F490772
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1145 | 392 | 2290 | 243 |
Family's Representative Sequence
| Representative Sequence | 3300005981|Ga0081538_10000328|Ga0081538_1000032856 |
| Length | 284 |
| Sequence | MGDSMTTHTRMTRTRPWTQPSSHWLALRTLSIATFAAIVAAFSLVFFYAPLDADQGFIQKIFYLHVPLGIVALVGFIVAGIHAVRHLRSGDPVHDARSYVSIHISVIFGVAVLVTGSIWARASWGKWWVWDEPTLVSFLIVFLLYATYYPLRYAIEDRDRQARYASVFAIMAGAFVPLNFIAVRLAETLLHPRVFATAEGGMPGSMWLTFLVSLFGIALLWVTLVGFELAAKDASAQLARLRRALQPRPAAGSGRRSSAPATVSAMRKSNARLAGKSRGPRGPE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 194 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 195 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 197 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 205 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 213 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 218 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 219 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 220 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 224 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 226 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 227 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 233 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 234 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 235 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 237 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 238 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 239 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 240 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 241 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 242 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 243 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 244 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 245 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 246 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 247 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 248 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 249 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 250 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 251 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 252 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 312 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 313 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 314 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 315 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 316 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 317 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 320 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 321 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 322 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 323 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 324 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 325 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 326 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 327 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 328 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 329 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 330 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 331 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 332 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 333 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 334 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 371 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 372 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 386 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 387 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 388 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 389 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 392 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.65 |
| Metatranscriptomes | 0.35 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.32 |
| Nodule | 0 |
| Rhizoplane | 11.7 |
| Rhizosphere | 79.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081538_10000328 | 3300005981 | Bacteria | 54328 |
| 2 | JGI24746J21847_1005583 | 3300001977 | Bacteria | 1961 |
| 3 | JGI24740J21852_10011273 | 3300001979 | Bacteria | 3408 |
| 4 | JGI24735J21928_10082687 | 3300002067 | Bacteria | 920 |
| 5 | JGI24750J21931_1031192 | 3300002070 | Bacteria | 782 |
| 6 | JGI24034J26672_10000392 | 3300002239 | Bacteria | 5690 |
| 7 | JGI24751J29686_10008668 | 3300002459 | Bacteria | 2083 |
| 8 | JGI25407J50210_10000894 | 3300003373 | Bacteria | 6419 |
| 9 | JGI25404J52841_10016459 | 3300003659 | Bacteria | 1604 |
| 10 | Ga0070658_10100748 | 3300005327 | Bacteria | 2388 |
| 11 | Ga0070658_10627794 | 3300005327 | Bacteria | 932 |
| 12 | Ga0070676_10082695 | 3300005328 | Bacteria | 1951 |
| 13 | Ga0070676_10296906 | 3300005328 | Bacteria | 1094 |
| 14 | Ga0070683_100002929 | 3300005329 | Bacteria | 13677 |
| 15 | Ga0070683_100003428 | 3300005329 | Bacteria | 12876 |
| 16 | Ga0070683_100030213 | 3300005329 | Bacteria | 4914 |
| 17 | Ga0070683_100035272 | 3300005329 | Bacteria | 4572 |
| 18 | Ga0070683_100082681 | 3300005329 | Bacteria | 3007 |
| 19 | Ga0070683_100111338 | 3300005329 | Bacteria | 2583 |
| 20 | Ga0070690_100193089 | 3300005330 | Bacteria | 1413 |
| 21 | Ga0070670_100226741 | 3300005331 | Bacteria | 1626 |
| 22 | Ga0070677_10000006 | 3300005333 | Bacteria | 75244 |
| 23 | Ga0070680_100001511 | 3300005336 | Bacteria | 16937 |
| 24 | Ga0070680_100043821 | 3300005336 | Bacteria | 3635 |
| 25 | Ga0070680_100375201 | 3300005336 | Bacteria | 1211 |
| 26 | Ga0070682_100000029 | 3300005337 | Bacteria | 183516 |
| 27 | Ga0070682_100026759 | 3300005337 | Bacteria | 3455 |
| 28 | Ga0070682_100046608 | 3300005337 | Bacteria | 2691 |
| 29 | Ga0070682_100051988 | 3300005337 | Bacteria | 2563 |
| 30 | Ga0068868_100001567 | 3300005338 | Bacteria | 15608 |
| 31 | Ga0068868_100004232 | 3300005338 | Bacteria | 10039 |
| 32 | Ga0068868_100029546 | 3300005338 | Bacteria | 4198 |
| 33 | Ga0070660_100000784 | 3300005339 | Bacteria | 21126 |
| 34 | Ga0070660_100013210 | 3300005339 | Bacteria | 5918 |
| 35 | Ga0070660_100041823 | 3300005339 | Bacteria | 3495 |
| 36 | Ga0070660_100130483 | 3300005339 | Bacteria | 2011 |
| 37 | Ga0070660_100233469 | 3300005339 | Bacteria | 1497 |
| 38 | Ga0070689_100095957 | 3300005340 | Bacteria | 2343 |
| 39 | Ga0070689_100234061 | 3300005340 | Bacteria | 1511 |
| 40 | Ga0070689_100417259 | 3300005340 | Bacteria | 1137 |
| 41 | Ga0070691_10000069 | 3300005341 | Bacteria | 28638 |
| 42 | Ga0070691_10013503 | 3300005341 | Bacteria | 3741 |
| 43 | Ga0070691_10053497 | 3300005341 | Bacteria | 1931 |
| 44 | Ga0070687_100138570 | 3300005343 | Bacteria | 1414 |
| 45 | Ga0070661_100000161 | 3300005344 | Bacteria | 55183 |
| 46 | Ga0070661_100060433 | 3300005344 | Bacteria | 2781 |
| 47 | Ga0070661_100062495 | 3300005344 | Bacteria | 2734 |
| 48 | Ga0070692_10005505 | 3300005345 | Bacteria | 5409 |
| 49 | Ga0070692_10030508 | 3300005345 | Bacteria | 2696 |
| 50 | Ga0070668_100080075 | 3300005347 | Bacteria | 2558 |
| 51 | Ga0070669_100008473 | 3300005353 | Bacteria | 7341 |
| 52 | Ga0070669_100177477 | 3300005353 | Bacteria | 1664 |
| 53 | Ga0070669_100178720 | 3300005353 | Bacteria | 1659 |
| 54 | Ga0070675_100000153 | 3300005354 | Bacteria | 41558 |
| 55 | Ga0070671_100149015 | 3300005355 | Bacteria | 1975 |
| 56 | Ga0070674_100000014 | 3300005356 | Bacteria | 100122 |
| 57 | Ga0070674_100000033 | 3300005356 | Bacteria | 63982 |
| 58 | Ga0070674_100043542 | 3300005356 | Bacteria | 3054 |
| 59 | Ga0070674_100086322 | 3300005356 | Bacteria | 2254 |
| 60 | Ga0070673_100023228 | 3300005364 | Bacteria | 4529 |
| 61 | Ga0070688_100000853 | 3300005365 | Bacteria | 15130 |
| 62 | Ga0070688_100045831 | 3300005365 | Bacteria | 2704 |
| 63 | Ga0070659_100000002 | 3300005366 | Bacteria | 369239 |
| 64 | Ga0070659_100007235 | 3300005366 | Bacteria | 8057 |
| 65 | Ga0070659_100016061 | 3300005366 | Bacteria | 5617 |
| 66 | Ga0070659_100082914 | 3300005366 | Bacteria | 2562 |
| 67 | Ga0070667_100024800 | 3300005367 | Bacteria | 4982 |
| 68 | Ga0070667_100045427 | 3300005367 | Bacteria | 3693 |
| 69 | Ga0070667_100514036 | 3300005367 | Bacteria | 1098 |
| 70 | Ga0070714_100000170 | 3300005435 | Bacteria | 52761 |
| 71 | Ga0070714_100020511 | 3300005435 | Bacteria | 5398 |
| 72 | Ga0070714_100099532 | 3300005435 | Bacteria | 2559 |
| 73 | Ga0070714_100188096 | 3300005435 | Bacteria | 1882 |
| 74 | Ga0070714_100205979 | 3300005435 | Bacteria | 1801 |
| 75 | Ga0070714_100304747 | 3300005435 | Bacteria | 1486 |
| 76 | Ga0070713_100187446 | 3300005436 | Bacteria | 1862 |
| 77 | Ga0070713_100366033 | 3300005436 | Bacteria | 1340 |
| 78 | Ga0070713_100551219 | 3300005436 | Bacteria | 1092 |
| 79 | Ga0070710_10000006 | 3300005437 | Bacteria | 217422 |
| 80 | Ga0070711_100131113 | 3300005439 | Unclassified | 1867 |
| 81 | Ga0070711_100678739 | 3300005439 | Bacteria | 866 |
| 82 | Ga0070705_100001402 | 3300005440 | Bacteria | 12780 |
| 83 | Ga0070700_100015821 | 3300005441 | Bacteria | 4286 |
| 84 | Ga0070700_100065674 | 3300005441 | Bacteria | 2301 |
| 85 | Ga0070694_100275594 | 3300005444 | Bacteria | 1281 |
| 86 | Ga0070663_100005918 | 3300005455 | Bacteria | 7320 |
| 87 | Ga0070663_100006461 | 3300005455 | Bacteria | 7054 |
| 88 | Ga0070663_100308495 | 3300005455 | Bacteria | 1269 |
| 89 | Ga0070678_100097190 | 3300005456 | Bacteria | 2274 |
| 90 | Ga0070678_100097480 | 3300005456 | Bacteria | 2271 |
| 91 | Ga0070678_100304205 | 3300005456 | Bacteria | 1356 |
| 92 | Ga0070678_100401626 | 3300005456 | Bacteria | 1191 |
| 93 | Ga0070662_100000008 | 3300005457 | Bacteria | 168754 |
| 94 | Ga0070681_10009233 | 3300005458 | Bacteria | 9692 |
| 95 | Ga0070681_10014965 | 3300005458 | Bacteria | 7715 |
| 96 | Ga0070681_10051191 | 3300005458 | Bacteria | 4120 |
| 97 | Ga0068867_100000247 | 3300005459 | Bacteria | 35692 |
| 98 | Ga0070685_10000203 | 3300005466 | Bacteria | 39835 |
| 99 | Ga0070685_10001711 | 3300005466 | Bacteria | 11510 |
| 100 | Ga0070685_10051492 | 3300005466 | Bacteria | 2381 |
| 101 | Ga0070679_100002585 | 3300005530 | Bacteria | 16453 |
| 102 | Ga0070679_100002649 | 3300005530 | Bacteria | 16293 |
| 103 | Ga0070679_100014750 | 3300005530 | Bacteria | 7508 |
| 104 | Ga0070679_100116556 | 3300005530 | Bacteria | 2656 |
| 105 | Ga0070679_100282348 | 3300005530 | Bacteria | 1613 |
| 106 | Ga0070684_100002882 | 3300005535 | Bacteria | 12789 |
| 107 | Ga0070684_100005122 | 3300005535 | Bacteria | 10017 |
| 108 | Ga0070684_100015188 | 3300005535 | Bacteria | 6262 |
| 109 | Ga0070684_100108633 | 3300005535 | Bacteria | 2486 |
| 110 | Ga0070684_100112693 | 3300005535 | Bacteria | 2440 |
| 111 | Ga0070684_100115689 | 3300005535 | Bacteria | 2408 |
| 112 | Ga0070684_100149567 | 3300005535 | Bacteria | 2115 |
| 113 | Ga0070684_100216075 | 3300005535 | Bacteria | 1748 |
| 114 | Ga0070684_100285420 | 3300005535 | Bacteria | 1513 |
| 115 | Ga0070684_100597746 | 3300005535 | Bacteria | 1026 |
| 116 | Ga0070684_100801110 | 3300005535 | Bacteria | 881 |
| 117 | Ga0068853_100002309 | 3300005539 | Bacteria | 14267 |
| 118 | Ga0068853_100266063 | 3300005539 | Bacteria | 1577 |
| 119 | Ga0068853_100281683 | 3300005539 | Bacteria | 1533 |
| 120 | Ga0068853_100349858 | 3300005539 | Bacteria | 1374 |
| 121 | Ga0070672_100000262 | 3300005543 | Bacteria | 29769 |
| 122 | Ga0070672_100010429 | 3300005543 | Bacteria | 6447 |
| 123 | Ga0070686_100066715 | 3300005544 | Bacteria | 2342 |
| 124 | Ga0070686_100123268 | 3300005544 | Bacteria | 1782 |
| 125 | Ga0070686_100168630 | 3300005544 | Bacteria | 1547 |
| 126 | Ga0070686_100252449 | 3300005544 | Bacteria | 1289 |
| 127 | Ga0070696_100186171 | 3300005546 | Bacteria | 1543 |
| 128 | Ga0070693_100001031 | 3300005547 | Bacteria | 12430 |
| 129 | Ga0070693_100503345 | 3300005547 | Bacteria | 860 |
| 130 | Ga0070665_100000870 | 3300005548 | Bacteria | 39061 |
| 131 | Ga0070665_100025257 | 3300005548 | Bacteria | 5986 |
| 132 | Ga0070704_100117440 | 3300005549 | Bacteria | 2036 |
| 133 | Ga0070704_100325809 | 3300005549 | Bacteria | 1289 |
| 134 | Ga0070704_100331944 | 3300005549 | Bacteria | 1278 |
| 135 | Ga0070704_100474985 | 3300005549 | Bacteria | 1081 |
| 136 | Ga0068855_100493914 | 3300005563 | Bacteria | 1331 |
| 137 | Ga0070664_100026536 | 3300005564 | Bacteria | 4806 |
| 138 | Ga0070664_100045886 | 3300005564 | Bacteria | 3691 |
| 139 | Ga0070664_100085667 | 3300005564 | Bacteria | 2722 |
| 140 | Ga0070664_100127841 | 3300005564 | Bacteria | 2230 |
| 141 | Ga0068854_100000115 | 3300005578 | Bacteria | 55089 |
| 142 | Ga0068854_100025929 | 3300005578 | Bacteria | 4024 |
| 143 | Ga0068854_100037063 | 3300005578 | Bacteria | 3421 |
| 144 | Ga0068854_100316523 | 3300005578 | Bacteria | 1267 |
| 145 | Ga0068856_100000057 | 3300005614 | Bacteria | 102045 |
| 146 | Ga0068856_100009716 | 3300005614 | Bacteria | 9344 |
| 147 | Ga0068856_100017908 | 3300005614 | Bacteria | 6870 |
| 148 | Ga0068856_100080915 | 3300005614 | Bacteria | 3222 |
| 149 | Ga0068856_100109097 | 3300005614 | Bacteria | 2764 |
| 150 | Ga0068856_100319245 | 3300005614 | Bacteria | 1570 |
| 151 | Ga0070702_100017882 | 3300005615 | Bacteria | 3666 |
| 152 | Ga0068852_100000058 | 3300005616 | Bacteria | 75312 |
| 153 | Ga0068852_100043696 | 3300005616 | Bacteria | 3801 |
| 154 | Ga0068852_100540323 | 3300005616 | Bacteria | 1165 |
| 155 | Ga0068852_100798096 | 3300005616 | Bacteria | 958 |
| 156 | Ga0068852_100803851 | 3300005616 | Bacteria | 954 |
| 157 | Ga0068859_100266922 | 3300005617 | Bacteria | 1803 |
| 158 | Ga0068864_100000262 | 3300005618 | Bacteria | 47006 |
| 159 | Ga0068864_100217585 | 3300005618 | Bacteria | 1761 |
| 160 | Ga0068866_10000002 | 3300005718 | Bacteria | 394090 |
| 161 | Ga0068866_10001413 | 3300005718 | Bacteria | 10308 |
| 162 | Ga0068866_10017802 | 3300005718 | Bacteria | 3202 |
| 163 | Ga0068866_10031076 | 3300005718 | Bacteria | 2569 |
| 164 | Ga0068851_10014822 | 3300005834 | Bacteria | 3707 |
| 165 | Ga0068851_10054543 | 3300005834 | Bacteria | 2036 |
| 166 | Ga0068870_10120353 | 3300005840 | Bacteria | 1512 |
| 167 | Ga0068863_100000042 | 3300005841 | Bacteria | 154459 |
| 168 | Ga0068858_100000086 | 3300005842 | Bacteria | 96201 |
| 169 | Ga0068858_100000155 | 3300005842 | Bacteria | 72794 |
| 170 | Ga0068858_100149827 | 3300005842 | Bacteria | 2193 |
| 171 | Ga0068858_100182184 | 3300005842 | Unclassified | 1984 |
| 172 | Ga0068860_100061823 | 3300005843 | Bacteria | 3558 |
| 173 | Ga0068860_100173607 | 3300005843 | Bacteria | 2083 |
| 174 | Ga0068862_100006786 | 3300005844 | Bacteria | 9492 |
| 175 | Ga0068862_100271700 | 3300005844 | Bacteria | 1550 |
| 176 | Ga0081455_10008739 | 3300005937 | Bacteria | 10488 |
| 177 | Ga0081455_10013826 | 3300005937 | Bacteria | 7943 |
| 178 | Ga0081455_10022993 | 3300005937 | Bacteria | 5811 |
| 179 | Ga0081455_10024890 | 3300005937 | Bacteria | 5534 |
| 180 | Ga0081455_10034667 | 3300005937 | Bacteria | 4519 |
| 181 | Ga0081455_10045051 | 3300005937 | Bacteria | 3841 |
| 182 | Ga0081455_10103074 | 3300005937 | Bacteria | 2286 |
| 183 | Ga0081455_10106184 | 3300005937 | Bacteria | 2242 |
| 184 | Ga0081538_10000114 | 3300005981 | Bacteria | 81354 |
| 185 | Ga0081538_10000357 | 3300005981 | Bacteria | 51919 |
| 186 | Ga0081538_10001471 | 3300005981 | Bacteria | 24193 |
| 187 | Ga0081538_10007628 | 3300005981 | Bacteria | 9327 |
| 188 | Ga0081540_1000427 | 3300005983 | Bacteria | 41566 |
| 189 | Ga0081540_1000546 | 3300005983 | Bacteria | 36470 |
| 190 | Ga0081540_1001605 | 3300005983 | Bacteria | 19279 |
| 191 | Ga0081540_1027018 | 3300005983 | Bacteria | 3261 |
| 192 | Ga0081540_1110011 | 3300005983 | Bacteria | 1167 |
| 193 | Ga0081540_1133440 | 3300005983 | Bacteria | 1010 |
| 194 | Ga0081539_10001100 | 3300005985 | Bacteria | 49090 |
| 195 | Ga0081539_10014343 | 3300005985 | Bacteria | 5870 |
| 196 | Ga0081539_10100845 | 3300005985 | Bacteria | 1472 |
| 197 | Ga0070717_10000005 | 3300006028 | Bacteria | 357819 |
| 198 | Ga0070717_10157982 | 3300006028 | Bacteria | 1965 |
| 199 | Ga0070717_10196937 | 3300006028 | Bacteria | 1763 |
| 200 | Ga0075365_10005616 | 3300006038 | Bacteria | 6787 |
| 201 | Ga0075365_10006075 | 3300006038 | Bacteria | 6597 |
| 202 | Ga0075365_10015257 | 3300006038 | Bacteria | 4643 |
| 203 | Ga0075365_10015633 | 3300006038 | Bacteria | 4594 |
| 204 | Ga0075365_10044115 | 3300006038 | Bacteria | 2921 |
| 205 | Ga0075365_10063852 | 3300006038 | Bacteria | 2465 |
| 206 | Ga0075365_10089498 | 3300006038 | Bacteria | 2095 |
| 207 | Ga0075365_10094113 | 3300006038 | Bacteria | 2044 |
| 208 | Ga0075365_10175830 | 3300006038 | Bacteria | 1495 |
| 209 | Ga0075365_10461095 | 3300006038 | Bacteria | 897 |
| 210 | Ga0075363_100009204 | 3300006048 | Bacteria | 4638 |
| 211 | Ga0075363_100042038 | 3300006048 | Bacteria | 2413 |
| 212 | Ga0075363_100231670 | 3300006048 | Bacteria | 1060 |
| 213 | Ga0075363_100276310 | 3300006048 | Bacteria | 971 |
| 214 | Ga0075364_10037299 | 3300006051 | Bacteria | 3146 |
| 215 | Ga0075364_10089986 | 3300006051 | Bacteria | 2036 |
| 216 | Ga0075364_10160283 | 3300006051 | Bacteria | 1518 |
| 217 | Ga0075364_10392739 | 3300006051 | Bacteria | 946 |
| 218 | Ga0075432_10008489 | 3300006058 | Bacteria | 3504 |
| 219 | Ga0070715_10000015 | 3300006163 | Bacteria | 152816 |
| 220 | Ga0070716_100038221 | 3300006173 | Bacteria | 2657 |
| 221 | Ga0070712_100003222 | 3300006175 | Bacteria | 10059 |
| 222 | Ga0075367_10084122 | 3300006178 | Bacteria | 1928 |
| 223 | Ga0075367_10232439 | 3300006178 | Bacteria | 1155 |
| 224 | Ga0075370_10137887 | 3300006353 | Bacteria | 1426 |
| 225 | Ga0068871_100306784 | 3300006358 | Bacteria | 1394 |
| 226 | Ga0075428_100347537 | 3300006844 | Bacteria | 1592 |
| 227 | Ga0075430_100058859 | 3300006846 | Bacteria | 3230 |
| 228 | Ga0075430_100233371 | 3300006846 | Bacteria | 1525 |
| 229 | Ga0075431_100009378 | 3300006847 | Bacteria | 9824 |
| 230 | Ga0075431_100228260 | 3300006847 | Bacteria | 1897 |
| 231 | Ga0075431_100412829 | 3300006847 | Bacteria | 1350 |
| 232 | Ga0075433_10000663 | 3300006852 | Bacteria | 23254 |
| 233 | Ga0075433_10003490 | 3300006852 | Bacteria | 12148 |
| 234 | Ga0075433_10008610 | 3300006852 | Bacteria | 8139 |
| 235 | Ga0075434_100009254 | 3300006871 | Bacteria | 9179 |
| 236 | Ga0075434_100622853 | 3300006871 | Bacteria | 1098 |
| 237 | Ga0075429_100281353 | 3300006880 | Unclassified | 1457 |
| 238 | Ga0075429_100420370 | 3300006880 | Bacteria | 1171 |
| 239 | Ga0068865_100000020 | 3300006881 | Bacteria | 104487 |
| 240 | Ga0068865_100023362 | 3300006881 | Bacteria | 4047 |
| 241 | Ga0068865_100242781 | 3300006881 | Bacteria | 1418 |
| 242 | Ga0075436_100326432 | 3300006914 | Bacteria | 1103 |
| 243 | Ga0097620_100266939 | 3300006931 | Bacteria | 1803 |
| 244 | Ga0105244_10213774 | 3300009036 | Bacteria | 906 |
| 245 | Ga0105240_10091944 | 3300009093 | Bacteria | 3706 |
| 246 | Ga0105240_10183320 | 3300009093 | Bacteria | 2469 |
| 247 | Ga0105240_10779718 | 3300009093 | Bacteria | 1037 |
| 248 | Ga0111539_10027089 | 3300009094 | Bacteria | 7001 |
| 249 | Ga0111539_10256714 | 3300009094 | Bacteria | 2035 |
| 250 | Ga0111539_10619545 | 3300009094 | Bacteria | 1260 |
| 251 | Ga0105245_10000053 | 3300009098 | Bacteria | 125678 |
| 252 | Ga0105245_10000159 | 3300009098 | Bacteria | 63630 |
| 253 | Ga0105245_10001015 | 3300009098 | Bacteria | 25483 |
| 254 | Ga0105245_10001365 | 3300009098 | Bacteria | 22096 |
| 255 | Ga0105245_10002749 | 3300009098 | Bacteria | 15821 |
| 256 | Ga0105245_10011439 | 3300009098 | Bacteria | 7728 |
| 257 | Ga0105245_10217551 | 3300009098 | Bacteria | 1841 |
| 258 | Ga0105247_10052018 | 3300009101 | Bacteria | 2524 |
| 259 | Ga0105247_10065907 | 3300009101 | Bacteria | 2253 |
| 260 | Ga0105247_10362632 | 3300009101 | Bacteria | 1022 |
| 261 | Ga0114129_10005150 | 3300009147 | Bacteria | 18404 |
| 262 | Ga0114129_10071282 | 3300009147 | Bacteria | 4846 |
| 263 | Ga0114129_10076902 | 3300009147 | Bacteria | 4645 |
| 264 | Ga0114129_10259087 | 3300009147 | Bacteria | 2332 |
| 265 | Ga0114129_10488040 | 3300009147 | Bacteria | 1611 |
| 266 | Ga0105243_10002833 | 3300009148 | Bacteria | 14390 |
| 267 | Ga0105243_10006302 | 3300009148 | Bacteria | 9168 |
| 268 | Ga0105243_10400784 | 3300009148 | Bacteria | 1274 |
| 269 | Ga0105241_10131796 | 3300009174 | Bacteria | 2025 |
| 270 | Ga0105242_10000017 | 3300009176 | Bacteria | 122190 |
| 271 | Ga0105242_10002766 | 3300009176 | Bacteria | 13729 |
| 272 | Ga0105242_10028630 | 3300009176 | Bacteria | 4437 |
| 273 | Ga0105242_10390535 | 3300009176 | Bacteria | 1296 |
| 274 | Ga0105242_10509441 | 3300009176 | Bacteria | 1146 |
| 275 | Ga0105242_10633653 | 3300009176 | Bacteria | 1037 |
| 276 | Ga0105237_10180125 | 3300009545 | Bacteria | 2114 |
| 277 | Ga0105237_10358123 | 3300009545 | Bacteria | 1463 |
| 278 | Ga0105237_10418753 | 3300009545 | Bacteria | 1345 |
| 279 | Ga0105237_10952258 | 3300009545 | Bacteria | 865 |
| 280 | Ga0105238_10026476 | 3300009551 | Bacteria | 5914 |
| 281 | Ga0105238_10093086 | 3300009551 | Bacteria | 3002 |
| 282 | Ga0105249_10000085 | 3300009553 | Bacteria | 133497 |
| 283 | Ga0105249_10000841 | 3300009553 | Bacteria | 27506 |
| 284 | Ga0105249_10103913 | 3300009553 | Bacteria | 2676 |
| 285 | Ga0105249_10337817 | 3300009553 | Bacteria | 1522 |
| 286 | Ga0105249_10427285 | 3300009553 | Bacteria | 1360 |
| 287 | Ga0105239_10091386 | 3300010375 | Bacteria | 3359 |
| 288 | Ga0105239_10141631 | 3300010375 | Bacteria | 2680 |
| 289 | Ga0105239_10186124 | 3300010375 | Bacteria | 2324 |
| 290 | Ga0105239_10218964 | 3300010375 | Bacteria | 2135 |
| 291 | Ga0105246_10016207 | 3300011119 | Bacteria | 4717 |
| 292 | Ga0105246_10377751 | 3300011119 | Bacteria | 1170 |
| 293 | Ga0157371_10041090 | 3300013102 | Bacteria | 3301 |
| 294 | Ga0157370_10017872 | 3300013104 | Bacteria | 7144 |
| 295 | Ga0157370_10040093 | 3300013104 | Bacteria | 4522 |
| 296 | Ga0157370_10519131 | 3300013104 | Bacteria | 1093 |
| 297 | Ga0157369_10000118 | 3300013105 | Bacteria | 111618 |
| 298 | Ga0157369_10109106 | 3300013105 | Bacteria | 2943 |
| 299 | Ga0157369_10300821 | 3300013105 | Bacteria | 1669 |
| 300 | Ga0157369_10873716 | 3300013105 | Bacteria | 923 |
| 301 | Ga0157374_10015535 | 3300013296 | Bacteria | 6678 |
| 302 | Ga0157374_10591849 | 3300013296 | Bacteria | 1119 |
| 303 | Ga0157378_10227755 | 3300013297 | Bacteria | 1774 |
| 304 | Ga0157378_10367759 | 3300013297 | Bacteria | 1409 |
| 305 | Ga0163162_10208219 | 3300013306 | Bacteria | 2085 |
| 306 | Ga0163162_10528766 | 3300013306 | Bacteria | 1308 |
| 307 | Ga0157372_10000616 | 3300013307 | Bacteria | 38850 |
| 308 | Ga0157372_10131416 | 3300013307 | Bacteria | 2881 |
| 309 | Ga0157372_10482863 | 3300013307 | Bacteria | 1445 |
| 310 | Ga0157375_10001691 | 3300013308 | Bacteria | 18948 |
| 311 | Ga0157375_10004687 | 3300013308 | Bacteria | 11895 |
| 312 | Ga0157375_10026400 | 3300013308 | Bacteria | 5412 |
| 313 | Ga0157375_10028700 | 3300013308 | Bacteria | 5221 |
| 314 | Ga0157375_10142517 | 3300013308 | Bacteria | 2525 |
| 315 | Ga0157375_11524047 | 3300013308 | Bacteria | 789 |
| 316 | Ga0163163_10055862 | 3300014325 | Bacteria | 3902 |
| 317 | Ga0163163_10258811 | 3300014325 | Bacteria | 1791 |
| 318 | Ga0163163_10695715 | 3300014325 | Bacteria | 1080 |
| 319 | Ga0157380_10000024 | 3300014326 | Bacteria | 110947 |
| 320 | Ga0157380_10000080 | 3300014326 | Bacteria | 53731 |
| 321 | Ga0182008_10151795 | 3300014497 | Bacteria | 1162 |
| 322 | Ga0157379_10047840 | 3300014968 | Bacteria | 3817 |
| 323 | Ga0157379_10128171 | 3300014968 | Bacteria | 2283 |
| 324 | Ga0157379_10331926 | 3300014968 | Bacteria | 1390 |
| 325 | Ga0157376_10003520 | 3300014969 | Bacteria | 10800 |
| 326 | Ga0157376_10034676 | 3300014969 | Bacteria | 4076 |
| 327 | Ga0163161_10000364 | 3300017792 | Bacteria | 37857 |
| 328 | Ga0163161_10707599 | 3300017792 | Bacteria | 839 |
| 329 | Ga0206356_11585180 | 3300020070 | Bacteria | 3300 |
| 330 | Ga0206356_11678748 | 3300020070 | Bacteria | 1674 |
| 331 | Ga0206354_10417134 | 3300020081 | Bacteria | 2104 |
| 332 | Ga0206353_11990320 | 3300020082 | Bacteria | 4648 |
| 333 | Ga0213874_10009823 | 3300021377 | Bacteria | 2379 |
| 334 | Ga0213874_10021776 | 3300021377 | Bacteria | 1771 |
| 335 | Ga0213874_10049567 | 3300021377 | Bacteria | 1284 |
| 336 | Ga0213874_10090197 | 3300021377 | Bacteria | 1006 |
| 337 | Ga0213876_10015206 | 3300021384 | Bacteria | 4076 |
| 338 | Ga0213876_10021333 | 3300021384 | Bacteria | 3426 |
| 339 | Ga0213876_10043521 | 3300021384 | Bacteria | 2373 |
| 340 | Ga0213876_10043663 | 3300021384 | Bacteria | 2369 |
| 341 | Ga0213876_10243084 | 3300021384 | Bacteria | 957 |
| 342 | Ga0213875_10010967 | 3300021388 | Bacteria | 4526 |
| 343 | Ga0213875_10016033 | 3300021388 | Bacteria | 3636 |
| 344 | Ga0213875_10048975 | 3300021388 | Bacteria | 1981 |
| 345 | Ga0213875_10131837 | 3300021388 | Bacteria | 1169 |
| 346 | Ga0207656_10008405 | 3300025321 | Bacteria | 3798 |
| 347 | Ga0207656_10008446 | 3300025321 | Bacteria | 3792 |
| 348 | Ga0207682_10000036 | 3300025893 | Bacteria | 55330 |
| 349 | Ga0207692_10000001 | 3300025898 | Bacteria | 558345 |
| 350 | Ga0207692_10041316 | 3300025898 | Bacteria | 2282 |
| 351 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 352 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 353 | Ga0207642_10000094 | 3300025899 | Bacteria | 23395 |
| 354 | Ga0207642_10005915 | 3300025899 | Bacteria | 4029 |
| 355 | Ga0207710_10000151 | 3300025900 | Bacteria | 77424 |
| 356 | Ga0207710_10075132 | 3300025900 | Bacteria | 1557 |
| 357 | Ga0207688_10004383 | 3300025901 | Bacteria | 7686 |
| 358 | Ga0207680_10095941 | 3300025903 | Bacteria | 1896 |
| 359 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 360 | Ga0207685_10013360 | 3300025905 | Bacteria | 2537 |
| 361 | Ga0207645_10162962 | 3300025907 | Bacteria | 1459 |
| 362 | Ga0207643_10156726 | 3300025908 | Bacteria | 1368 |
| 363 | Ga0207705_10060535 | 3300025909 | Bacteria | 2735 |
| 364 | Ga0207705_10122277 | 3300025909 | Bacteria | 1932 |
| 365 | Ga0207707_10015020 | 3300025912 | Bacteria | 6742 |
| 366 | Ga0207707_10031589 | 3300025912 | Bacteria | 4634 |
| 367 | Ga0207707_10063719 | 3300025912 | Bacteria | 3209 |
| 368 | Ga0207695_10097188 | 3300025913 | Bacteria | 2946 |
| 369 | Ga0207695_10146494 | 3300025913 | Bacteria | 2305 |
| 370 | Ga0207671_10310056 | 3300025914 | Bacteria | 1247 |
| 371 | Ga0207671_10316281 | 3300025914 | Bacteria | 1235 |
| 372 | Ga0207693_10000464 | 3300025915 | Bacteria | 37116 |
| 373 | Ga0207693_10000905 | 3300025915 | Bacteria | 26632 |
| 374 | Ga0207693_10006011 | 3300025915 | Bacteria | 10061 |
| 375 | Ga0207663_10049919 | 3300025916 | Bacteria | 2598 |
| 376 | Ga0207663_10150030 | 3300025916 | Bacteria | 1634 |
| 377 | Ga0207663_10201747 | 3300025916 | Bacteria | 1435 |
| 378 | Ga0207660_10020675 | 3300025917 | Bacteria | 4421 |
| 379 | Ga0207660_10510945 | 3300025917 | Bacteria | 975 |
| 380 | Ga0207662_10055093 | 3300025918 | Bacteria | 2372 |
| 381 | Ga0207662_10135146 | 3300025918 | Bacteria | 1558 |
| 382 | Ga0207662_10370406 | 3300025918 | Bacteria | 966 |
| 383 | Ga0207657_10000514 | 3300025919 | Bacteria | 40984 |
| 384 | Ga0207657_10016416 | 3300025919 | Bacteria | 7143 |
| 385 | Ga0207657_10050060 | 3300025919 | Bacteria | 3637 |
| 386 | Ga0207657_10070903 | 3300025919 | Bacteria | 2952 |
| 387 | Ga0207649_10000024 | 3300025920 | Bacteria | 183104 |
| 388 | Ga0207649_10010436 | 3300025920 | Bacteria | 5104 |
| 389 | Ga0207652_10000150 | 3300025921 | Bacteria | 75189 |
| 390 | Ga0207652_10002711 | 3300025921 | Bacteria | 14855 |
| 391 | Ga0207652_10008834 | 3300025921 | Bacteria | 8116 |
| 392 | Ga0207652_10090480 | 3300025921 | Bacteria | 2689 |
| 393 | Ga0207681_10067184 | 3300025923 | Bacteria | 2485 |
| 394 | Ga0207694_10000035 | 3300025924 | Bacteria | 195870 |
| 395 | Ga0207694_10022313 | 3300025924 | Bacteria | 4801 |
| 396 | Ga0207694_10319454 | 3300025924 | Bacteria | 1281 |
| 397 | Ga0207650_10043219 | 3300025925 | Bacteria | 3307 |
| 398 | Ga0207650_10496911 | 3300025925 | Bacteria | 1019 |
| 399 | Ga0207659_10000043 | 3300025926 | Bacteria | 90795 |
| 400 | Ga0207659_10070993 | 3300025926 | Bacteria | 2541 |
| 401 | Ga0207687_10000011 | 3300025927 | Bacteria | 388349 |
| 402 | Ga0207687_10000021 | 3300025927 | Bacteria | 226396 |
| 403 | Ga0207687_10000350 | 3300025927 | Bacteria | 30682 |
| 404 | Ga0207687_10002791 | 3300025927 | Bacteria | 11845 |
| 405 | Ga0207687_10022605 | 3300025927 | Bacteria | 4187 |
| 406 | Ga0207687_10090709 | 3300025927 | Bacteria | 2228 |
| 407 | Ga0207687_10185163 | 3300025927 | Bacteria | 1616 |
| 408 | Ga0207700_10000009 | 3300025928 | Bacteria | 314953 |
| 409 | Ga0207700_10288869 | 3300025928 | Bacteria | 1413 |
| 410 | Ga0207700_10509018 | 3300025928 | Bacteria | 1066 |
| 411 | Ga0207700_10620661 | 3300025928 | Bacteria | 963 |
| 412 | Ga0207664_10000035 | 3300025929 | Bacteria | 173780 |
| 413 | Ga0207664_10163609 | 3300025929 | Bacteria | 1899 |
| 414 | Ga0207664_10222317 | 3300025929 | Bacteria | 1638 |
| 415 | Ga0207664_10435931 | 3300025929 | Bacteria | 1168 |
| 416 | Ga0207644_10062523 | 3300025931 | Bacteria | 2701 |
| 417 | Ga0207690_10000024 | 3300025932 | Bacteria | 194416 |
| 418 | Ga0207690_10003651 | 3300025932 | Bacteria | 9165 |
| 419 | Ga0207690_10010080 | 3300025932 | Bacteria | 5614 |
| 420 | Ga0207706_10000016 | 3300025933 | Bacteria | 170697 |
| 421 | Ga0207706_10385087 | 3300025933 | Bacteria | 1217 |
| 422 | Ga0207686_10000016 | 3300025934 | Bacteria | 198779 |
| 423 | Ga0207686_10000029 | 3300025934 | Bacteria | 160239 |
| 424 | Ga0207686_10000549 | 3300025934 | Bacteria | 24232 |
| 425 | Ga0207686_10012730 | 3300025934 | Bacteria | 4632 |
| 426 | Ga0207686_10090418 | 3300025934 | Bacteria | 2020 |
| 427 | Ga0207686_10113409 | 3300025934 | Bacteria | 1832 |
| 428 | Ga0207686_10116759 | 3300025934 | Bacteria | 1809 |
| 429 | Ga0207686_10399381 | 3300025934 | Bacteria | 1047 |
| 430 | Ga0207709_10004991 | 3300025935 | Bacteria | 7589 |
| 431 | Ga0207709_10005805 | 3300025935 | Bacteria | 6974 |
| 432 | Ga0207709_10051303 | 3300025935 | Bacteria | 2528 |
| 433 | Ga0207709_10150427 | 3300025935 | Bacteria | 1611 |
| 434 | Ga0207709_10205107 | 3300025935 | Bacteria | 1411 |
| 435 | Ga0207709_10224610 | 3300025935 | Bacteria | 1356 |
| 436 | Ga0207670_10028660 | 3300025936 | Bacteria | 3539 |
| 437 | Ga0207670_10076963 | 3300025936 | Bacteria | 2323 |
| 438 | Ga0207670_10086523 | 3300025936 | Bacteria | 2206 |
| 439 | Ga0207669_10000007 | 3300025937 | Bacteria | 169904 |
| 440 | Ga0207669_10000137 | 3300025937 | Bacteria | 35016 |
| 441 | Ga0207669_10154909 | 3300025937 | Bacteria | 1610 |
| 442 | Ga0207669_10342142 | 3300025937 | Bacteria | 1152 |
| 443 | Ga0207669_10566138 | 3300025937 | Bacteria | 919 |
| 444 | Ga0207704_10000004 | 3300025938 | Bacteria | 239295 |
| 445 | Ga0207704_10016963 | 3300025938 | Bacteria | 3761 |
| 446 | Ga0207704_10043490 | 3300025938 | Bacteria | 2653 |
| 447 | Ga0207704_10415873 | 3300025938 | Bacteria | 1065 |
| 448 | Ga0207665_10153996 | 3300025939 | Bacteria | 1648 |
| 449 | Ga0207691_10000374 | 3300025940 | Bacteria | 45009 |
| 450 | Ga0207691_10018685 | 3300025940 | Bacteria | 6566 |
| 451 | Ga0207689_10039478 | 3300025942 | Bacteria | 3907 |
| 452 | Ga0207689_10201186 | 3300025942 | Bacteria | 1644 |
| 453 | Ga0207689_10202491 | 3300025942 | Bacteria | 1639 |
| 454 | Ga0207661_10000142 | 3300025944 | Bacteria | 45456 |
| 455 | Ga0207661_10004000 | 3300025944 | Bacteria | 10300 |
| 456 | Ga0207661_10017781 | 3300025944 | Bacteria | 5269 |
| 457 | Ga0207661_10018328 | 3300025944 | Bacteria | 5201 |
| 458 | Ga0207661_10025205 | 3300025944 | Bacteria | 4519 |
| 459 | Ga0207661_10051371 | 3300025944 | Bacteria | 3289 |
| 460 | Ga0207661_10066907 | 3300025944 | Bacteria | 2920 |
| 461 | Ga0207661_10126815 | 3300025944 | Bacteria | 2181 |
| 462 | Ga0207661_10247878 | 3300025944 | Bacteria | 1582 |
| 463 | Ga0207679_10264217 | 3300025945 | Bacteria | 1469 |
| 464 | Ga0207667_10115864 | 3300025949 | Bacteria | 2762 |
| 465 | Ga0207667_10419800 | 3300025949 | Bacteria | 1361 |
| 466 | Ga0207651_10000641 | 3300025960 | Bacteria | 14829 |
| 467 | Ga0207712_10000033 | 3300025961 | Bacteria | 209336 |
| 468 | Ga0207712_10090042 | 3300025961 | Bacteria | 2257 |
| 469 | Ga0207712_10115429 | 3300025961 | Bacteria | 2021 |
| 470 | Ga0207712_10386870 | 3300025961 | Bacteria | 1172 |
| 471 | Ga0207668_10031383 | 3300025972 | Bacteria | 3499 |
| 472 | Ga0207668_10722734 | 3300025972 | Bacteria | 877 |
| 473 | Ga0207640_10000059 | 3300025981 | Bacteria | 90901 |
| 474 | Ga0207640_10074605 | 3300025981 | Bacteria | 2296 |
| 475 | Ga0207640_10158365 | 3300025981 | Bacteria | 1672 |
| 476 | Ga0207658_10080916 | 3300025986 | Bacteria | 2489 |
| 477 | Ga0207658_10181019 | 3300025986 | Bacteria | 1744 |
| 478 | Ga0207658_10214744 | 3300025986 | Bacteria | 1614 |
| 479 | Ga0207658_10371333 | 3300025986 | Bacteria | 1251 |
| 480 | Ga0207658_10388652 | 3300025986 | Bacteria | 1224 |
| 481 | Ga0207677_10016790 | 3300026023 | Bacteria | 4347 |
| 482 | Ga0207677_10022711 | 3300026023 | Bacteria | 3861 |
| 483 | Ga0207677_10037765 | 3300026023 | Bacteria | 3159 |
| 484 | Ga0207677_10230035 | 3300026023 | Bacteria | 1493 |
| 485 | Ga0207703_10000072 | 3300026035 | Bacteria | 120727 |
| 486 | Ga0207703_10000266 | 3300026035 | Bacteria | 58337 |
| 487 | Ga0207703_10045722 | 3300026035 | Bacteria | 3522 |
| 488 | Ga0207703_10052994 | 3300026035 | Bacteria | 3297 |
| 489 | Ga0207703_10069535 | 3300026035 | Bacteria | 2904 |
| 490 | Ga0207703_10298596 | 3300026035 | Unclassified | 1468 |
| 491 | Ga0207639_10014674 | 3300026041 | Bacteria | 5517 |
| 492 | Ga0207639_10403294 | 3300026041 | Bacteria | 1232 |
| 493 | Ga0207678_10001193 | 3300026067 | Bacteria | 23817 |
| 494 | Ga0207678_10004455 | 3300026067 | Bacteria | 12594 |
| 495 | Ga0207678_10321155 | 3300026067 | Bacteria | 1332 |
| 496 | Ga0207708_10000640 | 3300026075 | Bacteria | 26934 |
| 497 | Ga0207708_10071477 | 3300026075 | Bacteria | 2658 |
| 498 | Ga0207708_10348746 | 3300026075 | Bacteria | 1214 |
| 499 | Ga0207708_10399333 | 3300026075 | Bacteria | 1136 |
| 500 | Ga0207702_10000027 | 3300026078 | Bacteria | 183792 |
| 501 | Ga0207702_10059405 | 3300026078 | Bacteria | 3257 |
| 502 | Ga0207702_10062479 | 3300026078 | Bacteria | 3181 |
| 503 | Ga0207641_10000231 | 3300026088 | Bacteria | 72245 |
| 504 | Ga0207641_10002333 | 3300026088 | Bacteria | 17596 |
| 505 | Ga0207641_10140391 | 3300026088 | Bacteria | 2179 |
| 506 | Ga0207641_10579958 | 3300026088 | Bacteria | 1096 |
| 507 | Ga0207641_10869767 | 3300026088 | Bacteria | 894 |
| 508 | Ga0207648_10000230 | 3300026089 | Bacteria | 59713 |
| 509 | Ga0207648_10041159 | 3300026089 | Bacteria | 4059 |
| 510 | Ga0207676_10000038 | 3300026095 | Bacteria | 171492 |
| 511 | Ga0207674_10041782 | 3300026116 | Bacteria | 4740 |
| 512 | Ga0207674_10133707 | 3300026116 | Bacteria | 2443 |
| 513 | Ga0207674_10573733 | 3300026116 | Bacteria | 1090 |
| 514 | Ga0207675_100179302 | 3300026118 | Bacteria | 2028 |
| 515 | Ga0207675_100264216 | 3300026118 | Bacteria | 1669 |
| 516 | Ga0207675_100351077 | 3300026118 | Bacteria | 1445 |
| 517 | Ga0207683_10047826 | 3300026121 | Bacteria | 3746 |
| 518 | Ga0207698_10000002 | 3300026142 | Bacteria | 404991 |
| 519 | Ga0207698_10022738 | 3300026142 | Bacteria | 4366 |
| 520 | Ga0207698_10724071 | 3300026142 | Bacteria | 992 |
| 521 | Ga0207428_10028772 | 3300027907 | Bacteria | 4613 |
| 522 | Ga0207428_10164204 | 3300027907 | Bacteria | 1685 |
| 523 | Ga0268266_10000076 | 3300028379 | Bacteria | 217644 |
| 524 | Ga0268266_10000664 | 3300028379 | Bacteria | 46506 |
| 525 | Ga0268266_10000809 | 3300028379 | Bacteria | 41366 |
| 526 | Ga0268265_10067744 | 3300028380 | Bacteria | 2764 |
| 527 | Ga0268265_10100915 | 3300028380 | Bacteria | 2331 |
| 528 | Ga0268265_10760417 | 3300028380 | Bacteria | 941 |
| 529 | Ga0268264_10025994 | 3300028381 | Bacteria | 4780 |
| 530 | Ga0268264_10112768 | 3300028381 | Bacteria | 2384 |
| 531 | Ga0265337_1000004 | 3300028556 | Bacteria | 106708 |
| 532 | Ga0265326_10000004 | 3300028558 | Bacteria | 283947 |
| 533 | Ga0265326_10000091 | 3300028558 | Bacteria | 47039 |
| 534 | Ga0265319_1000029 | 3300028563 | Bacteria | 131291 |
| 535 | Ga0265319_1009335 | 3300028563 | Bacteria | 4187 |
| 536 | Ga0265334_10000019 | 3300028573 | Bacteria | 143921 |
| 537 | Ga0265322_10000006 | 3300028654 | Bacteria | 231685 |
| 538 | Ga0265336_10001559 | 3300028666 | Bacteria | 10280 |
| 539 | Ga0265336_10001891 | 3300028666 | Bacteria | 9055 |
| 540 | Ga0265336_10038625 | 3300028666 | Bacteria | 1465 |
| 541 | Ga0265338_10000179 | 3300028800 | Bacteria | 117995 |
| 542 | Ga0265338_10004866 | 3300028800 | Bacteria | 17893 |
| 543 | Ga0265324_10000185 | 3300029957 | Bacteria | 47817 |
| 544 | Ga0265324_10000269 | 3300029957 | Bacteria | 38425 |
| 545 | Ga0265324_10004148 | 3300029957 | Bacteria | 6625 |
| 546 | Ga0265332_10123483 | 3300031238 | Bacteria | 1087 |
| 547 | Ga0265328_10003537 | 3300031239 | Bacteria | 6889 |
| 548 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 549 | Ga0265320_10055494 | 3300031240 | Bacteria | 1906 |
| 550 | Ga0265331_10001356 | 3300031250 | Bacteria | 17990 |
| 551 | Ga0265331_10012050 | 3300031250 | Bacteria | 4707 |
| 552 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 553 | Ga0265327_10085636 | 3300031251 | Bacteria | 1547 |
| 554 | Ga0265316_10011172 | 3300031344 | Bacteria | 8122 |
| 555 | Ga0307408_100311165 | 3300031548 | Bacteria | 1323 |
| 556 | Ga0265314_10000567 | 3300031711 | Bacteria | 47136 |
| 557 | Ga0307405_10423859 | 3300031731 | Bacteria | 1048 |
| 558 | Ga0307413_10016288 | 3300031824 | Bacteria | 3836 |
| 559 | Ga0307410_10015757 | 3300031852 | Bacteria | 4491 |
| 560 | Ga0307410_10056053 | 3300031852 | Bacteria | 2678 |
| 561 | Ga0307410_10087118 | 3300031852 | Bacteria | 2208 |
| 562 | Ga0307410_10271477 | 3300031852 | Bacteria | 1327 |
| 563 | Ga0307410_10314353 | 3300031852 | Bacteria | 1241 |
| 564 | Ga0307410_10589068 | 3300031852 | Bacteria | 926 |
| 565 | Ga0307406_10025903 | 3300031901 | Bacteria | 3515 |
| 566 | Ga0307406_10036449 | 3300031901 | Bacteria | 3031 |
| 567 | Ga0307406_10363362 | 3300031901 | Bacteria | 1135 |
| 568 | Ga0307407_10074236 | 3300031903 | Bacteria | 2034 |
| 569 | Ga0307407_10264530 | 3300031903 | Bacteria | 1184 |
| 570 | Ga0307412_10010849 | 3300031911 | Bacteria | 5260 |
| 571 | Ga0307409_100016973 | 3300031995 | Bacteria | 4837 |
| 572 | Ga0307409_100047936 | 3300031995 | Bacteria | 3247 |
| 573 | Ga0307409_100235555 | 3300031995 | Bacteria | 1663 |
| 574 | Ga0307409_100481956 | 3300031995 | Bacteria | 1204 |
| 575 | Ga0307416_100018582 | 3300032002 | Bacteria | 4902 |
| 576 | Ga0307416_100164577 | 3300032002 | Bacteria | 2055 |
| 577 | Ga0307416_100769129 | 3300032002 | Bacteria | 1057 |
| 578 | Ga0307414_10031329 | 3300032004 | Bacteria | 3487 |
| 579 | Ga0307414_10289777 | 3300032004 | Bacteria | 1380 |
| 580 | Ga0307415_100128037 | 3300032126 | Bacteria | 1917 |
| 581 | Ga0307415_100293078 | 3300032126 | Bacteria | 1344 |
| 582 | Ga0307415_100389427 | 3300032126 | Bacteria | 1186 |
| 583 | Ga0373957_0040463 | 3300035120 | Bacteria | 1753 |
| 584 | Ga0316574_0033228 | 3300035398 | Bacteria | 3140 |
| 585 | Ga0316574_0040470 | 3300035398 | Bacteria | 2871 |
| 586 | Ga0316574_0151403 | 3300035398 | Bacteria | 1495 |
| 587 | Ga0373931_0068204 | 3300035691 | Bacteria | 1935 |
| 588 | Ga0373933_0091340 | 3300035724 | Bacteria | 1879 |
| 589 | Ga0373937_0040714 | 3300036401 | Bacteria | 4236 |
| 590 | Ga0373937_0153441 | 3300036401 | Bacteria | 2158 |
| 591 | Ga0316584_0039677 | 3300036712 | Bacteria | 3505 |
| 592 | Ga0316584_0102679 | 3300036712 | Bacteria | 2141 |
| 593 | Ga0373925_0259484 | 3300037068 | Bacteria | 1396 |
| 594 | Ga0395899_0190046 | 3300037312 | Bacteria | 1437 |
| 595 | Ga0395900_0005227 | 3300037418 | Bacteria | 13620 |
| 596 | Ga0395900_0036309 | 3300037418 | Bacteria | 5080 |
| 597 | Ga0395900_0583280 | 3300037418 | Bacteria | 1060 |
| 598 | Ga0395898_0005197 | 3300037466 | Bacteria | 14074 |
| 599 | Ga0395898_0026957 | 3300037466 | Bacteria | 5774 |
| 600 | Ga0395898_0033386 | 3300037466 | Bacteria | 5137 |
| 601 | Ga0395898_0269451 | 3300037466 | Bacteria | 1624 |
| 602 | Ga0395898_0427206 | 3300037466 | Bacteria | 1262 |
| 603 | Ga0395905_0003983 | 3300037471 | Bacteria | 15532 |
| 604 | Ga0395905_0006802 | 3300037471 | Bacteria | 11455 |
| 605 | Ga0395905_0293094 | 3300037471 | Bacteria | 1514 |
| 606 | Ga0395905_0672956 | 3300037471 | Bacteria | 937 |
| 607 | Ga0436364_0011780 | 3300037853 | Bacteria | 9228 |
| 608 | Ga0436364_0036263 | 3300037853 | Bacteria | 3546 |
| 609 | Ga0436364_0037496 | 3300037853 | Bacteria | 12823 |
| 610 | Ga0436364_0106102 | 3300037853 | Bacteria | 7750 |
| 611 | Ga0436364_0566741 | 3300037853 | Bacteria | 1921 |
| 612 | Ga0436364_0568939 | 3300037853 | Bacteria | 19992 |
| 613 | Ga0436364_1036677 | 3300037853 | Bacteria | 11971 |
| 614 | Ga0436364_1277199 | 3300037853 | Bacteria | 8771 |
| 615 | Ga0436364_1318699 | 3300037853 | Bacteria | 1192 |
| 616 | Ga0436364_1345153 | 3300037853 | Bacteria | 31795 |
| 617 | Ga0395901_0003503 | 3300038443 | Bacteria | 15812 |
| 618 | Ga0395901_0021645 | 3300038443 | Bacteria | 6587 |
| 619 | Ga0395901_0067075 | 3300038443 | Bacteria | 3737 |
| 620 | Ga0395901_0091450 | 3300038443 | Bacteria | 3185 |
| 621 | Ga0395901_0219002 | 3300038443 | Bacteria | 1990 |
| 622 | Ga0395901_0697684 | 3300038443 | Bacteria | 1013 |
| 623 | Ga0436365_0110675 | 3300039437 | Bacteria | 3574 |
| 624 | Ga0436365_0120316 | 3300039437 | Bacteria | 4840 |
| 625 | Ga0436365_0246939 | 3300039437 | Bacteria | 31160 |
| 626 | Ga0436365_0259665 | 3300039437 | Bacteria | 4490 |
| 627 | Ga0436365_0447550 | 3300039437 | Bacteria | 1444 |
| 628 | Ga0436365_0632396 | 3300039437 | Bacteria | 2634 |
| 629 | Ga0436365_0704007 | 3300039437 | Bacteria | 2907 |
| 630 | Ga0436365_0728883 | 3300039437 | Bacteria | 6384 |
| 631 | Ga0436365_1199839 | 3300039437 | Bacteria | 10857 |
| 632 | Ga0436365_1332524 | 3300039437 | Bacteria | 3702 |
| 633 | Ga0436365_1392317 | 3300039437 | Bacteria | 2995 |
| 634 | Ga0436365_1652791 | 3300039437 | Bacteria | 22443 |
| 635 | Ga0436365_1710566 | 3300039437 | Bacteria | 1253 |
| 636 | Ga0436360_0343660 | 3300039438 | Bacteria | 1093 |
| 637 | Ga0436363_0080822 | 3300039450 | Bacteria | 2036 |
| 638 | Ga0436363_0093570 | 3300039450 | Bacteria | 2829 |
| 639 | Ga0436363_0111697 | 3300039450 | Bacteria | 1679 |
| 640 | Ga0436363_0451482 | 3300039450 | Bacteria | 773 |
| 641 | Ga0436363_0871224 | 3300039450 | Bacteria | 2476 |
| 642 | Ga0436363_0918977 | 3300039450 | Bacteria | 31736 |
| 643 | Ga0436363_1527297 | 3300039450 | Bacteria | 2872 |
| 644 | Ga0436362_1236380 | 3300039453 | Bacteria | 1352 |
| 645 | Ga0451800_0403305 | 3300041459 | Bacteria | 1175 |
| 646 | Ga0451845_0477232 | 3300041501 | Bacteria | 950 |
| 647 | Ga0451849_0909594 | 3300041505 | Bacteria | 846 |
| 648 | Ga0451849_1338131 | 3300041505 | Bacteria | 1143 |
| 649 | Ga0451843_0185767 | 3300041509 | Bacteria | 1268 |
| 650 | Ga0451853_3581193 | 3300041512 | Bacteria | 1983 |
| 651 | Ga0450923_067683 | 3300042125 | Bacteria | 788 |
| 652 | Ga0466965_0131936 | 3300044683 | Bacteria | 1296 |
| 653 | Ga0466966_0029883 | 3300044684 | Bacteria | 3543 |
| 654 | Ga0466966_0046094 | 3300044684 | Bacteria | 2785 |
| 655 | Ga0466966_0262273 | 3300044684 | Bacteria | 1040 |
| 656 | Ga0466961_0007985 | 3300044693 | Bacteria | 6745 |
| 657 | Ga0466961_0035299 | 3300044693 | Bacteria | 3211 |
| 658 | Ga0466961_0090653 | 3300044693 | Bacteria | 1930 |
| 659 | Ga0466963_0000124 | 3300044694 | Bacteria | 28905 |
| 660 | Ga0466963_0000529 | 3300044694 | Bacteria | 17918 |
| 661 | Ga0466963_0013326 | 3300044694 | Bacteria | 5047 |
| 662 | Ga0466963_0013444 | 3300044694 | Bacteria | 5026 |
| 663 | Ga0466963_0116762 | 3300044694 | Bacteria | 1834 |
| 664 | Ga0466963_0180980 | 3300044694 | Bacteria | 1472 |
| 665 | Ga0466963_0358282 | 3300044694 | Bacteria | 1027 |
| 666 | Ga0466971_0004371 | 3300044719 | Bacteria | 6097 |
| 667 | Ga0466971_0018488 | 3300044719 | Bacteria | 3087 |
| 668 | Ga0466971_0072398 | 3300044719 | Bacteria | 1566 |
| 669 | Ga0466971_0090348 | 3300044719 | Bacteria | 1402 |
| 670 | Ga0466968_0003736 | 3300044735 | Bacteria | 5643 |
| 671 | Ga0466968_0017345 | 3300044735 | Bacteria | 2877 |
| 672 | Ga0466968_0120749 | 3300044735 | Bacteria | 1185 |
| 673 | Ga0466957_0000145 | 3300044842 | Bacteria | 30469 |
| 674 | Ga0466957_0026396 | 3300044842 | Bacteria | 3446 |
| 675 | Ga0466957_0032771 | 3300044842 | Bacteria | 3113 |
| 676 | Ga0466957_0058407 | 3300044842 | Bacteria | 2363 |
| 677 | Ga0466957_0220814 | 3300044842 | Bacteria | 1251 |
| 678 | Ga0466960_0058299 | 3300044901 | Bacteria | 1886 |
| 679 | Ga0466960_0101417 | 3300044901 | Bacteria | 1483 |
| 680 | Ga0466960_0328096 | 3300044901 | Bacteria | 868 |
| 681 | Ga0466959_0012139 | 3300045049 | Bacteria | 6216 |
| 682 | Ga0466959_0015753 | 3300045049 | Bacteria | 5514 |
| 683 | Ga0466959_0063911 | 3300045049 | Bacteria | 2672 |
| 684 | Ga0466959_0116367 | 3300045049 | Bacteria | 1904 |
| 685 | Ga0466959_0126333 | 3300045049 | Bacteria | 1815 |
| 686 | Ga0466959_0141252 | 3300045049 | Bacteria | 1702 |
| 687 | Ga0466959_0506918 | 3300045049 | Bacteria | 815 |
| 688 | Ga0466958_0001477 | 3300045836 | Bacteria | 11206 |
| 689 | Ga0466958_0005313 | 3300045836 | Bacteria | 6914 |
| 690 | Ga0466958_0021557 | 3300045836 | Bacteria | 3767 |
| 691 | Ga0466958_0023202 | 3300045836 | Bacteria | 3639 |
| 692 | Ga0466958_0046555 | 3300045836 | Bacteria | 2617 |
| 693 | Ga0466958_0048144 | 3300045836 | Bacteria | 2575 |
| 694 | Ga0466958_0100923 | 3300045836 | Bacteria | 1794 |
| 695 | Ga0466958_0115707 | 3300045836 | Bacteria | 1676 |
| 696 | Ga0466958_0117685 | 3300045836 | Bacteria | 1662 |
| 697 | Ga0466958_0144192 | 3300045836 | Bacteria | 1500 |
| 698 | Ga0466958_0383052 | 3300045836 | Bacteria | 907 |
| 699 | Ga0466967_0000008 | 3300045976 | Bacteria | 127135 |
| 700 | Ga0466967_0001903 | 3300045976 | Bacteria | 12605 |
| 701 | Ga0466967_0008828 | 3300045976 | Bacteria | 7429 |
| 702 | Ga0466967_0063657 | 3300045976 | Bacteria | 3278 |
| 703 | Ga0466967_0077424 | 3300045976 | Bacteria | 2994 |
| 704 | Ga0466967_0093743 | 3300045976 | Bacteria | 2733 |
| 705 | Ga0466967_0097015 | 3300045976 | Bacteria | 2690 |
| 706 | Ga0466967_0254830 | 3300045976 | Bacteria | 1677 |
| 707 | Ga0466967_0536406 | 3300045976 | Bacteria | 1151 |
| 708 | Ga0495592_0000521 | 3300046454 | Bacteria | 27805 |
| 709 | Ga0495592_0066802 | 3300046454 | Bacteria | 2631 |
| 710 | Ga0495603_0000117 | 3300046455 | Bacteria | 38871 |
| 711 | Ga0495603_0009250 | 3300046455 | Bacteria | 5956 |
| 712 | Ga0495603_0130487 | 3300046455 | Bacteria | 1464 |
| 713 | Ga0495603_0289067 | 3300046455 | Bacteria | 942 |
| 714 | Ga0495629_0001391 | 3300046459 | Bacteria | 19098 |
| 715 | Ga0495629_0018397 | 3300046459 | Bacteria | 5002 |
| 716 | Ga0495638_0005536 | 3300046460 | Bacteria | 9366 |
| 717 | Ga0495641_0000001 | 3300046461 | Bacteria | 485224 |
| 718 | Ga0495641_0129071 | 3300046461 | Bacteria | 1128 |
| 719 | Ga0495651_0045643 | 3300046462 | Bacteria | 3394 |
| 720 | Ga0495653_0046920 | 3300046463 | Bacteria | 3343 |
| 721 | Ga0495653_0155055 | 3300046463 | Bacteria | 1596 |
| 722 | Ga0495653_0198722 | 3300046463 | Bacteria | 1362 |
| 723 | Ga0495582_0000022 | 3300046473 | Bacteria | 83315 |
| 724 | Ga0495605_0099576 | 3300046474 | Bacteria | 1338 |
| 725 | Ga0495639_0116691 | 3300046475 | Bacteria | 1270 |
| 726 | Ga0495662_0000509 | 3300046476 | Bacteria | 17683 |
| 727 | Ga0495662_0001149 | 3300046476 | Bacteria | 13032 |
| 728 | Ga0495662_0129757 | 3300046476 | Bacteria | 1239 |
| 729 | Ga0495664_0177796 | 3300046477 | Bacteria | 1291 |
| 730 | Ga0495584_0108614 | 3300046491 | Bacteria | 1403 |
| 731 | Ga0495594_0000276 | 3300046499 | Bacteria | 25314 |
| 732 | Ga0495606_0000045 | 3300046507 | Bacteria | 212105 |
| 733 | Ga0495608_0000001 | 3300046511 | Bacteria | 411278 |
| 734 | Ga0495608_0000163 | 3300046511 | Bacteria | 47170 |
| 735 | Ga0495608_0020569 | 3300046511 | Bacteria | 4536 |
| 736 | Ga0495608_0029968 | 3300046511 | Bacteria | 3686 |
| 737 | Ga0495618_0001468 | 3300046514 | Bacteria | 15801 |
| 738 | Ga0495618_0035453 | 3300046514 | Bacteria | 3131 |
| 739 | Ga0495620_0000990 | 3300046515 | Bacteria | 17542 |
| 740 | Ga0495620_0095793 | 3300046515 | Bacteria | 1187 |
| 741 | Ga0495628_0001583 | 3300046516 | Bacteria | 20854 |
| 742 | Ga0495628_0019793 | 3300046516 | Bacteria | 5559 |
| 743 | Ga0495628_0046506 | 3300046516 | Bacteria | 3446 |
| 744 | Ga0495628_0061324 | 3300046516 | Bacteria | 2949 |
| 745 | Ga0495628_0143898 | 3300046516 | Bacteria | 1818 |
| 746 | Ga0495628_0164307 | 3300046516 | Bacteria | 1686 |
| 747 | Ga0495630_0000037 | 3300046517 | Bacteria | 114404 |
| 748 | Ga0495630_0000435 | 3300046517 | Bacteria | 31943 |
| 749 | Ga0495630_0053084 | 3300046517 | Bacteria | 3034 |
| 750 | Ga0495630_0098367 | 3300046517 | Bacteria | 2213 |
| 751 | Ga0495637_0018145 | 3300046520 | Bacteria | 3268 |
| 752 | Ga0495637_0038902 | 3300046520 | Bacteria | 2057 |
| 753 | Ga0495644_0001413 | 3300046523 | Bacteria | 9813 |
| 754 | Ga0495644_0043406 | 3300046523 | Unclassified | 1692 |
| 755 | Ga0495644_0070097 | 3300046523 | Bacteria | 1317 |
| 756 | Ga0495644_0095130 | 3300046523 | Bacteria | 1125 |
| 757 | Ga0495642_0033816 | 3300046528 | Bacteria | 2057 |
| 758 | Ga0495652_0000086 | 3300046529 | Bacteria | 99373 |
| 759 | Ga0495652_0047667 | 3300046529 | Bacteria | 3674 |
| 760 | Ga0495640_0022922 | 3300046533 | Bacteria | 4560 |
| 761 | Ga0495640_0032586 | 3300046533 | Bacteria | 3711 |
| 762 | Ga0495586_0008998 | 3300046535 | Bacteria | 5313 |
| 763 | Ga0495587_0001022 | 3300046536 | Bacteria | 18410 |
| 764 | Ga0495621_0003812 | 3300046539 | Bacteria | 4185 |
| 765 | Ga0495645_0038645 | 3300046543 | Bacteria | 3481 |
| 766 | Ga0495622_0000690 | 3300046557 | Bacteria | 19165 |
| 767 | Ga0495667_0000044 | 3300046559 | Bacteria | 121910 |
| 768 | Ga0495667_0013193 | 3300046559 | Bacteria | 5596 |
| 769 | Ga0495667_0019970 | 3300046559 | Bacteria | 4519 |
| 770 | Ga0495667_0495033 | 3300046559 | Bacteria | 766 |
| 771 | Ga0495656_0048019 | 3300046615 | Bacteria | 1812 |
| 772 | Ga0495656_0094707 | 3300046615 | Bacteria | 1372 |
| 773 | Ga0495668_0141057 | 3300046616 | Bacteria | 1319 |
| 774 | Ga0495668_0150206 | 3300046616 | Bacteria | 1276 |
| 775 | Ga0495634_0000013 | 3300046642 | Bacteria | 130546 |
| 776 | Ga0495634_0001471 | 3300046642 | Bacteria | 20875 |
| 777 | Ga0495634_0004564 | 3300046642 | Bacteria | 10814 |
| 778 | Ga0495634_0040160 | 3300046642 | Bacteria | 3184 |
| 779 | Ga0495625_0001659 | 3300046660 | Bacteria | 26100 |
| 780 | Ga0495625_0143466 | 3300046660 | Bacteria | 1610 |
| 781 | Ga0495635_0000063 | 3300046663 | Bacteria | 65304 |
| 782 | Ga0495635_0165956 | 3300046663 | Bacteria | 1502 |
| 783 | Ga0495588_0000240 | 3300046674 | Bacteria | 46975 |
| 784 | Ga0495657_0000002 | 3300046675 | Bacteria | 411958 |
| 785 | Ga0495657_0027265 | 3300046675 | Bacteria | 4034 |
| 786 | Ga0495657_0027810 | 3300046675 | Bacteria | 3986 |
| 787 | Ga0495599_0008094 | 3300046678 | Bacteria | 6384 |
| 788 | Ga0495599_0153212 | 3300046678 | Bacteria | 1427 |
| 789 | Ga0495646_0127464 | 3300046680 | Bacteria | 1435 |
| 790 | Ga0495647_0000003 | 3300046681 | Bacteria | 145235 |
| 791 | Ga0495647_0001273 | 3300046681 | Bacteria | 7768 |
| 792 | Ga0495647_0144314 | 3300046681 | Bacteria | 1017 |
| 793 | Ga0495658_0000008 | 3300046683 | Bacteria | 115426 |
| 794 | Ga0495658_0156537 | 3300046683 | Unclassified | 1402 |
| 795 | Ga0495669_0000594 | 3300046684 | Bacteria | 15905 |
| 796 | Ga0495669_0002395 | 3300046684 | Bacteria | 7694 |
| 797 | Ga0495613_0000298 | 3300046689 | Bacteria | 44864 |
| 798 | Ga0495613_0000342 | 3300046689 | Bacteria | 41726 |
| 799 | Ga0495624_0000164 | 3300046690 | Bacteria | 48886 |
| 800 | Ga0495624_0002296 | 3300046690 | Bacteria | 14562 |
| 801 | Ga0495624_0018570 | 3300046690 | Bacteria | 4650 |
| 802 | Ga0495670_0039098 | 3300046691 | Bacteria | 2366 |
| 803 | Ga0495670_0207530 | 3300046691 | Bacteria | 1039 |
| 804 | Ga0495671_0079164 | 3300046692 | Bacteria | 1611 |
| 805 | Ga0495649_0010293 | 3300046694 | Bacteria | 5523 |
| 806 | Ga0495600_0033050 | 3300046809 | Bacteria | 3358 |
| 807 | Ga0495660_0107541 | 3300046810 | Bacteria | 1427 |
| 808 | Ga0495604_0000033 | 3300047317 | Bacteria | 134810 |
| 809 | Ga0495604_0000850 | 3300047317 | Bacteria | 25489 |
| 810 | Ga0495604_0051006 | 3300047317 | Bacteria | 3210 |
| 811 | Ga0495604_0059679 | 3300047317 | Bacteria | 2923 |
| 812 | Ga0495604_0379025 | 3300047317 | Bacteria | 935 |
| 813 | Ga0495674_0000007 | 3300047319 | Bacteria | 336257 |
| 814 | Ga0495676_0005668 | 3300047321 | Bacteria | 11446 |
| 815 | Ga0495676_0011669 | 3300047321 | Bacteria | 7927 |
| 816 | Ga0495676_0020541 | 3300047321 | Bacteria | 5791 |
| 817 | Ga0495676_0064327 | 3300047321 | Bacteria | 2854 |
| 818 | Ga0495676_0092114 | 3300047321 | Bacteria | 2263 |
| 819 | Ga0495676_0144367 | 3300047321 | Bacteria | 1702 |
| 820 | Ga0495676_0248886 | 3300047321 | Bacteria | 1213 |
| 821 | Ga0495676_0369320 | 3300047321 | Bacteria | 956 |
| 822 | Ga0495680_0000215 | 3300047322 | Bacteria | 63049 |
| 823 | Ga0495680_0002477 | 3300047322 | Bacteria | 18877 |
| 824 | Ga0495680_0013125 | 3300047322 | Bacteria | 7240 |
| 825 | Ga0495680_0025078 | 3300047322 | Bacteria | 4939 |
| 826 | Ga0495680_0029513 | 3300047322 | Bacteria | 4491 |
| 827 | Ga0495680_0034864 | 3300047322 | Bacteria | 4059 |
| 828 | Ga0495680_0210965 | 3300047322 | Bacteria | 1390 |
| 829 | Ga0495680_0555744 | 3300047322 | Bacteria | 773 |
| 830 | Ga0495675_0000046 | 3300047444 | Bacteria | 82596 |
| 831 | Ga0495675_0025403 | 3300047444 | Bacteria | 3777 |
| 832 | Ga0495675_0276922 | 3300047444 | Bacteria | 1001 |
| 833 | Ga0495684_0395914 | 3300047471 | Bacteria | 971 |
| 834 | Ga0495602_0000010 | 3300048088 | Bacteria | 212121 |
| 835 | Ga0495602_0017974 | 3300048088 | Bacteria | 7075 |
| 836 | Ga0495602_0204394 | 3300048088 | Bacteria | 1504 |
| 837 | Ga0496100_0000003 | 3300048903 | Bacteria | 360802 |
| 838 | Ga0496100_0000063 | 3300048903 | Bacteria | 60957 |
| 839 | Ga0496100_0000647 | 3300048903 | Bacteria | 16538 |
| 840 | Ga0496100_0082981 | 3300048903 | Unclassified | 2168 |
| 841 | Ga0496100_0127630 | 3300048903 | Bacteria | 1787 |
| 842 | Ga0496100_0132658 | 3300048903 | Bacteria | 1756 |
| 843 | Ga0496100_0163760 | 3300048903 | Bacteria | 1596 |
| 844 | Ga0496101_0000003 | 3300048904 | Bacteria | 406565 |
| 845 | Ga0496101_0000016 | 3300048904 | Bacteria | 240753 |
| 846 | Ga0496101_0000505 | 3300048904 | Bacteria | 24566 |
| 847 | Ga0496101_0001570 | 3300048904 | Bacteria | 13704 |
| 848 | Ga0496101_0012862 | 3300048904 | Bacteria | 5598 |
| 849 | Ga0496101_0035176 | 3300048904 | Bacteria | 3542 |
| 850 | Ga0496101_0097576 | 3300048904 | Bacteria | 2195 |
| 851 | Ga0496102_0000965 | 3300048905 | Bacteria | 27059 |
| 852 | Ga0496102_0003219 | 3300048905 | Bacteria | 13851 |
| 853 | Ga0496102_0007169 | 3300048905 | Bacteria | 9517 |
| 854 | Ga0496102_0036940 | 3300048905 | Bacteria | 4404 |
| 855 | Ga0496102_0053500 | 3300048905 | Bacteria | 3679 |
| 856 | Ga0496102_0218396 | 3300048905 | Bacteria | 1797 |
| 857 | Ga0496102_0536550 | 3300048905 | Bacteria | 1092 |
| 858 | Ga0496103_0000627 | 3300048906 | Bacteria | 27075 |
| 859 | Ga0496103_0000683 | 3300048906 | Bacteria | 25335 |
| 860 | Ga0496103_0028350 | 3300048906 | Bacteria | 3398 |
| 861 | Ga0496103_0053152 | 3300048906 | Bacteria | 2510 |
| 862 | Ga0496103_0122898 | 3300048906 | Bacteria | 1654 |
| 863 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 864 | Ga0496104_0000066 | 3300048907 | Bacteria | 108721 |
| 865 | Ga0496104_0004998 | 3300048907 | Bacteria | 11572 |
| 866 | Ga0496104_0046436 | 3300048907 | Bacteria | 4090 |
| 867 | Ga0496104_0057747 | 3300048907 | Bacteria | 3672 |
| 868 | Ga0496104_0100456 | 3300048907 | Bacteria | 2769 |
| 869 | Ga0496104_0162343 | 3300048907 | Bacteria | 2143 |
| 870 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 871 | Ga0496105_0000020 | 3300048908 | Bacteria | 181484 |
| 872 | Ga0496105_0005573 | 3300048908 | Bacteria | 9561 |
| 873 | Ga0496105_0022996 | 3300048908 | Bacteria | 5053 |
| 874 | Ga0496105_0041413 | 3300048908 | Bacteria | 3797 |
| 875 | Ga0496105_0065325 | 3300048908 | Bacteria | 3003 |
| 876 | Ga0496105_0191717 | 3300048908 | Bacteria | 1671 |
| 877 | Ga0496106_0000015 | 3300048909 | Bacteria | 187570 |
| 878 | Ga0496106_0000160 | 3300048909 | Bacteria | 48936 |
| 879 | Ga0496106_0007972 | 3300048909 | Bacteria | 7824 |
| 880 | Ga0496106_0013752 | 3300048909 | Bacteria | 5978 |
| 881 | Ga0496106_0069093 | 3300048909 | Bacteria | 2695 |
| 882 | Ga0496107_0000008 | 3300048910 | Bacteria | 251874 |
| 883 | Ga0496107_0000014 | 3300048910 | Bacteria | 176738 |
| 884 | Ga0496107_0014097 | 3300048910 | Bacteria | 5596 |
| 885 | Ga0496107_0029654 | 3300048910 | Bacteria | 3894 |
| 886 | Ga0496107_0035605 | 3300048910 | Bacteria | 3568 |
| 887 | Ga0496107_0040628 | 3300048910 | Bacteria | 3339 |
| 888 | Ga0496107_0043066 | 3300048910 | Bacteria | 3243 |
| 889 | Ga0496107_0069671 | 3300048910 | Bacteria | 2553 |
| 890 | Ga0496107_0091436 | 3300048910 | Bacteria | 2224 |
| 891 | Ga0496107_0138828 | 3300048910 | Bacteria | 1796 |
| 892 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 893 | Ga0496108_0001400 | 3300048911 | Bacteria | 18998 |
| 894 | Ga0496108_0011069 | 3300048911 | Bacteria | 7326 |
| 895 | Ga0496108_0011544 | 3300048911 | Bacteria | 7182 |
| 896 | Ga0496108_0011748 | 3300048911 | Bacteria | 7122 |
| 897 | Ga0496108_0033235 | 3300048911 | Bacteria | 4285 |
| 898 | Ga0496108_0037410 | 3300048911 | Bacteria | 4042 |
| 899 | Ga0496108_0115895 | 3300048911 | Bacteria | 2295 |
| 900 | Ga0496108_0380673 | 3300048911 | Bacteria | 1232 |
| 901 | Ga0496108_0604629 | 3300048911 | Bacteria | 955 |
| 902 | Ga0496108_0689182 | 3300048911 | Bacteria | 886 |
| 903 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 904 | Ga0496109_0000035 | 3300048912 | Bacteria | 159744 |
| 905 | Ga0496109_0000246 | 3300048912 | Bacteria | 52127 |
| 906 | Ga0496109_0000888 | 3300048912 | Bacteria | 25009 |
| 907 | Ga0496109_0001890 | 3300048912 | Bacteria | 17385 |
| 908 | Ga0496109_0010833 | 3300048912 | Bacteria | 7807 |
| 909 | Ga0496109_0020718 | 3300048912 | Bacteria | 5807 |
| 910 | Ga0496109_0029569 | 3300048912 | Bacteria | 4908 |
| 911 | Ga0496109_0048317 | 3300048912 | Bacteria | 3872 |
| 912 | Ga0496109_0051223 | 3300048912 | Bacteria | 3760 |
| 913 | Ga0496109_0241075 | 3300048912 | Bacteria | 1701 |
| 914 | Ga0496109_0271920 | 3300048912 | Bacteria | 1596 |
| 915 | Ga0496109_0379223 | 3300048912 | Bacteria | 1336 |
| 916 | Ga0496109_0445752 | 3300048912 | Bacteria | 1223 |
| 917 | Ga0496109_0865564 | 3300048912 | Bacteria | 842 |
| 918 | Ga0496110_0002971 | 3300048913 | Bacteria | 12859 |
| 919 | Ga0496110_0003803 | 3300048913 | Bacteria | 11631 |
| 920 | Ga0496110_0005956 | 3300048913 | Bacteria | 9597 |
| 921 | Ga0496110_0010155 | 3300048913 | Bacteria | 7649 |
| 922 | Ga0496110_0019926 | 3300048913 | Bacteria | 5653 |
| 923 | Ga0496110_0034907 | 3300048913 | Bacteria | 4359 |
| 924 | Ga0496110_0183589 | 3300048913 | Bacteria | 1899 |
| 925 | Ga0496110_0274932 | 3300048913 | Bacteria | 1534 |
| 926 | Ga0496111_0000022 | 3300048914 | Bacteria | 66777 |
| 927 | Ga0496111_0007441 | 3300048914 | Bacteria | 7177 |
| 928 | Ga0496111_0014044 | 3300048914 | Bacteria | 5462 |
| 929 | Ga0496111_0045157 | 3300048914 | Bacteria | 3169 |
| 930 | Ga0496111_0132949 | 3300048914 | Bacteria | 1842 |
| 931 | Ga0496111_0151567 | 3300048914 | Bacteria | 1719 |
| 932 | Ga0496111_0215222 | 3300048914 | Bacteria | 1427 |
| 933 | Ga0496111_0348589 | 3300048914 | Bacteria | 1096 |
| 934 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 935 | Ga0496112_0004601 | 3300048915 | Bacteria | 11737 |
| 936 | Ga0496112_0009702 | 3300048915 | Bacteria | 8691 |
| 937 | Ga0496112_0017265 | 3300048915 | Bacteria | 6776 |
| 938 | Ga0496112_0019581 | 3300048915 | Bacteria | 6391 |
| 939 | Ga0496112_0069529 | 3300048915 | Bacteria | 3478 |
| 940 | Ga0496112_0070806 | 3300048915 | Bacteria | 3446 |
| 941 | Ga0496112_0098339 | 3300048915 | Bacteria | 2896 |
| 942 | Ga0496112_0204895 | 3300048915 | Bacteria | 1931 |
| 943 | Ga0496112_0219519 | 3300048915 | Bacteria | 1857 |
| 944 | Ga0496113_0000093 | 3300048916 | Bacteria | 38914 |
| 945 | Ga0496113_0004574 | 3300048916 | Bacteria | 8526 |
| 946 | Ga0496113_0007849 | 3300048916 | Bacteria | 6899 |
| 947 | Ga0496113_0009677 | 3300048916 | Bacteria | 6331 |
| 948 | Ga0496113_0011497 | 3300048916 | Bacteria | 5909 |
| 949 | Ga0496113_0046527 | 3300048916 | Bacteria | 3221 |
| 950 | Ga0496113_0122234 | 3300048916 | Bacteria | 2036 |
| 951 | Ga0496113_0206762 | 3300048916 | Bacteria | 1561 |
| 952 | Ga0496114_0000010 | 3300048917 | Bacteria | 363396 |
| 953 | Ga0496114_0013558 | 3300048917 | Bacteria | 6539 |
| 954 | Ga0496114_0019118 | 3300048917 | Bacteria | 5550 |
| 955 | Ga0496114_0029049 | 3300048917 | Bacteria | 4542 |
| 956 | Ga0496114_0147063 | 3300048917 | Bacteria | 2043 |
| 957 | Ga0496114_0162716 | 3300048917 | Bacteria | 1941 |
| 958 | Ga0496114_0185036 | 3300048917 | Bacteria | 1820 |
| 959 | Ga0496114_0192348 | 3300048917 | Bacteria | 1785 |
| 960 | Ga0496114_0264491 | 3300048917 | Bacteria | 1515 |
| 961 | Ga0496114_0412914 | 3300048917 | Bacteria | 1195 |
| 962 | Ga0496115_0000004 | 3300048918 | Bacteria | 319734 |
| 963 | Ga0496115_0000363 | 3300048918 | Bacteria | 37766 |
| 964 | Ga0496115_0009607 | 3300048918 | Bacteria | 7193 |
| 965 | Ga0496115_0020491 | 3300048918 | Bacteria | 5102 |
| 966 | Ga0496115_0053073 | 3300048918 | Bacteria | 3253 |
| 967 | Ga0496115_0166218 | 3300048918 | Bacteria | 1824 |
| 968 | Ga0496115_0261065 | 3300048918 | Bacteria | 1424 |
| 969 | Ga0496115_0338744 | 3300048918 | Bacteria | 1228 |
| 970 | Ga0496116_0000014 | 3300048919 | Bacteria | 569049 |
| 971 | Ga0496117_0001652 | 3300048920 | Bacteria | 31325 |
| 972 | Ga0496118_0008936 | 3300048921 | Bacteria | 10230 |
| 973 | Ga0496118_0030195 | 3300048921 | Bacteria | 4529 |
| 974 | Ga0496118_0267469 | 3300048921 | Bacteria | 960 |
| 975 | Ga0496119_0000862 | 3300048922 | Bacteria | 40026 |
| 976 | Ga0496119_0010593 | 3300048922 | Bacteria | 7737 |
| 977 | Ga0496119_0025801 | 3300048922 | Bacteria | 4094 |
| 978 | Ga0496120_0040305 | 3300048923 | Bacteria | 2746 |
| 979 | Ga0496121_0009587 | 3300048924 | Bacteria | 11093 |
| 980 | Ga0496121_0015987 | 3300048924 | Bacteria | 7782 |
| 981 | Ga0496124_0186529 | 3300048927 | Bacteria | 1591 |
| 982 | Ga0496125_0109356 | 3300048928 | Bacteria | 2007 |
| 983 | Ga0496126_0029731 | 3300048929 | Bacteria | 5186 |
| 984 | Ga0496126_0138661 | 3300048929 | Bacteria | 2095 |
| 985 | Ga0501031_0005839 | 3300049568 | Bacteria | 8022 |
| 986 | Ga0501031_0100251 | 3300049568 | Bacteria | 1890 |
| 987 | Ga0501032_0003387 | 3300049569 | Bacteria | 12224 |
| 988 | Ga0501032_0015038 | 3300049569 | Bacteria | 5469 |
| 989 | Ga0501032_0182655 | 3300049569 | Bacteria | 1373 |
| 990 | Ga0501033_0002622 | 3300049570 | Bacteria | 15139 |
| 991 | Ga0501033_0021431 | 3300049570 | Bacteria | 4875 |
| 992 | Ga0501034_0005810 | 3300049571 | Bacteria | 13419 |
| 993 | Ga0501034_0073096 | 3300049571 | Bacteria | 3437 |
| 994 | Ga0501034_0171335 | 3300049571 | Bacteria | 2138 |
| 995 | Ga0501034_0315688 | 3300049571 | Bacteria | 1496 |
| 996 | Ga0501036_0027155 | 3300049572 | Bacteria | 4836 |
| 997 | Ga0501036_0362707 | 3300049572 | Bacteria | 1210 |
| 998 | Ga0501037_0000170 | 3300049573 | Bacteria | 61439 |
| 999 | Ga0501037_0030415 | 3300049573 | Bacteria | 3990 |
| 1000 | Ga0501038_0003338 | 3300049574 | Bacteria | 14965 |
| 1001 | Ga0501038_0011467 | 3300049574 | Bacteria | 8086 |
| 1002 | Ga0501039_0022091 | 3300049575 | Bacteria | 4883 |
| 1003 | Ga0501039_0090125 | 3300049575 | Bacteria | 2390 |
| 1004 | Ga0501039_0095649 | 3300049575 | Bacteria | 2316 |
| 1005 | Ga0501040_0137042 | 3300049576 | Bacteria | 1723 |
| 1006 | Ga0501041_0085110 | 3300049577 | Bacteria | 1949 |
| 1007 | Ga0501042_0013042 | 3300049578 | Bacteria | 5649 |
| 1008 | Ga0501042_0021328 | 3300049578 | Bacteria | 4513 |
| 1009 | Ga0501042_0052440 | 3300049578 | Bacteria | 2909 |
| 1010 | Ga0501043_0002950 | 3300049579 | Bacteria | 14183 |
| 1011 | Ga0501043_0034170 | 3300049579 | Bacteria | 3999 |
| 1012 | Ga0501043_0185677 | 3300049579 | Bacteria | 1619 |
| 1013 | Ga0501043_0226813 | 3300049579 | Bacteria | 1444 |
| 1014 | Ga0501046_0003826 | 3300049580 | Bacteria | 13774 |
| 1015 | Ga0501046_0038231 | 3300049580 | Bacteria | 3853 |
| 1016 | Ga0501046_0133425 | 3300049580 | Bacteria | 1882 |
| 1017 | Ga0501047_0005681 | 3300049581 | Bacteria | 11740 |
| 1018 | Ga0501047_0229032 | 3300049581 | Bacteria | 1712 |
| 1019 | Ga0501048_0001492 | 3300049582 | Bacteria | 17762 |
| 1020 | Ga0501067_0018075 | 3300049583 | Bacteria | 3904 |
| 1021 | Ga0501067_0036952 | 3300049583 | Bacteria | 2712 |
| 1022 | Ga0501067_0077821 | 3300049583 | Bacteria | 1838 |
| 1023 | Ga0501067_0188723 | 3300049583 | Bacteria | 1148 |
| 1024 | Ga0501068_0005744 | 3300049584 | Bacteria | 6803 |
| 1025 | Ga0501068_0015591 | 3300049584 | Bacteria | 4366 |
| 1026 | Ga0501068_0198527 | 3300049584 | Bacteria | 1272 |
| 1027 | Ga0501069_0209592 | 3300049585 | Bacteria | 1131 |
| 1028 | Ga0501070_0009270 | 3300049586 | Bacteria | 8324 |
| 1029 | Ga0501070_0025397 | 3300049586 | Bacteria | 4969 |
| 1030 | Ga0501070_0059462 | 3300049586 | Bacteria | 3168 |
| 1031 | Ga0501070_0080988 | 3300049586 | Bacteria | 2686 |
| 1032 | Ga0501070_0144143 | 3300049586 | Bacteria | 1966 |
| 1033 | Ga0501070_0165210 | 3300049586 | Bacteria | 1824 |
| 1034 | Ga0501071_0017769 | 3300049587 | Bacteria | 4913 |
| 1035 | Ga0501071_0072194 | 3300049587 | Bacteria | 2517 |
| 1036 | Ga0501071_0144791 | 3300049587 | Bacteria | 1771 |
| 1037 | Ga0501071_0145153 | 3300049587 | Bacteria | 1769 |
| 1038 | Ga0501071_0146715 | 3300049587 | Bacteria | 1759 |
| 1039 | Ga0501072_0003087 | 3300049588 | Bacteria | 12557 |
| 1040 | Ga0501072_0061721 | 3300049588 | Bacteria | 2956 |
| 1041 | Ga0501073_0003594 | 3300049589 | Bacteria | 11657 |
| 1042 | Ga0501073_0157716 | 3300049589 | Bacteria | 1572 |
| 1043 | Ga0501074_0012687 | 3300049590 | Bacteria | 6127 |
| 1044 | Ga0501074_0021006 | 3300049590 | Bacteria | 4741 |
| 1045 | Ga0501074_0142917 | 3300049590 | Bacteria | 1711 |
| 1046 | Ga0501074_0422384 | 3300049590 | Bacteria | 945 |
| 1047 | Ga0501075_0003933 | 3300049591 | Bacteria | 10006 |
| 1048 | Ga0501076_0005125 | 3300049592 | Bacteria | 9379 |
| 1049 | Ga0501076_0072411 | 3300049592 | Bacteria | 2758 |
| 1050 | Ga0501076_0259011 | 3300049592 | Bacteria | 1424 |
| 1051 | Ga0501076_0510627 | 3300049592 | Bacteria | 991 |
| 1052 | Ga0501077_0269952 | 3300049593 | Bacteria | 1082 |
| 1053 | Ga0501079_0008481 | 3300049741 | Bacteria | 7791 |
| 1054 | Ga0501079_0013023 | 3300049741 | Bacteria | 6344 |
| 1055 | Ga0501079_0060203 | 3300049741 | Bacteria | 2929 |
| 1056 | Ga0501079_0444499 | 3300049741 | Bacteria | 1018 |
| 1057 | Ga0501080_0030269 | 3300049742 | Bacteria | 5043 |
| 1058 | Ga0501080_0057255 | 3300049742 | Bacteria | 3629 |
| 1059 | Ga0501080_0179279 | 3300049742 | Bacteria | 1950 |
| 1060 | Ga0501081_0424011 | 3300049743 | Bacteria | 987 |
| 1061 | Ga0501083_0002143 | 3300049744 | Bacteria | 13548 |
| 1062 | Ga0501083_0031257 | 3300049744 | Bacteria | 3654 |
| 1063 | Ga0501083_0062458 | 3300049744 | Bacteria | 2485 |
| 1064 | Ga0501035_0000206 | 3300049822 | Bacteria | 71942 |
| 1065 | Ga0501035_0004772 | 3300049822 | Bacteria | 12867 |
| 1066 | Ga0501044_0000542 | 3300049823 | Bacteria | 45924 |
| 1067 | Ga0501044_0020490 | 3300049823 | Bacteria | 7061 |
| 1068 | Ga0501044_0185032 | 3300049823 | Bacteria | 2048 |
| 1069 | Ga0501044_0483166 | 3300049823 | Bacteria | 1142 |
| 1070 | Ga0501045_0007613 | 3300049824 | Bacteria | 7528 |
| 1071 | nmdc:mga03n38_198761_c1 | 3300050490 | Bacteria | 1037 |
| 1072 | nmdc:mga03n38_33252_c1 | 3300050490 | Bacteria | 2192 |
| 1073 | nmdc:mga00v17_132195_c1 | 3300050491 | Bacteria | 1595 |
| 1074 | nmdc:mga00v17_271802_c1 | 3300050491 | Bacteria | 1100 |
| 1075 | nmdc:mga00v17_68057_c1 | 3300050491 | Bacteria | 2201 |
| 1076 | nmdc:mga00v17_73468_c1 | 3300050491 | Bacteria | 2124 |
| 1077 | nmdc:mga0yw44_10211_c1 | 3300050492 | Bacteria | 4787 |
| 1078 | nmdc:mga0yw44_198314_c1 | 3300050492 | Bacteria | 1325 |
| 1079 | nmdc:mga0yw44_24325_c1 | 3300050492 | Bacteria | 3426 |
| 1080 | nmdc:mga0yw44_52127_c1 | 3300050492 | Bacteria | 2480 |
| 1081 | nmdc:mga06z11_108401_c1 | 3300050494 | Bacteria | 1534 |
| 1082 | nmdc:mga06z11_127719_c1 | 3300050494 | Bacteria | 1424 |
| 1083 | nmdc:mga07m45_292826_c1 | 3300050496 | Bacteria | 947 |
| 1084 | nmdc:mga05p37_279946_c1 | 3300050507 | Bacteria | 1989 |
| 1085 | nmdc:mga05p37_407177_c1 | 3300050507 | Bacteria | 1586 |
| 1086 | nmdc:mga05p37_42314_c1 | 3300050507 | Bacteria | 5596 |
| 1087 | nmdc:mga05p37_8426_c1 | 3300050507 | Bacteria | 12190 |
| 1088 | nmdc:mga09592_340650_c1 | 3300050508 | Unclassified | 1298 |
| 1089 | nmdc:mga0qj67_31798_c1 | 3300050509 | Bacteria | 4112 |
| 1090 | nmdc:mga06r32_327625_c1 | 3300050510 | Bacteria | 1517 |
| 1091 | nmdc:mga06r32_7959_c1 | 3300050510 | Bacteria | 9526 |
| 1092 | nmdc:mga08y16_254423_c1 | 3300050511 | Bacteria | 1815 |
| 1093 | nmdc:mga08y16_416198_c1 | 3300050511 | Bacteria | 1374 |
| 1094 | nmdc:mga08y16_939847_c1 | 3300050511 | Bacteria | 848 |
| 1095 | nmdc:mga0n895_26006_c1 | 3300050512 | Bacteria | 5536 |
| 1096 | nmdc:mga0n895_833_c1 | 3300050512 | Bacteria | 22117 |
| 1097 | nmdc:mga0rr50_198901_c1 | 3300050513 | Bacteria | 1646 |
| 1098 | nmdc:mga0rr50_22957_c1 | 3300050513 | Bacteria | 4291 |
| 1099 | nmdc:mga0a205_155_c1 | 3300050515 | Bacteria | 44726 |
| 1100 | nmdc:mga0a205_181176_c1 | 3300050515 | Bacteria | 2001 |
| 1101 | nmdc:mga0a205_6078_c2 | 3300050515 | Bacteria | 8381 |
| 1102 | nmdc:mga0a205_6985_c1 | 3300050515 | Bacteria | 10204 |
| 1103 | nmdc:mga0a205_90315_c1 | 3300050515 | Bacteria | 2960 |
| 1104 | nmdc:mga0a205_9_c2 | 3300050515 | Bacteria | 69167 |
| 1105 | Ga0495601_0000012 | 3300053077 | Bacteria | 227853 |
| 1106 | Ga0495601_0000169 | 3300053077 | Bacteria | 35095 |
| 1107 | Ga0495601_0004850 | 3300053077 | Bacteria | 7804 |
| 1108 | Ga0495601_0017516 | 3300053077 | Bacteria | 4350 |
| 1109 | Ga0495601_0039313 | 3300053077 | Bacteria | 2962 |
| 1110 | Ga0495601_0056084 | 3300053077 | Bacteria | 2495 |
| 1111 | Ga0495601_0085318 | 3300053077 | Bacteria | 2029 |
| 1112 | Ga0495612_0000997 | 3300053078 | Bacteria | 11644 |
| 1113 | Ga0495655_0000003 | 3300053083 | Bacteria | 303053 |
| 1114 | Ga0495655_0005600 | 3300053083 | Bacteria | 2230 |
| 1115 | Ga0495655_0070523 | 3300053083 | Bacteria | 976 |
| 1116 | Ga0495595_0000001 | 3300053084 | Bacteria | 495226 |
| 1117 | Ga0495595_0000372 | 3300053084 | Bacteria | 17048 |
| 1118 | Ga0495595_0021777 | 3300053084 | Bacteria | 2804 |
| 1119 | Ga0495595_0101944 | 3300053084 | Bacteria | 1386 |
| 1120 | Ga0495595_0174703 | 3300053084 | Bacteria | 1064 |
| 1121 | Ga0495595_0210073 | 3300053084 | Bacteria | 970 |
| 1122 | Ga0495619_0000015 | 3300053085 | Bacteria | 252787 |
| 1123 | Ga0495619_0000018 | 3300053085 | Bacteria | 209943 |
| 1124 | Ga0495619_0000120 | 3300053085 | Bacteria | 58265 |
| 1125 | Ga0495619_0000408 | 3300053085 | Bacteria | 29246 |
| 1126 | Ga0495619_0000428 | 3300053085 | Bacteria | 28554 |
| 1127 | Ga0495619_0000758 | 3300053085 | Bacteria | 21054 |
| 1128 | Ga0495619_0010299 | 3300053085 | Bacteria | 5884 |
| 1129 | Ga0495619_0036957 | 3300053085 | Bacteria | 3181 |
| 1130 | Ga0495619_0064878 | 3300053085 | Bacteria | 2435 |
| 1131 | Ga0500566_0042822 | 3300053094 | Bacteria | 2610 |
| 1132 | Ga0500641_0072160 | 3300053096 | Bacteria | 1455 |
| 1133 | Ga0500614_001280 | 3300053123 | Bacteria | 6079 |
| 1134 | Ga0500628_000002 | 3300053129 | Bacteria | 357687 |
| 1135 | Ga0501084_0250468 | 3300054114 | Bacteria | 1495 |
| 1136 | Ga0501084_0346378 | 3300054114 | Bacteria | 1255 |
| 1137 | Ga0501082_0007010 | 3300060353 | Bacteria | 9723 |
| 1138 | Ga0501082_0009675 | 3300060353 | Bacteria | 8300 |
| 1139 | Ga0501082_0136304 | 3300060353 | Bacteria | 2130 |
| 1140 | Ga0466962_0009436 | 3300061719 | Bacteria | 4678 |
| 1141 | Ga0466962_0018390 | 3300061719 | Bacteria | 3361 |
| 1142 | Ga0466962_0044218 | 3300061719 | Bacteria | 2130 |
| 1143 | Ga0466962_0073021 | 3300061719 | Bacteria | 1639 |
| 1144 | Ga0466962_0199518 | 3300061719 | Bacteria | 977 |
| 1145 | Ga0530510_0138664 | 3300061734 | Bacteria | 1791 |
| 1146 | Ga0081538_10000328 | |||
| 1147 | JGI24746J21847_1005583 | |||
| 1148 | JGI24740J21852_10011273 | |||
| 1149 | JGI24735J21928_10082687 | |||
| 1150 | JGI24750J21931_1031192 | |||
| 1151 | JGI24034J26672_10000392 | |||
| 1152 | JGI24751J29686_10008668 | |||
| 1153 | JGI25407J50210_10000894 | |||
| 1154 | JGI25404J52841_10016459 | |||
| 1155 | Ga0070658_10100748 | |||
| 1156 | Ga0070658_10627794 | |||
| 1157 | Ga0070676_10082695 | |||
| 1158 | Ga0070676_10296906 | |||
| 1159 | Ga0070683_100002929 | |||
| 1160 | Ga0070683_100003428 | |||
| 1161 | Ga0070683_100030213 | |||
| 1162 | Ga0070683_100035272 | |||
| 1163 | Ga0070683_100082681 | |||
| 1164 | Ga0070683_100111338 | |||
| 1165 | Ga0070690_100193089 | |||
| 1166 | Ga0070670_100226741 | |||
| 1167 | Ga0070677_10000006 | |||
| 1168 | Ga0070680_100001511 | |||
| 1169 | Ga0070680_100043821 | |||
| 1170 | Ga0070680_100375201 | |||
| 1171 | Ga0070682_100000029 | |||
| 1172 | Ga0070682_100026759 | |||
| 1173 | Ga0070682_100046608 | |||
| 1174 | Ga0070682_100051988 | |||
| 1175 | Ga0068868_100001567 | |||
| 1176 | Ga0068868_100004232 | |||
| 1177 | Ga0068868_100029546 | |||
| 1178 | Ga0070660_100000784 | |||
| 1179 | Ga0070660_100013210 | |||
| 1180 | Ga0070660_100041823 | |||
| 1181 | Ga0070660_100130483 | |||
| 1182 | Ga0070660_100233469 | |||
| 1183 | Ga0070689_100095957 | |||
| 1184 | Ga0070689_100234061 | |||
| 1185 | Ga0070689_100417259 | |||
| 1186 | Ga0070691_10000069 | |||
| 1187 | Ga0070691_10013503 | |||
| 1188 | Ga0070691_10053497 | |||
| 1189 | Ga0070687_100138570 | |||
| 1190 | Ga0070661_100000161 | |||
| 1191 | Ga0070661_100060433 | |||
| 1192 | Ga0070661_100062495 | |||
| 1193 | Ga0070692_10005505 | |||
| 1194 | Ga0070692_10030508 | |||
| 1195 | Ga0070668_100080075 | |||
| 1196 | Ga0070669_100008473 | |||
| 1197 | Ga0070669_100177477 | |||
| 1198 | Ga0070669_100178720 | |||
| 1199 | Ga0070675_100000153 | |||
| 1200 | Ga0070671_100149015 | |||
| 1201 | Ga0070674_100000014 | |||
| 1202 | Ga0070674_100000033 | |||
| 1203 | Ga0070674_100043542 | |||
| 1204 | Ga0070674_100086322 | |||
| 1205 | Ga0070673_100023228 | |||
| 1206 | Ga0070688_100000853 | |||
| 1207 | Ga0070688_100045831 | |||
| 1208 | Ga0070659_100000002 | |||
| 1209 | Ga0070659_100007235 | |||
| 1210 | Ga0070659_100016061 | |||
| 1211 | Ga0070659_100082914 | |||
| 1212 | Ga0070667_100024800 | |||
| 1213 | Ga0070667_100045427 | |||
| 1214 | Ga0070667_100514036 | |||
| 1215 | Ga0070714_100000170 | |||
| 1216 | Ga0070714_100020511 | |||
| 1217 | Ga0070714_100099532 | |||
| 1218 | Ga0070714_100188096 | |||
| 1219 | Ga0070714_100205979 | |||
| 1220 | Ga0070714_100304747 | |||
| 1221 | Ga0070713_100187446 | |||
| 1222 | Ga0070713_100366033 | |||
| 1223 | Ga0070713_100551219 | |||
| 1224 | Ga0070710_10000006 | |||
| 1225 | Ga0070711_100131113 | |||
| 1226 | Ga0070711_100678739 | |||
| 1227 | Ga0070705_100001402 | |||
| 1228 | Ga0070700_100015821 | |||
| 1229 | Ga0070700_100065674 | |||
| 1230 | Ga0070694_100275594 | |||
| 1231 | Ga0070663_100005918 | |||
| 1232 | Ga0070663_100006461 | |||
| 1233 | Ga0070663_100308495 | |||
| 1234 | Ga0070678_100097190 | |||
| 1235 | Ga0070678_100097480 | |||
| 1236 | Ga0070678_100304205 | |||
| 1237 | Ga0070678_100401626 | |||
| 1238 | Ga0070662_100000008 | |||
| 1239 | Ga0070681_10009233 | |||
| 1240 | Ga0070681_10014965 | |||
| 1241 | Ga0070681_10051191 | |||
| 1242 | Ga0068867_100000247 | |||
| 1243 | Ga0070685_10000203 | |||
| 1244 | Ga0070685_10001711 | |||
| 1245 | Ga0070685_10051492 | |||
| 1246 | Ga0070679_100002585 | |||
| 1247 | Ga0070679_100002649 | |||
| 1248 | Ga0070679_100014750 | |||
| 1249 | Ga0070679_100116556 | |||
| 1250 | Ga0070679_100282348 | |||
| 1251 | Ga0070684_100002882 | |||
| 1252 | Ga0070684_100005122 | |||
| 1253 | Ga0070684_100015188 | |||
| 1254 | Ga0070684_100108633 | |||
| 1255 | Ga0070684_100112693 | |||
| 1256 | Ga0070684_100115689 | |||
| 1257 | Ga0070684_100149567 | |||
| 1258 | Ga0070684_100216075 | |||
| 1259 | Ga0070684_100285420 | |||
| 1260 | Ga0070684_100597746 | |||
| 1261 | Ga0070684_100801110 | |||
| 1262 | Ga0068853_100002309 | |||
| 1263 | Ga0068853_100266063 | |||
| 1264 | Ga0068853_100281683 | |||
| 1265 | Ga0068853_100349858 | |||
| 1266 | Ga0070672_100000262 | |||
| 1267 | Ga0070672_100010429 | |||
| 1268 | Ga0070686_100066715 | |||
| 1269 | Ga0070686_100123268 | |||
| 1270 | Ga0070686_100168630 | |||
| 1271 | Ga0070686_100252449 | |||
| 1272 | Ga0070696_100186171 | |||
| 1273 | Ga0070693_100001031 | |||
| 1274 | Ga0070693_100503345 | |||
| 1275 | Ga0070665_100000870 | |||
| 1276 | Ga0070665_100025257 | |||
| 1277 | Ga0070704_100117440 | |||
| 1278 | Ga0070704_100325809 | |||
| 1279 | Ga0070704_100331944 | |||
| 1280 | Ga0070704_100474985 | |||
| 1281 | Ga0068855_100493914 | |||
| 1282 | Ga0070664_100026536 | |||
| 1283 | Ga0070664_100045886 | |||
| 1284 | Ga0070664_100085667 | |||
| 1285 | Ga0070664_100127841 | |||
| 1286 | Ga0068854_100000115 | |||
| 1287 | Ga0068854_100025929 | |||
| 1288 | Ga0068854_100037063 | |||
| 1289 | Ga0068854_100316523 | |||
| 1290 | Ga0068856_100000057 | |||
| 1291 | Ga0068856_100009716 | |||
| 1292 | Ga0068856_100017908 | |||
| 1293 | Ga0068856_100080915 | |||
| 1294 | Ga0068856_100109097 | |||
| 1295 | Ga0068856_100319245 | |||
| 1296 | Ga0070702_100017882 | |||
| 1297 | Ga0068852_100000058 | |||
| 1298 | Ga0068852_100043696 | |||
| 1299 | Ga0068852_100540323 | |||
| 1300 | Ga0068852_100798096 | |||
| 1301 | Ga0068852_100803851 | |||
| 1302 | Ga0068859_100266922 | |||
| 1303 | Ga0068864_100000262 | |||
| 1304 | Ga0068864_100217585 | |||
| 1305 | Ga0068866_10000002 | |||
| 1306 | Ga0068866_10001413 | |||
| 1307 | Ga0068866_10017802 | |||
| 1308 | Ga0068866_10031076 | |||
| 1309 | Ga0068851_10014822 | |||
| 1310 | Ga0068851_10054543 | |||
| 1311 | Ga0068870_10120353 | |||
| 1312 | Ga0068863_100000042 | |||
| 1313 | Ga0068858_100000086 | |||
| 1314 | Ga0068858_100000155 | |||
| 1315 | Ga0068858_100149827 | |||
| 1316 | Ga0068858_100182184 | |||
| 1317 | Ga0068860_100061823 | |||
| 1318 | Ga0068860_100173607 | |||
| 1319 | Ga0068862_100006786 | |||
| 1320 | Ga0068862_100271700 | |||
| 1321 | Ga0081455_10008739 | |||
| 1322 | Ga0081455_10013826 | |||
| 1323 | Ga0081455_10022993 | |||
| 1324 | Ga0081455_10024890 | |||
| 1325 | Ga0081455_10034667 | |||
| 1326 | Ga0081455_10045051 | |||
| 1327 | Ga0081455_10103074 | |||
| 1328 | Ga0081455_10106184 | |||
| 1329 | Ga0081538_10000114 | |||
| 1330 | Ga0081538_10000357 | |||
| 1331 | Ga0081538_10001471 | |||
| 1332 | Ga0081538_10007628 | |||
| 1333 | Ga0081540_1000427 | |||
| 1334 | Ga0081540_1000546 | |||
| 1335 | Ga0081540_1001605 | |||
| 1336 | Ga0081540_1027018 | |||
| 1337 | Ga0081540_1110011 | |||
| 1338 | Ga0081540_1133440 | |||
| 1339 | Ga0081539_10001100 | |||
| 1340 | Ga0081539_10014343 | |||
| 1341 | Ga0081539_10100845 | |||
| 1342 | Ga0070717_10000005 | |||
| 1343 | Ga0070717_10157982 | |||
| 1344 | Ga0070717_10196937 | |||
| 1345 | Ga0075365_10005616 | |||
| 1346 | Ga0075365_10006075 | |||
| 1347 | Ga0075365_10015257 | |||
| 1348 | Ga0075365_10015633 | |||
| 1349 | Ga0075365_10044115 | |||
| 1350 | Ga0075365_10063852 | |||
| 1351 | Ga0075365_10089498 | |||
| 1352 | Ga0075365_10094113 | |||
| 1353 | Ga0075365_10175830 | |||
| 1354 | Ga0075365_10461095 | |||
| 1355 | Ga0075363_100009204 | |||
| 1356 | Ga0075363_100042038 | |||
| 1357 | Ga0075363_100231670 | |||
| 1358 | Ga0075363_100276310 | |||
| 1359 | Ga0075364_10037299 | |||
| 1360 | Ga0075364_10089986 | |||
| 1361 | Ga0075364_10160283 | |||
| 1362 | Ga0075364_10392739 | |||
| 1363 | Ga0075432_10008489 | |||
| 1364 | Ga0070715_10000015 | |||
| 1365 | Ga0070716_100038221 | |||
| 1366 | Ga0070712_100003222 | |||
| 1367 | Ga0075367_10084122 | |||
| 1368 | Ga0075367_10232439 | |||
| 1369 | Ga0075370_10137887 | |||
| 1370 | Ga0068871_100306784 | |||
| 1371 | Ga0075428_100347537 | |||
| 1372 | Ga0075430_100058859 | |||
| 1373 | Ga0075430_100233371 | |||
| 1374 | Ga0075431_100009378 | |||
| 1375 | Ga0075431_100228260 | |||
| 1376 | Ga0075431_100412829 | |||
| 1377 | Ga0075433_10000663 | |||
| 1378 | Ga0075433_10003490 | |||
| 1379 | Ga0075433_10008610 | |||
| 1380 | Ga0075434_100009254 | |||
| 1381 | Ga0075434_100622853 | |||
| 1382 | Ga0075429_100281353 | |||
| 1383 | Ga0075429_100420370 | |||
| 1384 | Ga0068865_100000020 | |||
| 1385 | Ga0068865_100023362 | |||
| 1386 | Ga0068865_100242781 | |||
| 1387 | Ga0075436_100326432 | |||
| 1388 | Ga0097620_100266939 | |||
| 1389 | Ga0105244_10213774 | |||
| 1390 | Ga0105240_10091944 | |||
| 1391 | Ga0105240_10183320 | |||
| 1392 | Ga0105240_10779718 | |||
| 1393 | Ga0111539_10027089 | |||
| 1394 | Ga0111539_10256714 | |||
| 1395 | Ga0111539_10619545 | |||
| 1396 | Ga0105245_10000053 | |||
| 1397 | Ga0105245_10000159 | |||
| 1398 | Ga0105245_10001015 | |||
| 1399 | Ga0105245_10001365 | |||
| 1400 | Ga0105245_10002749 | |||
| 1401 | Ga0105245_10011439 | |||
| 1402 | Ga0105245_10217551 | |||
| 1403 | Ga0105247_10052018 | |||
| 1404 | Ga0105247_10065907 | |||
| 1405 | Ga0105247_10362632 | |||
| 1406 | Ga0114129_10005150 | |||
| 1407 | Ga0114129_10071282 | |||
| 1408 | Ga0114129_10076902 | |||
| 1409 | Ga0114129_10259087 | |||
| 1410 | Ga0114129_10488040 | |||
| 1411 | Ga0105243_10002833 | |||
| 1412 | Ga0105243_10006302 | |||
| 1413 | Ga0105243_10400784 | |||
| 1414 | Ga0105241_10131796 | |||
| 1415 | Ga0105242_10000017 | |||
| 1416 | Ga0105242_10002766 | |||
| 1417 | Ga0105242_10028630 | |||
| 1418 | Ga0105242_10390535 | |||
| 1419 | Ga0105242_10509441 | |||
| 1420 | Ga0105242_10633653 | |||
| 1421 | Ga0105237_10180125 | |||
| 1422 | Ga0105237_10358123 | |||
| 1423 | Ga0105237_10418753 | |||
| 1424 | Ga0105237_10952258 | |||
| 1425 | Ga0105238_10026476 | |||
| 1426 | Ga0105238_10093086 | |||
| 1427 | Ga0105249_10000085 | |||
| 1428 | Ga0105249_10000841 | |||
| 1429 | Ga0105249_10103913 | |||
| 1430 | Ga0105249_10337817 | |||
| 1431 | Ga0105249_10427285 | |||
| 1432 | Ga0105239_10091386 | |||
| 1433 | Ga0105239_10141631 | |||
| 1434 | Ga0105239_10186124 | |||
| 1435 | Ga0105239_10218964 | |||
| 1436 | Ga0105246_10016207 | |||
| 1437 | Ga0105246_10377751 | |||
| 1438 | Ga0157371_10041090 | |||
| 1439 | Ga0157370_10017872 | |||
| 1440 | Ga0157370_10040093 | |||
| 1441 | Ga0157370_10519131 | |||
| 1442 | Ga0157369_10000118 | |||
| 1443 | Ga0157369_10109106 | |||
| 1444 | Ga0157369_10300821 | |||
| 1445 | Ga0157369_10873716 | |||
| 1446 | Ga0157374_10015535 | |||
| 1447 | Ga0157374_10591849 | |||
| 1448 | Ga0157378_10227755 | |||
| 1449 | Ga0157378_10367759 | |||
| 1450 | Ga0163162_10208219 | |||
| 1451 | Ga0163162_10528766 | |||
| 1452 | Ga0157372_10000616 | |||
| 1453 | Ga0157372_10131416 | |||
| 1454 | Ga0157372_10482863 | |||
| 1455 | Ga0157375_10001691 | |||
| 1456 | Ga0157375_10004687 | |||
| 1457 | Ga0157375_10026400 | |||
| 1458 | Ga0157375_10028700 | |||
| 1459 | Ga0157375_10142517 | |||
| 1460 | Ga0157375_11524047 | |||
| 1461 | Ga0163163_10055862 | |||
| 1462 | Ga0163163_10258811 | |||
| 1463 | Ga0163163_10695715 | |||
| 1464 | Ga0157380_10000024 | |||
| 1465 | Ga0157380_10000080 | |||
| 1466 | Ga0182008_10151795 | |||
| 1467 | Ga0157379_10047840 | |||
| 1468 | Ga0157379_10128171 | |||
| 1469 | Ga0157379_10331926 | |||
| 1470 | Ga0157376_10003520 | |||
| 1471 | Ga0157376_10034676 | |||
| 1472 | Ga0163161_10000364 | |||
| 1473 | Ga0163161_10707599 | |||
| 1474 | Ga0206356_11585180 | |||
| 1475 | Ga0206356_11678748 | |||
| 1476 | Ga0206354_10417134 | |||
| 1477 | Ga0206353_11990320 | |||
| 1478 | Ga0213874_10009823 | |||
| 1479 | Ga0213874_10021776 | |||
| 1480 | Ga0213874_10049567 | |||
| 1481 | Ga0213874_10090197 | |||
| 1482 | Ga0213876_10015206 | |||
| 1483 | Ga0213876_10021333 | |||
| 1484 | Ga0213876_10043521 | |||
| 1485 | Ga0213876_10043663 | |||
| 1486 | Ga0213876_10243084 | |||
| 1487 | Ga0213875_10010967 | |||
| 1488 | Ga0213875_10016033 | |||
| 1489 | Ga0213875_10048975 | |||
| 1490 | Ga0213875_10131837 | |||
| 1491 | Ga0207656_10008405 | |||
| 1492 | Ga0207656_10008446 | |||
| 1493 | Ga0207682_10000036 | |||
| 1494 | Ga0207692_10000001 | |||
| 1495 | Ga0207692_10041316 | |||
| 1496 | Ga0207642_10000001 | |||
| 1497 | Ga0207642_10000003 | |||
| 1498 | Ga0207642_10000094 | |||
| 1499 | Ga0207642_10005915 | |||
| 1500 | Ga0207710_10000151 | |||
| 1501 | Ga0207710_10075132 | |||
| 1502 | Ga0207688_10004383 | |||
| 1503 | Ga0207680_10095941 | |||
| 1504 | Ga0207685_10000001 | |||
| 1505 | Ga0207685_10013360 | |||
| 1506 | Ga0207645_10162962 | |||
| 1507 | Ga0207643_10156726 | |||
| 1508 | Ga0207705_10060535 | |||
| 1509 | Ga0207705_10122277 | |||
| 1510 | Ga0207707_10015020 | |||
| 1511 | Ga0207707_10031589 | |||
| 1512 | Ga0207707_10063719 | |||
| 1513 | Ga0207695_10097188 | |||
| 1514 | Ga0207695_10146494 | |||
| 1515 | Ga0207671_10310056 | |||
| 1516 | Ga0207671_10316281 | |||
| 1517 | Ga0207693_10000464 | |||
| 1518 | Ga0207693_10000905 | |||
| 1519 | Ga0207693_10006011 | |||
| 1520 | Ga0207663_10049919 | |||
| 1521 | Ga0207663_10150030 | |||
| 1522 | Ga0207663_10201747 | |||
| 1523 | Ga0207660_10020675 | |||
| 1524 | Ga0207660_10510945 | |||
| 1525 | Ga0207662_10055093 | |||
| 1526 | Ga0207662_10135146 | |||
| 1527 | Ga0207662_10370406 | |||
| 1528 | Ga0207657_10000514 | |||
| 1529 | Ga0207657_10016416 | |||
| 1530 | Ga0207657_10050060 | |||
| 1531 | Ga0207657_10070903 | |||
| 1532 | Ga0207649_10000024 | |||
| 1533 | Ga0207649_10010436 | |||
| 1534 | Ga0207652_10000150 | |||
| 1535 | Ga0207652_10002711 | |||
| 1536 | Ga0207652_10008834 | |||
| 1537 | Ga0207652_10090480 | |||
| 1538 | Ga0207681_10067184 | |||
| 1539 | Ga0207694_10000035 | |||
| 1540 | Ga0207694_10022313 | |||
| 1541 | Ga0207694_10319454 | |||
| 1542 | Ga0207650_10043219 | |||
| 1543 | Ga0207650_10496911 | |||
| 1544 | Ga0207659_10000043 | |||
| 1545 | Ga0207659_10070993 | |||
| 1546 | Ga0207687_10000011 | |||
| 1547 | Ga0207687_10000021 | |||
| 1548 | Ga0207687_10000350 | |||
| 1549 | Ga0207687_10002791 | |||
| 1550 | Ga0207687_10022605 | |||
| 1551 | Ga0207687_10090709 | |||
| 1552 | Ga0207687_10185163 | |||
| 1553 | Ga0207700_10000009 | |||
| 1554 | Ga0207700_10288869 | |||
| 1555 | Ga0207700_10509018 | |||
| 1556 | Ga0207700_10620661 | |||
| 1557 | Ga0207664_10000035 | |||
| 1558 | Ga0207664_10163609 | |||
| 1559 | Ga0207664_10222317 | |||
| 1560 | Ga0207664_10435931 | |||
| 1561 | Ga0207644_10062523 | |||
| 1562 | Ga0207690_10000024 | |||
| 1563 | Ga0207690_10003651 | |||
| 1564 | Ga0207690_10010080 | |||
| 1565 | Ga0207706_10000016 | |||
| 1566 | Ga0207706_10385087 | |||
| 1567 | Ga0207686_10000016 | |||
| 1568 | Ga0207686_10000029 | |||
| 1569 | Ga0207686_10000549 | |||
| 1570 | Ga0207686_10012730 | |||
| 1571 | Ga0207686_10090418 | |||
| 1572 | Ga0207686_10113409 | |||
| 1573 | Ga0207686_10116759 | |||
| 1574 | Ga0207686_10399381 | |||
| 1575 | Ga0207709_10004991 | |||
| 1576 | Ga0207709_10005805 | |||
| 1577 | Ga0207709_10051303 | |||
| 1578 | Ga0207709_10150427 | |||
| 1579 | Ga0207709_10205107 | |||
| 1580 | Ga0207709_10224610 | |||
| 1581 | Ga0207670_10028660 | |||
| 1582 | Ga0207670_10076963 | |||
| 1583 | Ga0207670_10086523 | |||
| 1584 | Ga0207669_10000007 | |||
| 1585 | Ga0207669_10000137 | |||
| 1586 | Ga0207669_10154909 | |||
| 1587 | Ga0207669_10342142 | |||
| 1588 | Ga0207669_10566138 | |||
| 1589 | Ga0207704_10000004 | |||
| 1590 | Ga0207704_10016963 | |||
| 1591 | Ga0207704_10043490 | |||
| 1592 | Ga0207704_10415873 | |||
| 1593 | Ga0207665_10153996 | |||
| 1594 | Ga0207691_10000374 | |||
| 1595 | Ga0207691_10018685 | |||
| 1596 | Ga0207689_10039478 | |||
| 1597 | Ga0207689_10201186 | |||
| 1598 | Ga0207689_10202491 | |||
| 1599 | Ga0207661_10000142 | |||
| 1600 | Ga0207661_10004000 | |||
| 1601 | Ga0207661_10017781 | |||
| 1602 | Ga0207661_10018328 | |||
| 1603 | Ga0207661_10025205 | |||
| 1604 | Ga0207661_10051371 | |||
| 1605 | Ga0207661_10066907 | |||
| 1606 | Ga0207661_10126815 | |||
| 1607 | Ga0207661_10247878 | |||
| 1608 | Ga0207679_10264217 | |||
| 1609 | Ga0207667_10115864 | |||
| 1610 | Ga0207667_10419800 | |||
| 1611 | Ga0207651_10000641 | |||
| 1612 | Ga0207712_10000033 | |||
| 1613 | Ga0207712_10090042 | |||
| 1614 | Ga0207712_10115429 | |||
| 1615 | Ga0207712_10386870 | |||
| 1616 | Ga0207668_10031383 | |||
| 1617 | Ga0207668_10722734 | |||
| 1618 | Ga0207640_10000059 | |||
| 1619 | Ga0207640_10074605 | |||
| 1620 | Ga0207640_10158365 | |||
| 1621 | Ga0207658_10080916 | |||
| 1622 | Ga0207658_10181019 | |||
| 1623 | Ga0207658_10214744 | |||
| 1624 | Ga0207658_10371333 | |||
| 1625 | Ga0207658_10388652 | |||
| 1626 | Ga0207677_10016790 | |||
| 1627 | Ga0207677_10022711 | |||
| 1628 | Ga0207677_10037765 | |||
| 1629 | Ga0207677_10230035 | |||
| 1630 | Ga0207703_10000072 | |||
| 1631 | Ga0207703_10000266 | |||
| 1632 | Ga0207703_10045722 | |||
| 1633 | Ga0207703_10052994 | |||
| 1634 | Ga0207703_10069535 | |||
| 1635 | Ga0207703_10298596 | |||
| 1636 | Ga0207639_10014674 | |||
| 1637 | Ga0207639_10403294 | |||
| 1638 | Ga0207678_10001193 | |||
| 1639 | Ga0207678_10004455 | |||
| 1640 | Ga0207678_10321155 | |||
| 1641 | Ga0207708_10000640 | |||
| 1642 | Ga0207708_10071477 | |||
| 1643 | Ga0207708_10348746 | |||
| 1644 | Ga0207708_10399333 | |||
| 1645 | Ga0207702_10000027 | |||
| 1646 | Ga0207702_10059405 | |||
| 1647 | Ga0207702_10062479 | |||
| 1648 | Ga0207641_10000231 | |||
| 1649 | Ga0207641_10002333 | |||
| 1650 | Ga0207641_10140391 | |||
| 1651 | Ga0207641_10579958 | |||
| 1652 | Ga0207641_10869767 | |||
| 1653 | Ga0207648_10000230 | |||
| 1654 | Ga0207648_10041159 | |||
| 1655 | Ga0207676_10000038 | |||
| 1656 | Ga0207674_10041782 | |||
| 1657 | Ga0207674_10133707 | |||
| 1658 | Ga0207674_10573733 | |||
| 1659 | Ga0207675_100179302 | |||
| 1660 | Ga0207675_100264216 | |||
| 1661 | Ga0207675_100351077 | |||
| 1662 | Ga0207683_10047826 | |||
| 1663 | Ga0207698_10000002 | |||
| 1664 | Ga0207698_10022738 | |||
| 1665 | Ga0207698_10724071 | |||
| 1666 | Ga0207428_10028772 | |||
| 1667 | Ga0207428_10164204 | |||
| 1668 | Ga0268266_10000076 | |||
| 1669 | Ga0268266_10000664 | |||
| 1670 | Ga0268266_10000809 | |||
| 1671 | Ga0268265_10067744 | |||
| 1672 | Ga0268265_10100915 | |||
| 1673 | Ga0268265_10760417 | |||
| 1674 | Ga0268264_10025994 | |||
| 1675 | Ga0268264_10112768 | |||
| 1676 | Ga0265337_1000004 | |||
| 1677 | Ga0265326_10000004 | |||
| 1678 | Ga0265326_10000091 | |||
| 1679 | Ga0265319_1000029 | |||
| 1680 | Ga0265319_1009335 | |||
| 1681 | Ga0265334_10000019 | |||
| 1682 | Ga0265322_10000006 | |||
| 1683 | Ga0265336_10001559 | |||
| 1684 | Ga0265336_10001891 | |||
| 1685 | Ga0265336_10038625 | |||
| 1686 | Ga0265338_10000179 | |||
| 1687 | Ga0265338_10004866 | |||
| 1688 | Ga0265324_10000185 | |||
| 1689 | Ga0265324_10000269 | |||
| 1690 | Ga0265324_10004148 | |||
| 1691 | Ga0265332_10123483 | |||
| 1692 | Ga0265328_10003537 | |||
| 1693 | Ga0265320_10000001 | |||
| 1694 | Ga0265320_10055494 | |||
| 1695 | Ga0265331_10001356 | |||
| 1696 | Ga0265331_10012050 | |||
| 1697 | Ga0265327_10000003 | |||
| 1698 | Ga0265327_10085636 | |||
| 1699 | Ga0265316_10011172 | |||
| 1700 | Ga0307408_100311165 | |||
| 1701 | Ga0265314_10000567 | |||
| 1702 | Ga0307405_10423859 | |||
| 1703 | Ga0307413_10016288 | |||
| 1704 | Ga0307410_10015757 | |||
| 1705 | Ga0307410_10056053 | |||
| 1706 | Ga0307410_10087118 | |||
| 1707 | Ga0307410_10271477 | |||
| 1708 | Ga0307410_10314353 | |||
| 1709 | Ga0307410_10589068 | |||
| 1710 | Ga0307406_10025903 | |||
| 1711 | Ga0307406_10036449 | |||
| 1712 | Ga0307406_10363362 | |||
| 1713 | Ga0307407_10074236 | |||
| 1714 | Ga0307407_10264530 | |||
| 1715 | Ga0307412_10010849 | |||
| 1716 | Ga0307409_100016973 | |||
| 1717 | Ga0307409_100047936 | |||
| 1718 | Ga0307409_100235555 | |||
| 1719 | Ga0307409_100481956 | |||
| 1720 | Ga0307416_100018582 | |||
| 1721 | Ga0307416_100164577 | |||
| 1722 | Ga0307416_100769129 | |||
| 1723 | Ga0307414_10031329 | |||
| 1724 | Ga0307414_10289777 | |||
| 1725 | Ga0307415_100128037 | |||
| 1726 | Ga0307415_100293078 | |||
| 1727 | Ga0307415_100389427 | |||
| 1728 | Ga0373957_0040463 | |||
| 1729 | Ga0316574_0033228 | |||
| 1730 | Ga0316574_0040470 | |||
| 1731 | Ga0316574_0151403 | |||
| 1732 | Ga0373931_0068204 | |||
| 1733 | Ga0373933_0091340 | |||
| 1734 | Ga0373937_0040714 | |||
| 1735 | Ga0373937_0153441 | |||
| 1736 | Ga0316584_0039677 | |||
| 1737 | Ga0316584_0102679 | |||
| 1738 | Ga0373925_0259484 | |||
| 1739 | Ga0395899_0190046 | |||
| 1740 | Ga0395900_0005227 | |||
| 1741 | Ga0395900_0036309 | |||
| 1742 | Ga0395900_0583280 | |||
| 1743 | Ga0395898_0005197 | |||
| 1744 | Ga0395898_0026957 | |||
| 1745 | Ga0395898_0033386 | |||
| 1746 | Ga0395898_0269451 | |||
| 1747 | Ga0395898_0427206 | |||
| 1748 | Ga0395905_0003983 | |||
| 1749 | Ga0395905_0006802 | |||
| 1750 | Ga0395905_0293094 | |||
| 1751 | Ga0395905_0672956 | |||
| 1752 | Ga0436364_0011780 | |||
| 1753 | Ga0436364_0036263 | |||
| 1754 | Ga0436364_0037496 | |||
| 1755 | Ga0436364_0106102 | |||
| 1756 | Ga0436364_0566741 | |||
| 1757 | Ga0436364_0568939 | |||
| 1758 | Ga0436364_1036677 | |||
| 1759 | Ga0436364_1277199 | |||
| 1760 | Ga0436364_1318699 | |||
| 1761 | Ga0436364_1345153 | |||
| 1762 | Ga0395901_0003503 | |||
| 1763 | Ga0395901_0021645 | |||
| 1764 | Ga0395901_0067075 | |||
| 1765 | Ga0395901_0091450 | |||
| 1766 | Ga0395901_0219002 | |||
| 1767 | Ga0395901_0697684 | |||
| 1768 | Ga0436365_0110675 | |||
| 1769 | Ga0436365_0120316 | |||
| 1770 | Ga0436365_0246939 | |||
| 1771 | Ga0436365_0259665 | |||
| 1772 | Ga0436365_0447550 | |||
| 1773 | Ga0436365_0632396 | |||
| 1774 | Ga0436365_0704007 | |||
| 1775 | Ga0436365_0728883 | |||
| 1776 | Ga0436365_1199839 | |||
| 1777 | Ga0436365_1332524 | |||
| 1778 | Ga0436365_1392317 | |||
| 1779 | Ga0436365_1652791 | |||
| 1780 | Ga0436365_1710566 | |||
| 1781 | Ga0436360_0343660 | |||
| 1782 | Ga0436363_0080822 | |||
| 1783 | Ga0436363_0093570 | |||
| 1784 | Ga0436363_0111697 | |||
| 1785 | Ga0436363_0451482 | |||
| 1786 | Ga0436363_0871224 | |||
| 1787 | Ga0436363_0918977 | |||
| 1788 | Ga0436363_1527297 | |||
| 1789 | Ga0436362_1236380 | |||
| 1790 | Ga0451800_0403305 | |||
| 1791 | Ga0451845_0477232 | |||
| 1792 | Ga0451849_0909594 | |||
| 1793 | Ga0451849_1338131 | |||
| 1794 | Ga0451843_0185767 | |||
| 1795 | Ga0451853_3581193 | |||
| 1796 | Ga0450923_067683 | |||
| 1797 | Ga0466965_0131936 | |||
| 1798 | Ga0466966_0029883 | |||
| 1799 | Ga0466966_0046094 | |||
| 1800 | Ga0466966_0262273 | |||
| 1801 | Ga0466961_0007985 | |||
| 1802 | Ga0466961_0035299 | |||
| 1803 | Ga0466961_0090653 | |||
| 1804 | Ga0466963_0000124 | |||
| 1805 | Ga0466963_0000529 | |||
| 1806 | Ga0466963_0013326 | |||
| 1807 | Ga0466963_0013444 | |||
| 1808 | Ga0466963_0116762 | |||
| 1809 | Ga0466963_0180980 | |||
| 1810 | Ga0466963_0358282 | |||
| 1811 | Ga0466971_0004371 | |||
| 1812 | Ga0466971_0018488 | |||
| 1813 | Ga0466971_0072398 | |||
| 1814 | Ga0466971_0090348 | |||
| 1815 | Ga0466968_0003736 | |||
| 1816 | Ga0466968_0017345 | |||
| 1817 | Ga0466968_0120749 | |||
| 1818 | Ga0466957_0000145 | |||
| 1819 | Ga0466957_0026396 | |||
| 1820 | Ga0466957_0032771 | |||
| 1821 | Ga0466957_0058407 | |||
| 1822 | Ga0466957_0220814 | |||
| 1823 | Ga0466960_0058299 | |||
| 1824 | Ga0466960_0101417 | |||
| 1825 | Ga0466960_0328096 | |||
| 1826 | Ga0466959_0012139 | |||
| 1827 | Ga0466959_0015753 | |||
| 1828 | Ga0466959_0063911 | |||
| 1829 | Ga0466959_0116367 | |||
| 1830 | Ga0466959_0126333 | |||
| 1831 | Ga0466959_0141252 | |||
| 1832 | Ga0466959_0506918 | |||
| 1833 | Ga0466958_0001477 | |||
| 1834 | Ga0466958_0005313 | |||
| 1835 | Ga0466958_0021557 | |||
| 1836 | Ga0466958_0023202 | |||
| 1837 | Ga0466958_0046555 | |||
| 1838 | Ga0466958_0048144 | |||
| 1839 | Ga0466958_0100923 | |||
| 1840 | Ga0466958_0115707 | |||
| 1841 | Ga0466958_0117685 | |||
| 1842 | Ga0466958_0144192 | |||
| 1843 | Ga0466958_0383052 | |||
| 1844 | Ga0466967_0000008 | |||
| 1845 | Ga0466967_0001903 | |||
| 1846 | Ga0466967_0008828 | |||
| 1847 | Ga0466967_0063657 | |||
| 1848 | Ga0466967_0077424 | |||
| 1849 | Ga0466967_0093743 | |||
| 1850 | Ga0466967_0097015 | |||
| 1851 | Ga0466967_0254830 | |||
| 1852 | Ga0466967_0536406 | |||
| 1853 | Ga0495592_0000521 | |||
| 1854 | Ga0495592_0066802 | |||
| 1855 | Ga0495603_0000117 | |||
| 1856 | Ga0495603_0009250 | |||
| 1857 | Ga0495603_0130487 | |||
| 1858 | Ga0495603_0289067 | |||
| 1859 | Ga0495629_0001391 | |||
| 1860 | Ga0495629_0018397 | |||
| 1861 | Ga0495638_0005536 | |||
| 1862 | Ga0495641_0000001 | |||
| 1863 | Ga0495641_0129071 | |||
| 1864 | Ga0495651_0045643 | |||
| 1865 | Ga0495653_0046920 | |||
| 1866 | Ga0495653_0155055 | |||
| 1867 | Ga0495653_0198722 | |||
| 1868 | Ga0495582_0000022 | |||
| 1869 | Ga0495605_0099576 | |||
| 1870 | Ga0495639_0116691 | |||
| 1871 | Ga0495662_0000509 | |||
| 1872 | Ga0495662_0001149 | |||
| 1873 | Ga0495662_0129757 | |||
| 1874 | Ga0495664_0177796 | |||
| 1875 | Ga0495584_0108614 | |||
| 1876 | Ga0495594_0000276 | |||
| 1877 | Ga0495606_0000045 | |||
| 1878 | Ga0495608_0000001 | |||
| 1879 | Ga0495608_0000163 | |||
| 1880 | Ga0495608_0020569 | |||
| 1881 | Ga0495608_0029968 | |||
| 1882 | Ga0495618_0001468 | |||
| 1883 | Ga0495618_0035453 | |||
| 1884 | Ga0495620_0000990 | |||
| 1885 | Ga0495620_0095793 | |||
| 1886 | Ga0495628_0001583 | |||
| 1887 | Ga0495628_0019793 | |||
| 1888 | Ga0495628_0046506 | |||
| 1889 | Ga0495628_0061324 | |||
| 1890 | Ga0495628_0143898 | |||
| 1891 | Ga0495628_0164307 | |||
| 1892 | Ga0495630_0000037 | |||
| 1893 | Ga0495630_0000435 | |||
| 1894 | Ga0495630_0053084 | |||
| 1895 | Ga0495630_0098367 | |||
| 1896 | Ga0495637_0018145 | |||
| 1897 | Ga0495637_0038902 | |||
| 1898 | Ga0495644_0001413 | |||
| 1899 | Ga0495644_0043406 | |||
| 1900 | Ga0495644_0070097 | |||
| 1901 | Ga0495644_0095130 | |||
| 1902 | Ga0495642_0033816 | |||
| 1903 | Ga0495652_0000086 | |||
| 1904 | Ga0495652_0047667 | |||
| 1905 | Ga0495640_0022922 | |||
| 1906 | Ga0495640_0032586 | |||
| 1907 | Ga0495586_0008998 | |||
| 1908 | Ga0495587_0001022 | |||
| 1909 | Ga0495621_0003812 | |||
| 1910 | Ga0495645_0038645 | |||
| 1911 | Ga0495622_0000690 | |||
| 1912 | Ga0495667_0000044 | |||
| 1913 | Ga0495667_0013193 | |||
| 1914 | Ga0495667_0019970 | |||
| 1915 | Ga0495667_0495033 | |||
| 1916 | Ga0495656_0048019 | |||
| 1917 | Ga0495656_0094707 | |||
| 1918 | Ga0495668_0141057 | |||
| 1919 | Ga0495668_0150206 | |||
| 1920 | Ga0495634_0000013 | |||
| 1921 | Ga0495634_0001471 | |||
| 1922 | Ga0495634_0004564 | |||
| 1923 | Ga0495634_0040160 | |||
| 1924 | Ga0495625_0001659 | |||
| 1925 | Ga0495625_0143466 | |||
| 1926 | Ga0495635_0000063 | |||
| 1927 | Ga0495635_0165956 | |||
| 1928 | Ga0495588_0000240 | |||
| 1929 | Ga0495657_0000002 | |||
| 1930 | Ga0495657_0027265 | |||
| 1931 | Ga0495657_0027810 | |||
| 1932 | Ga0495599_0008094 | |||
| 1933 | Ga0495599_0153212 | |||
| 1934 | Ga0495646_0127464 | |||
| 1935 | Ga0495647_0000003 | |||
| 1936 | Ga0495647_0001273 | |||
| 1937 | Ga0495647_0144314 | |||
| 1938 | Ga0495658_0000008 | |||
| 1939 | Ga0495658_0156537 | |||
| 1940 | Ga0495669_0000594 | |||
| 1941 | Ga0495669_0002395 | |||
| 1942 | Ga0495613_0000298 | |||
| 1943 | Ga0495613_0000342 | |||
| 1944 | Ga0495624_0000164 | |||
| 1945 | Ga0495624_0002296 | |||
| 1946 | Ga0495624_0018570 | |||
| 1947 | Ga0495670_0039098 | |||
| 1948 | Ga0495670_0207530 | |||
| 1949 | Ga0495671_0079164 | |||
| 1950 | Ga0495649_0010293 | |||
| 1951 | Ga0495600_0033050 | |||
| 1952 | Ga0495660_0107541 | |||
| 1953 | Ga0495604_0000033 | |||
| 1954 | Ga0495604_0000850 | |||
| 1955 | Ga0495604_0051006 | |||
| 1956 | Ga0495604_0059679 | |||
| 1957 | Ga0495604_0379025 | |||
| 1958 | Ga0495674_0000007 | |||
| 1959 | Ga0495676_0005668 | |||
| 1960 | Ga0495676_0011669 | |||
| 1961 | Ga0495676_0020541 | |||
| 1962 | Ga0495676_0064327 | |||
| 1963 | Ga0495676_0092114 | |||
| 1964 | Ga0495676_0144367 | |||
| 1965 | Ga0495676_0248886 | |||
| 1966 | Ga0495676_0369320 | |||
| 1967 | Ga0495680_0000215 | |||
| 1968 | Ga0495680_0002477 | |||
| 1969 | Ga0495680_0013125 | |||
| 1970 | Ga0495680_0025078 | |||
| 1971 | Ga0495680_0029513 | |||
| 1972 | Ga0495680_0034864 | |||
| 1973 | Ga0495680_0210965 | |||
| 1974 | Ga0495680_0555744 | |||
| 1975 | Ga0495675_0000046 | |||
| 1976 | Ga0495675_0025403 | |||
| 1977 | Ga0495675_0276922 | |||
| 1978 | Ga0495684_0395914 | |||
| 1979 | Ga0495602_0000010 | |||
| 1980 | Ga0495602_0017974 | |||
| 1981 | Ga0495602_0204394 | |||
| 1982 | Ga0496100_0000003 | |||
| 1983 | Ga0496100_0000063 | |||
| 1984 | Ga0496100_0000647 | |||
| 1985 | Ga0496100_0082981 | |||
| 1986 | Ga0496100_0127630 | |||
| 1987 | Ga0496100_0132658 | |||
| 1988 | Ga0496100_0163760 | |||
| 1989 | Ga0496101_0000003 | |||
| 1990 | Ga0496101_0000016 | |||
| 1991 | Ga0496101_0000505 | |||
| 1992 | Ga0496101_0001570 | |||
| 1993 | Ga0496101_0012862 | |||
| 1994 | Ga0496101_0035176 | |||
| 1995 | Ga0496101_0097576 | |||
| 1996 | Ga0496102_0000965 | |||
| 1997 | Ga0496102_0003219 | |||
| 1998 | Ga0496102_0007169 | |||
| 1999 | Ga0496102_0036940 | |||
| 2000 | Ga0496102_0053500 | |||
| 2001 | Ga0496102_0218396 | |||
| 2002 | Ga0496102_0536550 | |||
| 2003 | Ga0496103_0000627 | |||
| 2004 | Ga0496103_0000683 | |||
| 2005 | Ga0496103_0028350 | |||
| 2006 | Ga0496103_0053152 | |||
| 2007 | Ga0496103_0122898 | |||
| 2008 | Ga0496104_0000002 | |||
| 2009 | Ga0496104_0000066 | |||
| 2010 | Ga0496104_0004998 | |||
| 2011 | Ga0496104_0046436 | |||
| 2012 | Ga0496104_0057747 | |||
| 2013 | Ga0496104_0100456 | |||
| 2014 | Ga0496104_0162343 | |||
| 2015 | Ga0496105_0000001 | |||
| 2016 | Ga0496105_0000020 | |||
| 2017 | Ga0496105_0005573 | |||
| 2018 | Ga0496105_0022996 | |||
| 2019 | Ga0496105_0041413 | |||
| 2020 | Ga0496105_0065325 | |||
| 2021 | Ga0496105_0191717 | |||
| 2022 | Ga0496106_0000015 | |||
| 2023 | Ga0496106_0000160 | |||
| 2024 | Ga0496106_0007972 | |||
| 2025 | Ga0496106_0013752 | |||
| 2026 | Ga0496106_0069093 | |||
| 2027 | Ga0496107_0000008 | |||
| 2028 | Ga0496107_0000014 | |||
| 2029 | Ga0496107_0014097 | |||
| 2030 | Ga0496107_0029654 | |||
| 2031 | Ga0496107_0035605 | |||
| 2032 | Ga0496107_0040628 | |||
| 2033 | Ga0496107_0043066 | |||
| 2034 | Ga0496107_0069671 | |||
| 2035 | Ga0496107_0091436 | |||
| 2036 | Ga0496107_0138828 | |||
| 2037 | Ga0496108_0000002 | |||
| 2038 | Ga0496108_0001400 | |||
| 2039 | Ga0496108_0011069 | |||
| 2040 | Ga0496108_0011544 | |||
| 2041 | Ga0496108_0011748 | |||
| 2042 | Ga0496108_0033235 | |||
| 2043 | Ga0496108_0037410 | |||
| 2044 | Ga0496108_0115895 | |||
| 2045 | Ga0496108_0380673 | |||
| 2046 | Ga0496108_0604629 | |||
| 2047 | Ga0496108_0689182 | |||
| 2048 | Ga0496109_0000001 | |||
| 2049 | Ga0496109_0000035 | |||
| 2050 | Ga0496109_0000246 | |||
| 2051 | Ga0496109_0000888 | |||
| 2052 | Ga0496109_0001890 | |||
| 2053 | Ga0496109_0010833 | |||
| 2054 | Ga0496109_0020718 | |||
| 2055 | Ga0496109_0029569 | |||
| 2056 | Ga0496109_0048317 | |||
| 2057 | Ga0496109_0051223 | |||
| 2058 | Ga0496109_0241075 | |||
| 2059 | Ga0496109_0271920 | |||
| 2060 | Ga0496109_0379223 | |||
| 2061 | Ga0496109_0445752 | |||
| 2062 | Ga0496109_0865564 | |||
| 2063 | Ga0496110_0002971 | |||
| 2064 | Ga0496110_0003803 | |||
| 2065 | Ga0496110_0005956 | |||
| 2066 | Ga0496110_0010155 | |||
| 2067 | Ga0496110_0019926 | |||
| 2068 | Ga0496110_0034907 | |||
| 2069 | Ga0496110_0183589 | |||
| 2070 | Ga0496110_0274932 | |||
| 2071 | Ga0496111_0000022 | |||
| 2072 | Ga0496111_0007441 | |||
| 2073 | Ga0496111_0014044 | |||
| 2074 | Ga0496111_0045157 | |||
| 2075 | Ga0496111_0132949 | |||
| 2076 | Ga0496111_0151567 | |||
| 2077 | Ga0496111_0215222 | |||
| 2078 | Ga0496111_0348589 | |||
| 2079 | Ga0496112_0000003 | |||
| 2080 | Ga0496112_0004601 | |||
| 2081 | Ga0496112_0009702 | |||
| 2082 | Ga0496112_0017265 | |||
| 2083 | Ga0496112_0019581 | |||
| 2084 | Ga0496112_0069529 | |||
| 2085 | Ga0496112_0070806 | |||
| 2086 | Ga0496112_0098339 | |||
| 2087 | Ga0496112_0204895 | |||
| 2088 | Ga0496112_0219519 | |||
| 2089 | Ga0496113_0000093 | |||
| 2090 | Ga0496113_0004574 | |||
| 2091 | Ga0496113_0007849 | |||
| 2092 | Ga0496113_0009677 | |||
| 2093 | Ga0496113_0011497 | |||
| 2094 | Ga0496113_0046527 | |||
| 2095 | Ga0496113_0122234 | |||
| 2096 | Ga0496113_0206762 | |||
| 2097 | Ga0496114_0000010 | |||
| 2098 | Ga0496114_0013558 | |||
| 2099 | Ga0496114_0019118 | |||
| 2100 | Ga0496114_0029049 | |||
| 2101 | Ga0496114_0147063 | |||
| 2102 | Ga0496114_0162716 | |||
| 2103 | Ga0496114_0185036 | |||
| 2104 | Ga0496114_0192348 | |||
| 2105 | Ga0496114_0264491 | |||
| 2106 | Ga0496114_0412914 | |||
| 2107 | Ga0496115_0000004 | |||
| 2108 | Ga0496115_0000363 | |||
| 2109 | Ga0496115_0009607 | |||
| 2110 | Ga0496115_0020491 | |||
| 2111 | Ga0496115_0053073 | |||
| 2112 | Ga0496115_0166218 | |||
| 2113 | Ga0496115_0261065 | |||
| 2114 | Ga0496115_0338744 | |||
| 2115 | Ga0496116_0000014 | |||
| 2116 | Ga0496117_0001652 | |||
| 2117 | Ga0496118_0008936 | |||
| 2118 | Ga0496118_0030195 | |||
| 2119 | Ga0496118_0267469 | |||
| 2120 | Ga0496119_0000862 | |||
| 2121 | Ga0496119_0010593 | |||
| 2122 | Ga0496119_0025801 | |||
| 2123 | Ga0496120_0040305 | |||
| 2124 | Ga0496121_0009587 | |||
| 2125 | Ga0496121_0015987 | |||
| 2126 | Ga0496124_0186529 | |||
| 2127 | Ga0496125_0109356 | |||
| 2128 | Ga0496126_0029731 | |||
| 2129 | Ga0496126_0138661 | |||
| 2130 | Ga0501031_0005839 | |||
| 2131 | Ga0501031_0100251 | |||
| 2132 | Ga0501032_0003387 | |||
| 2133 | Ga0501032_0015038 | |||
| 2134 | Ga0501032_0182655 | |||
| 2135 | Ga0501033_0002622 | |||
| 2136 | Ga0501033_0021431 | |||
| 2137 | Ga0501034_0005810 | |||
| 2138 | Ga0501034_0073096 | |||
| 2139 | Ga0501034_0171335 | |||
| 2140 | Ga0501034_0315688 | |||
| 2141 | Ga0501036_0027155 | |||
| 2142 | Ga0501036_0362707 | |||
| 2143 | Ga0501037_0000170 | |||
| 2144 | Ga0501037_0030415 | |||
| 2145 | Ga0501038_0003338 | |||
| 2146 | Ga0501038_0011467 | |||
| 2147 | Ga0501039_0022091 | |||
| 2148 | Ga0501039_0090125 | |||
| 2149 | Ga0501039_0095649 | |||
| 2150 | Ga0501040_0137042 | |||
| 2151 | Ga0501041_0085110 | |||
| 2152 | Ga0501042_0013042 | |||
| 2153 | Ga0501042_0021328 | |||
| 2154 | Ga0501042_0052440 | |||
| 2155 | Ga0501043_0002950 | |||
| 2156 | Ga0501043_0034170 | |||
| 2157 | Ga0501043_0185677 | |||
| 2158 | Ga0501043_0226813 | |||
| 2159 | Ga0501046_0003826 | |||
| 2160 | Ga0501046_0038231 | |||
| 2161 | Ga0501046_0133425 | |||
| 2162 | Ga0501047_0005681 | |||
| 2163 | Ga0501047_0229032 | |||
| 2164 | Ga0501048_0001492 | |||
| 2165 | Ga0501067_0018075 | |||
| 2166 | Ga0501067_0036952 | |||
| 2167 | Ga0501067_0077821 | |||
| 2168 | Ga0501067_0188723 | |||
| 2169 | Ga0501068_0005744 | |||
| 2170 | Ga0501068_0015591 | |||
| 2171 | Ga0501068_0198527 | |||
| 2172 | Ga0501069_0209592 | |||
| 2173 | Ga0501070_0009270 | |||
| 2174 | Ga0501070_0025397 | |||
| 2175 | Ga0501070_0059462 | |||
| 2176 | Ga0501070_0080988 | |||
| 2177 | Ga0501070_0144143 | |||
| 2178 | Ga0501070_0165210 | |||
| 2179 | Ga0501071_0017769 | |||
| 2180 | Ga0501071_0072194 | |||
| 2181 | Ga0501071_0144791 | |||
| 2182 | Ga0501071_0145153 | |||
| 2183 | Ga0501071_0146715 | |||
| 2184 | Ga0501072_0003087 | |||
| 2185 | Ga0501072_0061721 | |||
| 2186 | Ga0501073_0003594 | |||
| 2187 | Ga0501073_0157716 | |||
| 2188 | Ga0501074_0012687 | |||
| 2189 | Ga0501074_0021006 | |||
| 2190 | Ga0501074_0142917 | |||
| 2191 | Ga0501074_0422384 | |||
| 2192 | Ga0501075_0003933 | |||
| 2193 | Ga0501076_0005125 | |||
| 2194 | Ga0501076_0072411 | |||
| 2195 | Ga0501076_0259011 | |||
| 2196 | Ga0501076_0510627 | |||
| 2197 | Ga0501077_0269952 | |||
| 2198 | Ga0501079_0008481 | |||
| 2199 | Ga0501079_0013023 | |||
| 2200 | Ga0501079_0060203 | |||
| 2201 | Ga0501079_0444499 | |||
| 2202 | Ga0501080_0030269 | |||
| 2203 | Ga0501080_0057255 | |||
| 2204 | Ga0501080_0179279 | |||
| 2205 | Ga0501081_0424011 | |||
| 2206 | Ga0501083_0002143 | |||
| 2207 | Ga0501083_0031257 | |||
| 2208 | Ga0501083_0062458 | |||
| 2209 | Ga0501035_0000206 | |||
| 2210 | Ga0501035_0004772 | |||
| 2211 | Ga0501044_0000542 | |||
| 2212 | Ga0501044_0020490 | |||
| 2213 | Ga0501044_0185032 | |||
| 2214 | Ga0501044_0483166 | |||
| 2215 | Ga0501045_0007613 | |||
| 2216 | nmdc:mga03n38_198761_c1 | |||
| 2217 | nmdc:mga03n38_33252_c1 | |||
| 2218 | nmdc:mga00v17_132195_c1 | |||
| 2219 | nmdc:mga00v17_271802_c1 | |||
| 2220 | nmdc:mga00v17_68057_c1 | |||
| 2221 | nmdc:mga00v17_73468_c1 | |||
| 2222 | nmdc:mga0yw44_10211_c1 | |||
| 2223 | nmdc:mga0yw44_198314_c1 | |||
| 2224 | nmdc:mga0yw44_24325_c1 | |||
| 2225 | nmdc:mga0yw44_52127_c1 | |||
| 2226 | nmdc:mga06z11_108401_c1 | |||
| 2227 | nmdc:mga06z11_127719_c1 | |||
| 2228 | nmdc:mga07m45_292826_c1 | |||
| 2229 | nmdc:mga05p37_279946_c1 | |||
| 2230 | nmdc:mga05p37_407177_c1 | |||
| 2231 | nmdc:mga05p37_42314_c1 | |||
| 2232 | nmdc:mga05p37_8426_c1 | |||
| 2233 | nmdc:mga09592_340650_c1 | |||
| 2234 | nmdc:mga0qj67_31798_c1 | |||
| 2235 | nmdc:mga06r32_327625_c1 | |||
| 2236 | nmdc:mga06r32_7959_c1 | |||
| 2237 | nmdc:mga08y16_254423_c1 | |||
| 2238 | nmdc:mga08y16_416198_c1 | |||
| 2239 | nmdc:mga08y16_939847_c1 | |||
| 2240 | nmdc:mga0n895_26006_c1 | |||
| 2241 | nmdc:mga0n895_833_c1 | |||
| 2242 | nmdc:mga0rr50_198901_c1 | |||
| 2243 | nmdc:mga0rr50_22957_c1 | |||
| 2244 | nmdc:mga0a205_155_c1 | |||
| 2245 | nmdc:mga0a205_181176_c1 | |||
| 2246 | nmdc:mga0a205_6078_c2 | |||
| 2247 | nmdc:mga0a205_6985_c1 | |||
| 2248 | nmdc:mga0a205_90315_c1 | |||
| 2249 | nmdc:mga0a205_9_c2 | |||
| 2250 | Ga0495601_0000012 | |||
| 2251 | Ga0495601_0000169 | |||
| 2252 | Ga0495601_0004850 | |||
| 2253 | Ga0495601_0017516 | |||
| 2254 | Ga0495601_0039313 | |||
| 2255 | Ga0495601_0056084 | |||
| 2256 | Ga0495601_0085318 | |||
| 2257 | Ga0495612_0000997 | |||
| 2258 | Ga0495655_0000003 | |||
| 2259 | Ga0495655_0005600 | |||
| 2260 | Ga0495655_0070523 | |||
| 2261 | Ga0495595_0000001 | |||
| 2262 | Ga0495595_0000372 | |||
| 2263 | Ga0495595_0021777 | |||
| 2264 | Ga0495595_0101944 | |||
| 2265 | Ga0495595_0174703 | |||
| 2266 | Ga0495595_0210073 | |||
| 2267 | Ga0495619_0000015 | |||
| 2268 | Ga0495619_0000018 | |||
| 2269 | Ga0495619_0000120 | |||
| 2270 | Ga0495619_0000408 | |||
| 2271 | Ga0495619_0000428 | |||
| 2272 | Ga0495619_0000758 | |||
| 2273 | Ga0495619_0010299 | |||
| 2274 | Ga0495619_0036957 | |||
| 2275 | Ga0495619_0064878 | |||
| 2276 | Ga0500566_0042822 | |||
| 2277 | Ga0500641_0072160 | |||
| 2278 | Ga0500614_001280 | |||
| 2279 | Ga0500628_000002 | |||
| 2280 | Ga0501084_0250468 | |||
| 2281 | Ga0501084_0346378 | |||
| 2282 | Ga0501082_0007010 | |||
| 2283 | Ga0501082_0009675 | |||
| 2284 | Ga0501082_0136304 | |||
| 2285 | Ga0466962_0009436 | |||
| 2286 | Ga0466962_0018390 | |||
| 2287 | Ga0466962_0044218 | |||
| 2288 | Ga0466962_0073021 | |||
| 2289 | Ga0466962_0199518 | |||
| 2290 | Ga0530510_0138664 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7f02-assembly1.cif.gz_C | cytochrome c-type biogenesis protein ccmabcd from e. coli | 0.8192 | 2 | 229 |
| 7f02-assembly1.cif.gz_C | cytochrome c-type biogenesis protein ccmabcd from e. coli | 0.7662 | 2 | 229 |
| 6zmq-assembly1.cif.gz_A | cytochrome c heme lyase ccmf | 0.5491 | 44 | 203 |
| 8ss3-assembly1.cif.gz_E | structure of lbd-tmd of ampa receptor glua2 in complex with auxiliary subunits tarp gamma-5 and cornichon-2 bound to competitive antagonist zk and channel blocker spermidine (closed state) | 0.5432 | 40 | 165 |
| 5xsj-assembly1.cif.gz_L | xylfii-lytsn complex | 0.5431 | 47 | 164 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6JN65_108_240_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7098 | 44 | 164 | 1.20.120.1770 |
| af_A0A1D6JN65_108_240_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.6529 | 44 | 164 | 1.20.120.1770 |
| 1t8bA01 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.6311 | 37 | 156 | 1.20.58.220 |
| 1t8bB01 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.6307 | 37 | 156 | 1.20.58.220 |
| af_A2BHF4_1432_1552_1.20.120.350 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C | 0.6203 | 41 | 159 | 1.20.120.350 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0SW06-F1-model_v4 | Heme exporter protein C | 0.9594 | 4 | 145 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
| AF-A0A838I9E4-F1-model_v4 | Heme exporter protein C | 0.9462 | 1 | 233 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
| AF-A0A359E4W1-F1-model_v4 | ABC transporter permease | 0.9462 | 18 | 147 |
GO:0005886
GO:0017004 GO:0020037 |
| AF-A0A3M1BSS2-F1-model_v4 | deleted | 0.9457 | 7 | 159 |
|
| AF-A0A7V9EZ29-F1-model_v4 | Heme exporter protein C | 0.9454 | 1 | 194 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |