F490869

General Info

Members Datasets Scaffolds Average Seq Length
1151 826 592 156

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2791355253|2793282283
Length 174
Sequence QNELLSGGCQCGAVRFRASHLGRPSICHCRMCQKQFGSFFGAFVTADPAHLEWTRGAPALYRSSNKVRRGFCQRCGTPLTYHHPGGVELAIGAFDHPEKLEPEIQVNHHKRLPWIDRLFDKPVLVSEEADAFFASIDSYQHPDHDTAVWPPEDDGAPAPRSRHGRHGSGEGVEE

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
8 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
9 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
10 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
11 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
12 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
13 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
14 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
15 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
16 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
17 2512875024 Mesorhizobium loti R88b Isolate Nodule
18 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
19 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
20 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
21 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
22 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
23 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
24 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
25 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
26 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
27 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
28 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
29 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
30 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
31 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
32 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
33 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
34 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
35 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
36 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
37 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
38 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
39 2519899620 Rhizobium sp. Pop5 Isolate Nodule
40 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
41 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
42 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
43 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
44 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
45 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
46 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
47 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
48 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
49 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
50 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
51 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
52 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
53 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
54 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
55 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
56 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
57 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
58 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
59 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
60 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
61 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
62 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
63 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
64 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
65 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
66 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
67 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
68 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
69 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
70 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
71 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
72 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
73 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
74 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
75 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
76 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
77 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
78 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
79 2643221557 Ensifer sp. Root558 Isolate Unclassified
80 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
81 2643221599 Rhizobium sp. Root708 Isolate Unclassified
82 2643221610 Ensifer sp. Root74 Isolate Unclassified
83 2643221618 Ensifer sp. Root231 Isolate Unclassified
84 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
85 2643221626 Ensifer sp. Root31 Isolate Unclassified
86 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
87 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
88 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
89 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
90 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
91 2643221655 Ensifer sp. Root1252 Isolate Unclassified
92 2643221659 Ensifer sp. Root127 Isolate Unclassified
93 2643221668 Ensifer sp. Root423 Isolate Unclassified
94 2643221675 Ensifer sp. Root1298 Isolate Unclassified
95 2643221680 Ensifer sp. Root1312 Isolate Unclassified
96 2643221688 Rhizobium sp. Root482 Isolate Unclassified
97 2643221698 Ensifer sp. Root142 Isolate Unclassified
98 2643221712 Ensifer sp. Root258 Isolate Unclassified
99 2643221718 Rhizobium sp. Root268 Isolate Unclassified
100 2643221719 Rhizobium sp. Root274 Isolate Unclassified
101 2643221723 Ensifer sp. Root278 Isolate Unclassified
102 2643221726 Ensifer sp. Root954 Isolate Unclassified
103 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
104 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
105 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
106 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
107 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
108 2718217882 Rhizobium sp. N741 Isolate Nodule
109 2718217927 Rhizobium sp. N324 Isolate Nodule
110 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
111 2718218009 Rhizobium sp. N561 Isolate Nodule
112 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
113 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
114 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
115 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
116 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
117 2718218363 Rhizobium sp. N113 Isolate Nodule
118 2718218365 Rhizobium sp. N731 Isolate Nodule
119 2718218366 Rhizobium sp. N621 Isolate Nodule
120 2718218423 Rhizobium sp. N941 Isolate Nodule
121 2721755514 Rhizobium sp. N6212 Isolate Nodule
122 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
123 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
124 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
125 2721755809 Rhizobium sp. N541 Isolate Nodule
126 2721755810 Rhizobium sp. N871 Isolate Nodule
127 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
128 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
129 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
130 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
131 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
132 2728369365 Rhizobium sp. N1341 Isolate Nodule
133 2728369397 Rhizobium sp. N1314 Isolate Nodule
134 2738541293 Rhizobium sp. GV031 Isolate Unclassified
135 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
136 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
137 2738543024 Aminobacter sp. AP02 Isolate Unclassified
138 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
139 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
140 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
141 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
142 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
143 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
144 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
145 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
146 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
147 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
148 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
149 2791355260 Rhizobium sp. L9 Isolate Nodule
150 2791355261 Rhizobium sp. J15 Isolate Nodule
151 2791355262 Rhizobium sp. M1 Isolate Nodule
152 2791355263 Rhizobium chutanense C5 Isolate Nodule
153 2791355264 Rhizobium sp. S9 Isolate Nodule
154 2791355265 Rhizobium sp. H4 Isolate Nodule
155 2791355266 Rhizobium sp. L43 Isolate Nodule
156 2791355267 Rhizobium sp. L18 Isolate Nodule
157 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
158 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
159 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
160 2802429633 Rhizobium anhuiense J3 Isolate Nodule
161 2802429634 Rhizobium anhuiense S10 Isolate Nodule
162 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
163 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
164 2802429637 Rhizobium anhuiense C15 Isolate Nodule
165 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
166 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
167 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
168 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
169 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
170 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
171 2838048938 Rhizobium pisi 27/80 Isolate Nodule
172 2838061910 Rhizobium phaseoli L15 Isolate Nodule
173 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
174 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
175 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
176 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
177 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
178 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
179 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
180 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
181 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
182 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
183 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
184 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
185 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
186 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
187 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
188 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
189 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
190 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
191 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
192 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
193 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
194 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
195 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
196 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
197 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
198 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
199 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
200 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
201 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
202 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
203 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
204 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
205 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
206 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
207 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
208 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
209 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
210 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
211 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
212 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
213 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
214 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
215 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
216 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
217 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
218 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
219 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
220 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
221 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
222 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
223 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
224 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
225 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
226 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
227 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
228 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
229 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
230 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
231 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
232 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
233 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
234 2844163670 Ensifer sp. 1H6 Isolate Unclassified
235 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
236 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
237 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
238 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
239 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
240 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
241 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
242 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
243 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
244 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
245 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
246 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
247 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
248 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
249 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
250 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
251 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
252 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
253 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
254 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
255 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
256 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
257 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
258 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
259 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
260 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
261 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
262 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
263 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
264 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
265 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
266 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
267 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
268 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
269 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
270 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
271 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
272 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
273 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
274 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
275 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
276 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
277 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
278 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
279 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
280 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
281 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
282 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
283 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
284 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
285 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
286 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
287 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
288 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
289 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
290 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
291 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
292 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
293 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
294 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
295 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
296 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
297 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
298 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
299 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
300 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
301 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
302 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
303 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
304 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
305 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
306 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
307 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
308 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
309 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
310 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
311 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
312 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
313 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
314 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
315 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
316 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
317 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
318 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
319 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
320 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
321 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
322 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
323 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
324 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
325 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
326 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
327 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
328 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
329 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
330 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
331 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
332 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
333 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
334 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
335 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
336 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
337 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
338 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
339 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
340 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
341 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
342 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
343 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
344 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
345 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
346 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
347 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
348 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
349 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
350 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
351 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
352 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
353 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
354 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
355 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
356 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
357 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
358 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
359 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
360 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
361 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
362 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
363 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
364 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
365 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
366 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
367 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
368 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
369 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
370 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
371 2933599457 Rhizobium phaseoli M3 Isolate Nodule
372 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
373 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
374 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
375 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
376 2936381700 Rhizobium chutanense C16 Isolate Unclassified
377 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
378 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
379 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
380 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
381 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
382 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
383 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
384 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
385 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
386 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
387 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
388 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
389 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
390 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
391 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
392 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
393 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
394 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
395 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
396 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
397 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
398 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
399 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
400 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
401 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
402 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
403 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
404 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
405 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
406 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
407 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
408 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
409 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
410 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
411 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
412 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
413 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
414 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
415 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
416 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
417 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
418 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
419 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
420 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
421 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
422 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
423 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
424 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
425 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
426 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
427 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
428 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
429 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
430 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
431 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
432 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
433 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
434 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
435 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
436 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
437 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
438 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
439 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
440 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
441 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
442 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
443 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
444 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
445 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
446 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
447 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
448 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
449 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
450 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
451 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
452 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
453 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
454 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
455 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
456 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
457 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
458 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
459 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
460 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
461 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
462 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
463 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
464 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
465 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
466 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
467 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
468 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
469 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
470 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
471 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
472 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
473 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
474 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
475 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
476 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
477 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
478 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
479 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
480 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
481 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
482 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
483 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
484 2996887358 Rhizobium sp. R711 Isolate Nodule
485 2996893221 Rhizobium sp. R635 Isolate Nodule
486 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
487 3004167301 Mesorhizobium loti 582 Isolate Unclassified
488 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
489 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
490 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
491 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
492 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
493 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
494 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
495 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
496 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
497 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
498 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
499 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
500 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
501 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
502 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
503 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
504 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
505 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
506 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
507 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
508 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
509 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
510 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
511 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
512 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
513 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
514 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
515 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
516 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
517 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
518 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
519 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
520 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
521 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
522 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
523 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
524 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
525 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
526 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
527 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
528 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
529 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
530 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
531 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
532 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
533 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
534 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
535 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
536 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
537 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
538 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
539 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
540 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
541 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
542 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
543 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
544 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
545 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
546 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
547 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
548 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
549 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
550 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
551 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
552 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
553 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
554 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
555 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
556 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
557 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
558 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
559 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
560 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
561 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
562 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
563 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
564 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
565 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
566 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
567 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
568 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
569 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
570 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
571 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
572 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
573 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
574 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
575 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
576 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
577 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
578 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
579 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
580 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
581 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
582 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
583 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
584 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
585 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
586 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
587 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
588 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
589 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
590 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
591 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
592 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
593 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
594 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
595 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
596 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
597 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
598 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
599 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
600 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
601 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
602 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
603 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
604 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
605 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
606 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
607 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
608 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
609 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
610 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
611 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
612 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
613 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
614 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
615 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
616 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
617 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
618 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
619 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
620 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
621 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
622 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
623 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
624 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
625 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
626 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
627 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
628 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
629 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
630 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
631 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
632 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
633 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
634 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
635 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
636 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
637 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
638 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
639 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
640 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
641 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
642 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
643 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
644 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
645 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
646 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
647 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
648 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
649 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
650 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
651 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
652 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
653 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
654 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
655 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
656 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
657 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
658 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
659 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
660 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
661 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
662 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
663 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
664 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
665 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
666 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
667 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
668 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
669 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
670 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
671 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
672 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
673 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
674 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
675 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
676 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
677 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
678 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
679 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
680 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
681 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
682 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
683 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
684 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
685 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
686 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
687 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
688 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
689 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
690 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
691 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
692 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
693 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
694 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
695 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
696 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
697 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
698 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
699 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
700 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
701 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
702 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
703 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
704 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
705 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
706 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
707 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
708 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
709 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
710 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
711 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
712 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
713 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
714 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
715 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
716 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
717 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
718 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
719 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
720 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
721 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
722 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
723 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
724 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
725 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
726 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
727 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
728 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
729 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
730 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
731 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
732 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
733 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
734 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
735 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
736 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
737 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
738 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
739 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
740 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
741 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
742 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
743 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
744 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
745 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
746 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
747 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
748 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
749 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
750 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
751 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
752 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
753 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
754 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
755 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
756 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
757 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
758 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
759 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
760 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
761 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
762 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
763 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
764 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
765 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
766 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
767 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
768 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
769 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
770 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
771 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
772 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
773 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
774 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
775 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
776 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
777 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
778 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
779 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
780 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
781 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
782 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
783 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
784 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
785 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
786 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
787 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
788 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
789 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
790 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
791 8005258706 Rhizobium sp. R693 Isolate Nodule
792 8005275841 Rhizobium sp. N4311 Isolate Nodule
793 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
794 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
795 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
796 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
797 8005321885 Rhizobium sp. R72 Isolate Nodule
798 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
799 8005382845 Rhizobium sp. R634 Isolate Nodule
800 8005395548 Rhizobium sp. R339 Isolate Nodule
801 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
802 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
803 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
804 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
805 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
806 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
807 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
808 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
809 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
810 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
811 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
812 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
813 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
814 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
815 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
816 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
817 8018176218 Rhizobium sp. N122 Isolate Nodule
818 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
819 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
820 8024501048 Rhizobium sp. H4 Isolate Nodule
821 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
822 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
823 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
824 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
825 8056382006 Rhizobium croatiense 13T Isolate Nodule
826 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 51.52
Metatranscriptomes 0
Isolates 48.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.94
Nodule 39.44
Rhizoplane 1.48
Rhizosphere 24.33
Stem 0
Stem Tuber 0
Unclassified 13.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10022684 3300001979 Bacteria 2156
2 JGI25156J39149_1008029 3300002705 Bacteria 2702
3 JGI25158J39367_1001006 3300002739 Bacteria 5165
4 JGI25157J39369_1001043 3300002741 Bacteria 12662
5 JGI25152J39213_1000489 3300002773 Bacteria 22488
6 JGI25152J39213_1000613 3300002773 Bacteria 19217
7 JGI25152J39213_1003002 3300002773 Bacteria 5975
8 JGI25152J39213_1003200 3300002773 Bacteria 5695
9 JGI25152J39213_1005384 3300002773 Bacteria 3748
10 JGI25152J39213_1006798 3300002773 Bacteria 3042
11 JGI25152J39213_1009132 3300002773 Bacteria 2383
12 JGI25150J39212_1000033 3300002774 Bacteria 96269
13 JGI25150J39212_1006735 3300002774 Bacteria 2350
14 JGI25150J39212_1006851 3300002774 Bacteria 2323
15 JGI25150J39212_1026697 3300002774 Bacteria 833
16 JGI25159J45721_1000002 3300002987 Bacteria 289163
17 JGI25159J45721_1000299 3300002987 Bacteria 23242
18 JGI25151J46595_10000062 3300003187 Bacteria 146687
19 JGI25151J46595_10001325 3300003187 Bacteria 17313
20 JGI25151J46595_10002042 3300003187 Bacteria 12612
21 JGI25151J46595_10002593 3300003187 Bacteria 10668
22 JGI25151J46595_10011784 3300003187 Bacteria 4006
23 JGI25151J46595_10017797 3300003187 Bacteria 3069
24 JGI25165J46597_1000028 3300003214 Bacteria 325146
25 JGI25165J46597_1011001 3300003214 Bacteria 1303
26 JGI25153J46596_10005408 3300003215 Bacteria 6706
27 JGI25153J46596_10006589 3300003215 Bacteria 5851
28 JGI25153J46596_10007464 3300003215 Bacteria 5373
29 JGI25153J46596_10029503 3300003215 Bacteria 1882
30 JGI25160J50197_1000008 3300003354 Bacteria 289163
31 JGI25160J50197_1008183 3300003354 Bacteria 4008
32 JGI25160J50197_1010532 3300003354 Bacteria 3336
33 JGI25160J50197_1015293 3300003354 Bacteria 2526
34 JGI25161J50226_1000133 3300003374 Bacteria 52508
35 JGI25161J50226_1000527 3300003374 Bacteria 16442
36 JGI25161J50226_1011868 3300003374 Bacteria 1073
37 Ga0055542_1001076 3300003762 Bacteria 16735
38 Ga0055542_1001152 3300003762 Bacteria 15471
39 Ga0055529_1004622 3300003763 Bacteria 2072
40 Ga0055526_1002912 3300003771 Bacteria 11251
41 Ga0055526_1005297 3300003771 Bacteria 7469
42 Ga0055526_1010461 3300003771 Bacteria 4312
43 Ga0055526_1010634 3300003771 Bacteria 4255
44 Ga0055526_1013070 3300003771 Bacteria 3549
45 Ga0055524_1001918 3300003775 Bacteria 11229
46 Ga0055524_1008684 3300003775 Bacteria 4201
47 Ga0055524_1014462 3300003775 Bacteria 2923
48 Ga0055524_1015539 3300003775 Bacteria 2769
49 Ga0055524_1018673 3300003775 Bacteria 2399
50 Ga0055524_1020377 3300003775 Bacteria 2235
51 Ga0055524_1020565 3300003775 Bacteria 2219
52 Ga0055524_1035008 3300003775 Bacteria 1377
53 Ga0055528_1000149 3300003790 Bacteria 57620
54 Ga0055528_1004949 3300003790 Bacteria 6291
55 Ga0055528_1006210 3300003790 Bacteria 5442
56 Ga0055528_1019412 3300003790 Bacteria 2254
57 Ga0055528_1028634 3300003790 Bacteria 1531
58 Ga0055528_1030824 3300003790 Bacteria 1411
59 Ga0055528_1044220 3300003790 Bacteria 961
60 Ga0055530_10048270 3300003791 Bacteria 1001
61 Ga0055540_1001764 3300003792 Bacteria 12339
62 Ga0055540_1002583 3300003792 Bacteria 9430
63 Ga0055540_1017412 3300003792 Bacteria 2007
64 Ga0055540_1021002 3300003792 Bacteria 1710
65 Ga0055531_10048480 3300003794 Bacteria 1145
66 Ga0055543_1000040 3300004625 Bacteria 122485
67 Ga0055543_1000048 3300004625 Bacteria 109807
68 Ga0055543_1003720 3300004625 Bacteria 4365
69 Ga0065165_1000015 3300005262 Bacteria 289201
70 Ga0065165_1006738 3300005262 Bacteria 5891
71 Ga0065165_1012418 3300005262 Bacteria 3468
72 Ga0070658_10187688 3300005327 Bacteria 1742
73 Ga0070670_100002600 3300005331 Bacteria 14919
74 Ga0070668_100154878 3300005347 Bacteria 1856
75 Ga0070668_100774398 3300005347 Bacteria 851
76 Ga0070668_100783679 3300005347 Bacteria 846
77 Ga0070671_100083420 3300005355 Bacteria 2672
78 Ga0070674_100128790 3300005356 Bacteria 1884
79 Ga0070667_100912721 3300005367 Bacteria 818
80 Ga0070708_100338798 3300005445 Bacteria 1417
81 Ga0070663_100274643 3300005455 Bacteria 1341
82 Ga0070663_100650142 3300005455 Bacteria 892
83 Ga0070662_101300743 3300005457 Bacteria 626
84 Ga0068867_100189684 3300005459 Bacteria 1640
85 Ga0068853_100070932 3300005539 Bacteria 3033
86 Ga0068853_100427759 3300005539 Bacteria 1242
87 Ga0070672_100821548 3300005543 Bacteria 818
88 Ga0070686_101526876 3300005544 Bacteria 563
89 Ga0070665_100033875 3300005548 Bacteria 5138
90 Ga0070665_100281328 3300005548 Bacteria 1666
91 Ga0068855_100315987 3300005563 Bacteria 1727
92 Ga0068855_100558333 3300005563 Bacteria 1239
93 Ga0068855_100571357 3300005563 Bacteria 1222
94 Ga0068857_101023395 3300005577 Bacteria 796
95 Ga0068854_100090229 3300005578 Bacteria 2279
96 Ga0068856_100300925 3300005614 Bacteria 1621
97 Ga0068852_100734426 3300005616 Bacteria 999
98 Ga0068866_10244873 3300005718 Bacteria 1094
99 Ga0075365_10017666 3300006038 Bacteria 4370
100 Ga0075365_10068542 3300006038 Bacteria 2383
101 Ga0075365_10114595 3300006038 Bacteria 1855
102 Ga0075365_10270810 3300006038 Bacteria 1194
103 Ga0075365_10307324 3300006038 Bacteria 1116
104 Ga0075368_10017680 3300006042 Bacteria 2671
105 Ga0075368_10041467 3300006042 Bacteria 1808
106 Ga0075368_10119913 3300006042 Bacteria 1089
107 Ga0075363_100055331 3300006048 Bacteria 2125
108 Ga0075363_100079110 3300006048 Bacteria 1796
109 Ga0075363_100132813 3300006048 Bacteria 1397
110 Ga0075363_100367440 3300006048 Bacteria 842
111 Ga0075364_10074936 3300006051 Bacteria 2232
112 Ga0075364_10182629 3300006051 Bacteria 1420
113 Ga0075364_10456967 3300006051 Bacteria 872
114 Ga0075362_10001294 3300006177 Bacteria 7929
115 Ga0075362_10017051 3300006177 Bacteria 2986
116 Ga0075367_10003380 3300006178 Bacteria 7597
117 Ga0075367_10050221 3300006178 Bacteria 2462
118 Ga0075367_10063595 3300006178 Bacteria 2206
119 Ga0075367_10077631 3300006178 Bacteria 2005
120 Ga0075367_10133647 3300006178 Bacteria 1534
121 Ga0075367_10190304 3300006178 Bacteria 1280
122 Ga0075369_10000715 3300006186 Bacteria 10691
123 Ga0075369_10001441 3300006186 Bacteria 8117
124 Ga0075369_10023990 3300006186 Bacteria 2525
125 Ga0075369_10120044 3300006186 Bacteria 1189
126 Ga0075366_10008659 3300006195 Bacteria 5664
127 Ga0075366_10082331 3300006195 Bacteria 1923
128 Ga0075366_10224384 3300006195 Bacteria 1145
129 Ga0075370_10010914 3300006353 Bacteria 4762
130 Ga0075370_10061958 3300006353 Bacteria 2131
131 Ga0075370_10278133 3300006353 Bacteria 994
132 Ga0075370_10531535 3300006353 Bacteria 711
133 Ga0075370_10538892 3300006353 Bacteria 705
134 Ga0068871_100662265 3300006358 Bacteria 954
135 Ga0079104_1002273 3300006946 Bacteria 10662
136 Ga0079104_1005092 3300006946 Bacteria 5353
137 Ga0105251_10008511 3300009011 Bacteria 6160
138 Ga0105244_10117097 3300009036 Bacteria 1292
139 Ga0105250_10108155 3300009092 Bacteria 1137
140 Ga0105240_10605453 3300009093 Bacteria 1206
141 Ga0105245_10544602 3300009098 Bacteria 1182
142 Ga0105241_10109885 3300009174 Bacteria 2205
143 Ga0105241_10223107 3300009174 Bacteria 1585
144 Ga0105241_10611519 3300009174 Bacteria 986
145 Ga0105242_11531386 3300009176 Bacteria 698
146 Ga0105248_10057126 3300009177 Bacteria 4380
147 Ga0105248_10177749 3300009177 Bacteria 2398
148 Ga0105237_10018053 3300009545 Bacteria 7307
149 Ga0105237_10538977 3300009545 Bacteria 1174
150 Ga0105238_10198943 3300009551 Bacteria 1979
151 Ga0105238_10570887 3300009551 Bacteria 1137
152 Ga0105249_10758749 3300009553 Bacteria 1032
153 Ga0123341_1012981 3300009765 Bacteria 7522
154 Ga0105239_10131477 3300010375 Bacteria 2784
155 Ga0105239_10655701 3300010375 Bacteria 1199
156 Ga0105239_10772903 3300010375 Bacteria 1100
157 Ga0105239_11191159 3300010375 Bacteria 878
158 Ga0105239_11422805 3300010375 Bacteria 801
159 Ga0105246_10992580 3300011119 Bacteria 760
160 Ga0157322_1004632 3300012490 Bacteria 907
161 Ga0157319_1002016 3300012497 Bacteria 1120
162 Ga0157373_10391332 3300013100 Bacteria 995
163 Ga0157370_10196562 3300013104 Bacteria 1872
164 Ga0171463_1001 3300013249 Bacteria 1406070
165 Ga0157374_10681521 3300013296 Bacteria 1040
166 Ga0157372_12209991 3300013307 Bacteria 632
167 Ga0163163_10418466 3300014325 Bacteria 1399
168 Ga0182008_10182930 3300014497 Bacteria 1061
169 Ga0157376_10574220 3300014969 Bacteria 1119
170 Ga0182007_10001216 3300015262 Bacteria 13977
171 Ga0183363_1336 3300015690 Bacteria 5813
172 Ga0214544_1008762 3300021320 Bacteria 16495
173 Ga0214542_1000006 3300021321 Bacteria 345164
174 Ga0214542_1016338 3300021321 Bacteria 7243
175 Ga0214543_1000003 3300021327 Bacteria 692327
176 Ga0214543_1000014 3300021327 Bacteria 324986
177 Ga0228711_1000001 3300022739 Bacteria 357377
178 Ga0228710_1000001 3300022740 Bacteria 314328
179 Ga0209435_100042 3300025206 Bacteria 105563
180 Ga0209436_100064 3300025208 Bacteria 56015
181 Ga0209436_102030 3300025208 Bacteria 6388
182 Ga0207425_1000031 3300025245 Bacteria 261181
183 Ga0207425_1000671 3300025245 Bacteria 18714
184 Ga0207425_1002445 3300025245 Bacteria 6535
185 Ga0207425_1018724 3300025245 Bacteria 1499
186 Ga0207425_1029317 3300025245 Bacteria 1110
187 Ga0209646_1000145 3300025246 Bacteria 105563
188 Ga0209026_1000160 3300025250 Bacteria 105563
189 Ga0209026_1000215 3300025250 Bacteria 80382
190 Ga0209148_1000056 3300025254 Bacteria 363380
191 Ga0209759_1000177 3300025256 Bacteria 105563
192 Ga0209759_1000591 3300025256 Bacteria 35218
193 Ga0209129_1000053 3300025258 Bacteria 262823
194 Ga0209129_1000362 3300025258 Bacteria 37617
195 Ga0209129_1000592 3300025258 Bacteria 24759
196 Ga0209129_1002000 3300025258 Bacteria 10596
197 Ga0209129_1003332 3300025258 Bacteria 7079
198 Ga0209129_1003827 3300025258 Bacteria 6287
199 Ga0209129_1028176 3300025258 Bacteria 957
200 Ga0209233_1000087 3300025261 Bacteria 325225
201 Ga0209233_1000209 3300025261 Bacteria 115124
202 Ga0209233_1004639 3300025261 Bacteria 4644
203 Ga0209565_1032250 3300025263 Bacteria 1014
204 Ga0209455_1000137 3300025272 Bacteria 142099
205 Ga0209673_1000041 3300025273 Bacteria 307397
206 Ga0209673_1000254 3300025273 Bacteria 101508
207 Ga0209673_1001371 3300025273 Bacteria 23980
208 Ga0209673_1001660 3300025273 Bacteria 19205
209 Ga0209673_1001767 3300025273 Bacteria 17949
210 Ga0209673_1006511 3300025273 Bacteria 5620
211 Ga0209673_1009724 3300025273 Bacteria 4130
212 Ga0209673_1010174 3300025273 Bacteria 3991
213 Ga0209673_1012400 3300025273 Bacteria 3435
214 Ga0209673_1031104 3300025273 Bacteria 1668
215 Ga0209130_1000006 3300025284 Bacteria 596528
216 Ga0209130_1000007 3300025284 Bacteria 591584
217 Ga0209130_1025430 3300025284 Bacteria 1282
218 Ga0209676_1009408 3300025292 Bacteria 4219
219 Ga0209025_1000087 3300025294 Bacteria 261181
220 Ga0209025_1000100 3300025294 Bacteria 229182
221 Ga0209025_1000149 3300025294 Bacteria 173393
222 Ga0209025_1000284 3300025294 Bacteria 114754
223 Ga0209025_1001310 3300025294 Bacteria 33978
224 Ga0209025_1007344 3300025294 Bacteria 8246
225 Ga0209025_1015697 3300025294 Bacteria 4540
226 Ga0209025_1020918 3300025294 Bacteria 3549
227 Ga0209025_1053139 3300025294 Bacteria 1593
228 Ga0209564_1000233 3300025295 Bacteria 121692
229 Ga0209564_1000425 3300025295 Bacteria 74279
230 Ga0209564_1000439 3300025295 Bacteria 71637
231 Ga0209564_1001684 3300025295 Bacteria 21000
232 Ga0209564_1002798 3300025295 Bacteria 13010
233 Ga0209564_1015377 3300025295 Bacteria 3117
234 Ga0209564_1019775 3300025295 Bacteria 2501
235 Ga0209758_1000081 3300025297 Bacteria 261181
236 Ga0209758_1000737 3300025297 Bacteria 47765
237 Ga0209758_1002088 3300025297 Bacteria 21248
238 Ga0209758_1002164 3300025297 Bacteria 20648
239 Ga0209758_1002288 3300025297 Bacteria 19817
240 Ga0209758_1003671 3300025297 Bacteria 13657
241 Ga0209758_1016828 3300025297 Bacteria 3687
242 Ga0209050_1001222 3300025298 Bacteria 29857
243 Ga0209256_1001044 3300025299 Bacteria 32321
244 Ga0209256_1002554 3300025299 Bacteria 14564
245 Ga0209256_1002658 3300025299 Bacteria 14031
246 Ga0209256_1002838 3300025299 Bacteria 13211
247 Ga0209256_1002860 3300025299 Bacteria 13140
248 Ga0209256_1007676 3300025299 Bacteria 5241
249 Ga0209256_1008783 3300025299 Bacteria 4595
250 Ga0209256_1011782 3300025299 Bacteria 3446
251 Ga0209256_1018967 3300025299 Bacteria 2210
252 Ga0207426_1000064 3300025302 Bacteria 358276
253 Ga0207426_1000106 3300025302 Bacteria 244368
254 Ga0207426_1000265 3300025302 Bacteria 110545
255 Ga0207426_1000652 3300025302 Bacteria 42638
256 Ga0209051_1000514 3300025303 Bacteria 48877
257 Ga0209051_1006315 3300025303 Bacteria 6714
258 Ga0209051_1009158 3300025303 Bacteria 5136
259 Ga0209051_1010723 3300025303 Bacteria 4590
260 Ga0209051_1012051 3300025303 Bacteria 4213
261 Ga0209051_1035661 3300025303 Bacteria 1846
262 Ga0209257_1001514 3300025304 Bacteria 27239
263 Ga0209257_1003433 3300025304 Bacteria 13603
264 Ga0209257_1007276 3300025304 Bacteria 6752
265 Ga0207647_10136275 3300025904 Bacteria 1441
266 Ga0207645_10381329 3300025907 Bacteria 946
267 Ga0207705_10494451 3300025909 Bacteria 950
268 Ga0207705_10507774 3300025909 Bacteria 936
269 Ga0207654_10195106 3300025911 Bacteria 1330
270 Ga0207695_10000024 3300025913 Bacteria 632311
271 Ga0207695_10204177 3300025913 Bacteria 1889
272 Ga0207695_10893348 3300025913 Bacteria 768
273 Ga0207671_10000548 3300025914 Bacteria 50646
274 Ga0207671_10278982 3300025914 Bacteria 1318
275 Ga0207671_10442674 3300025914 Bacteria 1035
276 Ga0207657_10314739 3300025919 Bacteria 1238
277 Ga0207649_10264276 3300025920 Bacteria 1245
278 Ga0207694_10422646 3300025924 Bacteria 1110
279 Ga0207650_10081813 3300025925 Bacteria 2450
280 Ga0207650_10533838 3300025925 Bacteria 983
281 Ga0207709_10153168 3300025935 Bacteria 1599
282 Ga0207691_10654793 3300025940 Bacteria 887
283 Ga0207711_10184523 3300025941 Bacteria 1899
284 Ga0207711_10668304 3300025941 Bacteria 969
285 Ga0207711_11106698 3300025941 Bacteria 733
286 Ga0207667_10592290 3300025949 Bacteria 1119
287 Ga0207667_11073160 3300025949 Bacteria 790
288 Ga0207712_10870052 3300025961 Bacteria 795
289 Ga0207668_10127330 3300025972 Bacteria 1939
290 Ga0207658_10817774 3300025986 Bacteria 846
291 Ga0207639_10483918 3300026041 Bacteria 1128
292 Ga0207678_10292975 3300026067 Bacteria 1398
293 Ga0207678_10395227 3300026067 Bacteria 1196
294 Ga0207678_10624394 3300026067 Bacteria 946
295 Ga0207678_10698046 3300026067 Bacteria 893
296 Ga0207702_10339629 3300026078 Bacteria 1434
297 Ga0207648_10048598 3300026089 Bacteria 3713
298 Ga0207676_10908409 3300026095 Bacteria 864
299 Ga0207674_10620286 3300026116 Bacteria 1044
300 Ga0207674_11228247 3300026116 Bacteria 719
301 Ga0207698_10071975 3300026142 Bacteria 2746
302 Ga0207698_11460869 3300026142 Bacteria 699
303 Ga0207698_11920988 3300026142 Bacteria 607
304 Ga0209281_1000266 3300027111 Bacteria 100574
305 Ga0209281_1000332 3300027111 Bacteria 81534
306 Ga0209371_1006525 3300027312 Bacteria 4299
307 Ga0209282_1000007 3300027666 Bacteria 254917
308 Ga0209813_10096417 3300027866 Bacteria 1000
309 Ga0209813_10098778 3300027866 Bacteria 991
310 Ga0268266_10197576 3300028379 Bacteria 1839
311 Ga0307517_10189616 3300028786 Bacteria 1308
312 Ga0307515_10005751 3300028794 Bacteria 25053
313 Ga0307515_10035625 3300028794 Bacteria 8086
314 Ga0307515_10584617 3300028794 Bacteria 727
315 Ga0265340_10000501 3300031247 Bacteria 21465
316 Ga0265339_10003493 3300031249 Bacteria 10989
317 Ga0265331_10124673 3300031250 Bacteria 1177
318 Ga0265316_10005614 3300031344 Bacteria 12140
319 Ga0307513_10007830 3300031456 Bacteria 13779
320 Ga0307513_10519529 3300031456 Bacteria 906
321 Ga0307408_100222233 3300031548 Bacteria 1542
322 Ga0307408_101963377 3300031548 Bacteria 562
323 Ga0265313_10001319 3300031595 Bacteria 23394
324 Ga0265342_10004425 3300031712 Bacteria 11079
325 Ga0307405_10156070 3300031731 Bacteria 1611
326 Ga0307410_11417569 3300031852 Bacteria 610
327 Ga0307406_10180703 3300031901 Bacteria 1535
328 Ga0307412_10007614 3300031911 Bacteria 6148
329 Ga0307412_10226708 3300031911 Bacteria 1436
330 Ga0315914_1000006 3300031967 Bacteria 239817
331 Ga0307414_10836656 3300032004 Bacteria 841
332 Ga0307411_11734411 3300032005 Bacteria 579
333 Ga0307415_100732409 3300032126 Bacteria 896
334 Ga0315913_1000002 3300033430 Bacteria 241452
335 Ga0315915_1000001 3300033464 Bacteria 481518
336 Ga0395899_0606124 3300037312 Bacteria 697
337 Ga0395900_0137569 3300037418 Bacteria 2502
338 Ga0395900_1214023 3300037418 Bacteria 669
339 Ga0395900_1770937 3300037418 Bacteria 528
340 Ga0395905_0071155 3300037471 Bacteria 3261
341 Ga0395905_0152536 3300037471 Bacteria 2173
342 Ga0395905_1037070 3300037471 Bacteria 723
343 Ga0395901_0085966 3300038443 Bacteria 3288
344 Ga0395901_0310835 3300038443 Bacteria 1632
345 Ga0395901_0360412 3300038443 Bacteria 1499
346 Ga0439465_0159451 3300041413 Bacteria 809
347 Ga0451800_0535748 3300041459 Bacteria 749
348 Ga0451807_1582717 3300041486 Bacteria 841
349 Ga0451845_0248020 3300041501 Bacteria 609
350 Ga0439449_0024873 3300042007 Bacteria 2239
351 Ga0439458_0065109 3300042157 Bacteria 915
352 Ga0466972_0017014 3300044658 Bacteria 3637
353 Ga0466972_0053763 3300044658 Bacteria 1939
354 Ga0466965_0507163 3300044683 Bacteria 677
355 Ga0466968_0133356 3300044735 Bacteria 1132
356 Ga0495638_0000353 3300046460 Bacteria 57451
357 Ga0495650_0029385 3300046471 Bacteria 2506
358 Ga0495650_0067074 3300046471 Bacteria 1419
359 Ga0495605_0007427 3300046474 Bacteria 6219
360 Ga0495584_0379935 3300046491 Bacteria 718
361 Ga0495585_0006433 3300046492 Bacteria 7289
362 Ga0495607_0026537 3300046501 Bacteria 3593
363 Ga0495583_0008191 3300046506 Bacteria 6423
364 Ga0495583_0052157 3300046506 Bacteria 1862
365 Ga0495583_0246509 3300046506 Bacteria 717
366 Ga0495606_0010611 3300046507 Bacteria 7624
367 Ga0495606_0053589 3300046507 Bacteria 2617
368 Ga0495606_0266217 3300046507 Bacteria 943
369 Ga0495606_0361752 3300046507 Bacteria 767
370 Ga0495610_0002493 3300046512 Bacteria 15389
371 Ga0495610_0041836 3300046512 Bacteria 2296
372 Ga0495620_0031635 3300046515 Bacteria 2422
373 Ga0495631_0027247 3300046518 Bacteria 2617
374 Ga0495631_0051597 3300046518 Bacteria 1797
375 Ga0495632_0007287 3300046519 Bacteria 6973
376 Ga0495632_0048475 3300046519 Bacteria 2103
377 Ga0495632_0077562 3300046519 Bacteria 1588
378 Ga0495643_0032728 3300046522 Bacteria 2883
379 Ga0495643_0048443 3300046522 Bacteria 2297
380 Ga0495643_0073423 3300046522 Bacteria 1792
381 Ga0495648_0054864 3300046524 Bacteria 2405
382 Ga0495654_0170477 3300046530 Bacteria 949
383 Ga0495609_0263297 3300046538 Bacteria 708
384 Ga0495597_0020027 3300046542 Bacteria 3122
385 Ga0495668_0012552 3300046616 Bacteria 5023
386 Ga0495668_0017902 3300046616 Bacteria 4104
387 Ga0495668_0208060 3300046616 Bacteria 1071
388 Ga0495668_0376928 3300046616 Bacteria 779
389 Ga0495611_0017639 3300046648 Bacteria 3056
390 Ga0495625_0001623 3300046660 Bacteria 26508
391 Ga0495625_0012480 3300046660 Bacteria 6882
392 Ga0495625_0495380 3300046660 Bacteria 748
393 Ga0495661_0319278 3300046665 Bacteria 772
394 Ga0495670_0251093 3300046691 Bacteria 943
395 Ga0495649_0037909 3300046694 Bacteria 2645
396 Ga0495649_0138817 3300046694 Bacteria 1280
397 Ga0495660_0033898 3300046810 Bacteria 2860
398 Ga0495660_0043125 3300046810 Bacteria 2489
399 Ga0495660_0096574 3300046810 Bacteria 1527
400 Ga0495636_0053564 3300047318 Bacteria 1694
401 Ga0495636_0054551 3300047318 Bacteria 1680
402 Ga0495672_0011740 3300047320 Bacteria 6160
403 Ga0495683_0272747 3300047323 Bacteria 735
404 Ga0495687_040495 3300047443 Bacteria 2052
405 Ga0495687_107672 3300047443 Bacteria 1032
406 Ga0495686_0010459 3300047472 Bacteria 6597
407 Ga0495686_0011085 3300047472 Bacteria 6373
408 Ga0495686_0061215 3300047472 Bacteria 2338
409 Ga0495686_0071177 3300047472 Bacteria 2141
410 Ga0495686_0249930 3300047472 Bacteria 997
411 Ga0495686_0269012 3300047472 Bacteria 951
412 Ga0495686_0332664 3300047472 Bacteria 830
413 Ga0495686_0365231 3300047472 Bacteria 782
414 Ga0495626_0228138 3300048091 Bacteria 754
415 Ga0496101_0459728 3300048904 Bacteria 1004
416 Ga0496101_0485489 3300048904 Bacteria 976
417 Ga0496102_0375020 3300048905 Bacteria 1339
418 Ga0496103_0279087 3300048906 Bacteria 1075
419 Ga0496105_0263058 3300048908 Bacteria 1395
420 Ga0496106_0018110 3300048909 Bacteria 5208
421 Ga0496108_1210510 3300048911 Bacteria 638
422 Ga0496109_0430614 3300048912 Bacteria 1246
423 Ga0496112_0154436 3300048915 Bacteria 2262
424 Ga0496112_0240994 3300048915 Bacteria 1761
425 Ga0496115_0052156 3300048918 Bacteria 3281
426 Ga0496115_1086062 3300048918 Bacteria 607
427 Ga0496116_0007220 3300048919 Bacteria 9912
428 Ga0496116_0009103 3300048919 Bacteria 8512
429 Ga0496116_0015251 3300048919 Bacteria 6082
430 Ga0496116_0018933 3300048919 Bacteria 5287
431 Ga0496116_0051522 3300048919 Bacteria 2734
432 Ga0496116_0115594 3300048919 Bacteria 1565
433 Ga0496117_0003176 3300048920 Bacteria 19539
434 Ga0496117_0026761 3300048920 Bacteria 4506
435 Ga0496117_0061050 3300048920 Bacteria 2593
436 Ga0496117_0066338 3300048920 Bacteria 2449
437 Ga0496117_0241822 3300048920 Bacteria 990
438 Ga0496117_0340261 3300048920 Bacteria 779
439 Ga0496118_0046838 3300048921 Bacteria 3358
440 Ga0496118_0081627 3300048921 Bacteria 2269
441 Ga0496118_0093731 3300048921 Bacteria 2056
442 Ga0496119_0043400 3300048922 Bacteria 2841
443 Ga0496119_0078325 3300048922 Bacteria 1912
444 Ga0496119_0145859 3300048922 Bacteria 1273
445 Ga0496119_0214718 3300048922 Bacteria 988
446 Ga0496119_0252069 3300048922 Bacteria 890
447 Ga0496119_0547788 3300048922 Bacteria 532
448 Ga0496119_0568823 3300048922 Bacteria 519
449 Ga0496120_0000860 3300048923 Bacteria 42971
450 Ga0496121_0008689 3300048924 Bacteria 11858
451 Ga0496121_0010436 3300048924 Bacteria 10479
452 Ga0496121_0016167 3300048924 Bacteria 7725
453 Ga0496121_0017218 3300048924 Bacteria 7400
454 Ga0496121_0210637 3300048924 Bacteria 1377
455 Ga0496121_0220364 3300048924 Bacteria 1337
456 Ga0496121_0340235 3300048924 Bacteria 1003
457 Ga0496122_0000492 3300048925 Bacteria 82125
458 Ga0496122_0010176 3300048925 Bacteria 9745
459 Ga0496122_0032451 3300048925 Bacteria 4318
460 Ga0496122_0046163 3300048925 Bacteria 3377
461 Ga0496122_0152169 3300048925 Bacteria 1426
462 Ga0496123_0000460 3300048926 Bacteria 71476
463 Ga0496123_0008658 3300048926 Bacteria 9300
464 Ga0496123_0030918 3300048926 Bacteria 3909
465 Ga0496123_0055898 3300048926 Bacteria 2585
466 Ga0496123_0077128 3300048926 Bacteria 2048
467 Ga0496124_0000679 3300048927 Bacteria 55901
468 Ga0496124_0008621 3300048927 Bacteria 10629
469 Ga0496124_0023070 3300048927 Bacteria 5692
470 Ga0496124_0035244 3300048927 Bacteria 4380
471 Ga0496124_0274342 3300048927 Bacteria 1233
472 Ga0496124_0351007 3300048927 Bacteria 1043
473 Ga0496124_0353882 3300048927 Bacteria 1038
474 Ga0496124_0386900 3300048927 Bacteria 976
475 Ga0496124_0505504 3300048927 Bacteria 809
476 Ga0496125_0000912 3300048928 Bacteria 46601
477 Ga0496125_0005687 3300048928 Bacteria 13749
478 Ga0496125_0067235 3300048928 Bacteria 2825
479 Ga0496125_0193125 3300048928 Bacteria 1342
480 Ga0496125_0313219 3300048928 Bacteria 955
481 Ga0496125_0529709 3300048928 Bacteria 657
482 Ga0496126_0000811 3300048929 Bacteria 55747
483 Ga0496126_0042355 3300048929 Bacteria 4206
484 Ga0496126_0058039 3300048929 Bacteria 3490
485 Ga0496126_0063975 3300048929 Bacteria 3296
486 Ga0496126_0064123 3300048929 Bacteria 3292
487 Ga0496126_0556629 3300048929 Bacteria 909
488 Ga0496126_0577823 3300048929 Bacteria 888
489 Ga0495678_042285 3300049459 Bacteria 1817
490 Ga0495678_084516 3300049459 Bacteria 1132
491 Ga0501031_0264111 3300049568 Bacteria 1118
492 Ga0501033_0160706 3300049570 Bacteria 1617
493 Ga0501034_0094492 3300049571 Bacteria 2986
494 Ga0501034_0198137 3300049571 Bacteria 1967
495 Ga0501034_0259846 3300049571 Bacteria 1679
496 Ga0501034_0295098 3300049571 Bacteria 1558
497 Ga0501034_0345362 3300049571 Bacteria 1417
498 Ga0501034_1710748 3300049571 Bacteria 501
499 Ga0501036_0078466 3300049572 Bacteria 2793
500 Ga0501036_0456669 3300049572 Bacteria 1064
501 Ga0501037_0133340 3300049573 Bacteria 1780
502 Ga0501038_0099928 3300049574 Bacteria 2418
503 Ga0501038_0296287 3300049574 Bacteria 1270
504 Ga0501043_0065320 3300049579 Bacteria 2857
505 Ga0501046_0369144 3300049580 Bacteria 1040
506 Ga0501046_0622939 3300049580 Bacteria 764
507 Ga0501047_0065217 3300049581 Bacteria 3510
508 Ga0501047_0111102 3300049581 Bacteria 2623
509 Ga0501047_0197521 3300049581 Bacteria 1873
510 Ga0501047_0900762 3300049581 Bacteria 698
511 Ga0501047_0979782 3300049581 Bacteria 659
512 Ga0501067_0023007 3300049583 Bacteria 3451
513 Ga0501068_0292612 3300049584 Bacteria 1042
514 Ga0501069_0214667 3300049585 Bacteria 1117
515 Ga0501070_0869177 3300049586 Bacteria 705
516 Ga0501070_0910576 3300049586 Bacteria 686
517 Ga0501070_0922812 3300049586 Bacteria 680
518 Ga0501072_0640867 3300049588 Bacteria 837
519 Ga0501073_0079190 3300049589 Bacteria 2287
520 Ga0501073_0200642 3300049589 Bacteria 1379
521 Ga0501073_0339623 3300049589 Bacteria 1037
522 Ga0501074_0012831 3300049590 Bacteria 6092
523 Ga0501076_0773633 3300049592 Bacteria 792
524 Ga0501076_1730454 3300049592 Bacteria 513
525 Ga0501080_0181495 3300049742 Bacteria 1936
526 Ga0501083_0009805 3300049744 Bacteria 6761
527 Ga0501083_0039640 3300049744 Bacteria 3198
528 Ga0501035_0057961 3300049822 Bacteria 3452
529 Ga0501035_0132077 3300049822 Bacteria 2176
530 Ga0501044_0167742 3300049823 Bacteria 2169
531 Ga0501044_0237335 3300049823 Bacteria 1768
532 Ga0501044_0481942 3300049823 Bacteria 1143
533 nmdc:mga03683_11535_c1 3300050489 Bacteria 3202
534 nmdc:mga03683_22372_c1 3300050489 Bacteria 2450
535 nmdc:mga03683_47539_c1 3300050489 Bacteria 1781
536 nmdc:mga03n38_124021_c1 3300050490 Bacteria 1273
537 nmdc:mga03n38_35795_c1 3300050490 Bacteria 2130
538 nmdc:mga03n38_631065_c1 3300050490 Bacteria 613
539 nmdc:mga03n38_87203_c1 3300050490 Bacteria 1479
540 nmdc:mga00v17_117063_c1 3300050491 Bacteria 1694
541 nmdc:mga00v17_202522_c1 3300050491 Bacteria 1283
542 nmdc:mga00v17_569844_c1 3300050491 Bacteria 731
543 nmdc:mga00v17_9680_c1 3300050491 Bacteria 5228
544 nmdc:mga0yw44_12368_c1 3300050492 Bacteria 4446
545 nmdc:mga0yw44_132598_c1 3300050492 Bacteria 1614
546 nmdc:mga0yw44_319901_c1 3300050492 Bacteria 1042
547 nmdc:mga0yw44_474748_c1 3300050492 Bacteria 848
548 nmdc:mga0k408_379304_c1 3300050493 Bacteria 842
549 nmdc:mga0k408_575918_c1 3300050493 Bacteria 665
550 nmdc:mga06z11_14207_c1 3300050494 Bacteria 3521
551 nmdc:mga06z11_145082_c1 3300050494 Bacteria 1345
552 nmdc:mga06z11_20079_c1 3300050494 Bacteria 3083
553 nmdc:mga04h51_115056_c1 3300050495 Bacteria 996
554 nmdc:mga04h51_246638_c1 3300050495 Bacteria 715
555 nmdc:mga07m45_106669_c1 3300050496 Bacteria 1612
556 nmdc:mga07m45_13864_c1 3300050496 Bacteria 4283
557 nmdc:mga07m45_329980_c1 3300050496 Bacteria 887
558 nmdc:mga0sz30_121118_c1 3300050516 Bacteria 1150
559 nmdc:mga0sz30_169813_c1 3300050516 Bacteria 967
560 nmdc:mga0sz30_31522_c1 3300050516 Bacteria 2194
561 Ga0500610_0064332 3300053079 Bacteria 1913
562 Ga0500610_0167408 3300053079 Bacteria 1088
563 Ga0495655_0112839 3300053083 Bacteria 819
564 Ga0500578_0373652 3300053086 Bacteria 828
565 Ga0500644_0170197 3300053088 Bacteria 886
566 Ga0500557_014653 3300053105 Bacteria 2098
567 Ga0500569_007004 3300053109 Bacteria 2507
568 Ga0500569_030321 3300053109 Bacteria 1512
569 Ga0500594_0081562 3300053118 Bacteria 968
570 Ga0500595_060013 3300053119 Bacteria 1152
571 Ga0500608_257868 3300053122 Bacteria 675
572 Ga0500658_0006268 3300053134 Bacteria 4422
573 Ga0500658_0339962 3300053134 Bacteria 689
574 Ga0500658_0475661 3300053134 Bacteria 567
575 Ga0500568_0000108 3300053139 Bacteria 77013
576 Ga0500568_0006791 3300053139 Bacteria 5703
577 Ga0500568_0008893 3300053139 Bacteria 4804
578 Ga0500577_0142941 3300053142 Bacteria 1010
579 Ga0500588_0033680 3300053146 Bacteria 1496
580 Ga0500604_0041599 3300053151 Bacteria 1390
581 Ga0500604_0049242 3300053151 Bacteria 1295
582 Ga0500616_0006373 3300053153 Bacteria 7739
583 Ga0500616_0094806 3300053153 Bacteria 1469
584 Ga0500622_0002169 3300053156 Bacteria 14541
585 Ga0500627_0083951 3300053158 Bacteria 1421
586 Ga0500611_005807 3300053727 Bacteria 1759
587 Ga0500611_111195 3300053727 Bacteria 720
588 Ga0500645_153143 3300053730 Bacteria 634
589 Ga0501084_0201222 3300054114 Bacteria 1680
590 Ga0501084_0323491 3300054114 Bacteria 1302
591 Ga0501082_0208207 3300060353 Bacteria 1701
592 Ga0501082_0950758 3300060353 Bacteria 751

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049580 Ga0501046_0622939 Ga0501046_0622939_368_739 120
2 3300049585 Ga0501069_0214667 Ga0501069_0214667_352_723 120
3 3300049586 Ga0501070_0922812 Ga0501070_0922812_49_420 120
4 3300049823 Ga0501044_0167742 Ga0501044_0167742_1161_1532 120
5 3300049571 Ga0501034_0259846 Ga0501034_0259846_39_416 122
6 3300049571 Ga0501034_0295098 Ga0501034_0295098_759_1136 122
7 3300049571 Ga0501034_1710748 Ga0501034_1710748_42_419 122
8 3300049574 Ga0501038_0296287 Ga0501038_0296287_553_930 122
9 3300049586 Ga0501070_0869177 Ga0501070_0869177_199_576 122
10 3300049589 Ga0501073_0339623 Ga0501073_0339623_633_1010 122
11 3300060353 Ga0501082_0950758 Ga0501082_0950758_330_713 122
12 3300049581 Ga0501047_0979782 Ga0501047_0979782_89_469 123
13 iso_pu_bacteria 2534681796 2535515701 135
14 3300049581 Ga0501047_0197521 Ga0501047_0197521_228_650 137
15 3300049588 Ga0501072_0640867 Ga0501072_0640867_33_455 137
16 3300049592 Ga0501076_0773633 Ga0501076_0773633_35_457 137
17 3300049744 Ga0501083_0039640 Ga0501083_0039640_1961_2383 137
18 3300054114 Ga0501084_0201222 Ga0501084_0201222_439_861 137
19 3300028794 Ga0307515_10005751 Ga0307515_1000575110 139
20 iso_pu_bacteria 2922178524 2922184670 143
21 3300037418 Ga0395900_1770937 Ga0395900_1770937_15_449 144
22 3300042007 Ga0439449_0024873 Ga0439449_0024873_1000_1434 144
23 3300046507 Ga0495606_0361752 Ga0495606_0361752_28_462 144
24 3300048904 Ga0496101_0485489 Ga0496101_0485489_509_943 144
25 3300048922 Ga0496119_0252069 Ga0496119_0252069_402_836 144
26 3300048922 Ga0496119_0547788 Ga0496119_0547788_35_469 144
27 3300048927 Ga0496124_0351007 Ga0496124_0351007_116_550 144
28 3300048928 Ga0496125_0529709 Ga0496125_0529709_194_628 144
29 3300053086 Ga0500578_0373652 Ga0500578_0373652_37_471 144
30 3300053151 Ga0500604_0049242 Ga0500604_0049242_20_454 144
31 3300053153 Ga0500616_0006373 Ga0500616_0006373_16_450 144
32 3300006051 Ga0075364_10182629 Ga0075364_101826292 145
33 3300006177 Ga0075362_10017051 Ga0075362_100170513 145
34 3300050489 nmdc:mga03683_11535_c1 nmdc:mga03683_11535_c1_1221_1700 145
35 3300050491 nmdc:mga00v17_117063_c1 nmdc:mga00v17_117063_c1_711_1163 145
36 iso_pu_bacteria 2775507049 2776912753 145
37 iso_pu_bacteria 2995392953 2995393815 148
38 iso_pu_bacteria 8005658619 8005659997 148
39 3300049589 Ga0501073_0079190 Ga0501073_0079190_1749_2213 149
40 iso_pu_bacteria 8018150411 8018150821 149
41 3300049571 Ga0501034_0198137 Ga0501034_0198137_1161_1622 150
42 3300049581 Ga0501047_0065217 Ga0501047_0065217_2398_2859 150
43 3300049583 Ga0501067_0023007 Ga0501067_0023007_1814_2275 150
44 3300049589 Ga0501073_0200642 Ga0501073_0200642_630_1091 150
45 3300049590 Ga0501074_0012831 Ga0501074_0012831_2704_3165 150
46 3300049744 Ga0501083_0009805 Ga0501083_0009805_4151_4612 150
47 3300054114 Ga0501084_0323491 Ga0501084_0323491_270_731 150
48 3300060353 Ga0501082_0208207 Ga0501082_0208207_1185_1646 150
49 iso_pu_bacteria 2558860983 2561466041 150
50 iso_pu_bacteria 2643221653 2644296853 150
51 iso_pu_bacteria 2643221719 2644655107 150
52 iso_pu_bacteria 2989776772 2989778159 150
53 iso_pu_bacteria 8005246636 8005251341 150
54 iso_pu_bacteria 8055431914 8055434153 150
55 3300005331 Ga0070670_100002600 Ga0070670_1000026004 152
56 3300025925 Ga0207650_10081813 Ga0207650_100818132 152
57 3300037471 Ga0395905_0152536 Ga0395905_0152536_501_971 152
58 3300047472 Ga0495686_0249930 Ga0495686_0249930_138_605 152
59 3300053122 Ga0500608_257868 Ga0500608_257868_119_592 152
60 3300049581 Ga0501047_0111102 Ga0501047_0111102_505_975 153
61 iso_pu_bacteria 2582581866 2585392696 153
62 iso_pu_bacteria 2738541317 2738946574 153
63 iso_pu_bacteria 2791355253 2793282283 153
64 iso_pu_bacteria 2899803654 2899803757 153
65 iso_pu_bacteria 2913308742 2913310991 153
66 iso_pu_bacteria 2989349275 2989354192 153
67 3300053139 Ga0500568_0000108 Ga0500568_0000108_38265_38738 154
68 iso_pu_bacteria 2503198000 2503203346 154
69 iso_pu_bacteria 2508501122 2509108503 154
70 iso_pu_bacteria 2508501123 2509116108 154
71 iso_pu_bacteria 2508501127 2509141512 154
72 iso_pu_bacteria 2509276018 2509370077 154
73 iso_pu_bacteria 2509276019 2509374471 154
74 iso_pu_bacteria 2509276021 2509387733 154
75 iso_pu_bacteria 2509276022 2509397775 154
76 iso_pu_bacteria 2509276033 2509443091 154
77 iso_pu_bacteria 2510065019 2510132283 154
78 iso_pu_bacteria 2510065059 2510319032 154
79 iso_pu_bacteria 2510461076 2510898622 154
80 iso_pu_bacteria 2510917022 2511133508 154
81 iso_pu_bacteria 2510917028 2511186342 154
82 iso_pu_bacteria 2510917030 2511197239 154
83 iso_pu_bacteria 2512875016 2512929769 154
84 iso_pu_bacteria 2512875024 2512964540 154
85 iso_pu_bacteria 2513237084 2513569120 154
86 iso_pu_bacteria 2513237085 2513578789 154
87 iso_pu_bacteria 2513237086 2513583460 154
88 iso_pu_bacteria 2513237088 2513596232 154
89 iso_pu_bacteria 2513237090 2513608416 154
90 iso_pu_bacteria 2513237093 2513632771 154
91 iso_pu_bacteria 2513237103 2513709222 154
92 iso_pu_bacteria 2513237138 2513868752 154
93 iso_pu_bacteria 2513237146 2513925691 154
94 iso_pu_bacteria 2513237162 2514020768 154
95 iso_pu_bacteria 2513237164 2514033345 154
96 iso_pu_bacteria 2515075009 2515111267 154
97 iso_pu_bacteria 2515154107 2515608112 154
98 iso_pu_bacteria 2515154113 2515637852 154
99 iso_pu_bacteria 2515154114 2515642598 154
100 iso_pu_bacteria 2515154116 2515659207 154
101 iso_pu_bacteria 2515154134 2515740446 154
102 iso_pu_bacteria 2516653077 2517039909 154
103 iso_pu_bacteria 2516653085 2517075451 154
104 iso_pu_bacteria 2517093000 2517094040 154
105 iso_pu_bacteria 2517287029 2517405858 154
106 iso_pu_bacteria 2519899620 2520378746 154
107 iso_pu_bacteria 2524023207 2524451150 154
108 iso_pu_bacteria 2524023209 2524460668 154
109 iso_pu_bacteria 2529292951 2530643910 154
110 iso_pu_bacteria 2551306084 2551676461 154
111 iso_pu_bacteria 2551306085 2551687182 154
112 iso_pu_bacteria 2551306087 2551702979 154
113 iso_pu_bacteria 2551306090 2551720643 154
114 iso_pu_bacteria 2551306093 2551739533 154
115 iso_pu_bacteria 2558860100 2558863498 154
116 iso_pu_bacteria 2582581294 2585203061 154
117 iso_pu_bacteria 2582581298 2585220978 154
118 iso_pu_bacteria 2582581299 2585231512 154
119 iso_pu_bacteria 2582581304 2585256632 154
120 iso_pu_bacteria 2582581307 2585273278 154
121 iso_pu_bacteria 2582581308 2585278889 154
122 iso_pu_bacteria 2582581315 2585325498 154
123 iso_pu_bacteria 2582581316 2585329653 154
124 iso_pu_bacteria 2582581867 2585400142 154
125 iso_pu_bacteria 2585427526 2585527947 154
126 iso_pu_bacteria 2585427527 2585530686 154
127 iso_pu_bacteria 2585427528 2585541449 154
128 iso_pu_bacteria 2585427529 2585549922 154
129 iso_pu_bacteria 2585427530 2585554866 154
130 iso_pu_bacteria 2585427531 2585559422 154
131 iso_pu_bacteria 2585427590 2585822701 154
132 iso_pu_bacteria 2585427593 2585839418 154
133 iso_pu_bacteria 2585427594 2585847235 154
134 iso_pu_bacteria 2585427608 2585902092 154
135 iso_pu_bacteria 2585427609 2585905202 154
136 iso_pu_bacteria 2585428125 2587979683 154
137 iso_pu_bacteria 2597489875 2597815053 154
138 iso_pu_bacteria 2599185170 2599418607 154
139 iso_pu_bacteria 2599185301 2599940368 154
140 iso_pu_bacteria 2599185352 2600191916 154
141 iso_pu_bacteria 2615840624 2616296229 154
142 iso_pu_bacteria 2615840626 2616305838 154
143 iso_pu_bacteria 2643221557 2643807219 154
144 iso_pu_bacteria 2643221595 2643985385 154
145 iso_pu_bacteria 2643221599 2644007907 154
146 iso_pu_bacteria 2643221610 2644069515 154
147 iso_pu_bacteria 2643221618 2644109009 154
148 iso_pu_bacteria 2643221623 2644132889 154
149 iso_pu_bacteria 2643221626 2644151531 154
150 iso_pu_bacteria 2643221627 2644152081 154
151 iso_pu_bacteria 2643221634 2644196497 154
152 iso_pu_bacteria 2643221637 2644206223 154
153 iso_pu_bacteria 2643221643 2644242868 154
154 iso_pu_bacteria 2643221655 2644311665 154
155 iso_pu_bacteria 2643221659 2644329923 154
156 iso_pu_bacteria 2643221668 2644380601 154
157 iso_pu_bacteria 2643221675 2644420669 154
158 iso_pu_bacteria 2643221680 2644454194 154
159 iso_pu_bacteria 2643221688 2644493417 154
160 iso_pu_bacteria 2643221698 2644546597 154
161 iso_pu_bacteria 2643221712 2644617464 154
162 iso_pu_bacteria 2643221718 2644649870 154
163 iso_pu_bacteria 2643221723 2644675668 154
164 iso_pu_bacteria 2643221726 2644689531 154
165 iso_pu_bacteria 2657244999 2657683276 154
166 iso_pu_bacteria 2687453392 2688600182 154
167 iso_pu_bacteria 2690316117 2692316840 154
168 iso_pu_bacteria 2718217882 2719180274 154
169 iso_pu_bacteria 2718217927 2719384843 154
170 iso_pu_bacteria 2718217997 2719664600 154
171 iso_pu_bacteria 2718218009 2719731023 154
172 iso_pu_bacteria 2718218199 2720491020 154
173 iso_pu_bacteria 2718218232 2720612382 154
174 iso_pu_bacteria 2718218233 2720619220 154
175 iso_pu_bacteria 2718218235 2720630622 154
176 iso_pu_bacteria 2718218269 2720774315 154
177 iso_pu_bacteria 2718218363 2721146368 154
178 iso_pu_bacteria 2718218365 2721157889 154
179 iso_pu_bacteria 2718218366 2721163247 154
180 iso_pu_bacteria 2718218423 2721398562 154
181 iso_pu_bacteria 2721755514 2722839417 154
182 iso_pu_bacteria 2721755556 2723026042 154
183 iso_pu_bacteria 2721755684 2723559586 154
184 iso_pu_bacteria 2721755685 2723566203 154
185 iso_pu_bacteria 2721755809 2724037375 154
186 iso_pu_bacteria 2721755810 2724043779 154
187 iso_pu_bacteria 2721755819 2724088922 154
188 iso_pu_bacteria 2721755822 2724103468 154
189 iso_pu_bacteria 2721755823 2724109313 154
190 iso_pu_bacteria 2724679232 2725948471 154
191 iso_pu_bacteria 2728369352 2730106978 154
192 iso_pu_bacteria 2728369365 2730163511 154
193 iso_pu_bacteria 2728369397 2730297521 154
194 iso_pu_bacteria 2738541293 2738802145 154
195 iso_pu_bacteria 2738541333 2739035879 154
196 iso_pu_bacteria 2738543024 2739306485 154
197 iso_pu_bacteria 2751185821 2753460794 154
198 iso_pu_bacteria 2756170246 2756673256 154
199 iso_pu_bacteria 2765235942 2766067620 154
200 iso_pu_bacteria 2775507266 2778177444 154
201 iso_pu_bacteria 2791355082 2792584151 154
202 iso_pu_bacteria 2791355091 2792622698 154
203 iso_pu_bacteria 2791355092 2792628381 154
204 iso_pu_bacteria 2791355094 2792638357 154
205 iso_pu_bacteria 2791355259 2793317507 154
206 iso_pu_bacteria 2791355260 2793321116 154
207 iso_pu_bacteria 2791355261 2793327149 154
208 iso_pu_bacteria 2791355262 2793333599 154
209 iso_pu_bacteria 2791355263 2793339816 154
210 iso_pu_bacteria 2791355264 2793347915 154
211 iso_pu_bacteria 2791355265 2793353557 154
212 iso_pu_bacteria 2791355266 2793358900 154
213 iso_pu_bacteria 2791355267 2793367832 154
214 iso_pu_bacteria 2802429268 2804751335 154
215 iso_pu_bacteria 2802429605 2805926593 154
216 iso_pu_bacteria 2802429606 2805933400 154
217 iso_pu_bacteria 2802429633 2806046942 154
218 iso_pu_bacteria 2802429634 2806052525 154
219 iso_pu_bacteria 2802429635 2806058704 154
220 iso_pu_bacteria 2802429636 2806067528 154
221 iso_pu_bacteria 2802429637 2806073967 154
222 iso_pu_bacteria 2818991453 2819639267 154
223 iso_pu_bacteria 2838016132 2838017271 154
224 iso_pu_bacteria 2838022645 2838023176 154
225 iso_pu_bacteria 2838029111 2838031400 154
226 iso_pu_bacteria 2838035591 2838037700 154
227 iso_pu_bacteria 2838042994 2838048003 154
228 iso_pu_bacteria 2838048938 2838049246 154
229 iso_pu_bacteria 2838061910 2838063308 154
230 iso_pu_bacteria 2838068647 2838074134 154
231 iso_pu_bacteria 2838074704 2838076426 154
232 iso_pu_bacteria 2838668709 2838670831 154
233 iso_pu_bacteria 2838680041 2838681325 154
234 iso_pu_bacteria 2838686498 2838688633 154
235 iso_pu_bacteria 2838694306 2838694640 154
236 iso_pu_bacteria 2838701080 2838703202 154
237 iso_pu_bacteria 2838707686 2838708018 154
238 iso_pu_bacteria 2838729681 2838730928 154
239 iso_pu_bacteria 2838742623 2838744178 154
240 iso_pu_bacteria 2841734538 2841741168 154
241 iso_pu_bacteria 2841851746 2841856859 154
242 iso_pu_bacteria 2841864319 2841865494 154
243 iso_pu_bacteria 2842077413 2842080751 154
244 iso_pu_bacteria 2842110456 2842114959 154
245 iso_pu_bacteria 2842118031 2842121370 154
246 iso_pu_bacteria 2842146304 2842147574 154
247 iso_pu_bacteria 2842156927 2842160029 154
248 iso_pu_bacteria 2842163707 2842168271 154
249 iso_pu_bacteria 2842180545 2842183354 154
250 iso_pu_bacteria 2842192696 2842197934 154
251 iso_pu_bacteria 2842198810 2842199604 154
252 iso_pu_bacteria 2842205361 2842207714 154
253 iso_pu_bacteria 2842217011 2842221186 154
254 iso_pu_bacteria 2842229732 2842235045 154
255 iso_pu_bacteria 2842237096 2842237429 154
256 iso_pu_bacteria 2842243621 2842245642 154
257 iso_pu_bacteria 2842250916 2842252640 154
258 iso_pu_bacteria 2842257432 2842259708 154
259 iso_pu_bacteria 2842264693 2842266945 154
260 iso_pu_bacteria 2842271015 2842274547 154
261 iso_pu_bacteria 2842278818 2842281491 154
262 iso_pu_bacteria 2842285085 2842287134 154
263 iso_pu_bacteria 2842291075 2842294407 154
264 iso_pu_bacteria 2842298080 2842302472 154
265 iso_pu_bacteria 2842304105 2842306791 154
266 iso_pu_bacteria 2842311132 2842314730 154
267 iso_pu_bacteria 2842317721 2842318667 154
268 iso_pu_bacteria 2842341865 2842343614 154
269 iso_pu_bacteria 2842357229 2842360795 154
270 iso_pu_bacteria 2842363717 2842365230 154
271 iso_pu_bacteria 2842370503 2842371788 154
272 iso_pu_bacteria 2842377471 2842380805 154
273 iso_pu_bacteria 2842384541 2842387876 154
274 iso_pu_bacteria 2842395702 2842398285 154
275 iso_pu_bacteria 2842402390 2842404402 154
276 iso_pu_bacteria 2842409023 2842410913 154
277 iso_pu_bacteria 2842415677 2842417631 154
278 iso_pu_bacteria 2842422224 2842427340 154
279 iso_pu_bacteria 2842428310 2842431076 154
280 iso_pu_bacteria 2842434925 2842436926 154
281 iso_pu_bacteria 2842441272 2842443004 154
282 iso_pu_bacteria 2842447887 2842453225 154
283 iso_pu_bacteria 2842462802 2842465015 154
284 iso_pu_bacteria 2842469257 2842471759 154
285 iso_pu_bacteria 2842475841 2842478005 154
286 iso_pu_bacteria 2842489311 2842493741 154
287 iso_pu_bacteria 2842495871 2842497302 154
288 iso_pu_bacteria 2842502639 2842504814 154
289 iso_pu_bacteria 2844002411 2844005716 154
290 iso_pu_bacteria 2844009547 2844015498 154
291 iso_pu_bacteria 2844163670 2844168534 154
292 iso_pu_bacteria 2844454524 2844455150 154
293 iso_pu_bacteria 2847417321 2847418095 154
294 iso_pu_bacteria 2847670302 2847671867 154
295 iso_pu_bacteria 2847686936 2847688094 154
296 iso_pu_bacteria 2848992105 2848993068 154
297 iso_pu_bacteria 2850079185 2850080463 154
298 iso_pu_bacteria 2855872281 2855879206 154
299 iso_pu_bacteria 2856314179 2856318403 154
300 iso_pu_bacteria 2856320880 2856324355 154
301 iso_pu_bacteria 2856342000 2856345499 154
302 iso_pu_bacteria 2856349417 2856354921 154
303 iso_pu_bacteria 2856356410 2856361398 154
304 iso_pu_bacteria 2856364286 2856364685 154
305 iso_pu_bacteria 2857349434 2857355034 154
306 iso_pu_bacteria 2857516855 2857520309 154
307 iso_pu_bacteria 2869162929 2869168800 154
308 iso_pu_bacteria 2869169390 2869172338 154
309 iso_pu_bacteria 2869234852 2869235765 154
310 iso_pu_bacteria 2869242130 2869248417 154
311 iso_pu_bacteria 2869256925 2869257639 154
312 iso_pu_bacteria 2869278585 2869281647 154
313 iso_pu_bacteria 2869285874 2869289867 154
314 iso_pu_bacteria 2871429161 2871431988 154
315 iso_pu_bacteria 2871444079 2871451931 154
316 iso_pu_bacteria 2871451962 2871459315 154
317 iso_pu_bacteria 2871466892 2871472653 154
318 iso_pu_bacteria 2871474448 2871478763 154
319 iso_pu_bacteria 2871481445 2871485740 154
320 iso_pu_bacteria 2871488783 2871493984 154
321 iso_pu_bacteria 2871495908 2871498503 154
322 iso_pu_bacteria 2874102143 2874102151 154
323 iso_pu_bacteria 2874109183 2874110906 154
324 iso_pu_bacteria 2874116593 2874117483 154
325 iso_pu_bacteria 2874123672 2874127617 154
326 iso_pu_bacteria 2874139085 2874140688 154
327 iso_pu_bacteria 2874146452 2874155610 154
328 iso_pu_bacteria 2874155637 2874162467 154
329 iso_pu_bacteria 2874162495 2874165768 154
330 iso_pu_bacteria 2874168670 2874175398 154
331 iso_pu_bacteria 2876363079 2876366668 154
332 iso_pu_bacteria 2876369609 2876373100 154
333 iso_pu_bacteria 2876377896 2876379560 154
334 iso_pu_bacteria 2876386047 2876387374 154
335 iso_pu_bacteria 2876392853 2876399424 154
336 iso_pu_bacteria 2876413966 2876420954 154
337 iso_pu_bacteria 2876420981 2876427385 154
338 iso_pu_bacteria 2878035449 2878037739 154
339 iso_pu_bacteria 2878730984 2878735248 154
340 iso_pu_bacteria 2878738818 2878742470 154
341 iso_pu_bacteria 2878745973 2878748594 154
342 iso_pu_bacteria 2878753008 2878756560 154
343 iso_pu_bacteria 2878760144 2878762722 154
344 iso_pu_bacteria 2878767105 2878769688 154
345 iso_pu_bacteria 2878781027 2878784520 154
346 iso_pu_bacteria 2878788777 2878793140 154
347 iso_pu_bacteria 2881147464 2881153708 154
348 iso_pu_bacteria 2881155292 2881157502 154
349 iso_pu_bacteria 2881161766 2881162865 154
350 iso_pu_bacteria 2881845957 2881849265 154
351 iso_pu_bacteria 2881853255 2881858690 154
352 iso_pu_bacteria 2881861095 2881862420 154
353 iso_pu_bacteria 2882632389 2882634433 154
354 iso_pu_bacteria 2882912400 2882916086 154
355 iso_pu_bacteria 2885305155 2885311642 154
356 iso_pu_bacteria 2885312484 2885316353 154
357 iso_pu_bacteria 2885318864 2885322178 154
358 iso_pu_bacteria 2885326080 2885328237 154
359 iso_pu_bacteria 2885334103 2885338505 154
360 iso_pu_bacteria 2885342637 2885347258 154
361 iso_pu_bacteria 2885350715 2885355254 154
362 iso_pu_bacteria 2888337043 2888341361 154
363 iso_pu_bacteria 2888343758 2888348530 154
364 iso_pu_bacteria 2888350351 2888350690 154
365 iso_pu_bacteria 2889010040 2889013030 154
366 iso_pu_bacteria 2889016732 2889022107 154
367 iso_pu_bacteria 2896384573 2896386627 154
368 iso_pu_bacteria 2903448605 2903452844 154
369 iso_pu_bacteria 2903492973 2903502512 154
370 iso_pu_bacteria 2903492973 2903506216 154
371 iso_pu_bacteria 2903513507 2903518159 154
372 iso_pu_bacteria 2903521522 2903524535 154
373 iso_pu_bacteria 2903528002 2903531222 154
374 iso_pu_bacteria 2903540706 2903543301 154
375 iso_pu_bacteria 2904659560 2904665951 154
376 iso_pu_bacteria 2906308376 2906312156 154
377 iso_pu_bacteria 2906321335 2906323894 154
378 iso_pu_bacteria 2906328253 2906331261 154
379 iso_pu_bacteria 2906354277 2906355443 154
380 iso_pu_bacteria 2906378014 2906382652 154
381 iso_pu_bacteria 2906386501 2906390879 154
382 iso_pu_bacteria 2906401398 2906401405 154
383 iso_pu_bacteria 2906408224 2906412996 154
384 iso_pu_bacteria 2906414383 2906418440 154
385 iso_pu_bacteria 2906427513 2906435623 154
386 iso_pu_bacteria 2913295892 2913297457 154
387 iso_pu_bacteria 2916068649 2916075420 154
388 iso_pu_bacteria 2919100787 2919103814 154
389 iso_pu_bacteria 2920822456 2920823829 154
390 iso_pu_bacteria 2921289301 2921290100 154
391 iso_pu_bacteria 2922130491 2922137284 154
392 iso_pu_bacteria 2922151315 2922156838 154
393 iso_pu_bacteria 2922158528 2922164354 154
394 iso_pu_bacteria 2922172374 2922176924 154
395 iso_pu_bacteria 2922185730 2922190135 154
396 iso_pu_bacteria 2923556063 2923557588 154
397 iso_pu_bacteria 2924165586 2924168121 154
398 iso_pu_bacteria 2924186466 2924189542 154
399 iso_pu_bacteria 2924214083 2924221337 154
400 iso_pu_bacteria 2924718760 2924725776 154
401 iso_pu_bacteria 2924726620 2924729204 154
402 iso_pu_bacteria 2924733363 2924735440 154
403 iso_pu_bacteria 2924741084 2924743794 154
404 iso_pu_bacteria 2924762789 2924764582 154
405 iso_pu_bacteria 2924776078 2924780270 154
406 iso_pu_bacteria 2924784321 2924788147 154
407 iso_pu_bacteria 2933016740 2933023491 154
408 iso_pu_bacteria 2933570622 2933573095 154
409 iso_pu_bacteria 2933586486 2933591358 154
410 iso_pu_bacteria 2933599457 2933604589 154
411 iso_pu_bacteria 2935894831 2935895162 154
412 iso_pu_bacteria 2935901341 2935904155 154
413 iso_pu_bacteria 2936367885 2936368140 154
414 iso_pu_bacteria 2936375103 2936381467 154
415 iso_pu_bacteria 2936381700 2936387404 154
416 iso_pu_bacteria 2937813078 2937818020 154
417 iso_pu_bacteria 2937822353 2937829229 154
418 iso_pu_bacteria 2937836603 2937840782 154
419 iso_pu_bacteria 2937861824 2937868549 154
420 iso_pu_bacteria 2937877337 2937882790 154
421 iso_pu_bacteria 2937891427 2937894211 154
422 iso_pu_bacteria 2937972304 2937973236 154
423 iso_pu_bacteria 2937994558 2937997150 154
424 iso_pu_bacteria 2938014810 2938018707 154
425 iso_pu_bacteria 2941499720 2941500233 154
426 iso_pu_bacteria 2957422303 2957423024 154
427 iso_pu_bacteria 2957505466 2957509622 154
428 iso_pu_bacteria 2958034702 2958037608 154
429 iso_pu_bacteria 2958041894 2958047319 154
430 iso_pu_bacteria 2958041894 2958054906 154
431 iso_pu_bacteria 2958064165 2958065983 154
432 iso_pu_bacteria 2958071322 2958075079 154
433 iso_pu_bacteria 2958084443 2958089915 154
434 iso_pu_bacteria 2958092219 2958093063 154
435 iso_pu_bacteria 2958100919 2958103982 154
436 iso_pu_bacteria 2958108152 2958109620 154
437 iso_pu_bacteria 2958122699 2958122822 154
438 iso_pu_bacteria 2958130278 2958134239 154
439 iso_pu_bacteria 2958137437 2958141324 154
440 iso_pu_bacteria 2958144490 2958150073 154
441 iso_pu_bacteria 2958158011 2958158606 154
442 iso_pu_bacteria 2958165035 2958167620 154
443 iso_pu_bacteria 2958172287 2958179565 154
444 iso_pu_bacteria 2958179912 2958183885 154
445 iso_pu_bacteria 2960645483 2960646157 154
446 iso_pu_bacteria 2961077736 2961081851 154
447 iso_pu_bacteria 2961114664 2961121295 154
448 iso_pu_bacteria 2961127735 2961136104 154
449 iso_pu_bacteria 2961163497 2961166092 154
450 iso_pu_bacteria 2961170736 2961172850 154
451 iso_pu_bacteria 2961183825 2961188958 154
452 iso_pu_bacteria 2963644680 2963649462 154
453 iso_pu_bacteria 2965018300 2965020911 154
454 iso_pu_bacteria 2965032056 2965034745 154
455 iso_pu_bacteria 2965047637 2965050211 154
456 iso_pu_bacteria 2965062239 2965066426 154
457 iso_pu_bacteria 2965089291 2965091563 154
458 iso_pu_bacteria 2965110997 2965117035 154
459 iso_pu_bacteria 2965119406 2965122836 154
460 iso_pu_bacteria 2967996073 2967998060 154
461 iso_pu_bacteria 2968003550 2968008712 154
462 iso_pu_bacteria 2968016561 2968019557 154
463 iso_pu_bacteria 2968083720 2968084625 154
464 iso_pu_bacteria 2968091066 2968092367 154
465 iso_pu_bacteria 2968097103 2968097585 154
466 iso_pu_bacteria 2968110612 2968117447 154
467 iso_pu_bacteria 2968117919 2968118370 154
468 iso_pu_bacteria 2968128360 2968131714 154
469 iso_pu_bacteria 2968138860 2968143195 154
470 iso_pu_bacteria 2968171901 2968174489 154
471 iso_pu_bacteria 2970191845 2970198294 154
472 iso_pu_bacteria 2970469710 2970472878 154
473 iso_pu_bacteria 2970489779 2970493496 154
474 iso_pu_bacteria 2970503327 2970505444 154
475 iso_pu_bacteria 2970510686 2970517770 154
476 iso_pu_bacteria 2970524798 2970529664 154
477 iso_pu_bacteria 2970532167 2970535131 154
478 iso_pu_bacteria 2970540015 2970547185 154
479 iso_pu_bacteria 2970547951 2970554118 154
480 iso_pu_bacteria 2970554993 2970557580 154
481 iso_pu_bacteria 2970593180 2970596250 154
482 iso_pu_bacteria 2970619444 2970625280 154
483 iso_pu_bacteria 2970627176 2970632353 154
484 iso_pu_bacteria 2977821940 2977825740 154
485 iso_pu_bacteria 2977828996 2977831241 154
486 iso_pu_bacteria 2977843712 2977851119 154
487 iso_pu_bacteria 2977851361 2977852939 154
488 iso_pu_bacteria 2977858184 2977859921 154
489 iso_pu_bacteria 2977864932 2977869513 154
490 iso_pu_bacteria 2977872689 2977875298 154
491 iso_pu_bacteria 2977907340 2977909905 154
492 iso_pu_bacteria 2977922695 2977926279 154
493 iso_pu_bacteria 2977942078 2977943903 154
494 iso_pu_bacteria 2977950692 2977955067 154
495 iso_pu_bacteria 2977971508 2977972963 154
496 iso_pu_bacteria 2977986579 2977992274 154
497 iso_pu_bacteria 2979710463 2979717382 154
498 iso_pu_bacteria 2979742915 2979743138 154
499 iso_pu_bacteria 2979764755 2979766916 154
500 iso_pu_bacteria 2979772303 2979774980 154
501 iso_pu_bacteria 2979779861 2979785472 154
502 iso_pu_bacteria 2979808191 2979810165 154
503 iso_pu_bacteria 2987636660 2987643635 154
504 iso_pu_bacteria 2987645492 2987651836 154
505 iso_pu_bacteria 2987652177 2987654855 154
506 iso_pu_bacteria 2987659509 2987662099 154
507 iso_pu_bacteria 2987666974 2987667386 154
508 iso_pu_bacteria 2989771324 2989772038 154
509 iso_pu_bacteria 2996341866 2996343187 154
510 iso_pu_bacteria 2996348954 2996352003 154
511 iso_pu_bacteria 2996386984 2996392113 154
512 iso_pu_bacteria 2996887358 2996890822 154
513 iso_pu_bacteria 2996893221 2996895062 154
514 iso_pu_bacteria 3000135777 3000141903 154
515 iso_pu_bacteria 3004167301 3004170957 154
516 iso_pu_bacteria 3004188549 3004191150 154
517 iso_pu_bacteria 3004195979 3004198337 154
518 iso_pu_bacteria 3004203850 3004207180 154
519 iso_pu_bacteria 3004211236 3004214594 154
520 iso_pu_bacteria 3004218560 3004219276 154
521 iso_pu_bacteria 3004232784 3004234274 154
522 iso_pu_bacteria 3004239961 3004241105 154
523 iso_pu_bacteria 3004248173 3004254355 154
524 iso_pu_bacteria 3004268573 3004273510 154
525 iso_pu_bacteria 3004275668 3004278701 154
526 iso_pu_bacteria 3004289098 3004290493 154
527 iso_pu_bacteria 3004334049 3004339349 154
528 iso_pu_bacteria 3005409236 3005412426 154
529 iso_pu_bacteria 3005445848 3005446742 154
530 iso_pu_bacteria 3005452660 3005453427 154
531 iso_pu_bacteria 637000159 637079513 154
532 iso_pu_bacteria 639633055 639647417 154
533 iso_pu_bacteria 643692032 643825070 154
534 iso_pu_bacteria 649633066 649874658 154
535 iso_pu_bacteria 8002285264 8002287825 154
536 iso_pu_bacteria 8004300914 8004303784 154
537 iso_pu_bacteria 8004312739 8004317107 154
538 iso_pu_bacteria 8004374579 8004378148 154
539 iso_pu_bacteria 8004387939 8004391744 154
540 iso_pu_bacteria 8004395343 8004396368 154
541 iso_pu_bacteria 8004445564 8004450600 154
542 iso_pu_bacteria 8004633249 8004636481 154
543 iso_pu_bacteria 8004640170 8004641244 154
544 iso_pu_bacteria 8004714634 8004717112 154
545 iso_pu_bacteria 8004727605 8004732302 154
546 iso_pu_bacteria 8005258706 8005261789 154
547 iso_pu_bacteria 8005275841 8005279562 154
548 iso_pu_bacteria 8005282627 8005284798 154
549 iso_pu_bacteria 8005289223 8005292776 154
550 iso_pu_bacteria 8005301065 8005304579 154
551 iso_pu_bacteria 8005307578 8005311069 154
552 iso_pu_bacteria 8005321885 8005325349 154
553 iso_pu_bacteria 8005376324 8005376627 154
554 iso_pu_bacteria 8005382845 8005386017 154
555 iso_pu_bacteria 8005395548 8005400199 154
556 iso_pu_bacteria 8005430974 8005432252 154
557 iso_pu_bacteria 8005460587 8005461911 154
558 iso_pu_bacteria 8005497431 8005499315 154
559 iso_pu_bacteria 8005542996 8005544333 154
560 iso_pu_bacteria 8005556819 8005558942 154
561 iso_pu_bacteria 8005563573 8005570420 154
562 iso_pu_bacteria 8005570704 8005572665 154
563 iso_pu_bacteria 8005619151 8005620510 154
564 iso_pu_bacteria 8005626139 8005627524 154
565 iso_pu_bacteria 8005668836 8005670731 154
566 iso_pu_bacteria 8005688590 8005691002 154
567 iso_pu_bacteria 8005695170 8005698810 154
568 iso_pu_bacteria 8018127388 8018131313 154
569 iso_pu_bacteria 8018163183 8018169141 154
570 iso_pu_bacteria 8018176218 8018177263 154
571 iso_pu_bacteria 8023680758 8023686976 154
572 iso_pu_bacteria 8024479707 8024481086 154
573 iso_pu_bacteria 8024501048 8024503267 154
574 iso_pu_bacteria 8049293176 8049293909 154
575 iso_pu_bacteria 8055617313 8055622746 154
576 iso_pu_bacteria 8056375014 8056380712 154
577 iso_pu_bacteria 8056382006 8056384769 154
578 iso_pu_bacteria 8057874678 8057879571 154
579 3300031247 Ga0265340_10000501 Ga0265340_1000050124 155
580 3300031249 Ga0265339_10003493 Ga0265339_100034936 155
581 3300031250 Ga0265331_10124673 Ga0265331_101246732 155
582 3300031344 Ga0265316_10005614 Ga0265316_100056148 155
583 3300031595 Ga0265313_10001319 Ga0265313_100013195 155
584 3300031712 Ga0265342_10004425 Ga0265342_100044255 155
585 3300011119 Ga0105246_10992580 Ga0105246_109925801 156
586 iso_pu_bacteria 2891373044 2891374707 156
587 3300025294 Ga0209025_1000149 Ga0209025_100014952 157
588 3300041459 Ga0451800_0535748 Ga0451800_0535748_229_702 157
589 3300048920 Ga0496117_0003176 Ga0496117_0003176_11894_12391 157
590 3300048925 Ga0496122_0000492 Ga0496122_0000492_41476_41973 157
591 3300048926 Ga0496123_0000460 Ga0496123_0000460_24327_24824 157
592 3300048927 Ga0496124_0000679 Ga0496124_0000679_8701_9198 157
593 3300048927 Ga0496124_0505504 Ga0496124_0505504_36_533 157
594 3300048928 Ga0496125_0000912 Ga0496125_0000912_25076_25558 157
595 3300048928 Ga0496125_0193125 Ga0496125_0193125_436_933 157
596 3300048929 Ga0496126_0000811 Ga0496126_0000811_37357_37854 157
597 3300048929 Ga0496126_0042355 Ga0496126_0042355_1870_2343 157
598 3300049568 Ga0501031_0264111 Ga0501031_0264111_449_922 157
599 3300049570 Ga0501033_0160706 Ga0501033_0160706_799_1272 157
600 3300049571 Ga0501034_0094492 Ga0501034_0094492_780_1274 157
601 3300049572 Ga0501036_0456669 Ga0501036_0456669_269_742 157
602 3300049574 Ga0501038_0099928 Ga0501038_0099928_388_882 157
603 3300049579 Ga0501043_0065320 Ga0501043_0065320_1353_1847 157
604 3300049822 Ga0501035_0057961 Ga0501035_0057961_2822_3316 157
605 3300049823 Ga0501044_0481942 Ga0501044_0481942_276_770 157
606 3300001979 JGI24740J21852_10022684 JGI24740J21852_100226842 158
607 3300002705 JGI25156J39149_1008029 JGI25156J39149_10080293 158
608 3300002739 JGI25158J39367_1001006 JGI25158J39367_10010064 158
609 3300002741 JGI25157J39369_1001043 JGI25157J39369_100104312 158
610 3300002773 JGI25152J39213_1000489 JGI25152J39213_100048913 158
611 3300002773 JGI25152J39213_1000613 JGI25152J39213_100061313 158
612 3300002773 JGI25152J39213_1003002 JGI25152J39213_10030022 158
613 3300002773 JGI25152J39213_1003200 JGI25152J39213_10032004 158
614 3300002773 JGI25152J39213_1005384 JGI25152J39213_10053843 158
615 3300002773 JGI25152J39213_1006798 JGI25152J39213_10067981 158
616 3300002773 JGI25152J39213_1009132 JGI25152J39213_10091323 158
617 3300002774 JGI25150J39212_1000033 JGI25150J39212_10000334 158
618 3300002774 JGI25150J39212_1006735 JGI25150J39212_10067352 158
619 3300002774 JGI25150J39212_1006851 JGI25150J39212_10068513 158
620 3300002774 JGI25150J39212_1026697 JGI25150J39212_10266972 158
621 3300002987 JGI25159J45721_1000002 JGI25159J45721_1000002249 158
622 3300002987 JGI25159J45721_1000299 JGI25159J45721_100029926 158
623 3300003187 JGI25151J46595_10000062 JGI25151J46595_1000006222 158
624 3300003187 JGI25151J46595_10001325 JGI25151J46595_1000132519 158
625 3300003187 JGI25151J46595_10002042 JGI25151J46595_1000204210 158
626 3300003187 JGI25151J46595_10002593 JGI25151J46595_100025938 158
627 3300003187 JGI25151J46595_10011784 JGI25151J46595_100117843 158
628 3300003187 JGI25151J46595_10017797 JGI25151J46595_100177974 158
629 3300003214 JGI25165J46597_1000028 JGI25165J46597_1000028286 158
630 3300003214 JGI25165J46597_1011001 JGI25165J46597_10110012 158
631 3300003215 JGI25153J46596_10005408 JGI25153J46596_100054084 158
632 3300003215 JGI25153J46596_10006589 JGI25153J46596_100065895 158
633 3300003215 JGI25153J46596_10007464 JGI25153J46596_100074644 158
634 3300003215 JGI25153J46596_10029503 JGI25153J46596_100295033 158
635 3300003354 JGI25160J50197_1000008 JGI25160J50197_1000008249 158
636 3300003354 JGI25160J50197_1008183 JGI25160J50197_10081833 158
637 3300003354 JGI25160J50197_1010532 JGI25160J50197_10105324 158
638 3300003354 JGI25160J50197_1015293 JGI25160J50197_10152932 158
639 3300003374 JGI25161J50226_1000133 JGI25161J50226_100013352 158
640 3300003374 JGI25161J50226_1000527 JGI25161J50226_100052710 158
641 3300003374 JGI25161J50226_1011868 JGI25161J50226_10118681 158
642 3300003762 Ga0055542_1001076 Ga0055542_10010767 158
643 3300003762 Ga0055542_1001152 Ga0055542_10011524 158
644 3300003763 Ga0055529_1004622 Ga0055529_10046222 158
645 3300003771 Ga0055526_1002912 Ga0055526_10029127 158
646 3300003771 Ga0055526_1005297 Ga0055526_10052973 158
647 3300003771 Ga0055526_1010461 Ga0055526_10104612 158
648 3300003771 Ga0055526_1010634 Ga0055526_10106344 158
649 3300003771 Ga0055526_1013070 Ga0055526_10130703 158
650 3300003775 Ga0055524_1001918 Ga0055524_10019183 158
651 3300003775 Ga0055524_1008684 Ga0055524_10086843 158
652 3300003775 Ga0055524_1014462 Ga0055524_10144622 158
653 3300003775 Ga0055524_1015539 Ga0055524_10155393 158
654 3300003775 Ga0055524_1018673 Ga0055524_10186732 158
655 3300003775 Ga0055524_1020377 Ga0055524_10203773 158
656 3300003775 Ga0055524_1020565 Ga0055524_10205652 158
657 3300003775 Ga0055524_1035008 Ga0055524_10350083 158
658 3300003790 Ga0055528_1000149 Ga0055528_100014925 158
659 3300003790 Ga0055528_1004949 Ga0055528_10049493 158
660 3300003790 Ga0055528_1006210 Ga0055528_10062103 158
661 3300003790 Ga0055528_1019412 Ga0055528_10194122 158
662 3300003790 Ga0055528_1028634 Ga0055528_10286342 158
663 3300003790 Ga0055528_1030824 Ga0055528_10308242 158
664 3300003790 Ga0055528_1044220 Ga0055528_10442201 158
665 3300003791 Ga0055530_10048270 Ga0055530_100482702 158
666 3300003792 Ga0055540_1001764 Ga0055540_10017646 158
667 3300003792 Ga0055540_1002583 Ga0055540_10025837 158
668 3300003792 Ga0055540_1017412 Ga0055540_10174123 158
669 3300003792 Ga0055540_1021002 Ga0055540_10210024 158
670 3300003794 Ga0055531_10048480 Ga0055531_100484802 158
671 3300004625 Ga0055543_1000040 Ga0055543_1000040109 158
672 3300004625 Ga0055543_1000048 Ga0055543_100004816 158
673 3300004625 Ga0055543_1003720 Ga0055543_10037202 158
674 3300005262 Ga0065165_1000015 Ga0065165_1000015250 158
675 3300005262 Ga0065165_1006738 Ga0065165_10067383 158
676 3300005262 Ga0065165_1012418 Ga0065165_10124183 158
677 3300005327 Ga0070658_10187688 Ga0070658_101876883 158
678 3300005347 Ga0070668_100154878 Ga0070668_1001548783 158
679 3300005347 Ga0070668_100774398 Ga0070668_1007743981 158
680 3300005347 Ga0070668_100783679 Ga0070668_1007836792 158
681 3300005355 Ga0070671_100083420 Ga0070671_1000834204 158
682 3300005356 Ga0070674_100128790 Ga0070674_1001287902 158
683 3300005367 Ga0070667_100912721 Ga0070667_1009127212 158
684 3300005445 Ga0070708_100338798 Ga0070708_1003387982 158
685 3300005455 Ga0070663_100274643 Ga0070663_1002746432 158
686 3300005455 Ga0070663_100650142 Ga0070663_1006501422 158
687 3300005457 Ga0070662_101300743 Ga0070662_1013007431 158
688 3300005459 Ga0068867_100189684 Ga0068867_1001896842 158
689 3300005539 Ga0068853_100070932 Ga0068853_1000709323 158
690 3300005539 Ga0068853_100427759 Ga0068853_1004277592 158
691 3300005543 Ga0070672_100821548 Ga0070672_1008215481 158
692 3300005544 Ga0070686_101526876 Ga0070686_1015268761 158
693 3300005548 Ga0070665_100033875 Ga0070665_1000338753 158
694 3300005548 Ga0070665_100281328 Ga0070665_1002813282 158
695 3300005563 Ga0068855_100315987 Ga0068855_1003159872 158
696 3300005563 Ga0068855_100558333 Ga0068855_1005583331 158
697 3300005563 Ga0068855_100571357 Ga0068855_1005713573 158
698 3300005577 Ga0068857_101023395 Ga0068857_1010233952 158
699 3300005578 Ga0068854_100090229 Ga0068854_1000902294 158
700 3300005614 Ga0068856_100300925 Ga0068856_1003009252 158
701 3300005616 Ga0068852_100734426 Ga0068852_1007344262 158
702 3300005718 Ga0068866_10244873 Ga0068866_102448732 158
703 3300006038 Ga0075365_10017666 Ga0075365_100176662 158
704 3300006038 Ga0075365_10068542 Ga0075365_100685423 158
705 3300006038 Ga0075365_10114595 Ga0075365_101145952 158
706 3300006038 Ga0075365_10270810 Ga0075365_102708103 158
707 3300006038 Ga0075365_10307324 Ga0075365_103073242 158
708 3300006042 Ga0075368_10017680 Ga0075368_100176802 158
709 3300006042 Ga0075368_10041467 Ga0075368_100414674 158
710 3300006042 Ga0075368_10119913 Ga0075368_101199132 158
711 3300006048 Ga0075363_100055331 Ga0075363_1000553312 158
712 3300006048 Ga0075363_100079110 Ga0075363_1000791104 158
713 3300006048 Ga0075363_100132813 Ga0075363_1001328132 158
714 3300006048 Ga0075363_100367440 Ga0075363_1003674402 158
715 3300006051 Ga0075364_10074936 Ga0075364_100749364 158
716 3300006051 Ga0075364_10456967 Ga0075364_104569672 158
717 3300006177 Ga0075362_10001294 Ga0075362_100012944 158
718 3300006178 Ga0075367_10003380 Ga0075367_100033804 158
719 3300006178 Ga0075367_10050221 Ga0075367_100502214 158
720 3300006178 Ga0075367_10063595 Ga0075367_100635955 158
721 3300006178 Ga0075367_10077631 Ga0075367_100776314 158
722 3300006178 Ga0075367_10133647 Ga0075367_101336472 158
723 3300006178 Ga0075367_10190304 Ga0075367_101903042 158
724 3300006186 Ga0075369_10000715 Ga0075369_100007154 158
725 3300006186 Ga0075369_10001441 Ga0075369_100014411 158
726 3300006186 Ga0075369_10023990 Ga0075369_100239904 158
727 3300006186 Ga0075369_10120044 Ga0075369_101200442 158
728 3300006195 Ga0075366_10008659 Ga0075366_100086594 158
729 3300006195 Ga0075366_10082331 Ga0075366_100823312 158
730 3300006195 Ga0075366_10224384 Ga0075366_102243842 158
731 3300006353 Ga0075370_10010914 Ga0075370_100109143 158
732 3300006353 Ga0075370_10061958 Ga0075370_100619583 158
733 3300006353 Ga0075370_10278133 Ga0075370_102781332 158
734 3300006353 Ga0075370_10531535 Ga0075370_105315351 158
735 3300006353 Ga0075370_10538892 Ga0075370_105388921 158
736 3300006358 Ga0068871_100662265 Ga0068871_1006622652 158
737 3300006946 Ga0079104_1002273 Ga0079104_10022736 158
738 3300006946 Ga0079104_1005092 Ga0079104_10050927 158
739 3300009011 Ga0105251_10008511 Ga0105251_100085117 158
740 3300009036 Ga0105244_10117097 Ga0105244_101170972 158
741 3300009092 Ga0105250_10108155 Ga0105250_101081551 158
742 3300009093 Ga0105240_10605453 Ga0105240_106054532 158
743 3300009098 Ga0105245_10544602 Ga0105245_105446022 158
744 3300009174 Ga0105241_10109885 Ga0105241_101098854 158
745 3300009174 Ga0105241_10223107 Ga0105241_102231071 158
746 3300009174 Ga0105241_10611519 Ga0105241_106115192 158
747 3300009176 Ga0105242_11531386 Ga0105242_115313862 158
748 3300009177 Ga0105248_10057126 Ga0105248_100571261 158
749 3300009177 Ga0105248_10177749 Ga0105248_101777492 158
750 3300009545 Ga0105237_10018053 Ga0105237_100180532 158
751 3300009545 Ga0105237_10538977 Ga0105237_105389772 158
752 3300009551 Ga0105238_10198943 Ga0105238_101989432 158
753 3300009551 Ga0105238_10570887 Ga0105238_105708872 158
754 3300009553 Ga0105249_10758749 Ga0105249_107587491 158
755 3300009765 Ga0123341_1012981 Ga0123341_10129812 158
756 3300010375 Ga0105239_10131477 Ga0105239_101314772 158
757 3300010375 Ga0105239_10655701 Ga0105239_106557011 158
758 3300010375 Ga0105239_10772903 Ga0105239_107729031 158
759 3300010375 Ga0105239_11191159 Ga0105239_111911592 158
760 3300010375 Ga0105239_11422805 Ga0105239_114228052 158
761 3300012490 Ga0157322_1004632 Ga0157322_10046322 158
762 3300012497 Ga0157319_1002016 Ga0157319_10020162 158
763 3300013100 Ga0157373_10391332 Ga0157373_103913321 158
764 3300013104 Ga0157370_10196562 Ga0157370_101965623 158
765 3300013249 Ga0171463_1001 Ga0171463_1001239 158
766 3300013296 Ga0157374_10681521 Ga0157374_106815212 158
767 3300013307 Ga0157372_12209991 Ga0157372_122099912 158
768 3300014325 Ga0163163_10418466 Ga0163163_104184662 158
769 3300014497 Ga0182008_10182930 Ga0182008_101829302 158
770 3300014969 Ga0157376_10574220 Ga0157376_105742202 158
771 3300015262 Ga0182007_10001216 Ga0182007_100012168 158
772 3300015690 Ga0183363_1336 Ga0183363_133610 158
773 3300021320 Ga0214544_1008762 Ga0214544_100876211 158
774 3300021321 Ga0214542_1000006 Ga0214542_100000629 158
775 3300021321 Ga0214542_1016338 Ga0214542_10163384 158
776 3300021327 Ga0214543_1000003 Ga0214543_1000003463 158
777 3300021327 Ga0214543_1000014 Ga0214543_1000014294 158
778 3300022739 Ga0228711_1000001 Ga0228711_100000190 158
779 3300022740 Ga0228710_1000001 Ga0228710_1000001235 158
780 3300025206 Ga0209435_100042 Ga0209435_10004277 158
781 3300025208 Ga0209436_100064 Ga0209436_10006410 158
782 3300025208 Ga0209436_102030 Ga0209436_1020305 158
783 3300025245 Ga0207425_1000031 Ga0207425_1000031138 158
784 3300025245 Ga0207425_1000671 Ga0207425_100067116 158
785 3300025245 Ga0207425_1002445 Ga0207425_10024454 158
786 3300025245 Ga0207425_1018724 Ga0207425_10187243 158
787 3300025245 Ga0207425_1029317 Ga0207425_10293172 158
788 3300025246 Ga0209646_1000145 Ga0209646_100014577 158
789 3300025250 Ga0209026_1000160 Ga0209026_100016077 158
790 3300025250 Ga0209026_1000215 Ga0209026_100021525 158
791 3300025254 Ga0209148_1000056 Ga0209148_1000056182 158
792 3300025256 Ga0209759_1000177 Ga0209759_100017777 158
793 3300025256 Ga0209759_1000591 Ga0209759_100059125 158
794 3300025258 Ga0209129_1000053 Ga0209129_1000053139 158
795 3300025258 Ga0209129_1000362 Ga0209129_100036242 158
796 3300025258 Ga0209129_1000592 Ga0209129_100059226 158
797 3300025258 Ga0209129_1002000 Ga0209129_10020006 158
798 3300025258 Ga0209129_1003332 Ga0209129_10033324 158
799 3300025258 Ga0209129_1003827 Ga0209129_10038276 158
800 3300025258 Ga0209129_1028176 Ga0209129_10281762 158
801 3300025261 Ga0209233_1000087 Ga0209233_1000087288 158
802 3300025261 Ga0209233_1000209 Ga0209233_100020946 158
803 3300025261 Ga0209233_1004639 Ga0209233_10046395 158
804 3300025263 Ga0209565_1032250 Ga0209565_10322502 158
805 3300025272 Ga0209455_1000137 Ga0209455_100013777 158
806 3300025273 Ga0209673_1000041 Ga0209673_100004143 158
807 3300025273 Ga0209673_1000254 Ga0209673_100025496 158
808 3300025273 Ga0209673_1001371 Ga0209673_10013718 158
809 3300025273 Ga0209673_1001660 Ga0209673_100166015 158
810 3300025273 Ga0209673_1001767 Ga0209673_100176720 158
811 3300025273 Ga0209673_1006511 Ga0209673_10065114 158
812 3300025273 Ga0209673_1009724 Ga0209673_10097243 158
813 3300025273 Ga0209673_1010174 Ga0209673_10101744 158
814 3300025273 Ga0209673_1012400 Ga0209673_10124002 158
815 3300025273 Ga0209673_1031104 Ga0209673_10311042 158
816 3300025284 Ga0209130_1000006 Ga0209130_1000006552 158
817 3300025284 Ga0209130_1000007 Ga0209130_100000753 158
818 3300025284 Ga0209130_1025430 Ga0209130_10254303 158
819 3300025292 Ga0209676_1009408 Ga0209676_10094082 158
820 3300025294 Ga0209025_1000087 Ga0209025_1000087138 158
821 3300025294 Ga0209025_1000100 Ga0209025_1000100198 158
822 3300025294 Ga0209025_1000284 Ga0209025_1000284109 158
823 3300025294 Ga0209025_1001310 Ga0209025_100131033 158
824 3300025294 Ga0209025_1007344 Ga0209025_10073443 158
825 3300025294 Ga0209025_1015697 Ga0209025_10156973 158
826 3300025294 Ga0209025_1020918 Ga0209025_10209184 158
827 3300025294 Ga0209025_1053139 Ga0209025_10531392 158
828 3300025295 Ga0209564_1000233 Ga0209564_100023393 158
829 3300025295 Ga0209564_1000425 Ga0209564_100042572 158
830 3300025295 Ga0209564_1000439 Ga0209564_100043940 158
831 3300025295 Ga0209564_1001684 Ga0209564_10016845 158
832 3300025295 Ga0209564_1002798 Ga0209564_100279813 158
833 3300025295 Ga0209564_1015377 Ga0209564_10153772 158
834 3300025295 Ga0209564_1019775 Ga0209564_10197754 158
835 3300025297 Ga0209758_1000081 Ga0209758_1000081138 158
836 3300025297 Ga0209758_1000737 Ga0209758_100073717 158
837 3300025297 Ga0209758_1002088 Ga0209758_100208817 158
838 3300025297 Ga0209758_1002164 Ga0209758_10021649 158
839 3300025297 Ga0209758_1002288 Ga0209758_10022886 158
840 3300025297 Ga0209758_1003671 Ga0209758_10036714 158
841 3300025297 Ga0209758_1016828 Ga0209758_10168284 158
842 3300025298 Ga0209050_1001222 Ga0209050_10012223 158
843 3300025299 Ga0209256_1001044 Ga0209256_10010445 158
844 3300025299 Ga0209256_1002554 Ga0209256_10025548 158
845 3300025299 Ga0209256_1002658 Ga0209256_10026585 158
846 3300025299 Ga0209256_1002838 Ga0209256_10028388 158
847 3300025299 Ga0209256_1002860 Ga0209256_10028608 158
848 3300025299 Ga0209256_1007676 Ga0209256_10076764 158
849 3300025299 Ga0209256_1008783 Ga0209256_10087833 158
850 3300025299 Ga0209256_1011782 Ga0209256_10117824 158
851 3300025299 Ga0209256_1018967 Ga0209256_10189672 158
852 3300025302 Ga0207426_1000064 Ga0207426_100006453 158
853 3300025302 Ga0207426_1000106 Ga0207426_1000106129 158
854 3300025302 Ga0207426_1000265 Ga0207426_100026515 158
855 3300025302 Ga0207426_1000652 Ga0207426_100065224 158
856 3300025303 Ga0209051_1000514 Ga0209051_100051423 158
857 3300025303 Ga0209051_1006315 Ga0209051_10063154 158
858 3300025303 Ga0209051_1009158 Ga0209051_10091583 158
859 3300025303 Ga0209051_1010723 Ga0209051_10107233 158
860 3300025303 Ga0209051_1012051 Ga0209051_10120513 158
861 3300025303 Ga0209051_1035661 Ga0209051_10356612 158
862 3300025304 Ga0209257_1001514 Ga0209257_100151422 158
863 3300025304 Ga0209257_1003433 Ga0209257_10034337 158
864 3300025304 Ga0209257_1007276 Ga0209257_10072768 158
865 3300025904 Ga0207647_10136275 Ga0207647_101362752 158
866 3300025907 Ga0207645_10381329 Ga0207645_103813291 158
867 3300025909 Ga0207705_10494451 Ga0207705_104944511 158
868 3300025909 Ga0207705_10507774 Ga0207705_105077742 158
869 3300025911 Ga0207654_10195106 Ga0207654_101951062 158
870 3300025913 Ga0207695_10000024 Ga0207695_10000024234 158
871 3300025913 Ga0207695_10204177 Ga0207695_102041773 158
872 3300025913 Ga0207695_10893348 Ga0207695_108933481 158
873 3300025914 Ga0207671_10000548 Ga0207671_1000054810 158
874 3300025914 Ga0207671_10278982 Ga0207671_102789823 158
875 3300025914 Ga0207671_10442674 Ga0207671_104426742 158
876 3300025919 Ga0207657_10314739 Ga0207657_103147392 158
877 3300025920 Ga0207649_10264276 Ga0207649_102642762 158
878 3300025924 Ga0207694_10422646 Ga0207694_104226462 158
879 3300025925 Ga0207650_10533838 Ga0207650_105338382 158
880 3300025935 Ga0207709_10153168 Ga0207709_101531682 158
881 3300025940 Ga0207691_10654793 Ga0207691_106547932 158
882 3300025941 Ga0207711_10184523 Ga0207711_101845232 158
883 3300025941 Ga0207711_10668304 Ga0207711_106683042 158
884 3300025941 Ga0207711_11106698 Ga0207711_111066982 158
885 3300025949 Ga0207667_10592290 Ga0207667_105922902 158
886 3300025949 Ga0207667_11073160 Ga0207667_110731602 158
887 3300025961 Ga0207712_10870052 Ga0207712_108700522 158
888 3300025972 Ga0207668_10127330 Ga0207668_101273302 158
889 3300025986 Ga0207658_10817774 Ga0207658_108177741 158
890 3300026041 Ga0207639_10483918 Ga0207639_104839182 158
891 3300026067 Ga0207678_10292975 Ga0207678_102929752 158
892 3300026067 Ga0207678_10395227 Ga0207678_103952272 158
893 3300026067 Ga0207678_10624394 Ga0207678_106243942 158
894 3300026067 Ga0207678_10698046 Ga0207678_106980462 158
895 3300026078 Ga0207702_10339629 Ga0207702_103396292 158
896 3300026089 Ga0207648_10048598 Ga0207648_100485983 158
897 3300026095 Ga0207676_10908409 Ga0207676_109084092 158
898 3300026116 Ga0207674_10620286 Ga0207674_106202862 158
899 3300026116 Ga0207674_11228247 Ga0207674_112282472 158
900 3300026142 Ga0207698_10071975 Ga0207698_100719752 158
901 3300026142 Ga0207698_11460869 Ga0207698_114608692 158
902 3300026142 Ga0207698_11920988 Ga0207698_119209882 158
903 3300027111 Ga0209281_1000266 Ga0209281_10002667 158
904 3300027111 Ga0209281_1000332 Ga0209281_100033252 158
905 3300027312 Ga0209371_1006525 Ga0209371_10065254 158
906 3300027666 Ga0209282_1000007 Ga0209282_1000007162 158
907 3300027866 Ga0209813_10096417 Ga0209813_100964172 158
908 3300027866 Ga0209813_10098778 Ga0209813_100987782 158
909 3300028379 Ga0268266_10197576 Ga0268266_101975762 158
910 3300028786 Ga0307517_10189616 Ga0307517_101896162 158
911 3300028794 Ga0307515_10035625 Ga0307515_100356256 158
912 3300028794 Ga0307515_10584617 Ga0307515_105846172 158
913 3300031456 Ga0307513_10007830 Ga0307513_100078303 158
914 3300031456 Ga0307513_10519529 Ga0307513_105195291 158
915 3300031548 Ga0307408_100222233 Ga0307408_1002222331 158
916 3300031548 Ga0307408_101963377 Ga0307408_1019633771 158
917 3300031731 Ga0307405_10156070 Ga0307405_101560703 158
918 3300031852 Ga0307410_11417569 Ga0307410_114175692 158
919 3300031901 Ga0307406_10180703 Ga0307406_101807032 158
920 3300031911 Ga0307412_10007614 Ga0307412_100076143 158
921 3300031911 Ga0307412_10226708 Ga0307412_102267082 158
922 3300031967 Ga0315914_1000006 Ga0315914_100000681 158
923 3300032004 Ga0307414_10836656 Ga0307414_108366562 158
924 3300032005 Ga0307411_11734411 Ga0307411_117344111 158
925 3300032126 Ga0307415_100732409 Ga0307415_1007324092 158
926 3300033430 Ga0315913_1000002 Ga0315913_1000002162 158
927 3300033464 Ga0315915_1000001 Ga0315915_1000001325 158
928 3300037312 Ga0395899_0606124 Ga0395899_0606124_202_678 158
929 3300037418 Ga0395900_0137569 Ga0395900_0137569_1969_2466 158
930 3300037418 Ga0395900_1214023 Ga0395900_1214023_74_571 158
931 3300037471 Ga0395905_0071155 Ga0395905_0071155_2366_2863 158
932 3300037471 Ga0395905_1037070 Ga0395905_1037070_21_497 158
933 3300038443 Ga0395901_0085966 Ga0395901_0085966_480_977 158
934 3300038443 Ga0395901_0310835 Ga0395901_0310835_1081_1578 158
935 3300038443 Ga0395901_0360412 Ga0395901_0360412_976_1473 158
936 3300041413 Ga0439465_0159451 Ga0439465_0159451_318_794 158
937 3300041486 Ga0451807_1582717 Ga0451807_1582717_87_563 158
938 3300041501 Ga0451845_0248020 Ga0451845_0248020_56_532 158
939 3300042157 Ga0439458_0065109 Ga0439458_0065109_384_887 158
940 3300044658 Ga0466972_0017014 Ga0466972_0017014_2048_2545 158
941 3300044658 Ga0466972_0053763 Ga0466972_0053763_321_818 158
942 3300044683 Ga0466965_0507163 Ga0466965_0507163_128_625 158
943 3300044735 Ga0466968_0133356 Ga0466968_0133356_315_800 158
944 3300046460 Ga0495638_0000353 Ga0495638_0000353_6710_7186 158
945 3300046471 Ga0495650_0029385 Ga0495650_0029385_1979_2455 158
946 3300046471 Ga0495650_0067074 Ga0495650_0067074_694_1191 158
947 3300046474 Ga0495605_0007427 Ga0495605_0007427_3918_4394 158
948 3300046491 Ga0495584_0379935 Ga0495584_0379935_158_634 158
949 3300046492 Ga0495585_0006433 Ga0495585_0006433_1266_1742 158
950 3300046501 Ga0495607_0026537 Ga0495607_0026537_3048_3524 158
951 3300046506 Ga0495583_0008191 Ga0495583_0008191_4780_5256 158
952 3300046506 Ga0495583_0052157 Ga0495583_0052157_902_1378 158
953 3300046506 Ga0495583_0246509 Ga0495583_0246509_68_544 158
954 3300046507 Ga0495606_0010611 Ga0495606_0010611_7087_7563 158
955 3300046507 Ga0495606_0053589 Ga0495606_0053589_1260_1736 158
956 3300046507 Ga0495606_0266217 Ga0495606_0266217_403_879 158
957 3300046512 Ga0495610_0002493 Ga0495610_0002493_13495_13992 158
958 3300046512 Ga0495610_0041836 Ga0495610_0041836_1375_1851 158
959 3300046515 Ga0495620_0031635 Ga0495620_0031635_1211_1687 158
960 3300046518 Ga0495631_0027247 Ga0495631_0027247_210_686 158
961 3300046518 Ga0495631_0051597 Ga0495631_0051597_776_1252 158
962 3300046519 Ga0495632_0007287 Ga0495632_0007287_1417_1914 158
963 3300046519 Ga0495632_0048475 Ga0495632_0048475_1268_1744 158
964 3300046519 Ga0495632_0077562 Ga0495632_0077562_205_681 158
965 3300046522 Ga0495643_0032728 Ga0495643_0032728_2279_2755 158
966 3300046522 Ga0495643_0048443 Ga0495643_0048443_1702_2178 158
967 3300046522 Ga0495643_0073423 Ga0495643_0073423_92_568 158
968 3300046524 Ga0495648_0054864 Ga0495648_0054864_1428_1904 158
969 3300046530 Ga0495654_0170477 Ga0495654_0170477_11_487 158
970 3300046538 Ga0495609_0263297 Ga0495609_0263297_169_645 158
971 3300046542 Ga0495597_0020027 Ga0495597_0020027_396_872 158
972 3300046616 Ga0495668_0012552 Ga0495668_0012552_292_768 158
973 3300046616 Ga0495668_0017902 Ga0495668_0017902_3189_3665 158
974 3300046616 Ga0495668_0208060 Ga0495668_0208060_389_865 158
975 3300046616 Ga0495668_0376928 Ga0495668_0376928_230_706 158
976 3300046648 Ga0495611_0017639 Ga0495611_0017639_1422_1898 158
977 3300046660 Ga0495625_0001623 Ga0495625_0001623_13466_13942 158
978 3300046660 Ga0495625_0012480 Ga0495625_0012480_2372_2848 158
979 3300046660 Ga0495625_0495380 Ga0495625_0495380_200_697 158
980 3300046665 Ga0495661_0319278 Ga0495661_0319278_106_582 158
981 3300046691 Ga0495670_0251093 Ga0495670_0251093_153_629 158
982 3300046694 Ga0495649_0037909 Ga0495649_0037909_1398_1874 158
983 3300046694 Ga0495649_0138817 Ga0495649_0138817_479_955 158
984 3300046810 Ga0495660_0033898 Ga0495660_0033898_1172_1648 158
985 3300046810 Ga0495660_0043125 Ga0495660_0043125_1198_1674 158
986 3300046810 Ga0495660_0096574 Ga0495660_0096574_261_758 158
987 3300047318 Ga0495636_0053564 Ga0495636_0053564_552_1028 158
988 3300047318 Ga0495636_0054551 Ga0495636_0054551_1192_1668 158
989 3300047320 Ga0495672_0011740 Ga0495672_0011740_380_856 158
990 3300047323 Ga0495683_0272747 Ga0495683_0272747_240_716 158
991 3300047443 Ga0495687_040495 Ga0495687_040495_1241_1738 158
992 3300047443 Ga0495687_107672 Ga0495687_107672_116_592 158
993 3300047472 Ga0495686_0010459 Ga0495686_0010459_1920_2396 158
994 3300047472 Ga0495686_0011085 Ga0495686_0011085_5483_5959 158
995 3300047472 Ga0495686_0061215 Ga0495686_0061215_450_947 158
996 3300047472 Ga0495686_0071177 Ga0495686_0071177_1221_1697 158
997 3300047472 Ga0495686_0269012 Ga0495686_0269012_99_575 158
998 3300047472 Ga0495686_0332664 Ga0495686_0332664_227_703 158
999 3300047472 Ga0495686_0365231 Ga0495686_0365231_71_547 158
1000 3300048091 Ga0495626_0228138 Ga0495626_0228138_106_582 158
1001 3300048904 Ga0496101_0459728 Ga0496101_0459728_362_841 158
1002 3300048905 Ga0496102_0375020 Ga0496102_0375020_498_974 158
1003 3300048906 Ga0496103_0279087 Ga0496103_0279087_309_806 158
1004 3300048908 Ga0496105_0263058 Ga0496105_0263058_245_742 158
1005 3300048909 Ga0496106_0018110 Ga0496106_0018110_1232_1708 158
1006 3300048911 Ga0496108_1210510 Ga0496108_1210510_113_610 158
1007 3300048912 Ga0496109_0430614 Ga0496109_0430614_159_656 158
1008 3300048915 Ga0496112_0154436 Ga0496112_0154436_918_1415 158
1009 3300048915 Ga0496112_0240994 Ga0496112_0240994_142_639 158
1010 3300048918 Ga0496115_0052156 Ga0496115_0052156_2732_3229 158
1011 3300048918 Ga0496115_1086062 Ga0496115_1086062_121_597 158
1012 3300048919 Ga0496116_0007220 Ga0496116_0007220_4111_4608 158
1013 3300048919 Ga0496116_0009103 Ga0496116_0009103_1174_1671 158
1014 3300048919 Ga0496116_0015251 Ga0496116_0015251_5538_6035 158
1015 3300048919 Ga0496116_0018933 Ga0496116_0018933_4411_4890 158
1016 3300048919 Ga0496116_0051522 Ga0496116_0051522_675_1172 158
1017 3300048919 Ga0496116_0115594 Ga0496116_0115594_603_1079 158
1018 3300048920 Ga0496117_0026761 Ga0496117_0026761_912_1409 158
1019 3300048920 Ga0496117_0061050 Ga0496117_0061050_623_1120 158
1020 3300048920 Ga0496117_0066338 Ga0496117_0066338_407_883 158
1021 3300048920 Ga0496117_0241822 Ga0496117_0241822_38_514 158
1022 3300048920 Ga0496117_0340261 Ga0496117_0340261_256_732 158
1023 3300048921 Ga0496118_0046838 Ga0496118_0046838_998_1495 158
1024 3300048921 Ga0496118_0081627 Ga0496118_0081627_1106_1582 158
1025 3300048921 Ga0496118_0093731 Ga0496118_0093731_1139_1636 158
1026 3300048922 Ga0496119_0043400 Ga0496119_0043400_981_1478 158
1027 3300048922 Ga0496119_0078325 Ga0496119_0078325_909_1406 158
1028 3300048922 Ga0496119_0145859 Ga0496119_0145859_173_652 158
1029 3300048922 Ga0496119_0214718 Ga0496119_0214718_282_758 158
1030 3300048922 Ga0496119_0568823 Ga0496119_0568823_11_508 158
1031 3300048923 Ga0496120_0000860 Ga0496120_0000860_9016_9513 158
1032 3300048924 Ga0496121_0008689 Ga0496121_0008689_5672_6169 158
1033 3300048924 Ga0496121_0010436 Ga0496121_0010436_5040_5537 158
1034 3300048924 Ga0496121_0016167 Ga0496121_0016167_4188_4664 158
1035 3300048924 Ga0496121_0017218 Ga0496121_0017218_4323_4799 158
1036 3300048924 Ga0496121_0210637 Ga0496121_0210637_732_1208 158
1037 3300048924 Ga0496121_0220364 Ga0496121_0220364_592_1089 158
1038 3300048924 Ga0496121_0340235 Ga0496121_0340235_303_779 158
1039 3300048925 Ga0496122_0010176 Ga0496122_0010176_8076_8573 158
1040 3300048925 Ga0496122_0032451 Ga0496122_0032451_2650_3147 158
1041 3300048925 Ga0496122_0046163 Ga0496122_0046163_216_692 158
1042 3300048925 Ga0496122_0152169 Ga0496122_0152169_281_757 158
1043 3300048926 Ga0496123_0008658 Ga0496123_0008658_3119_3616 158
1044 3300048926 Ga0496123_0030918 Ga0496123_0030918_762_1259 158
1045 3300048926 Ga0496123_0055898 Ga0496123_0055898_471_947 158
1046 3300048926 Ga0496123_0077128 Ga0496123_0077128_470_967 158
1047 3300048927 Ga0496124_0008621 Ga0496124_0008621_8988_9485 158
1048 3300048927 Ga0496124_0023070 Ga0496124_0023070_968_1447 158
1049 3300048927 Ga0496124_0035244 Ga0496124_0035244_2678_3175 158
1050 3300048927 Ga0496124_0274342 Ga0496124_0274342_388_864 158
1051 3300048927 Ga0496124_0353882 Ga0496124_0353882_80_577 158
1052 3300048927 Ga0496124_0386900 Ga0496124_0386900_111_587 158
1053 3300048928 Ga0496125_0005687 Ga0496125_0005687_7472_7969 158
1054 3300048928 Ga0496125_0067235 Ga0496125_0067235_1412_1888 158
1055 3300048928 Ga0496125_0313219 Ga0496125_0313219_353_832 158
1056 3300048929 Ga0496126_0058039 Ga0496126_0058039_2128_2604 158
1057 3300048929 Ga0496126_0063975 Ga0496126_0063975_1081_1578 158
1058 3300048929 Ga0496126_0064123 Ga0496126_0064123_895_1392 158
1059 3300048929 Ga0496126_0556629 Ga0496126_0556629_280_759 158
1060 3300048929 Ga0496126_0577823 Ga0496126_0577823_12_509 158
1061 3300049459 Ga0495678_042285 Ga0495678_042285_686_1162 158
1062 3300049459 Ga0495678_084516 Ga0495678_084516_445_921 158
1063 3300049571 Ga0501034_0345362 Ga0501034_0345362_83_559 158
1064 3300049572 Ga0501036_0078466 Ga0501036_0078466_1110_1586 158
1065 3300049573 Ga0501037_0133340 Ga0501037_0133340_1031_1507 158
1066 3300049580 Ga0501046_0369144 Ga0501046_0369144_133_609 158
1067 3300049581 Ga0501047_0900762 Ga0501047_0900762_46_522 158
1068 3300049584 Ga0501068_0292612 Ga0501068_0292612_396_872 158
1069 3300049586 Ga0501070_0910576 Ga0501070_0910576_75_572 158
1070 3300049592 Ga0501076_1730454 Ga0501076_1730454_13_489 158
1071 3300049742 Ga0501080_0181495 Ga0501080_0181495_299_775 158
1072 3300049822 Ga0501035_0132077 Ga0501035_0132077_50_526 158
1073 3300049823 Ga0501044_0237335 Ga0501044_0237335_62_538 158
1074 3300050489 nmdc:mga03683_22372_c1 nmdc:mga03683_22372_c1_873_1370 158
1075 3300050489 nmdc:mga03683_47539_c1 nmdc:mga03683_47539_c1_330_806 158
1076 3300050490 nmdc:mga03n38_124021_c1 nmdc:mga03n38_124021_c1_47_523 158
1077 3300050490 nmdc:mga03n38_35795_c1 nmdc:mga03n38_35795_c1_145_642 158
1078 3300050490 nmdc:mga03n38_631065_c1 nmdc:mga03n38_631065_c1_123_599 158
1079 3300050490 nmdc:mga03n38_87203_c1 nmdc:mga03n38_87203_c1_846_1343 158
1080 3300050491 nmdc:mga00v17_202522_c1 nmdc:mga00v17_202522_c1_454_930 158
1081 3300050491 nmdc:mga00v17_569844_c1 nmdc:mga00v17_569844_c1_48_545 158
1082 3300050491 nmdc:mga00v17_9680_c1 nmdc:mga00v17_9680_c1_259_756 158
1083 3300050492 nmdc:mga0yw44_12368_c1 nmdc:mga0yw44_12368_c1_1928_2425 158
1084 3300050492 nmdc:mga0yw44_132598_c1 nmdc:mga0yw44_132598_c1_121_618 158
1085 3300050492 nmdc:mga0yw44_319901_c1 nmdc:mga0yw44_319901_c1_507_1004 158
1086 3300050492 nmdc:mga0yw44_474748_c1 nmdc:mga0yw44_474748_c1_115_591 158
1087 3300050493 nmdc:mga0k408_379304_c1 nmdc:mga0k408_379304_c1_259_756 158
1088 3300050493 nmdc:mga0k408_575918_c1 nmdc:mga0k408_575918_c1_70_567 158
1089 3300050494 nmdc:mga06z11_14207_c1 nmdc:mga06z11_14207_c1_1954_2451 158
1090 3300050494 nmdc:mga06z11_145082_c1 nmdc:mga06z11_145082_c1_542_1018 158
1091 3300050494 nmdc:mga06z11_20079_c1 nmdc:mga06z11_20079_c1_412_909 158
1092 3300050495 nmdc:mga04h51_115056_c1 nmdc:mga04h51_115056_c1_43_540 158
1093 3300050495 nmdc:mga04h51_246638_c1 nmdc:mga04h51_246638_c1_139_636 158
1094 3300050496 nmdc:mga07m45_106669_c1 nmdc:mga07m45_106669_c1_107_604 158
1095 3300050496 nmdc:mga07m45_13864_c1 nmdc:mga07m45_13864_c1_907_1383 158
1096 3300050496 nmdc:mga07m45_329980_c1 nmdc:mga07m45_329980_c1_311_808 158
1097 3300050516 nmdc:mga0sz30_121118_c1 nmdc:mga0sz30_121118_c1_443_940 158
1098 3300050516 nmdc:mga0sz30_169813_c1 nmdc:mga0sz30_169813_c1_237_734 158
1099 3300050516 nmdc:mga0sz30_31522_c1 nmdc:mga0sz30_31522_c1_938_1414 158
1100 3300053079 Ga0500610_0064332 Ga0500610_0064332_1021_1497 158
1101 3300053079 Ga0500610_0167408 Ga0500610_0167408_199_675 158
1102 3300053083 Ga0495655_0112839 Ga0495655_0112839_269_745 158
1103 3300053088 Ga0500644_0170197 Ga0500644_0170197_202_678 158
1104 3300053105 Ga0500557_014653 Ga0500557_014653_1464_1940 158
1105 3300053109 Ga0500569_007004 Ga0500569_007004_792_1268 158
1106 3300053109 Ga0500569_030321 Ga0500569_030321_592_1068 158
1107 3300053118 Ga0500594_0081562 Ga0500594_0081562_131_607 158
1108 3300053119 Ga0500595_060013 Ga0500595_060013_159_656 158
1109 3300053134 Ga0500658_0006268 Ga0500658_0006268_2538_3014 158
1110 3300053134 Ga0500658_0339962 Ga0500658_0339962_84_560 158
1111 3300053134 Ga0500658_0475661 Ga0500658_0475661_26_523 158
1112 3300053139 Ga0500568_0000108 Ga0500568_0000108_38735_39211 158
1113 3300053139 Ga0500568_0006791 Ga0500568_0006791_3781_4257 158
1114 3300053139 Ga0500568_0008893 Ga0500568_0008893_4030_4506 158
1115 3300053142 Ga0500577_0142941 Ga0500577_0142941_211_687 158
1116 3300053146 Ga0500588_0033680 Ga0500588_0033680_429_905 158
1117 3300053151 Ga0500604_0041599 Ga0500604_0041599_724_1200 158
1118 3300053153 Ga0500616_0094806 Ga0500616_0094806_92_568 158
1119 3300053156 Ga0500622_0002169 Ga0500622_0002169_1718_2194 158
1120 3300053158 Ga0500627_0083951 Ga0500627_0083951_139_615 158
1121 3300053727 Ga0500611_005807 Ga0500611_005807_562_1038 158
1122 3300053727 Ga0500611_111195 Ga0500611_111195_88_564 158
1123 3300053730 Ga0500645_153143 Ga0500645_153143_51_548 158
1124 iso_pu_bacteria 2693429783 2694633753 158
1125 iso_pu_bacteria 2693429784 2694639907 158
1126 iso_pu_bacteria 2856328259 2856330898 158
1127 iso_pu_bacteria 2856334872 2856339171 158
1128 iso_pu_bacteria 2857367948 2857370807 158
1129 iso_pu_bacteria 2869249662 2869252904 158
1130 iso_pu_bacteria 2869264136 2869270071 158
1131 iso_pu_bacteria 2869271264 2869274365 158
1132 iso_pu_bacteria 2871459585 2871462422 158
1133 iso_pu_bacteria 2874131515 2874138222 158
1134 iso_pu_bacteria 2876399893 2876399919 158
1135 iso_pu_bacteria 2876406927 2876408843 158
1136 iso_pu_bacteria 2878774303 2878774994 158
1137 iso_pu_bacteria 2906363423 2906364541 158
1138 iso_pu_bacteria 2906370794 2906374958 158
1139 iso_pu_bacteria 2906393657 2906394227 158
1140 iso_pu_bacteria 2924748358 2924751612 158
1141 iso_pu_bacteria 2961136820 2961140559 158
1142 iso_pu_bacteria 2965025482 2965026107 158
1143 iso_pu_bacteria 2965040258 2965047459 158
1144 iso_pu_bacteria 2965102966 2965105411 158
1145 iso_pu_bacteria 2977915119 2977917126 158
1146 iso_pu_bacteria 2977935797 2977940784 158
1147 iso_pu_bacteria 2977957713 2977959104 158
1148 iso_pu_bacteria 2979793036 2979796143 158
1149 iso_pu_bacteria 2987673487 2987677546 158
1150 iso_pu_bacteria 8004361976 8004366874 158
1151 iso_pu_bacteria 8004695233 8004696819 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

25

110

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8387 1 129
8p1x-assembly1.cif.gz_AAA tarm(se)_g117r-udp-glucose 0.821 59 85
4wac-assembly1.cif.gz_A crystal structure of tarm 0.8105 58 85
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7657 7 107
4x7r-assembly1.cif.gz_A crystal structure of s. aureus tarm g117r mutant in complex with fondaparinux, alpha-glcnac-glycerol and udp 0.7476 58 85
ID Description Score Start End Superfamily
af_Q2FZM7_1_163_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7797 58 85 3.40.50.2000
af_Q54X87_13_141_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7544 7 110 2.170.150.70
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.7543 4 128 3.90.1590.10
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.6928 4 128 3.90.1590.10
1xa8D00 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.638 1 137 3.90.1590.10
ID Description Score Start End GO Terms
AF-A0A527VRP0-F1-model_v4 GFA family protein 0.987 1 110 GO:0016846
GO:0046872
AF-A0A527HG45-F1-model_v4 GFA family protein 0.9857 1 80 GO:0016846
GO:0046872
AF-A0A527VRP0-F1-model_v4 GFA family protein 0.9782 1 110 GO:0016846
GO:0046872
AF-A0A7R6Z2B9-F1-model_v4 CENP-V/GFA domain-containing protein 0.9753 1 158 GO:0016846
GO:0046872
AF-A0A527HG45-F1-model_v4 GFA family protein 0.9737 1 80 GO:0016846
GO:0046872

Feature Viewer

pLDDT pTM Quality
88.48 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map