_106669_c1 | 3300050496 | Bacteria | 1612 |
| 556 | nmdc:mga07m45_13864_c1 | 3300050496 | Bacteria | 4283 |
| 557 | nmdc:mga07m45_329980_c1 | 3300050496 | Bacteria | 887 |
| 558 | nmdc:mga0sz30_121118_c1 | 3300050516 | Bacteria | 1150 |
| 559 | nmdc:mga0sz30_169813_c1 | 3300050516 | Bacteria | 967 |
| 560 | nmdc:mga0sz30_31522_c1 | 3300050516 | Bacteria | 2194 |
| 561 | Ga0500610_0064332 | 3300053079 | Bacteria | 1913 |
| 562 | Ga0500610_0167408 | 3300053079 | Bacteria | 1088 |
| 563 | Ga0495655_0112839 | 3300053083 | Bacteria | 819 |
| 564 | Ga0500578_0373652 | 3300053086 | Bacteria | 828 |
| 565 | Ga0500644_0170197 | 3300053088 | Bacteria | 886 |
| 566 | Ga0500557_014653 | 3300053105 | Bacteria | 2098 |
| 567 | Ga0500569_007004 | 3300053109 | Bacteria | 2507 |
| 568 | Ga0500569_030321 | 3300053109 | Bacteria | 1512 |
| 569 | Ga0500594_0081562 | 3300053118 | Bacteria | 968 |
| 570 | Ga0500595_060013 | 3300053119 | Bacteria | 1152 |
| 571 | Ga0500608_257868 | 3300053122 | Bacteria | 675 |
| 572 | Ga0500658_0006268 | 3300053134 | Bacteria | 4422 |
| 573 | Ga0500658_0339962 | 3300053134 | Bacteria | 689 |
| 574 | Ga0500658_0475661 | 3300053134 | Bacteria | 567 |
| 575 | Ga0500568_0000108 | 3300053139 | Bacteria | 77013 |
| 576 | Ga0500568_0006791 | 3300053139 | Bacteria | 5703 |
| 577 | Ga0500568_0008893 | 3300053139 | Bacteria | 4804 |
| 578 | Ga0500577_0142941 | 3300053142 | Bacteria | 1010 |
| 579 | Ga0500588_0033680 | 3300053146 | Bacteria | 1496 |
| 580 | Ga0500604_0041599 | 3300053151 | Bacteria | 1390 |
| 581 | Ga0500604_0049242 | 3300053151 | Bacteria | 1295 |
| 582 | Ga0500616_0006373 | 3300053153 | Bacteria | 7739 |
| 583 | Ga0500616_0094806 | 3300053153 | Bacteria | 1469 |
| 584 | Ga0500622_0002169 | 3300053156 | Bacteria | 14541 |
| 585 | Ga0500627_0083951 | 3300053158 | Bacteria | 1421 |
| 586 | Ga0500611_005807 | 3300053727 | Bacteria | 1759 |
| 587 | Ga0500611_111195 | 3300053727 | Bacteria | 720 |
| 588 | Ga0500645_153143 | 3300053730 | Bacteria | 634 |
| 589 | Ga0501084_0201222 | 3300054114 | Bacteria | 1680 |
| 590 | Ga0501084_0323491 | 3300054114 | Bacteria | 1302 |
| 591 | Ga0501082_0208207 | 3300060353 | Bacteria | 1701 |
| 592 | Ga0501082_0950758 | 3300060353 | Bacteria | 751 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049580 | Ga0501046_0622939 | Ga0501046_0622939_368_739 | 120 |
| 2 | 3300049585 | Ga0501069_0214667 | Ga0501069_0214667_352_723 | 120 |
| 3 | 3300049586 | Ga0501070_0922812 | Ga0501070_0922812_49_420 | 120 |
| 4 | 3300049823 | Ga0501044_0167742 | Ga0501044_0167742_1161_1532 | 120 |
| 5 | 3300049571 | Ga0501034_0259846 | Ga0501034_0259846_39_416 | 122 |
| 6 | 3300049571 | Ga0501034_0295098 | Ga0501034_0295098_759_1136 | 122 |
| 7 | 3300049571 | Ga0501034_1710748 | Ga0501034_1710748_42_419 | 122 |
| 8 | 3300049574 | Ga0501038_0296287 | Ga0501038_0296287_553_930 | 122 |
| 9 | 3300049586 | Ga0501070_0869177 | Ga0501070_0869177_199_576 | 122 |
| 10 | 3300049589 | Ga0501073_0339623 | Ga0501073_0339623_633_1010 | 122 |
| 11 | 3300060353 | Ga0501082_0950758 | Ga0501082_0950758_330_713 | 122 |
| 12 | 3300049581 | Ga0501047_0979782 | Ga0501047_0979782_89_469 | 123 |
| 13 | iso_pu_bacteria | 2534681796 | 2535515701 | 135 |
| 14 | 3300049581 | Ga0501047_0197521 | Ga0501047_0197521_228_650 | 137 |
| 15 | 3300049588 | Ga0501072_0640867 | Ga0501072_0640867_33_455 | 137 |
| 16 | 3300049592 | Ga0501076_0773633 | Ga0501076_0773633_35_457 | 137 |
| 17 | 3300049744 | Ga0501083_0039640 | Ga0501083_0039640_1961_2383 | 137 |
| 18 | 3300054114 | Ga0501084_0201222 | Ga0501084_0201222_439_861 | 137 |
| 19 | 3300028794 | Ga0307515_10005751 | Ga0307515_1000575110 | 139 |
| 20 | iso_pu_bacteria | 2922178524 | 2922184670 | 143 |
| 21 | 3300037418 | Ga0395900_1770937 | Ga0395900_1770937_15_449 | 144 |
| 22 | 3300042007 | Ga0439449_0024873 | Ga0439449_0024873_1000_1434 | 144 |
| 23 | 3300046507 | Ga0495606_0361752 | Ga0495606_0361752_28_462 | 144 |
| 24 | 3300048904 | Ga0496101_0485489 | Ga0496101_0485489_509_943 | 144 |
| 25 | 3300048922 | Ga0496119_0252069 | Ga0496119_0252069_402_836 | 144 |
| 26 | 3300048922 | Ga0496119_0547788 | Ga0496119_0547788_35_469 | 144 |
| 27 | 3300048927 | Ga0496124_0351007 | Ga0496124_0351007_116_550 | 144 |
| 28 | 3300048928 | Ga0496125_0529709 | Ga0496125_0529709_194_628 | 144 |
| 29 | 3300053086 | Ga0500578_0373652 | Ga0500578_0373652_37_471 | 144 |
| 30 | 3300053151 | Ga0500604_0049242 | Ga0500604_0049242_20_454 | 144 |
| 31 | 3300053153 | Ga0500616_0006373 | Ga0500616_0006373_16_450 | 144 |
| 32 | 3300006051 | Ga0075364_10182629 | Ga0075364_101826292 | 145 |
| 33 | 3300006177 | Ga0075362_10017051 | Ga0075362_100170513 | 145 |
| 34 | 3300050489 | nmdc:mga03683_11535_c1 | nmdc:mga03683_11535_c1_1221_1700 | 145 |
| 35 | 3300050491 | nmdc:mga00v17_117063_c1 | nmdc:mga00v17_117063_c1_711_1163 | 145 |
| 36 | iso_pu_bacteria | 2775507049 | 2776912753 | 145 |
| 37 | iso_pu_bacteria | 2995392953 | 2995393815 | 148 |
| 38 | iso_pu_bacteria | 8005658619 | 8005659997 | 148 |
| 39 | 3300049589 | Ga0501073_0079190 | Ga0501073_0079190_1749_2213 | 149 |
| 40 | iso_pu_bacteria | 8018150411 | 8018150821 | 149 |
| 41 | 3300049571 | Ga0501034_0198137 | Ga0501034_0198137_1161_1622 | 150 |
| 42 | 3300049581 | Ga0501047_0065217 | Ga0501047_0065217_2398_2859 | 150 |
| 43 | 3300049583 | Ga0501067_0023007 | Ga0501067_0023007_1814_2275 | 150 |
| 44 | 3300049589 | Ga0501073_0200642 | Ga0501073_0200642_630_1091 | 150 |
| 45 | 3300049590 | Ga0501074_0012831 | Ga0501074_0012831_2704_3165 | 150 |
| 46 | 3300049744 | Ga0501083_0009805 | Ga0501083_0009805_4151_4612 | 150 |
| 47 | 3300054114 | Ga0501084_0323491 | Ga0501084_0323491_270_731 | 150 |
| 48 | 3300060353 | Ga0501082_0208207 | Ga0501082_0208207_1185_1646 | 150 |
| 49 | iso_pu_bacteria | 2558860983 | 2561466041 | 150 |
| 50 | iso_pu_bacteria | 2643221653 | 2644296853 | 150 |
| 51 | iso_pu_bacteria | 2643221719 | 2644655107 | 150 |
| 52 | iso_pu_bacteria | 2989776772 | 2989778159 | 150 |
| 53 | iso_pu_bacteria | 8005246636 | 8005251341 | 150 |
| 54 | iso_pu_bacteria | 8055431914 | 8055434153 | 150 |
| 55 | 3300005331 | Ga0070670_100002600 | Ga0070670_1000026004 | 152 |
| 56 | 3300025925 | Ga0207650_10081813 | Ga0207650_100818132 | 152 |
| 57 | 3300037471 | Ga0395905_0152536 | Ga0395905_0152536_501_971 | 152 |
| 58 | 3300047472 | Ga0495686_0249930 | Ga0495686_0249930_138_605 | 152 |
| 59 | 3300053122 | Ga0500608_257868 | Ga0500608_257868_119_592 | 152 |
| 60 | 3300049581 | Ga0501047_0111102 | Ga0501047_0111102_505_975 | 153 |
| 61 | iso_pu_bacteria | 2582581866 | 2585392696 | 153 |
| 62 | iso_pu_bacteria | 2738541317 | 2738946574 | 153 |
| 63 | iso_pu_bacteria | 2791355253 | 2793282283 | 153 |
| 64 | iso_pu_bacteria | 2899803654 | 2899803757 | 153 |
| 65 | iso_pu_bacteria | 2913308742 | 2913310991 | 153 |
| 66 | iso_pu_bacteria | 2989349275 | 2989354192 | 153 |
| 67 | 3300053139 | Ga0500568_0000108 | Ga0500568_0000108_38265_38738 | 154 |
| 68 | iso_pu_bacteria | 2503198000 | 2503203346 | 154 |
| 69 | iso_pu_bacteria | 2508501122 | 2509108503 | 154 |
| 70 | iso_pu_bacteria | 2508501123 | 2509116108 | 154 |
| 71 | iso_pu_bacteria | 2508501127 | 2509141512 | 154 |
| 72 | iso_pu_bacteria | 2509276018 | 2509370077 | 154 |
| 73 | iso_pu_bacteria | 2509276019 | 2509374471 | 154 |
| 74 | iso_pu_bacteria | 2509276021 | 2509387733 | 154 |
| 75 | iso_pu_bacteria | 2509276022 | 2509397775 | 154 |
| 76 | iso_pu_bacteria | 2509276033 | 2509443091 | 154 |
| 77 | iso_pu_bacteria | 2510065019 | 2510132283 | 154 |
| 78 | iso_pu_bacteria | 2510065059 | 2510319032 | 154 |
| 79 | iso_pu_bacteria | 2510461076 | 2510898622 | 154 |
| 80 | iso_pu_bacteria | 2510917022 | 2511133508 | 154 |
| 81 | iso_pu_bacteria | 2510917028 | 2511186342 | 154 |
| 82 | iso_pu_bacteria | 2510917030 | 2511197239 | 154 |
| 83 | iso_pu_bacteria | 2512875016 | 2512929769 | 154 |
| 84 | iso_pu_bacteria | 2512875024 | 2512964540 | 154 |
| 85 | iso_pu_bacteria | 2513237084 | 2513569120 | 154 |
| 86 | iso_pu_bacteria | 2513237085 | 2513578789 | 154 |
| 87 | iso_pu_bacteria | 2513237086 | 2513583460 | 154 |
| 88 | iso_pu_bacteria | 2513237088 | 2513596232 | 154 |
| 89 | iso_pu_bacteria | 2513237090 | 2513608416 | 154 |
| 90 | iso_pu_bacteria | 2513237093 | 2513632771 | 154 |
| 91 | iso_pu_bacteria | 2513237103 | 2513709222 | 154 |
| 92 | iso_pu_bacteria | 2513237138 | 2513868752 | 154 |
| 93 | iso_pu_bacteria | 2513237146 | 2513925691 | 154 |
| 94 | iso_pu_bacteria | 2513237162 | 2514020768 | 154 |
| 95 | iso_pu_bacteria | 2513237164 | 2514033345 | 154 |
| 96 | iso_pu_bacteria | 2515075009 | 2515111267 | 154 |
| 97 | iso_pu_bacteria | 2515154107 | 2515608112 | 154 |
| 98 | iso_pu_bacteria | 2515154113 | 2515637852 | 154 |
| 99 | iso_pu_bacteria | 2515154114 | 2515642598 | 154 |
| 100 | iso_pu_bacteria | 2515154116 | 2515659207 | 154 |
| 101 | iso_pu_bacteria | 2515154134 | 2515740446 | 154 |
| 102 | iso_pu_bacteria | 2516653077 | 2517039909 | 154 |
| 103 | iso_pu_bacteria | 2516653085 | 2517075451 | 154 |
| 104 | iso_pu_bacteria | 2517093000 | 2517094040 | 154 |
| 105 | iso_pu_bacteria | 2517287029 | 2517405858 | 154 |
| 106 | iso_pu_bacteria | 2519899620 | 2520378746 | 154 |
| 107 | iso_pu_bacteria | 2524023207 | 2524451150 | 154 |
| 108 | iso_pu_bacteria | 2524023209 | 2524460668 | 154 |
| 109 | iso_pu_bacteria | 2529292951 | 2530643910 | 154 |
| 110 | iso_pu_bacteria | 2551306084 | 2551676461 | 154 |
| 111 | iso_pu_bacteria | 2551306085 | 2551687182 | 154 |
| 112 | iso_pu_bacteria | 2551306087 | 2551702979 | 154 |
| 113 | iso_pu_bacteria | 2551306090 | 2551720643 | 154 |
| 114 | iso_pu_bacteria | 2551306093 | 2551739533 | 154 |
| 115 | iso_pu_bacteria | 2558860100 | 2558863498 | 154 |
| 116 | iso_pu_bacteria | 2582581294 | 2585203061 | 154 |
| 117 | iso_pu_bacteria | 2582581298 | 2585220978 | 154 |
| 118 | iso_pu_bacteria | 2582581299 | 2585231512 | 154 |
| 119 | iso_pu_bacteria | 2582581304 | 2585256632 | 154 |
| 120 | iso_pu_bacteria | 2582581307 | 2585273278 | 154 |
| 121 | iso_pu_bacteria | 2582581308 | 2585278889 | 154 |
| 122 | iso_pu_bacteria | 2582581315 | 2585325498 | 154 |
| 123 | iso_pu_bacteria | 2582581316 | 2585329653 | 154 |
| 124 | iso_pu_bacteria | 2582581867 | 2585400142 | 154 |
| 125 | iso_pu_bacteria | 2585427526 | 2585527947 | 154 |
| 126 | iso_pu_bacteria | 2585427527 | 2585530686 | 154 |
| 127 | iso_pu_bacteria | 2585427528 | 2585541449 | 154 |
| 128 | iso_pu_bacteria | 2585427529 | 2585549922 | 154 |
| 129 | iso_pu_bacteria | 2585427530 | 2585554866 | 154 |
| 130 | iso_pu_bacteria | 2585427531 | 2585559422 | 154 |
| 131 | iso_pu_bacteria | 2585427590 | 2585822701 | 154 |
| 132 | iso_pu_bacteria | 2585427593 | 2585839418 | 154 |
| 133 | iso_pu_bacteria | 2585427594 | 2585847235 | 154 |
| 134 | iso_pu_bacteria | 2585427608 | 2585902092 | 154 |
| 135 | iso_pu_bacteria | 2585427609 | 2585905202 | 154 |
| 136 | iso_pu_bacteria | 2585428125 | 2587979683 | 154 |
| 137 | iso_pu_bacteria | 2597489875 | 2597815053 | 154 |
| 138 | iso_pu_bacteria | 2599185170 | 2599418607 | 154 |
| 139 | iso_pu_bacteria | 2599185301 | 2599940368 | 154 |
| 140 | iso_pu_bacteria | 2599185352 | 2600191916 | 154 |
| 141 | iso_pu_bacteria | 2615840624 | 2616296229 | 154 |
| 142 | iso_pu_bacteria | 2615840626 | 2616305838 | 154 |
| 143 | iso_pu_bacteria | 2643221557 | 2643807219 | 154 |
| 144 | iso_pu_bacteria | 2643221595 | 2643985385 | 154 |
| 145 | iso_pu_bacteria | 2643221599 | 2644007907 | 154 |
| 146 | iso_pu_bacteria | 2643221610 | 2644069515 | 154 |
| 147 | iso_pu_bacteria | 2643221618 | 2644109009 | 154 |
| 148 | iso_pu_bacteria | 2643221623 | 2644132889 | 154 |
| 149 | iso_pu_bacteria | 2643221626 | 2644151531 | 154 |
| 150 | iso_pu_bacteria | 2643221627 | 2644152081 | 154 |
| 151 | iso_pu_bacteria | 2643221634 | 2644196497 | 154 |
| 152 | iso_pu_bacteria | 2643221637 | 2644206223 | 154 |
| 153 | iso_pu_bacteria | 2643221643 | 2644242868 | 154 |
| 154 | iso_pu_bacteria | 2643221655 | 2644311665 | 154 |
| 155 | iso_pu_bacteria | 2643221659 | 2644329923 | 154 |
| 156 | iso_pu_bacteria | 2643221668 | 2644380601 | 154 |
| 157 | iso_pu_bacteria | 2643221675 | 2644420669 | 154 |
| 158 | iso_pu_bacteria | 2643221680 | 2644454194 | 154 |
| 159 | iso_pu_bacteria | 2643221688 | 2644493417 | 154 |
| 160 | iso_pu_bacteria | 2643221698 | 2644546597 | 154 |
| 161 | iso_pu_bacteria | 2643221712 | 2644617464 | 154 |
| 162 | iso_pu_bacteria | 2643221718 | 2644649870 | 154 |
| 163 | iso_pu_bacteria | 2643221723 | 2644675668 | 154 |
| 164 | iso_pu_bacteria | 2643221726 | 2644689531 | 154 |
| 165 | iso_pu_bacteria | 2657244999 | 2657683276 | 154 |
| 166 | iso_pu_bacteria | 2687453392 | 2688600182 | 154 |
| 167 | iso_pu_bacteria | 2690316117 | 2692316840 | 154 |
| 168 | iso_pu_bacteria | 2718217882 | 2719180274 | 154 |
| 169 | iso_pu_bacteria | 2718217927 | 2719384843 | 154 |
| 170 | iso_pu_bacteria | 2718217997 | 2719664600 | 154 |
| 171 | iso_pu_bacteria | 2718218009 | 2719731023 | 154 |
| 172 | iso_pu_bacteria | 2718218199 | 2720491020 | 154 |
| 173 | iso_pu_bacteria | 2718218232 | 2720612382 | 154 |
| 174 | iso_pu_bacteria | 2718218233 | 2720619220 | 154 |
| 175 | iso_pu_bacteria | 2718218235 | 2720630622 | 154 |
| 176 | iso_pu_bacteria | 2718218269 | 2720774315 | 154 |
| 177 | iso_pu_bacteria | 2718218363 | 2721146368 | 154 |
| 178 | iso_pu_bacteria | 2718218365 | 2721157889 | 154 |
| 179 | iso_pu_bacteria | 2718218366 | 2721163247 | 154 |
| 180 | iso_pu_bacteria | 2718218423 | 2721398562 | 154 |
| 181 | iso_pu_bacteria | 2721755514 | 2722839417 | 154 |
| 182 | iso_pu_bacteria | 2721755556 | 2723026042 | 154 |
| 183 | iso_pu_bacteria | 2721755684 | 2723559586 | 154 |
| 184 | iso_pu_bacteria | 2721755685 | 2723566203 | 154 |
| 185 | iso_pu_bacteria | 2721755809 | 2724037375 | 154 |
| 186 | iso_pu_bacteria | 2721755810 | 2724043779 | 154 |
| 187 | iso_pu_bacteria | 2721755819 | 2724088922 | 154 |
| 188 | iso_pu_bacteria | 2721755822 | 2724103468 | 154 |
| 189 | iso_pu_bacteria | 2721755823 | 2724109313 | 154 |
| 190 | iso_pu_bacteria | 2724679232 | 2725948471 | 154 |
| 191 | iso_pu_bacteria | 2728369352 | 2730106978 | 154 |
| 192 | iso_pu_bacteria | 2728369365 | 2730163511 | 154 |
| 193 | iso_pu_bacteria | 2728369397 | 2730297521 | 154 |
| 194 | iso_pu_bacteria | 2738541293 | 2738802145 | 154 |
| 195 | iso_pu_bacteria | 2738541333 | 2739035879 | 154 |
| 196 | iso_pu_bacteria | 2738543024 | 2739306485 | 154 |
| 197 | iso_pu_bacteria | 2751185821 | 2753460794 | 154 |
| 198 | iso_pu_bacteria | 2756170246 | 2756673256 | 154 |
| 199 | iso_pu_bacteria | 2765235942 | 2766067620 | 154 |
| 200 | iso_pu_bacteria | 2775507266 | 2778177444 | 154 |
| 201 | iso_pu_bacteria | 2791355082 | 2792584151 | 154 |
| 202 | iso_pu_bacteria | 2791355091 | 2792622698 | 154 |
| 203 | iso_pu_bacteria | 2791355092 | 2792628381 | 154 |
| 204 | iso_pu_bacteria | 2791355094 | 2792638357 | 154 |
| 205 | iso_pu_bacteria | 2791355259 | 2793317507 | 154 |
| 206 | iso_pu_bacteria | 2791355260 | 2793321116 | 154 |
| 207 | iso_pu_bacteria | 2791355261 | 2793327149 | 154 |
| 208 | iso_pu_bacteria | 2791355262 | 2793333599 | 154 |
| 209 | iso_pu_bacteria | 2791355263 | 2793339816 | 154 |
| 210 | iso_pu_bacteria | 2791355264 | 2793347915 | 154 |
| 211 | iso_pu_bacteria | 2791355265 | 2793353557 | 154 |
| 212 | iso_pu_bacteria | 2791355266 | 2793358900 | 154 |
| 213 | iso_pu_bacteria | 2791355267 | 2793367832 | 154 |
| 214 | iso_pu_bacteria | 2802429268 | 2804751335 | 154 |
| 215 | iso_pu_bacteria | 2802429605 | 2805926593 | 154 |
| 216 | iso_pu_bacteria | 2802429606 | 2805933400 | 154 |
| 217 | iso_pu_bacteria | 2802429633 | 2806046942 | 154 |
| 218 | iso_pu_bacteria | 2802429634 | 2806052525 | 154 |
| 219 | iso_pu_bacteria | 2802429635 | 2806058704 | 154 |
| 220 | iso_pu_bacteria | 2802429636 | 2806067528 | 154 |
| 221 | iso_pu_bacteria | 2802429637 | 2806073967 | 154 |
| 222 | iso_pu_bacteria | 2818991453 | 2819639267 | 154 |
| 223 | iso_pu_bacteria | 2838016132 | 2838017271 | 154 |
| 224 | iso_pu_bacteria | 2838022645 | 2838023176 | 154 |
| 225 | iso_pu_bacteria | 2838029111 | 2838031400 | 154 |
| 226 | iso_pu_bacteria | 2838035591 | 2838037700 | 154 |
| 227 | iso_pu_bacteria | 2838042994 | 2838048003 | 154 |
| 228 | iso_pu_bacteria | 2838048938 | 2838049246 | 154 |
| 229 | iso_pu_bacteria | 2838061910 | 2838063308 | 154 |
| 230 | iso_pu_bacteria | 2838068647 | 2838074134 | 154 |
| 231 | iso_pu_bacteria | 2838074704 | 2838076426 | 154 |
| 232 | iso_pu_bacteria | 2838668709 | 2838670831 | 154 |
| 233 | iso_pu_bacteria | 2838680041 | 2838681325 | 154 |
| 234 | iso_pu_bacteria | 2838686498 | 2838688633 | 154 |
| 235 | iso_pu_bacteria | 2838694306 | 2838694640 | 154 |
| 236 | iso_pu_bacteria | 2838701080 | 2838703202 | 154 |
| 237 | iso_pu_bacteria | 2838707686 | 2838708018 | 154 |
| 238 | iso_pu_bacteria | 2838729681 | 2838730928 | 154 |
| 239 | iso_pu_bacteria | 2838742623 | 2838744178 | 154 |
| 240 | iso_pu_bacteria | 2841734538 | 2841741168 | 154 |
| 241 | iso_pu_bacteria | 2841851746 | 2841856859 | 154 |
| 242 | iso_pu_bacteria | 2841864319 | 2841865494 | 154 |
| 243 | iso_pu_bacteria | 2842077413 | 2842080751 | 154 |
| 244 | iso_pu_bacteria | 2842110456 | 2842114959 | 154 |
| 245 | iso_pu_bacteria | 2842118031 | 2842121370 | 154 |
| 246 | iso_pu_bacteria | 2842146304 | 2842147574 | 154 |
| 247 | iso_pu_bacteria | 2842156927 | 2842160029 | 154 |
| 248 | iso_pu_bacteria | 2842163707 | 2842168271 | 154 |
| 249 | iso_pu_bacteria | 2842180545 | 2842183354 | 154 |
| 250 | iso_pu_bacteria | 2842192696 | 2842197934 | 154 |
| 251 | iso_pu_bacteria | 2842198810 | 2842199604 | 154 |
| 252 | iso_pu_bacteria | 2842205361 | 2842207714 | 154 |
| 253 | iso_pu_bacteria | 2842217011 | 2842221186 | 154 |
| 254 | iso_pu_bacteria | 2842229732 | 2842235045 | 154 |
| 255 | iso_pu_bacteria | 2842237096 | 2842237429 | 154 |
| 256 | iso_pu_bacteria | 2842243621 | 2842245642 | 154 |
| 257 | iso_pu_bacteria | 2842250916 | 2842252640 | 154 |
| 258 | iso_pu_bacteria | 2842257432 | 2842259708 | 154 |
| 259 | iso_pu_bacteria | 2842264693 | 2842266945 | 154 |
| 260 | iso_pu_bacteria | 2842271015 | 2842274547 | 154 |
| 261 | iso_pu_bacteria | 2842278818 | 2842281491 | 154 |
| 262 | iso_pu_bacteria | 2842285085 | 2842287134 | 154 |
| 263 | iso_pu_bacteria | 2842291075 | 2842294407 | 154 |
| 264 | iso_pu_bacteria | 2842298080 | 2842302472 | 154 |
| 265 | iso_pu_bacteria | 2842304105 | 2842306791 | 154 |
| 266 | iso_pu_bacteria | 2842311132 | 2842314730 | 154 |
| 267 | iso_pu_bacteria | 2842317721 | 2842318667 | 154 |
| 268 | iso_pu_bacteria | 2842341865 | 2842343614 | 154 |
| 269 | iso_pu_bacteria | 2842357229 | 2842360795 | 154 |
| 270 | iso_pu_bacteria | 2842363717 | 2842365230 | 154 |
| 271 | iso_pu_bacteria | 2842370503 | 2842371788 | 154 |
| 272 | iso_pu_bacteria | 2842377471 | 2842380805 | 154 |
| 273 | iso_pu_bacteria | 2842384541 | 2842387876 | 154 |
| 274 | iso_pu_bacteria | 2842395702 | 2842398285 | 154 |
| 275 | iso_pu_bacteria | 2842402390 | 2842404402 | 154 |
| 276 | iso_pu_bacteria | 2842409023 | 2842410913 | 154 |
| 277 | iso_pu_bacteria | 2842415677 | 2842417631 | 154 |
| 278 | iso_pu_bacteria | 2842422224 | 2842427340 | 154 |
| 279 | iso_pu_bacteria | 2842428310 | 2842431076 | 154 |
| 280 | iso_pu_bacteria | 2842434925 | 2842436926 | 154 |
| 281 | iso_pu_bacteria | 2842441272 | 2842443004 | 154 |
| 282 | iso_pu_bacteria | 2842447887 | 2842453225 | 154 |
| 283 | iso_pu_bacteria | 2842462802 | 2842465015 | 154 |
| 284 | iso_pu_bacteria | 2842469257 | 2842471759 | 154 |
| 285 | iso_pu_bacteria | 2842475841 | 2842478005 | 154 |
| 286 | iso_pu_bacteria | 2842489311 | 2842493741 | 154 |
| 287 | iso_pu_bacteria | 2842495871 | 2842497302 | 154 |
| 288 | iso_pu_bacteria | 2842502639 | 2842504814 | 154 |
| 289 | iso_pu_bacteria | 2844002411 | 2844005716 | 154 |
| 290 | iso_pu_bacteria | 2844009547 | 2844015498 | 154 |
| 291 | iso_pu_bacteria | 2844163670 | 2844168534 | 154 |
| 292 | iso_pu_bacteria | 2844454524 | 2844455150 | 154 |
| 293 | iso_pu_bacteria | 2847417321 | 2847418095 | 154 |
| 294 | iso_pu_bacteria | 2847670302 | 2847671867 | 154 |
| 295 | iso_pu_bacteria | 2847686936 | 2847688094 | 154 |
| 296 | iso_pu_bacteria | 2848992105 | 2848993068 | 154 |
| 297 | iso_pu_bacteria | 2850079185 | 2850080463 | 154 |
| 298 | iso_pu_bacteria | 2855872281 | 2855879206 | 154 |
| 299 | iso_pu_bacteria | 2856314179 | 2856318403 | 154 |
| 300 | iso_pu_bacteria | 2856320880 | 2856324355 | 154 |
| 301 | iso_pu_bacteria | 2856342000 | 2856345499 | 154 |
| 302 | iso_pu_bacteria | 2856349417 | 2856354921 | 154 |
| 303 | iso_pu_bacteria | 2856356410 | 2856361398 | 154 |
| 304 | iso_pu_bacteria | 2856364286 | 2856364685 | 154 |
| 305 | iso_pu_bacteria | 2857349434 | 2857355034 | 154 |
| 306 | iso_pu_bacteria | 2857516855 | 2857520309 | 154 |
| 307 | iso_pu_bacteria | 2869162929 | 2869168800 | 154 |
| 308 | iso_pu_bacteria | 2869169390 | 2869172338 | 154 |
| 309 | iso_pu_bacteria | 2869234852 | 2869235765 | 154 |
| 310 | iso_pu_bacteria | 2869242130 | 2869248417 | 154 |
| 311 | iso_pu_bacteria | 2869256925 | 2869257639 | 154 |
| 312 | iso_pu_bacteria | 2869278585 | 2869281647 | 154 |
| 313 | iso_pu_bacteria | 2869285874 | 2869289867 | 154 |
| 314 | iso_pu_bacteria | 2871429161 | 2871431988 | 154 |
| 315 | iso_pu_bacteria | 2871444079 | 2871451931 | 154 |
| 316 | iso_pu_bacteria | 2871451962 | 2871459315 | 154 |
| 317 | iso_pu_bacteria | 2871466892 | 2871472653 | 154 |
| 318 | iso_pu_bacteria | 2871474448 | 2871478763 | 154 |
| 319 | iso_pu_bacteria | 2871481445 | 2871485740 | 154 |
| 320 | iso_pu_bacteria | 2871488783 | 2871493984 | 154 |
| 321 | iso_pu_bacteria | 2871495908 | 2871498503 | 154 |
| 322 | iso_pu_bacteria | 2874102143 | 2874102151 | 154 |
| 323 | iso_pu_bacteria | 2874109183 | 2874110906 | 154 |
| 324 | iso_pu_bacteria | 2874116593 | 2874117483 | 154 |
| 325 | iso_pu_bacteria | 2874123672 | 2874127617 | 154 |
| 326 | iso_pu_bacteria | 2874139085 | 2874140688 | 154 |
| 327 | iso_pu_bacteria | 2874146452 | 2874155610 | 154 |
| 328 | iso_pu_bacteria | 2874155637 | 2874162467 | 154 |
| 329 | iso_pu_bacteria | 2874162495 | 2874165768 | 154 |
| 330 | iso_pu_bacteria | 2874168670 | 2874175398 | 154 |
| 331 | iso_pu_bacteria | 2876363079 | 2876366668 | 154 |
| 332 | iso_pu_bacteria | 2876369609 | 2876373100 | 154 |
| 333 | iso_pu_bacteria | 2876377896 | 2876379560 | 154 |
| 334 | iso_pu_bacteria | 2876386047 | 2876387374 | 154 |
| 335 | iso_pu_bacteria | 2876392853 | 2876399424 | 154 |
| 336 | iso_pu_bacteria | 2876413966 | 2876420954 | 154 |
| 337 | iso_pu_bacteria | 2876420981 | 2876427385 | 154 |
| 338 | iso_pu_bacteria | 2878035449 | 2878037739 | 154 |
| 339 | iso_pu_bacteria | 2878730984 | 2878735248 | 154 |
| 340 | iso_pu_bacteria | 2878738818 | 2878742470 | 154 |
| 341 | iso_pu_bacteria | 2878745973 | 2878748594 | 154 |
| 342 | iso_pu_bacteria | 2878753008 | 2878756560 | 154 |
| 343 | iso_pu_bacteria | 2878760144 | 2878762722 | 154 |
| 344 | iso_pu_bacteria | 2878767105 | 2878769688 | 154 |
| 345 | iso_pu_bacteria | 2878781027 | 2878784520 | 154 |
| 346 | iso_pu_bacteria | 2878788777 | 2878793140 | 154 |
| 347 | iso_pu_bacteria | 2881147464 | 2881153708 | 154 |
| 348 | iso_pu_bacteria | 2881155292 | 2881157502 | 154 |
| 349 | iso_pu_bacteria | 2881161766 | 2881162865 | 154 |
| 350 | iso_pu_bacteria | 2881845957 | 2881849265 | 154 |
| 351 | iso_pu_bacteria | 2881853255 | 2881858690 | 154 |
| 352 | iso_pu_bacteria | 2881861095 | 2881862420 | 154 |
| 353 | iso_pu_bacteria | 2882632389 | 2882634433 | 154 |
| 354 | iso_pu_bacteria | 2882912400 | 2882916086 | 154 |
| 355 | iso_pu_bacteria | 2885305155 | 2885311642 | 154 |
| 356 | iso_pu_bacteria | 2885312484 | 2885316353 | 154 |
| 357 | iso_pu_bacteria | 2885318864 | 2885322178 | 154 |
| 358 | iso_pu_bacteria | 2885326080 | 2885328237 | 154 |
| 359 | iso_pu_bacteria | 2885334103 | 2885338505 | 154 |
| 360 | iso_pu_bacteria | 2885342637 | 2885347258 | 154 |
| 361 | iso_pu_bacteria | 2885350715 | 2885355254 | 154 |
| 362 | iso_pu_bacteria | 2888337043 | 2888341361 | 154 |
| 363 | iso_pu_bacteria | 2888343758 | 2888348530 | 154 |
| 364 | iso_pu_bacteria | 2888350351 | 2888350690 | 154 |
| 365 | iso_pu_bacteria | 2889010040 | 2889013030 | 154 |
| 366 | iso_pu_bacteria | 2889016732 | 2889022107 | 154 |
| 367 | iso_pu_bacteria | 2896384573 | 2896386627 | 154 |
| 368 | iso_pu_bacteria | 2903448605 | 2903452844 | 154 |
| 369 | iso_pu_bacteria | 2903492973 | 2903502512 | 154 |
| 370 | iso_pu_bacteria | 2903492973 | 2903506216 | 154 |
| 371 | iso_pu_bacteria | 2903513507 | 2903518159 | 154 |
| 372 | iso_pu_bacteria | 2903521522 | 2903524535 | 154 |
| 373 | iso_pu_bacteria | 2903528002 | 2903531222 | 154 |
| 374 | iso_pu_bacteria | 2903540706 | 2903543301 | 154 |
| 375 | iso_pu_bacteria | 2904659560 | 2904665951 | 154 |
| 376 | iso_pu_bacteria | 2906308376 | 2906312156 | 154 |
| 377 | iso_pu_bacteria | 2906321335 | 2906323894 | 154 |
| 378 | iso_pu_bacteria | 2906328253 | 2906331261 | 154 |
| 379 | iso_pu_bacteria | 2906354277 | 2906355443 | 154 |
| 380 | iso_pu_bacteria | 2906378014 | 2906382652 | 154 |
| 381 | iso_pu_bacteria | 2906386501 | 2906390879 | 154 |
| 382 | iso_pu_bacteria | 2906401398 | 2906401405 | 154 |
| 383 | iso_pu_bacteria | 2906408224 | 2906412996 | 154 |
| 384 | iso_pu_bacteria | 2906414383 | 2906418440 | 154 |
| 385 | iso_pu_bacteria | 2906427513 | 2906435623 | 154 |
| 386 | iso_pu_bacteria | 2913295892 | 2913297457 | 154 |
| 387 | iso_pu_bacteria | 2916068649 | 2916075420 | 154 |
| 388 | iso_pu_bacteria | 2919100787 | 2919103814 | 154 |
| 389 | iso_pu_bacteria | 2920822456 | 2920823829 | 154 |
| 390 | iso_pu_bacteria | 2921289301 | 2921290100 | 154 |
| 391 | iso_pu_bacteria | 2922130491 | 2922137284 | 154 |
| 392 | iso_pu_bacteria | 2922151315 | 2922156838 | 154 |
| 393 | iso_pu_bacteria | 2922158528 | 2922164354 | 154 |
| 394 | iso_pu_bacteria | 2922172374 | 2922176924 | 154 |
| 395 | iso_pu_bacteria | 2922185730 | 2922190135 | 154 |
| 396 | iso_pu_bacteria | 2923556063 | 2923557588 | 154 |
| 397 | iso_pu_bacteria | 2924165586 | 2924168121 | 154 |
| 398 | iso_pu_bacteria | 2924186466 | 2924189542 | 154 |
| 399 | iso_pu_bacteria | 2924214083 | 2924221337 | 154 |
| 400 | iso_pu_bacteria | 2924718760 | 2924725776 | 154 |
| 401 | iso_pu_bacteria | 2924726620 | 2924729204 | 154 |
| 402 | iso_pu_bacteria | 2924733363 | 2924735440 | 154 |
| 403 | iso_pu_bacteria | 2924741084 | 2924743794 | 154 |
| 404 | iso_pu_bacteria | 2924762789 | 2924764582 | 154 |
| 405 | iso_pu_bacteria | 2924776078 | 2924780270 | 154 |
| 406 | iso_pu_bacteria | 2924784321 | 2924788147 | 154 |
| 407 | iso_pu_bacteria | 2933016740 | 2933023491 | 154 |
| 408 | iso_pu_bacteria | 2933570622 | 2933573095 | 154 |
| 409 | iso_pu_bacteria | 2933586486 | 2933591358 | 154 |
| 410 | iso_pu_bacteria | 2933599457 | 2933604589 | 154 |
| 411 | iso_pu_bacteria | 2935894831 | 2935895162 | 154 |
| 412 | iso_pu_bacteria | 2935901341 | 2935904155 | 154 |
| 413 | iso_pu_bacteria | 2936367885 | 2936368140 | 154 |
| 414 | iso_pu_bacteria | 2936375103 | 2936381467 | 154 |
| 415 | iso_pu_bacteria | 2936381700 | 2936387404 | 154 |
| 416 | iso_pu_bacteria | 2937813078 | 2937818020 | 154 |
| 417 | iso_pu_bacteria | 2937822353 | 2937829229 | 154 |
| 418 | iso_pu_bacteria | 2937836603 | 2937840782 | 154 |
| 419 | iso_pu_bacteria | 2937861824 | 2937868549 | 154 |
| 420 | iso_pu_bacteria | 2937877337 | 2937882790 | 154 |
| 421 | iso_pu_bacteria | 2937891427 | 2937894211 | 154 |
| 422 | iso_pu_bacteria | 2937972304 | 2937973236 | 154 |
| 423 | iso_pu_bacteria | 2937994558 | 2937997150 | 154 |
| 424 | iso_pu_bacteria | 2938014810 | 2938018707 | 154 |
| 425 | iso_pu_bacteria | 2941499720 | 2941500233 | 154 |
| 426 | iso_pu_bacteria | 2957422303 | 2957423024 | 154 |
| 427 | iso_pu_bacteria | 2957505466 | 2957509622 | 154 |
| 428 | iso_pu_bacteria | 2958034702 | 2958037608 | 154 |
| 429 | iso_pu_bacteria | 2958041894 | 2958047319 | 154 |
| 430 | iso_pu_bacteria | 2958041894 | 2958054906 | 154 |
| 431 | iso_pu_bacteria | 2958064165 | 2958065983 | 154 |
| 432 | iso_pu_bacteria | 2958071322 | 2958075079 | 154 |
| 433 | iso_pu_bacteria | 2958084443 | 2958089915 | 154 |
| 434 | iso_pu_bacteria | 2958092219 | 2958093063 | 154 |
| 435 | iso_pu_bacteria | 2958100919 | 2958103982 | 154 |
| 436 | iso_pu_bacteria | 2958108152 | 2958109620 | 154 |
| 437 | iso_pu_bacteria | 2958122699 | 2958122822 | 154 |
| 438 | iso_pu_bacteria | 2958130278 | 2958134239 | 154 |
| 439 | iso_pu_bacteria | 2958137437 | 2958141324 | 154 |
| 440 | iso_pu_bacteria | 2958144490 | 2958150073 | 154 |
| 441 | iso_pu_bacteria | 2958158011 | 2958158606 | 154 |
| 442 | iso_pu_bacteria | 2958165035 | 2958167620 | 154 |
| 443 | iso_pu_bacteria | 2958172287 | 2958179565 | 154 |
| 444 | iso_pu_bacteria | 2958179912 | 2958183885 | 154 |
| 445 | iso_pu_bacteria | 2960645483 | 2960646157 | 154 |
| 446 | iso_pu_bacteria | 2961077736 | 2961081851 | 154 |
| 447 | iso_pu_bacteria | 2961114664 | 2961121295 | 154 |
| 448 | iso_pu_bacteria | 2961127735 | 2961136104 | 154 |
| 449 | iso_pu_bacteria | 2961163497 | 2961166092 | 154 |
| 450 | iso_pu_bacteria | 2961170736 | 2961172850 | 154 |
| 451 | iso_pu_bacteria | 2961183825 | 2961188958 | 154 |
| 452 | iso_pu_bacteria | 2963644680 | 2963649462 | 154 |
| 453 | iso_pu_bacteria | 2965018300 | 2965020911 | 154 |
| 454 | iso_pu_bacteria | 2965032056 | 2965034745 | 154 |
| 455 | iso_pu_bacteria | 2965047637 | 2965050211 | 154 |
| 456 | iso_pu_bacteria | 2965062239 | 2965066426 | 154 |
| 457 | iso_pu_bacteria | 2965089291 | 2965091563 | 154 |
| 458 | iso_pu_bacteria | 2965110997 | 2965117035 | 154 |
| 459 | iso_pu_bacteria | 2965119406 | 2965122836 | 154 |
| 460 | iso_pu_bacteria | 2967996073 | 2967998060 | 154 |
| 461 | iso_pu_bacteria | 2968003550 | 2968008712 | 154 |
| 462 | iso_pu_bacteria | 2968016561 | 2968019557 | 154 |
| 463 | iso_pu_bacteria | 2968083720 | 2968084625 | 154 |
| 464 | iso_pu_bacteria | 2968091066 | 2968092367 | 154 |
| 465 | iso_pu_bacteria | 2968097103 | 2968097585 | 154 |
| 466 | iso_pu_bacteria | 2968110612 | 2968117447 | 154 |
| 467 | iso_pu_bacteria | 2968117919 | 2968118370 | 154 |
| 468 | iso_pu_bacteria | 2968128360 | 2968131714 | 154 |
| 469 | iso_pu_bacteria | 2968138860 | 2968143195 | 154 |
| 470 | iso_pu_bacteria | 2968171901 | 2968174489 | 154 |
| 471 | iso_pu_bacteria | 2970191845 | 2970198294 | 154 |
| 472 | iso_pu_bacteria | 2970469710 | 2970472878 | 154 |
| 473 | iso_pu_bacteria | 2970489779 | 2970493496 | 154 |
| 474 | iso_pu_bacteria | 2970503327 | 2970505444 | 154 |
| 475 | iso_pu_bacteria | 2970510686 | 2970517770 | 154 |
| 476 | iso_pu_bacteria | 2970524798 | 2970529664 | 154 |
| 477 | iso_pu_bacteria | 2970532167 | 2970535131 | 154 |
| 478 | iso_pu_bacteria | 2970540015 | 2970547185 | 154 |
| 479 | iso_pu_bacteria | 2970547951 | 2970554118 | 154 |
| 480 | iso_pu_bacteria | 2970554993 | 2970557580 | 154 |
| 481 | iso_pu_bacteria | 2970593180 | 2970596250 | 154 |
| 482 | iso_pu_bacteria | 2970619444 | 2970625280 | 154 |
| 483 | iso_pu_bacteria | 2970627176 | 2970632353 | 154 |
| 484 | iso_pu_bacteria | 2977821940 | 2977825740 | 154 |
| 485 | iso_pu_bacteria | 2977828996 | 2977831241 | 154 |
| 486 | iso_pu_bacteria | 2977843712 | 2977851119 | 154 |
| 487 | iso_pu_bacteria | 2977851361 | 2977852939 | 154 |
| 488 | iso_pu_bacteria | 2977858184 | 2977859921 | 154 |
| 489 | iso_pu_bacteria | 2977864932 | 2977869513 | 154 |
| 490 | iso_pu_bacteria | 2977872689 | 2977875298 | 154 |
| 491 | iso_pu_bacteria | 2977907340 | 2977909905 | 154 |
| 492 | iso_pu_bacteria | 2977922695 | 2977926279 | 154 |
| 493 | iso_pu_bacteria | 2977942078 | 2977943903 | 154 |
| 494 | iso_pu_bacteria | 2977950692 | 2977955067 | 154 |
| 495 | iso_pu_bacteria | 2977971508 | 2977972963 | 154 |
| 496 | iso_pu_bacteria | 2977986579 | 2977992274 | 154 |
| 497 | iso_pu_bacteria | 2979710463 | 2979717382 | 154 |
| 498 | iso_pu_bacteria | 2979742915 | 2979743138 | 154 |
| 499 | iso_pu_bacteria | 2979764755 | 2979766916 | 154 |
| 500 | iso_pu_bacteria | 2979772303 | 2979774980 | 154 |
| 501 | iso_pu_bacteria | 2979779861 | 2979785472 | 154 |
| 502 | iso_pu_bacteria | 2979808191 | 2979810165 | 154 |
| 503 | iso_pu_bacteria | 2987636660 | 2987643635 | 154 |
| 504 | iso_pu_bacteria | 2987645492 | 2987651836 | 154 |
| 505 | iso_pu_bacteria | 2987652177 | 2987654855 | 154 |
| 506 | iso_pu_bacteria | 2987659509 | 2987662099 | 154 |
| 507 | iso_pu_bacteria | 2987666974 | 2987667386 | 154 |
| 508 | iso_pu_bacteria | 2989771324 | 2989772038 | 154 |
| 509 | iso_pu_bacteria | 2996341866 | 2996343187 | 154 |
| 510 | iso_pu_bacteria | 2996348954 | 2996352003 | 154 |
| 511 | iso_pu_bacteria | 2996386984 | 2996392113 | 154 |
| 512 | iso_pu_bacteria | 2996887358 | 2996890822 | 154 |
| 513 | iso_pu_bacteria | 2996893221 | 2996895062 | 154 |
| 514 | iso_pu_bacteria | 3000135777 | 3000141903 | 154 |
| 515 | iso_pu_bacteria | 3004167301 | 3004170957 | 154 |
| 516 | iso_pu_bacteria | 3004188549 | 3004191150 | 154 |
| 517 | iso_pu_bacteria | 3004195979 | 3004198337 | 154 |
| 518 | iso_pu_bacteria | 3004203850 | 3004207180 | 154 |
| 519 | iso_pu_bacteria | 3004211236 | 3004214594 | 154 |
| 520 | iso_pu_bacteria | 3004218560 | 3004219276 | 154 |
| 521 | iso_pu_bacteria | 3004232784 | 3004234274 | 154 |
| 522 | iso_pu_bacteria | 3004239961 | 3004241105 | 154 |
| 523 | iso_pu_bacteria | 3004248173 | 3004254355 | 154 |
| 524 | iso_pu_bacteria | 3004268573 | 3004273510 | 154 |
| 525 | iso_pu_bacteria | 3004275668 | 3004278701 | 154 |
| 526 | iso_pu_bacteria | 3004289098 | 3004290493 | 154 |
| 527 | iso_pu_bacteria | 3004334049 | 3004339349 | 154 |
| 528 | iso_pu_bacteria | 3005409236 | 3005412426 | 154 |
| 529 | iso_pu_bacteria | 3005445848 | 3005446742 | 154 |
| 530 | iso_pu_bacteria | 3005452660 | 3005453427 | 154 |
| 531 | iso_pu_bacteria | 637000159 | 637079513 | 154 |
| 532 | iso_pu_bacteria | 639633055 | 639647417 | 154 |
| 533 | iso_pu_bacteria | 643692032 | 643825070 | 154 |
| 534 | iso_pu_bacteria | 649633066 | 649874658 | 154 |
| 535 | iso_pu_bacteria | 8002285264 | 8002287825 | 154 |
| 536 | iso_pu_bacteria | 8004300914 | 8004303784 | 154 |
| 537 | iso_pu_bacteria | 8004312739 | 8004317107 | 154 |
| 538 | iso_pu_bacteria | 8004374579 | 8004378148 | 154 |
| 539 | iso_pu_bacteria | 8004387939 | 8004391744 | 154 |
| 540 | iso_pu_bacteria | 8004395343 | 8004396368 | 154 |
| 541 | iso_pu_bacteria | 8004445564 | 8004450600 | 154 |
| 542 | iso_pu_bacteria | 8004633249 | 8004636481 | 154 |
| 543 | iso_pu_bacteria | 8004640170 | 8004641244 | 154 |
| 544 | iso_pu_bacteria | 8004714634 | 8004717112 | 154 |
| 545 | iso_pu_bacteria | 8004727605 | 8004732302 | 154 |
| 546 | iso_pu_bacteria | 8005258706 | 8005261789 | 154 |
| 547 | iso_pu_bacteria | 8005275841 | 8005279562 | 154 |
| 548 | iso_pu_bacteria | 8005282627 | 8005284798 | 154 |
| 549 | iso_pu_bacteria | 8005289223 | 8005292776 | 154 |
| 550 | iso_pu_bacteria | 8005301065 | 8005304579 | 154 |
| 551 | iso_pu_bacteria | 8005307578 | 8005311069 | 154 |
| 552 | iso_pu_bacteria | 8005321885 | 8005325349 | 154 |
| 553 | iso_pu_bacteria | 8005376324 | 8005376627 | 154 |
| 554 | iso_pu_bacteria | 8005382845 | 8005386017 | 154 |
| 555 | iso_pu_bacteria | 8005395548 | 8005400199 | 154 |
| 556 | iso_pu_bacteria | 8005430974 | 8005432252 | 154 |
| 557 | iso_pu_bacteria | 8005460587 | 8005461911 | 154 |
| 558 | iso_pu_bacteria | 8005497431 | 8005499315 | 154 |
| 559 | iso_pu_bacteria | 8005542996 | 8005544333 | 154 |
| 560 | iso_pu_bacteria | 8005556819 | 8005558942 | 154 |
| 561 | iso_pu_bacteria | 8005563573 | 8005570420 | 154 |
| 562 | iso_pu_bacteria | 8005570704 | 8005572665 | 154 |
| 563 | iso_pu_bacteria | 8005619151 | 8005620510 | 154 |
| 564 | iso_pu_bacteria | 8005626139 | 8005627524 | 154 |
| 565 | iso_pu_bacteria | 8005668836 | 8005670731 | 154 |
| 566 | iso_pu_bacteria | 8005688590 | 8005691002 | 154 |
| 567 | iso_pu_bacteria | 8005695170 | 8005698810 | 154 |
| 568 | iso_pu_bacteria | 8018127388 | 8018131313 | 154 |
| 569 | iso_pu_bacteria | 8018163183 | 8018169141 | 154 |
| 570 | iso_pu_bacteria | 8018176218 | 8018177263 | 154 |
| 571 | iso_pu_bacteria | 8023680758 | 8023686976 | 154 |
| 572 | iso_pu_bacteria | 8024479707 | 8024481086 | 154 |
| 573 | iso_pu_bacteria | 8024501048 | 8024503267 | 154 |
| 574 | iso_pu_bacteria | 8049293176 | 8049293909 | 154 |
| 575 | iso_pu_bacteria | 8055617313 | 8055622746 | 154 |
| 576 | iso_pu_bacteria | 8056375014 | 8056380712 | 154 |
| 577 | iso_pu_bacteria | 8056382006 | 8056384769 | 154 |
| 578 | iso_pu_bacteria | 8057874678 | 8057879571 | 154 |
| 579 | 3300031247 | Ga0265340_10000501 | Ga0265340_1000050124 | 155 |
| 580 | 3300031249 | Ga0265339_10003493 | Ga0265339_100034936 | 155 |
| 581 | 3300031250 | Ga0265331_10124673 | Ga0265331_101246732 | 155 |
| 582 | 3300031344 | Ga0265316_10005614 | Ga0265316_100056148 | 155 |
| 583 | 3300031595 | Ga0265313_10001319 | Ga0265313_100013195 | 155 |
| 584 | 3300031712 | Ga0265342_10004425 | Ga0265342_100044255 | 155 |
| 585 | 3300011119 | Ga0105246_10992580 | Ga0105246_109925801 | 156 |
| 586 | iso_pu_bacteria | 2891373044 | 2891374707 | 156 |
| 587 | 3300025294 | Ga0209025_1000149 | Ga0209025_100014952 | 157 |
| 588 | 3300041459 | Ga0451800_0535748 | Ga0451800_0535748_229_702 | 157 |
| 589 | 3300048920 | Ga0496117_0003176 | Ga0496117_0003176_11894_12391 | 157 |
| 590 | 3300048925 | Ga0496122_0000492 | Ga0496122_0000492_41476_41973 | 157 |
| 591 | 3300048926 | Ga0496123_0000460 | Ga0496123_0000460_24327_24824 | 157 |
| 592 | 3300048927 | Ga0496124_0000679 | Ga0496124_0000679_8701_9198 | 157 |
| 593 | 3300048927 | Ga0496124_0505504 | Ga0496124_0505504_36_533 | 157 |
| 594 | 3300048928 | Ga0496125_0000912 | Ga0496125_0000912_25076_25558 | 157 |
| 595 | 3300048928 | Ga0496125_0193125 | Ga0496125_0193125_436_933 | 157 |
| 596 | 3300048929 | Ga0496126_0000811 | Ga0496126_0000811_37357_37854 | 157 |
| 597 | 3300048929 | Ga0496126_0042355 | Ga0496126_0042355_1870_2343 | 157 |
| 598 | 3300049568 | Ga0501031_0264111 | Ga0501031_0264111_449_922 | 157 |
| 599 | 3300049570 | Ga0501033_0160706 | Ga0501033_0160706_799_1272 | 157 |
| 600 | 3300049571 | Ga0501034_0094492 | Ga0501034_0094492_780_1274 | 157 |
| 601 | 3300049572 | Ga0501036_0456669 | Ga0501036_0456669_269_742 | 157 |
| 602 | 3300049574 | Ga0501038_0099928 | Ga0501038_0099928_388_882 | 157 |
| 603 | 3300049579 | Ga0501043_0065320 | Ga0501043_0065320_1353_1847 | 157 |
| 604 | 3300049822 | Ga0501035_0057961 | Ga0501035_0057961_2822_3316 | 157 |
| 605 | 3300049823 | Ga0501044_0481942 | Ga0501044_0481942_276_770 | 157 |
| 606 | 3300001979 | JGI24740J21852_10022684 | JGI24740J21852_100226842 | 158 |
| 607 | 3300002705 | JGI25156J39149_1008029 | JGI25156J39149_10080293 | 158 |
| 608 | 3300002739 | JGI25158J39367_1001006 | JGI25158J39367_10010064 | 158 |
| 609 | 3300002741 | JGI25157J39369_1001043 | JGI25157J39369_100104312 | 158 |
| 610 | 3300002773 | JGI25152J39213_1000489 | JGI25152J39213_100048913 | 158 |
| 611 | 3300002773 | JGI25152J39213_1000613 | JGI25152J39213_100061313 | 158 |
| 612 | 3300002773 | JGI25152J39213_1003002 | JGI25152J39213_10030022 | 158 |
| 613 | 3300002773 | JGI25152J39213_1003200 | JGI25152J39213_10032004 | 158 |
| 614 | 3300002773 | JGI25152J39213_1005384 | JGI25152J39213_10053843 | 158 |
| 615 | 3300002773 | JGI25152J39213_1006798 | JGI25152J39213_10067981 | 158 |
| 616 | 3300002773 | JGI25152J39213_1009132 | JGI25152J39213_10091323 | 158 |
| 617 | 3300002774 | JGI25150J39212_1000033 | JGI25150J39212_10000334 | 158 |
| 618 | 3300002774 | JGI25150J39212_1006735 | JGI25150J39212_10067352 | 158 |
| 619 | 3300002774 | JGI25150J39212_1006851 | JGI25150J39212_10068513 | 158 |
| 620 | 3300002774 | JGI25150J39212_1026697 | JGI25150J39212_10266972 | 158 |
| 621 | 3300002987 | JGI25159J45721_1000002 | JGI25159J45721_1000002249 | 158 |
| 622 | 3300002987 | JGI25159J45721_1000299 | JGI25159J45721_100029926 | 158 |
| 623 | 3300003187 | JGI25151J46595_10000062 | JGI25151J46595_1000006222 | 158 |
| 624 | 3300003187 | JGI25151J46595_10001325 | JGI25151J46595_1000132519 | 158 |
| 625 | 3300003187 | JGI25151J46595_10002042 | JGI25151J46595_1000204210 | 158 |
| 626 | 3300003187 | JGI25151J46595_10002593 | JGI25151J46595_100025938 | 158 |
| 627 | 3300003187 | JGI25151J46595_10011784 | JGI25151J46595_100117843 | 158 |
| 628 | 3300003187 | JGI25151J46595_10017797 | JGI25151J46595_100177974 | 158 |
| 629 | 3300003214 | JGI25165J46597_1000028 | JGI25165J46597_1000028286 | 158 |
| 630 | 3300003214 | JGI25165J46597_1011001 | JGI25165J46597_10110012 | 158 |
| 631 | 3300003215 | JGI25153J46596_10005408 | JGI25153J46596_100054084 | 158 |
| 632 | 3300003215 | JGI25153J46596_10006589 | JGI25153J46596_100065895 | 158 |
| 633 | 3300003215 | JGI25153J46596_10007464 | JGI25153J46596_100074644 | 158 |
| 634 | 3300003215 | JGI25153J46596_10029503 | JGI25153J46596_100295033 | 158 |
| 635 | 3300003354 | JGI25160J50197_1000008 | JGI25160J50197_1000008249 | 158 |
| 636 | 3300003354 | JGI25160J50197_1008183 | JGI25160J50197_10081833 | 158 |
| 637 | 3300003354 | JGI25160J50197_1010532 | JGI25160J50197_10105324 | 158 |
| 638 | 3300003354 | JGI25160J50197_1015293 | JGI25160J50197_10152932 | 158 |
| 639 | 3300003374 | JGI25161J50226_1000133 | JGI25161J50226_100013352 | 158 |
| 640 | 3300003374 | JGI25161J50226_1000527 | JGI25161J50226_100052710 | 158 |
| 641 | 3300003374 | JGI25161J50226_1011868 | JGI25161J50226_10118681 | 158 |
| 642 | 3300003762 | Ga0055542_1001076 | Ga0055542_10010767 | 158 |
| 643 | 3300003762 | Ga0055542_1001152 | Ga0055542_10011524 | 158 |
| 644 | 3300003763 | Ga0055529_1004622 | Ga0055529_10046222 | 158 |
| 645 | 3300003771 | Ga0055526_1002912 | Ga0055526_10029127 | 158 |
| 646 | 3300003771 | Ga0055526_1005297 | Ga0055526_10052973 | 158 |
| 647 | 3300003771 | Ga0055526_1010461 | Ga0055526_10104612 | 158 |
| 648 | 3300003771 | Ga0055526_1010634 | Ga0055526_10106344 | 158 |
| 649 | 3300003771 | Ga0055526_1013070 | Ga0055526_10130703 | 158 |
| 650 | 3300003775 | Ga0055524_1001918 | Ga0055524_10019183 | 158 |
| 651 | 3300003775 | Ga0055524_1008684 | Ga0055524_10086843 | 158 |
| 652 | 3300003775 | Ga0055524_1014462 | Ga0055524_10144622 | 158 |
| 653 | 3300003775 | Ga0055524_1015539 | Ga0055524_10155393 | 158 |
| 654 | 3300003775 | Ga0055524_1018673 | Ga0055524_10186732 | 158 |
| 655 | 3300003775 | Ga0055524_1020377 | Ga0055524_10203773 | 158 |
| 656 | 3300003775 | Ga0055524_1020565 | Ga0055524_10205652 | 158 |
| 657 | 3300003775 | Ga0055524_1035008 | Ga0055524_10350083 | 158 |
| 658 | 3300003790 | Ga0055528_1000149 | Ga0055528_100014925 | 158 |
| 659 | 3300003790 | Ga0055528_1004949 | Ga0055528_10049493 | 158 |
| 660 | 3300003790 | Ga0055528_1006210 | Ga0055528_10062103 | 158 |
| 661 | 3300003790 | Ga0055528_1019412 | Ga0055528_10194122 | 158 |
| 662 | 3300003790 | Ga0055528_1028634 | Ga0055528_10286342 | 158 |
| 663 | 3300003790 | Ga0055528_1030824 | Ga0055528_10308242 | 158 |
| 664 | 3300003790 | Ga0055528_1044220 | Ga0055528_10442201 | 158 |
| 665 | 3300003791 | Ga0055530_10048270 | Ga0055530_100482702 | 158 |
| 666 | 3300003792 | Ga0055540_1001764 | Ga0055540_10017646 | 158 |
| 667 | 3300003792 | Ga0055540_1002583 | Ga0055540_10025837 | 158 |
| 668 | 3300003792 | Ga0055540_1017412 | Ga0055540_10174123 | 158 |
| 669 | 3300003792 | Ga0055540_1021002 | Ga0055540_10210024 | 158 |
| 670 | 3300003794 | Ga0055531_10048480 | Ga0055531_100484802 | 158 |
| 671 | 3300004625 | Ga0055543_1000040 | Ga0055543_1000040109 | 158 |
| 672 | 3300004625 | Ga0055543_1000048 | Ga0055543_100004816 | 158 |
| 673 | 3300004625 | Ga0055543_1003720 | Ga0055543_10037202 | 158 |
| 674 | 3300005262 | Ga0065165_1000015 | Ga0065165_1000015250 | 158 |
| 675 | 3300005262 | Ga0065165_1006738 | Ga0065165_10067383 | 158 |
| 676 | 3300005262 | Ga0065165_1012418 | Ga0065165_10124183 | 158 |
| 677 | 3300005327 | Ga0070658_10187688 | Ga0070658_101876883 | 158 |
| 678 | 3300005347 | Ga0070668_100154878 | Ga0070668_1001548783 | 158 |
| 679 | 3300005347 | Ga0070668_100774398 | Ga0070668_1007743981 | 158 |
| 680 | 3300005347 | Ga0070668_100783679 | Ga0070668_1007836792 | 158 |
| 681 | 3300005355 | Ga0070671_100083420 | Ga0070671_1000834204 | 158 |
| 682 | 3300005356 | Ga0070674_100128790 | Ga0070674_1001287902 | 158 |
| 683 | 3300005367 | Ga0070667_100912721 | Ga0070667_1009127212 | 158 |
| 684 | 3300005445 | Ga0070708_100338798 | Ga0070708_1003387982 | 158 |
| 685 | 3300005455 | Ga0070663_100274643 | Ga0070663_1002746432 | 158 |
| 686 | 3300005455 | Ga0070663_100650142 | Ga0070663_1006501422 | 158 |
| 687 | 3300005457 | Ga0070662_101300743 | Ga0070662_1013007431 | 158 |
| 688 | 3300005459 | Ga0068867_100189684 | Ga0068867_1001896842 | 158 |
| 689 | 3300005539 | Ga0068853_100070932 | Ga0068853_1000709323 | 158 |
| 690 | 3300005539 | Ga0068853_100427759 | Ga0068853_1004277592 | 158 |
| 691 | 3300005543 | Ga0070672_100821548 | Ga0070672_1008215481 | 158 |
| 692 | 3300005544 | Ga0070686_101526876 | Ga0070686_1015268761 | 158 |
| 693 | 3300005548 | Ga0070665_100033875 | Ga0070665_1000338753 | 158 |
| 694 | 3300005548 | Ga0070665_100281328 | Ga0070665_1002813282 | 158 |
| 695 | 3300005563 | Ga0068855_100315987 | Ga0068855_1003159872 | 158 |
| 696 | 3300005563 | Ga0068855_100558333 | Ga0068855_1005583331 | 158 |
| 697 | 3300005563 | Ga0068855_100571357 | Ga0068855_1005713573 | 158 |
| 698 | 3300005577 | Ga0068857_101023395 | Ga0068857_1010233952 | 158 |
| 699 | 3300005578 | Ga0068854_100090229 | Ga0068854_1000902294 | 158 |
| 700 | 3300005614 | Ga0068856_100300925 | Ga0068856_1003009252 | 158 |
| 701 | 3300005616 | Ga0068852_100734426 | Ga0068852_1007344262 | 158 |
| 702 | 3300005718 | Ga0068866_10244873 | Ga0068866_102448732 | 158 |
| 703 | 3300006038 | Ga0075365_10017666 | Ga0075365_100176662 | 158 |
| 704 | 3300006038 | Ga0075365_10068542 | Ga0075365_100685423 | 158 |
| 705 | 3300006038 | Ga0075365_10114595 | Ga0075365_101145952 | 158 |
| 706 | 3300006038 | Ga0075365_10270810 | Ga0075365_102708103 | 158 |
| 707 | 3300006038 | Ga0075365_10307324 | Ga0075365_103073242 | 158 |
| 708 | 3300006042 | Ga0075368_10017680 | Ga0075368_100176802 | 158 |
| 709 | 3300006042 | Ga0075368_10041467 | Ga0075368_100414674 | 158 |
| 710 | 3300006042 | Ga0075368_10119913 | Ga0075368_101199132 | 158 |
| 711 | 3300006048 | Ga0075363_100055331 | Ga0075363_1000553312 | 158 |
| 712 | 3300006048 | Ga0075363_100079110 | Ga0075363_1000791104 | 158 |
| 713 | 3300006048 | Ga0075363_100132813 | Ga0075363_1001328132 | 158 |
| 714 | 3300006048 | Ga0075363_100367440 | Ga0075363_1003674402 | 158 |
| 715 | 3300006051 | Ga0075364_10074936 | Ga0075364_100749364 | 158 |
| 716 | 3300006051 | Ga0075364_10456967 | Ga0075364_104569672 | 158 |
| 717 | 3300006177 | Ga0075362_10001294 | Ga0075362_100012944 | 158 |
| 718 | 3300006178 | Ga0075367_10003380 | Ga0075367_100033804 | 158 |
| 719 | 3300006178 | Ga0075367_10050221 | Ga0075367_100502214 | 158 |
| 720 | 3300006178 | Ga0075367_10063595 | Ga0075367_100635955 | 158 |
| 721 | 3300006178 | Ga0075367_10077631 | Ga0075367_100776314 | 158 |
| 722 | 3300006178 | Ga0075367_10133647 | Ga0075367_101336472 | 158 |
| 723 | 3300006178 | Ga0075367_10190304 | Ga0075367_101903042 | 158 |
| 724 | 3300006186 | Ga0075369_10000715 | Ga0075369_100007154 | 158 |
| 725 | 3300006186 | Ga0075369_10001441 | Ga0075369_100014411 | 158 |
| 726 | 3300006186 | Ga0075369_10023990 | Ga0075369_100239904 | 158 |
| 727 | 3300006186 | Ga0075369_10120044 | Ga0075369_101200442 | 158 |
| 728 | 3300006195 | Ga0075366_10008659 | Ga0075366_100086594 | 158 |
| 729 | 3300006195 | Ga0075366_10082331 | Ga0075366_100823312 | 158 |
| 730 | 3300006195 | Ga0075366_10224384 | Ga0075366_102243842 | 158 |
| 731 | 3300006353 | Ga0075370_10010914 | Ga0075370_100109143 | 158 |
| 732 | 3300006353 | Ga0075370_10061958 | Ga0075370_100619583 | 158 |
| 733 | 3300006353 | Ga0075370_10278133 | Ga0075370_102781332 | 158 |
| 734 | 3300006353 | Ga0075370_10531535 | Ga0075370_105315351 | 158 |
| 735 | 3300006353 | Ga0075370_10538892 | Ga0075370_105388921 | 158 |
| 736 | 3300006358 | Ga0068871_100662265 | Ga0068871_1006622652 | 158 |
| 737 | 3300006946 | Ga0079104_1002273 | Ga0079104_10022736 | 158 |
| 738 | 3300006946 | Ga0079104_1005092 | Ga0079104_10050927 | 158 |
| 739 | 3300009011 | Ga0105251_10008511 | Ga0105251_100085117 | 158 |
| 740 | 3300009036 | Ga0105244_10117097 | Ga0105244_101170972 | 158 |
| 741 | 3300009092 | Ga0105250_10108155 | Ga0105250_101081551 | 158 |
| 742 | 3300009093 | Ga0105240_10605453 | Ga0105240_106054532 | 158 |
| 743 | 3300009098 | Ga0105245_10544602 | Ga0105245_105446022 | 158 |
| 744 | 3300009174 | Ga0105241_10109885 | Ga0105241_101098854 | 158 |
| 745 | 3300009174 | Ga0105241_10223107 | Ga0105241_102231071 | 158 |
| 746 | 3300009174 | Ga0105241_10611519 | Ga0105241_106115192 | 158 |
| 747 | 3300009176 | Ga0105242_11531386 | Ga0105242_115313862 | 158 |
| 748 | 3300009177 | Ga0105248_10057126 | Ga0105248_100571261 | 158 |
| 749 | 3300009177 | Ga0105248_10177749 | Ga0105248_101777492 | 158 |
| 750 | 3300009545 | Ga0105237_10018053 | Ga0105237_100180532 | 158 |
| 751 | 3300009545 | Ga0105237_10538977 | Ga0105237_105389772 | 158 |
| 752 | 3300009551 | Ga0105238_10198943 | Ga0105238_101989432 | 158 |
| 753 | 3300009551 | Ga0105238_10570887 | Ga0105238_105708872 | 158 |
| 754 | 3300009553 | Ga0105249_10758749 | Ga0105249_107587491 | 158 |
| 755 | 3300009765 | Ga0123341_1012981 | Ga0123341_10129812 | 158 |
| 756 | 3300010375 | Ga0105239_10131477 | Ga0105239_101314772 | 158 |
| 757 | 3300010375 | Ga0105239_10655701 | Ga0105239_106557011 | 158 |
| 758 | 3300010375 | Ga0105239_10772903 | Ga0105239_107729031 | 158 |
| 759 | 3300010375 | Ga0105239_11191159 | Ga0105239_111911592 | 158 |
| 760 | 3300010375 | Ga0105239_11422805 | Ga0105239_114228052 | 158 |
| 761 | 3300012490 | Ga0157322_1004632 | Ga0157322_10046322 | 158 |
| 762 | 3300012497 | Ga0157319_1002016 | Ga0157319_10020162 | 158 |
| 763 | 3300013100 | Ga0157373_10391332 | Ga0157373_103913321 | 158 |
| 764 | 3300013104 | Ga0157370_10196562 | Ga0157370_101965623 | 158 |
| 765 | 3300013249 | Ga0171463_1001 | Ga0171463_1001239 | 158 |
| 766 | 3300013296 | Ga0157374_10681521 | Ga0157374_106815212 | 158 |
| 767 | 3300013307 | Ga0157372_12209991 | Ga0157372_122099912 | 158 |
| 768 | 3300014325 | Ga0163163_10418466 | Ga0163163_104184662 | 158 |
| 769 | 3300014497 | Ga0182008_10182930 | Ga0182008_101829302 | 158 |
| 770 | 3300014969 | Ga0157376_10574220 | Ga0157376_105742202 | 158 |
| 771 | 3300015262 | Ga0182007_10001216 | Ga0182007_100012168 | 158 |
| 772 | 3300015690 | Ga0183363_1336 | Ga0183363_133610 | 158 |
| 773 | 3300021320 | Ga0214544_1008762 | Ga0214544_100876211 | 158 |
| 774 | 3300021321 | Ga0214542_1000006 | Ga0214542_100000629 | 158 |
| 775 | 3300021321 | Ga0214542_1016338 | Ga0214542_10163384 | 158 |
| 776 | 3300021327 | Ga0214543_1000003 | Ga0214543_1000003463 | 158 |
| 777 | 3300021327 | Ga0214543_1000014 | Ga0214543_1000014294 | 158 |
| 778 | 3300022739 | Ga0228711_1000001 | Ga0228711_100000190 | 158 |
| 779 | 3300022740 | Ga0228710_1000001 | Ga0228710_1000001235 | 158 |
| 780 | 3300025206 | Ga0209435_100042 | Ga0209435_10004277 | 158 |
| 781 | 3300025208 | Ga0209436_100064 | Ga0209436_10006410 | 158 |
| 782 | 3300025208 | Ga0209436_102030 | Ga0209436_1020305 | 158 |
| 783 | 3300025245 | Ga0207425_1000031 | Ga0207425_1000031138 | 158 |
| 784 | 3300025245 | Ga0207425_1000671 | Ga0207425_100067116 | 158 |
| 785 | 3300025245 | Ga0207425_1002445 | Ga0207425_10024454 | 158 |
| 786 | 3300025245 | Ga0207425_1018724 | Ga0207425_10187243 | 158 |
| 787 | 3300025245 | Ga0207425_1029317 | Ga0207425_10293172 | 158 |
| 788 | 3300025246 | Ga0209646_1000145 | Ga0209646_100014577 | 158 |
| 789 | 3300025250 | Ga0209026_1000160 | Ga0209026_100016077 | 158 |
| 790 | 3300025250 | Ga0209026_1000215 | Ga0209026_100021525 | 158 |
| 791 | 3300025254 | Ga0209148_1000056 | Ga0209148_1000056182 | 158 |
| 792 | 3300025256 | Ga0209759_1000177 | Ga0209759_100017777 | 158 |
| 793 | 3300025256 | Ga0209759_1000591 | Ga0209759_100059125 | 158 |
| 794 | 3300025258 | Ga0209129_1000053 | Ga0209129_1000053139 | 158 |
| 795 | 3300025258 | Ga0209129_1000362 | Ga0209129_100036242 | 158 |
| 796 | 3300025258 | Ga0209129_1000592 | Ga0209129_100059226 | 158 |
| 797 | 3300025258 | Ga0209129_1002000 | Ga0209129_10020006 | 158 |
| 798 | 3300025258 | Ga0209129_1003332 | Ga0209129_10033324 | 158 |
| 799 | 3300025258 | Ga0209129_1003827 | Ga0209129_10038276 | 158 |
| 800 | 3300025258 | Ga0209129_1028176 | Ga0209129_10281762 | 158 |
| 801 | 3300025261 | Ga0209233_1000087 | Ga0209233_1000087288 | 158 |
| 802 | 3300025261 | Ga0209233_1000209 | Ga0209233_100020946 | 158 |
| 803 | 3300025261 | Ga0209233_1004639 | Ga0209233_10046395 | 158 |
| 804 | 3300025263 | Ga0209565_1032250 | Ga0209565_10322502 | 158 |
| 805 | 3300025272 | Ga0209455_1000137 | Ga0209455_100013777 | 158 |
| 806 | 3300025273 | Ga0209673_1000041 | Ga0209673_100004143 | 158 |
| 807 | 3300025273 | Ga0209673_1000254 | Ga0209673_100025496 | 158 |
| 808 | 3300025273 | Ga0209673_1001371 | Ga0209673_10013718 | 158 |
| 809 | 3300025273 | Ga0209673_1001660 | Ga0209673_100166015 | 158 |
| 810 | 3300025273 | Ga0209673_1001767 | Ga0209673_100176720 | 158 |
| 811 | 3300025273 | Ga0209673_1006511 | Ga0209673_10065114 | 158 |
| 812 | 3300025273 | Ga0209673_1009724 | Ga0209673_10097243 | 158 |
| 813 | 3300025273 | Ga0209673_1010174 | Ga0209673_10101744 | 158 |
| 814 | 3300025273 | Ga0209673_1012400 | Ga0209673_10124002 | 158 |
| 815 | 3300025273 | Ga0209673_1031104 | Ga0209673_10311042 | 158 |
| 816 | 3300025284 | Ga0209130_1000006 | Ga0209130_1000006552 | 158 |
| 817 | 3300025284 | Ga0209130_1000007 | Ga0209130_100000753 | 158 |
| 818 | 3300025284 | Ga0209130_1025430 | Ga0209130_10254303 | 158 |
| 819 | 3300025292 | Ga0209676_1009408 | Ga0209676_10094082 | 158 |
| 820 | 3300025294 | Ga0209025_1000087 | Ga0209025_1000087138 | 158 |
| 821 | 3300025294 | Ga0209025_1000100 | Ga0209025_1000100198 | 158 |
| 822 | 3300025294 | Ga0209025_1000284 | Ga0209025_1000284109 | 158 |
| 823 | 3300025294 | Ga0209025_1001310 | Ga0209025_100131033 | 158 |
| 824 | 3300025294 | Ga0209025_1007344 | Ga0209025_10073443 | 158 |
| 825 | 3300025294 | Ga0209025_1015697 | Ga0209025_10156973 | 158 |
| 826 | 3300025294 | Ga0209025_1020918 | Ga0209025_10209184 | 158 |
| 827 | 3300025294 | Ga0209025_1053139 | Ga0209025_10531392 | 158 |
| 828 | 3300025295 | Ga0209564_1000233 | Ga0209564_100023393 | 158 |
| 829 | 3300025295 | Ga0209564_1000425 | Ga0209564_100042572 | 158 |
| 830 | 3300025295 | Ga0209564_1000439 | Ga0209564_100043940 | 158 |
| 831 | 3300025295 | Ga0209564_1001684 | Ga0209564_10016845 | 158 |
| 832 | 3300025295 | Ga0209564_1002798 | Ga0209564_100279813 | 158 |
| 833 | 3300025295 | Ga0209564_1015377 | Ga0209564_10153772 | 158 |
| 834 | 3300025295 | Ga0209564_1019775 | Ga0209564_10197754 | 158 |
| 835 | 3300025297 | Ga0209758_1000081 | Ga0209758_1000081138 | 158 |
| 836 | 3300025297 | Ga0209758_1000737 | Ga0209758_100073717 | 158 |
| 837 | 3300025297 | Ga0209758_1002088 | Ga0209758_100208817 | 158 |
| 838 | 3300025297 | Ga0209758_1002164 | Ga0209758_10021649 | 158 |
| 839 | 3300025297 | Ga0209758_1002288 | Ga0209758_10022886 | 158 |
| 840 | 3300025297 | Ga0209758_1003671 | Ga0209758_10036714 | 158 |
| 841 | 3300025297 | Ga0209758_1016828 | Ga0209758_10168284 | 158 |
| 842 | 3300025298 | Ga0209050_1001222 | Ga0209050_10012223 | 158 |
| 843 | 3300025299 | Ga0209256_1001044 | Ga0209256_10010445 | 158 |
| 844 | 3300025299 | Ga0209256_1002554 | Ga0209256_10025548 | 158 |
| 845 | 3300025299 | Ga0209256_1002658 | Ga0209256_10026585 | 158 |
| 846 | 3300025299 | Ga0209256_1002838 | Ga0209256_10028388 | 158 |
| 847 | 3300025299 | Ga0209256_1002860 | Ga0209256_10028608 | 158 |
| 848 | 3300025299 | Ga0209256_1007676 | Ga0209256_10076764 | 158 |
| 849 | 3300025299 | Ga0209256_1008783 | Ga0209256_10087833 | 158 |
| 850 | 3300025299 | Ga0209256_1011782 | Ga0209256_10117824 | 158 |
| 851 | 3300025299 | Ga0209256_1018967 | Ga0209256_10189672 | 158 |
| 852 | 3300025302 | Ga0207426_1000064 | Ga0207426_100006453 | 158 |
| 853 | 3300025302 | Ga0207426_1000106 | Ga0207426_1000106129 | 158 |
| 854 | 3300025302 | Ga0207426_1000265 | Ga0207426_100026515 | 158 |
| 855 | 3300025302 | Ga0207426_1000652 | Ga0207426_100065224 | 158 |
| 856 | 3300025303 | Ga0209051_1000514 | Ga0209051_100051423 | 158 |
| 857 | 3300025303 | Ga0209051_1006315 | Ga0209051_10063154 | 158 |
| 858 | 3300025303 | Ga0209051_1009158 | Ga0209051_10091583 | 158 |
| 859 | 3300025303 | Ga0209051_1010723 | Ga0209051_10107233 | 158 |
| 860 | 3300025303 | Ga0209051_1012051 | Ga0209051_10120513 | 158 |
| 861 | 3300025303 | Ga0209051_1035661 | Ga0209051_10356612 | 158 |
| 862 | 3300025304 | Ga0209257_1001514 | Ga0209257_100151422 | 158 |
| 863 | 3300025304 | Ga0209257_1003433 | Ga0209257_10034337 | 158 |
| 864 | 3300025304 | Ga0209257_1007276 | Ga0209257_10072768 | 158 |
| 865 | 3300025904 | Ga0207647_10136275 | Ga0207647_101362752 | 158 |
| 866 | 3300025907 | Ga0207645_10381329 | Ga0207645_103813291 | 158 |
| 867 | 3300025909 | Ga0207705_10494451 | Ga0207705_104944511 | 158 |
| 868 | 3300025909 | Ga0207705_10507774 | Ga0207705_105077742 | 158 |
| 869 | 3300025911 | Ga0207654_10195106 | Ga0207654_101951062 | 158 |
| 870 | 3300025913 | Ga0207695_10000024 | Ga0207695_10000024234 | 158 |
| 871 | 3300025913 | Ga0207695_10204177 | Ga0207695_102041773 | 158 |
| 872 | 3300025913 | Ga0207695_10893348 | Ga0207695_108933481 | 158 |
| 873 | 3300025914 | Ga0207671_10000548 | Ga0207671_1000054810 | 158 |
| 874 | 3300025914 | Ga0207671_10278982 | Ga0207671_102789823 | 158 |
| 875 | 3300025914 | Ga0207671_10442674 | Ga0207671_104426742 | 158 |
| 876 | 3300025919 | Ga0207657_10314739 | Ga0207657_103147392 | 158 |
| 877 | 3300025920 | Ga0207649_10264276 | Ga0207649_102642762 | 158 |
| 878 | 3300025924 | Ga0207694_10422646 | Ga0207694_104226462 | 158 |
| 879 | 3300025925 | Ga0207650_10533838 | Ga0207650_105338382 | 158 |
| 880 | 3300025935 | Ga0207709_10153168 | Ga0207709_101531682 | 158 |
| 881 | 3300025940 | Ga0207691_10654793 | Ga0207691_106547932 | 158 |
| 882 | 3300025941 | Ga0207711_10184523 | Ga0207711_101845232 | 158 |
| 883 | 3300025941 | Ga0207711_10668304 | Ga0207711_106683042 | 158 |
| 884 | 3300025941 | Ga0207711_11106698 | Ga0207711_111066982 | 158 |
| 885 | 3300025949 | Ga0207667_10592290 | Ga0207667_105922902 | 158 |
| 886 | 3300025949 | Ga0207667_11073160 | Ga0207667_110731602 | 158 |
| 887 | 3300025961 | Ga0207712_10870052 | Ga0207712_108700522 | 158 |
| 888 | 3300025972 | Ga0207668_10127330 | Ga0207668_101273302 | 158 |
| 889 | 3300025986 | Ga0207658_10817774 | Ga0207658_108177741 | 158 |
| 890 | 3300026041 | Ga0207639_10483918 | Ga0207639_104839182 | 158 |
| 891 | 3300026067 | Ga0207678_10292975 | Ga0207678_102929752 | 158 |
| 892 | 3300026067 | Ga0207678_10395227 | Ga0207678_103952272 | 158 |
| 893 | 3300026067 | Ga0207678_10624394 | Ga0207678_106243942 | 158 |
| 894 | 3300026067 | Ga0207678_10698046 | Ga0207678_106980462 | 158 |
| 895 | 3300026078 | Ga0207702_10339629 | Ga0207702_103396292 | 158 |
| 896 | 3300026089 | Ga0207648_10048598 | Ga0207648_100485983 | 158 |
| 897 | 3300026095 | Ga0207676_10908409 | Ga0207676_109084092 | 158 |
| 898 | 3300026116 | Ga0207674_10620286 | Ga0207674_106202862 | 158 |
| 899 | 3300026116 | Ga0207674_11228247 | Ga0207674_112282472 | 158 |
| 900 | 3300026142 | Ga0207698_10071975 | Ga0207698_100719752 | 158 |
| 901 | 3300026142 | Ga0207698_11460869 | Ga0207698_114608692 | 158 |
| 902 | 3300026142 | Ga0207698_11920988 | Ga0207698_119209882 | 158 |
| 903 | 3300027111 | Ga0209281_1000266 | Ga0209281_10002667 | 158 |
| 904 | 3300027111 | Ga0209281_1000332 | Ga0209281_100033252 | 158 |
| 905 | 3300027312 | Ga0209371_1006525 | Ga0209371_10065254 | 158 |
| 906 | 3300027666 | Ga0209282_1000007 | Ga0209282_1000007162 | 158 |
| 907 | 3300027866 | Ga0209813_10096417 | Ga0209813_100964172 | 158 |
| 908 | 3300027866 | Ga0209813_10098778 | Ga0209813_100987782 | 158 |
| 909 | 3300028379 | Ga0268266_10197576 | Ga0268266_101975762 | 158 |
| 910 | 3300028786 | Ga0307517_10189616 | Ga0307517_101896162 | 158 |
| 911 | 3300028794 | Ga0307515_10035625 | Ga0307515_100356256 | 158 |
| 912 | 3300028794 | Ga0307515_10584617 | Ga0307515_105846172 | 158 |
| 913 | 3300031456 | Ga0307513_10007830 | Ga0307513_100078303 | 158 |
| 914 | 3300031456 | Ga0307513_10519529 | Ga0307513_105195291 | 158 |
| 915 | 3300031548 | Ga0307408_100222233 | Ga0307408_1002222331 | 158 |
| 916 | 3300031548 | Ga0307408_101963377 | Ga0307408_1019633771 | 158 |
| 917 | 3300031731 | Ga0307405_10156070 | Ga0307405_101560703 | 158 |
| 918 | 3300031852 | Ga0307410_11417569 | Ga0307410_114175692 | 158 |
| 919 | 3300031901 | Ga0307406_10180703 | Ga0307406_101807032 | 158 |
| 920 | 3300031911 | Ga0307412_10007614 | Ga0307412_100076143 | 158 |
| 921 | 3300031911 | Ga0307412_10226708 | Ga0307412_102267082 | 158 |
| 922 | 3300031967 | Ga0315914_1000006 | Ga0315914_100000681 | 158 |
| 923 | 3300032004 | Ga0307414_10836656 | Ga0307414_108366562 | 158 |
| 924 | 3300032005 | Ga0307411_11734411 | Ga0307411_117344111 | 158 |
| 925 | 3300032126 | Ga0307415_100732409 | Ga0307415_1007324092 | 158 |
| 926 | 3300033430 | Ga0315913_1000002 | Ga0315913_1000002162 | 158 |
| 927 | 3300033464 | Ga0315915_1000001 | Ga0315915_1000001325 | 158 |
| 928 | 3300037312 | Ga0395899_0606124 | Ga0395899_0606124_202_678 | 158 |
| 929 | 3300037418 | Ga0395900_0137569 | Ga0395900_0137569_1969_2466 | 158 |
| 930 | 3300037418 | Ga0395900_1214023 | Ga0395900_1214023_74_571 | 158 |
| 931 | 3300037471 | Ga0395905_0071155 | Ga0395905_0071155_2366_2863 | 158 |
| 932 | 3300037471 | Ga0395905_1037070 | Ga0395905_1037070_21_497 | 158 |
| 933 | 3300038443 | Ga0395901_0085966 | Ga0395901_0085966_480_977 | 158 |
| 934 | 3300038443 | Ga0395901_0310835 | Ga0395901_0310835_1081_1578 | 158 |
| 935 | 3300038443 | Ga0395901_0360412 | Ga0395901_0360412_976_1473 | 158 |
| 936 | 3300041413 | Ga0439465_0159451 | Ga0439465_0159451_318_794 | 158 |
| 937 | 3300041486 | Ga0451807_1582717 | Ga0451807_1582717_87_563 | 158 |
| 938 | 3300041501 | Ga0451845_0248020 | Ga0451845_0248020_56_532 | 158 |
| 939 | 3300042157 | Ga0439458_0065109 | Ga0439458_0065109_384_887 | 158 |
| 940 | 3300044658 | Ga0466972_0017014 | Ga0466972_0017014_2048_2545 | 158 |
| 941 | 3300044658 | Ga0466972_0053763 | Ga0466972_0053763_321_818 | 158 |
| 942 | 3300044683 | Ga0466965_0507163 | Ga0466965_0507163_128_625 | 158 |
| 943 | 3300044735 | Ga0466968_0133356 | Ga0466968_0133356_315_800 | 158 |
| 944 | 3300046460 | Ga0495638_0000353 | Ga0495638_0000353_6710_7186 | 158 |
| 945 | 3300046471 | Ga0495650_0029385 | Ga0495650_0029385_1979_2455 | 158 |
| 946 | 3300046471 | Ga0495650_0067074 | Ga0495650_0067074_694_1191 | 158 |
| 947 | 3300046474 | Ga0495605_0007427 | Ga0495605_0007427_3918_4394 | 158 |
| 948 | 3300046491 | Ga0495584_0379935 | Ga0495584_0379935_158_634 | 158 |
| 949 | 3300046492 | Ga0495585_0006433 | Ga0495585_0006433_1266_1742 | 158 |
| 950 | 3300046501 | Ga0495607_0026537 | Ga0495607_0026537_3048_3524 | 158 |
| 951 | 3300046506 | Ga0495583_0008191 | Ga0495583_0008191_4780_5256 | 158 |
| 952 | 3300046506 | Ga0495583_0052157 | Ga0495583_0052157_902_1378 | 158 |
| 953 | 3300046506 | Ga0495583_0246509 | Ga0495583_0246509_68_544 | 158 |
| 954 | 3300046507 | Ga0495606_0010611 | Ga0495606_0010611_7087_7563 | 158 |
| 955 | 3300046507 | Ga0495606_0053589 | Ga0495606_0053589_1260_1736 | 158 |
| 956 | 3300046507 | Ga0495606_0266217 | Ga0495606_0266217_403_879 | 158 |
| 957 | 3300046512 | Ga0495610_0002493 | Ga0495610_0002493_13495_13992 | 158 |
| 958 | 3300046512 | Ga0495610_0041836 | Ga0495610_0041836_1375_1851 | 158 |
| 959 | 3300046515 | Ga0495620_0031635 | Ga0495620_0031635_1211_1687 | 158 |
| 960 | 3300046518 | Ga0495631_0027247 | Ga0495631_0027247_210_686 | 158 |
| 961 | 3300046518 | Ga0495631_0051597 | Ga0495631_0051597_776_1252 | 158 |
| 962 | 3300046519 | Ga0495632_0007287 | Ga0495632_0007287_1417_1914 | 158 |
| 963 | 3300046519 | Ga0495632_0048475 | Ga0495632_0048475_1268_1744 | 158 |
| 964 | 3300046519 | Ga0495632_0077562 | Ga0495632_0077562_205_681 | 158 |
| 965 | 3300046522 | Ga0495643_0032728 | Ga0495643_0032728_2279_2755 | 158 |
| 966 | 3300046522 | Ga0495643_0048443 | Ga0495643_0048443_1702_2178 | 158 |
| 967 | 3300046522 | Ga0495643_0073423 | Ga0495643_0073423_92_568 | 158 |
| 968 | 3300046524 | Ga0495648_0054864 | Ga0495648_0054864_1428_1904 | 158 |
| 969 | 3300046530 | Ga0495654_0170477 | Ga0495654_0170477_11_487 | 158 |
| 970 | 3300046538 | Ga0495609_0263297 | Ga0495609_0263297_169_645 | 158 |
| 971 | 3300046542 | Ga0495597_0020027 | Ga0495597_0020027_396_872 | 158 |
| 972 | 3300046616 | Ga0495668_0012552 | Ga0495668_0012552_292_768 | 158 |
| 973 | 3300046616 | Ga0495668_0017902 | Ga0495668_0017902_3189_3665 | 158 |
| 974 | 3300046616 | Ga0495668_0208060 | Ga0495668_0208060_389_865 | 158 |
| 975 | 3300046616 | Ga0495668_0376928 | Ga0495668_0376928_230_706 | 158 |
| 976 | 3300046648 | Ga0495611_0017639 | Ga0495611_0017639_1422_1898 | 158 |
| 977 | 3300046660 | Ga0495625_0001623 | Ga0495625_0001623_13466_13942 | 158 |
| 978 | 3300046660 | Ga0495625_0012480 | Ga0495625_0012480_2372_2848 | 158 |
| 979 | 3300046660 | Ga0495625_0495380 | Ga0495625_0495380_200_697 | 158 |
| 980 | 3300046665 | Ga0495661_0319278 | Ga0495661_0319278_106_582 | 158 |
| 981 | 3300046691 | Ga0495670_0251093 | Ga0495670_0251093_153_629 | 158 |
| 982 | 3300046694 | Ga0495649_0037909 | Ga0495649_0037909_1398_1874 | 158 |
| 983 | 3300046694 | Ga0495649_0138817 | Ga0495649_0138817_479_955 | 158 |
| 984 | 3300046810 | Ga0495660_0033898 | Ga0495660_0033898_1172_1648 | 158 |
| 985 | 3300046810 | Ga0495660_0043125 | Ga0495660_0043125_1198_1674 | 158 |
| 986 | 3300046810 | Ga0495660_0096574 | Ga0495660_0096574_261_758 | 158 |
| 987 | 3300047318 | Ga0495636_0053564 | Ga0495636_0053564_552_1028 | 158 |
| 988 | 3300047318 | Ga0495636_0054551 | Ga0495636_0054551_1192_1668 | 158 |
| 989 | 3300047320 | Ga0495672_0011740 | Ga0495672_0011740_380_856 | 158 |
| 990 | 3300047323 | Ga0495683_0272747 | Ga0495683_0272747_240_716 | 158 |
| 991 | 3300047443 | Ga0495687_040495 | Ga0495687_040495_1241_1738 | 158 |
| 992 | 3300047443 | Ga0495687_107672 | Ga0495687_107672_116_592 | 158 |
| 993 | 3300047472 | Ga0495686_0010459 | Ga0495686_0010459_1920_2396 | 158 |
| 994 | 3300047472 | Ga0495686_0011085 | Ga0495686_0011085_5483_5959 | 158 |
| 995 | 3300047472 | Ga0495686_0061215 | Ga0495686_0061215_450_947 | 158 |
| 996 | 3300047472 | Ga0495686_0071177 | Ga0495686_0071177_1221_1697 | 158 |
| 997 | 3300047472 | Ga0495686_0269012 | Ga0495686_0269012_99_575 | 158 |
| 998 | 3300047472 | Ga0495686_0332664 | Ga0495686_0332664_227_703 | 158 |
| 999 | 3300047472 | Ga0495686_0365231 | Ga0495686_0365231_71_547 | 158 |
| 1000 | 3300048091 | Ga0495626_0228138 | Ga0495626_0228138_106_582 | 158 |
| 1001 | 3300048904 | Ga0496101_0459728 | Ga0496101_0459728_362_841 | 158 |
| 1002 | 3300048905 | Ga0496102_0375020 | Ga0496102_0375020_498_974 | 158 |
| 1003 | 3300048906 | Ga0496103_0279087 | Ga0496103_0279087_309_806 | 158 |
| 1004 | 3300048908 | Ga0496105_0263058 | Ga0496105_0263058_245_742 | 158 |
| 1005 | 3300048909 | Ga0496106_0018110 | Ga0496106_0018110_1232_1708 | 158 |
| 1006 | 3300048911 | Ga0496108_1210510 | Ga0496108_1210510_113_610 | 158 |
| 1007 | 3300048912 | Ga0496109_0430614 | Ga0496109_0430614_159_656 | 158 |
| 1008 | 3300048915 | Ga0496112_0154436 | Ga0496112_0154436_918_1415 | 158 |
| 1009 | 3300048915 | Ga0496112_0240994 | Ga0496112_0240994_142_639 | 158 |
| 1010 | 3300048918 | Ga0496115_0052156 | Ga0496115_0052156_2732_3229 | 158 |
| 1011 | 3300048918 | Ga0496115_1086062 | Ga0496115_1086062_121_597 | 158 |
| 1012 | 3300048919 | Ga0496116_0007220 | Ga0496116_0007220_4111_4608 | 158 |
| 1013 | 3300048919 | Ga0496116_0009103 | Ga0496116_0009103_1174_1671 | 158 |
| 1014 | 3300048919 | Ga0496116_0015251 | Ga0496116_0015251_5538_6035 | 158 |
| 1015 | 3300048919 | Ga0496116_0018933 | Ga0496116_0018933_4411_4890 | 158 |
| 1016 | 3300048919 | Ga0496116_0051522 | Ga0496116_0051522_675_1172 | 158 |
| 1017 | 3300048919 | Ga0496116_0115594 | Ga0496116_0115594_603_1079 | 158 |
| 1018 | 3300048920 | Ga0496117_0026761 | Ga0496117_0026761_912_1409 | 158 |
| 1019 | 3300048920 | Ga0496117_0061050 | Ga0496117_0061050_623_1120 | 158 |
| 1020 | 3300048920 | Ga0496117_0066338 | Ga0496117_0066338_407_883 | 158 |
| 1021 | 3300048920 | Ga0496117_0241822 | Ga0496117_0241822_38_514 | 158 |
| 1022 | 3300048920 | Ga0496117_0340261 | Ga0496117_0340261_256_732 | 158 |
| 1023 | 3300048921 | Ga0496118_0046838 | Ga0496118_0046838_998_1495 | 158 |
| 1024 | 3300048921 | Ga0496118_0081627 | Ga0496118_0081627_1106_1582 | 158 |
| 1025 | 3300048921 | Ga0496118_0093731 | Ga0496118_0093731_1139_1636 | 158 |
| 1026 | 3300048922 | Ga0496119_0043400 | Ga0496119_0043400_981_1478 | 158 |
| 1027 | 3300048922 | Ga0496119_0078325 | Ga0496119_0078325_909_1406 | 158 |
| 1028 | 3300048922 | Ga0496119_0145859 | Ga0496119_0145859_173_652 | 158 |
| 1029 | 3300048922 | Ga0496119_0214718 | Ga0496119_0214718_282_758 | 158 |
| 1030 | 3300048922 | Ga0496119_0568823 | Ga0496119_0568823_11_508 | 158 |
| 1031 | 3300048923 | Ga0496120_0000860 | Ga0496120_0000860_9016_9513 | 158 |
| 1032 | 3300048924 | Ga0496121_0008689 | Ga0496121_0008689_5672_6169 | 158 |
| 1033 | 3300048924 | Ga0496121_0010436 | Ga0496121_0010436_5040_5537 | 158 |
| 1034 | 3300048924 | Ga0496121_0016167 | Ga0496121_0016167_4188_4664 | 158 |
| 1035 | 3300048924 | Ga0496121_0017218 | Ga0496121_0017218_4323_4799 | 158 |
| 1036 | 3300048924 | Ga0496121_0210637 | Ga0496121_0210637_732_1208 | 158 |
| 1037 | 3300048924 | Ga0496121_0220364 | Ga0496121_0220364_592_1089 | 158 |
| 1038 | 3300048924 | Ga0496121_0340235 | Ga0496121_0340235_303_779 | 158 |
| 1039 | 3300048925 | Ga0496122_0010176 | Ga0496122_0010176_8076_8573 | 158 |
| 1040 | 3300048925 | Ga0496122_0032451 | Ga0496122_0032451_2650_3147 | 158 |
| 1041 | 3300048925 | Ga0496122_0046163 | Ga0496122_0046163_216_692 | 158 |
| 1042 | 3300048925 | Ga0496122_0152169 | Ga0496122_0152169_281_757 | 158 |
| 1043 | 3300048926 | Ga0496123_0008658 | Ga0496123_0008658_3119_3616 | 158 |
| 1044 | 3300048926 | Ga0496123_0030918 | Ga0496123_0030918_762_1259 | 158 |
| 1045 | 3300048926 | Ga0496123_0055898 | Ga0496123_0055898_471_947 | 158 |
| 1046 | 3300048926 | Ga0496123_0077128 | Ga0496123_0077128_470_967 | 158 |
| 1047 | 3300048927 | Ga0496124_0008621 | Ga0496124_0008621_8988_9485 | 158 |
| 1048 | 3300048927 | Ga0496124_0023070 | Ga0496124_0023070_968_1447 | 158 |
| 1049 | 3300048927 | Ga0496124_0035244 | Ga0496124_0035244_2678_3175 | 158 |
| 1050 | 3300048927 | Ga0496124_0274342 | Ga0496124_0274342_388_864 | 158 |
| 1051 | 3300048927 | Ga0496124_0353882 | Ga0496124_0353882_80_577 | 158 |
| 1052 | 3300048927 | Ga0496124_0386900 | Ga0496124_0386900_111_587 | 158 |
| 1053 | 3300048928 | Ga0496125_0005687 | Ga0496125_0005687_7472_7969 | 158 |
| 1054 | 3300048928 | Ga0496125_0067235 | Ga0496125_0067235_1412_1888 | 158 |
| 1055 | 3300048928 | Ga0496125_0313219 | Ga0496125_0313219_353_832 | 158 |
| 1056 | 3300048929 | Ga0496126_0058039 | Ga0496126_0058039_2128_2604 | 158 |
| 1057 | 3300048929 | Ga0496126_0063975 | Ga0496126_0063975_1081_1578 | 158 |
| 1058 | 3300048929 | Ga0496126_0064123 | Ga0496126_0064123_895_1392 | 158 |
| 1059 | 3300048929 | Ga0496126_0556629 | Ga0496126_0556629_280_759 | 158 |
| 1060 | 3300048929 | Ga0496126_0577823 | Ga0496126_0577823_12_509 | 158 |
| 1061 | 3300049459 | Ga0495678_042285 | Ga0495678_042285_686_1162 | 158 |
| 1062 | 3300049459 | Ga0495678_084516 | Ga0495678_084516_445_921 | 158 |
| 1063 | 3300049571 | Ga0501034_0345362 | Ga0501034_0345362_83_559 | 158 |
| 1064 | 3300049572 | Ga0501036_0078466 | Ga0501036_0078466_1110_1586 | 158 |
| 1065 | 3300049573 | Ga0501037_0133340 | Ga0501037_0133340_1031_1507 | 158 |
| 1066 | 3300049580 | Ga0501046_0369144 | Ga0501046_0369144_133_609 | 158 |
| 1067 | 3300049581 | Ga0501047_0900762 | Ga0501047_0900762_46_522 | 158 |
| 1068 | 3300049584 | Ga0501068_0292612 | Ga0501068_0292612_396_872 | 158 |
| 1069 | 3300049586 | Ga0501070_0910576 | Ga0501070_0910576_75_572 | 158 |
| 1070 | 3300049592 | Ga0501076_1730454 | Ga0501076_1730454_13_489 | 158 |
| 1071 | 3300049742 | Ga0501080_0181495 | Ga0501080_0181495_299_775 | 158 |
| 1072 | 3300049822 | Ga0501035_0132077 | Ga0501035_0132077_50_526 | 158 |
| 1073 | 3300049823 | Ga0501044_0237335 | Ga0501044_0237335_62_538 | 158 |
| 1074 | 3300050489 | nmdc:mga03683_22372_c1 | nmdc:mga03683_22372_c1_873_1370 | 158 |
| 1075 | 3300050489 | nmdc:mga03683_47539_c1 | nmdc:mga03683_47539_c1_330_806 | 158 |
| 1076 | 3300050490 | nmdc:mga03n38_124021_c1 | nmdc:mga03n38_124021_c1_47_523 | 158 |
| 1077 | 3300050490 | nmdc:mga03n38_35795_c1 | nmdc:mga03n38_35795_c1_145_642 | 158 |
| 1078 | 3300050490 | nmdc:mga03n38_631065_c1 | nmdc:mga03n38_631065_c1_123_599 | 158 |
| 1079 | 3300050490 | nmdc:mga03n38_87203_c1 | nmdc:mga03n38_87203_c1_846_1343 | 158 |
| 1080 | 3300050491 | nmdc:mga00v17_202522_c1 | nmdc:mga00v17_202522_c1_454_930 | 158 |
| 1081 | 3300050491 | nmdc:mga00v17_569844_c1 | nmdc:mga00v17_569844_c1_48_545 | 158 |
| 1082 | 3300050491 | nmdc:mga00v17_9680_c1 | nmdc:mga00v17_9680_c1_259_756 | 158 |
| 1083 | 3300050492 | nmdc:mga0yw44_12368_c1 | nmdc:mga0yw44_12368_c1_1928_2425 | 158 |
| 1084 | 3300050492 | nmdc:mga0yw44_132598_c1 | nmdc:mga0yw44_132598_c1_121_618 | 158 |
| 1085 | 3300050492 | nmdc:mga0yw44_319901_c1 | nmdc:mga0yw44_319901_c1_507_1004 | 158 |
| 1086 | 3300050492 | nmdc:mga0yw44_474748_c1 | nmdc:mga0yw44_474748_c1_115_591 | 158 |
| 1087 | 3300050493 | nmdc:mga0k408_379304_c1 | nmdc:mga0k408_379304_c1_259_756 | 158 |
| 1088 | 3300050493 | nmdc:mga0k408_575918_c1 | nmdc:mga0k408_575918_c1_70_567 | 158 |
| 1089 | 3300050494 | nmdc:mga06z11_14207_c1 | nmdc:mga06z11_14207_c1_1954_2451 | 158 |
| 1090 | 3300050494 | nmdc:mga06z11_145082_c1 | nmdc:mga06z11_145082_c1_542_1018 | 158 |
| 1091 | 3300050494 | nmdc:mga06z11_20079_c1 | nmdc:mga06z11_20079_c1_412_909 | 158 |
| 1092 | 3300050495 | nmdc:mga04h51_115056_c1 | nmdc:mga04h51_115056_c1_43_540 | 158 |
| 1093 | 3300050495 | nmdc:mga04h51_246638_c1 | nmdc:mga04h51_246638_c1_139_636 | 158 |
| 1094 | 3300050496 | nmdc:mga07m45_106669_c1 | nmdc:mga07m45_106669_c1_107_604 | 158 |
| 1095 | 3300050496 | nmdc:mga07m45_13864_c1 | nmdc:mga07m45_13864_c1_907_1383 | 158 |
| 1096 | 3300050496 | nmdc:mga07m45_329980_c1 | nmdc:mga07m45_329980_c1_311_808 | 158 |
| 1097 | 3300050516 | nmdc:mga0sz30_121118_c1 | nmdc:mga0sz30_121118_c1_443_940 | 158 |
| 1098 | 3300050516 | nmdc:mga0sz30_169813_c1 | nmdc:mga0sz30_169813_c1_237_734 | 158 |
| 1099 | 3300050516 | nmdc:mga0sz30_31522_c1 | nmdc:mga0sz30_31522_c1_938_1414 | 158 |
| 1100 | 3300053079 | Ga0500610_0064332 | Ga0500610_0064332_1021_1497 | 158 |
| 1101 | 3300053079 | Ga0500610_0167408 | Ga0500610_0167408_199_675 | 158 |
| 1102 | 3300053083 | Ga0495655_0112839 | Ga0495655_0112839_269_745 | 158 |
| 1103 | 3300053088 | Ga0500644_0170197 | Ga0500644_0170197_202_678 | 158 |
| 1104 | 3300053105 | Ga0500557_014653 | Ga0500557_014653_1464_1940 | 158 |
| 1105 | 3300053109 | Ga0500569_007004 | Ga0500569_007004_792_1268 | 158 |
| 1106 | 3300053109 | Ga0500569_030321 | Ga0500569_030321_592_1068 | 158 |
| 1107 | 3300053118 | Ga0500594_0081562 | Ga0500594_0081562_131_607 | 158 |
| 1108 | 3300053119 | Ga0500595_060013 | Ga0500595_060013_159_656 | 158 |
| 1109 | 3300053134 | Ga0500658_0006268 | Ga0500658_0006268_2538_3014 | 158 |
| 1110 | 3300053134 | Ga0500658_0339962 | Ga0500658_0339962_84_560 | 158 |
| 1111 | 3300053134 | Ga0500658_0475661 | Ga0500658_0475661_26_523 | 158 |
| 1112 | 3300053139 | Ga0500568_0000108 | Ga0500568_0000108_38735_39211 | 158 |
| 1113 | 3300053139 | Ga0500568_0006791 | Ga0500568_0006791_3781_4257 | 158 |
| 1114 | 3300053139 | Ga0500568_0008893 | Ga0500568_0008893_4030_4506 | 158 |
| 1115 | 3300053142 | Ga0500577_0142941 | Ga0500577_0142941_211_687 | 158 |
| 1116 | 3300053146 | Ga0500588_0033680 | Ga0500588_0033680_429_905 | 158 |
| 1117 | 3300053151 | Ga0500604_0041599 | Ga0500604_0041599_724_1200 | 158 |
| 1118 | 3300053153 | Ga0500616_0094806 | Ga0500616_0094806_92_568 | 158 |
| 1119 | 3300053156 | Ga0500622_0002169 | Ga0500622_0002169_1718_2194 | 158 |
| 1120 | 3300053158 | Ga0500627_0083951 | Ga0500627_0083951_139_615 | 158 |
| 1121 | 3300053727 | Ga0500611_005807 | Ga0500611_005807_562_1038 | 158 |
| 1122 | 3300053727 | Ga0500611_111195 | Ga0500611_111195_88_564 | 158 |
| 1123 | 3300053730 | Ga0500645_153143 | Ga0500645_153143_51_548 | 158 |
| 1124 | iso_pu_bacteria | 2693429783 | 2694633753 | 158 |
| 1125 | iso_pu_bacteria | 2693429784 | 2694639907 | 158 |
| 1126 | iso_pu_bacteria | 2856328259 | 2856330898 | 158 |
| 1127 | iso_pu_bacteria | 2856334872 | 2856339171 | 158 |
| 1128 | iso_pu_bacteria | 2857367948 | 2857370807 | 158 |
| 1129 | iso_pu_bacteria | 2869249662 | 2869252904 | 158 |
| 1130 | iso_pu_bacteria | 2869264136 | 2869270071 | 158 |
| 1131 | iso_pu_bacteria | 2869271264 | 2869274365 | 158 |
| 1132 | iso_pu_bacteria | 2871459585 | 2871462422 | 158 |
| 1133 | iso_pu_bacteria | 2874131515 | 2874138222 | 158 |
| 1134 | iso_pu_bacteria | 2876399893 | 2876399919 | 158 |
| 1135 | iso_pu_bacteria | 2876406927 | 2876408843 | 158 |
| 1136 | iso_pu_bacteria | 2878774303 | 2878774994 | 158 |
| 1137 | iso_pu_bacteria | 2906363423 | 2906364541 | 158 |
| 1138 | iso_pu_bacteria | 2906370794 | 2906374958 | 158 |
| 1139 | iso_pu_bacteria | 2906393657 | 2906394227 | 158 |
| 1140 | iso_pu_bacteria | 2924748358 | 2924751612 | 158 |
| 1141 | iso_pu_bacteria | 2961136820 | 2961140559 | 158 |
| 1142 | iso_pu_bacteria | 2965025482 | 2965026107 | 158 |
| 1143 | iso_pu_bacteria | 2965040258 | 2965047459 | 158 |
| 1144 | iso_pu_bacteria | 2965102966 | 2965105411 | 158 |
| 1145 | iso_pu_bacteria | 2977915119 | 2977917126 | 158 |
| 1146 | iso_pu_bacteria | 2977935797 | 2977940784 | 158 |
| 1147 | iso_pu_bacteria | 2977957713 | 2977959104 | 158 |
| 1148 | iso_pu_bacteria | 2979793036 | 2979796143 | 158 |
| 1149 | iso_pu_bacteria | 2987673487 | 2987677546 | 158 |
| 1150 | iso_pu_bacteria | 8004361976 | 8004366874 | 158 |
| 1151 | iso_pu_bacteria | 8004695233 | 8004696819 | 158 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ajq-assembly3.cif.gz_E | crystal structure of pa2722 from pseudomonas aeruginosa pao1 | 0.8387 | 1 | 129 |
| 8p1x-assembly1.cif.gz_AAA | tarm(se)_g117r-udp-glucose | 0.821 | 59 | 85 |
| 4wac-assembly1.cif.gz_A | crystal structure of tarm | 0.8105 | 58 | 85 |
| 3fac-assembly8.cif.gz_H | crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. | 0.7657 | 7 | 107 |
| 4x7r-assembly1.cif.gz_A | crystal structure of s. aureus tarm g117r mutant in complex with fondaparinux, alpha-glcnac-glycerol and udp | 0.7476 | 58 | 85 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZM7_1_163_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.7797 | 58 | 85 | 3.40.50.2000 |
| af_Q54X87_13_141_2.170.150.70 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; | 0.7544 | 7 | 110 | 2.170.150.70 |
| af_O14034_2_133_3.90.1590.10 | Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) | 0.7543 | 4 | 128 | 3.90.1590.10 |
| af_O14034_2_133_3.90.1590.10 | Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) | 0.6928 | 4 | 128 | 3.90.1590.10 |
| 1xa8D00 | Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) | 0.638 | 1 | 137 | 3.90.1590.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A527VRP0-F1-model_v4 | GFA family protein | 0.987 | 1 | 110 |
GO:0016846
GO:0046872 |
| AF-A0A527HG45-F1-model_v4 | GFA family protein | 0.9857 | 1 | 80 |
GO:0016846
GO:0046872 |
| AF-A0A527VRP0-F1-model_v4 | GFA family protein | 0.9782 | 1 | 110 |
GO:0016846
GO:0046872 |
| AF-A0A7R6Z2B9-F1-model_v4 | CENP-V/GFA domain-containing protein | 0.9753 | 1 | 158 |
GO:0016846
GO:0046872 |
| AF-A0A527HG45-F1-model_v4 | GFA family protein | 0.9737 | 1 | 80 |
GO:0016846
GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar