F490763

General Info

Members Datasets Scaffolds Average Seq Length
1144 565 2288 317

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006425503|3006427120
Length 357
Sequence APVPSASSASSASSSSSPASPSSPSPSAPAPSPGTGAGAGAHRLRPRRSCLAVPGSNPRFLEKAQGLPADQVFLDLEDACAPLAKEGARHTIVDALNQGDWSGKTRVVRVNDWTTHWTYRDVVTVVEGAGANLDCVMLPKVQSAEQVVALDLLLTQIEKTMGFEVGRIGIEAQIENAAGLVAVDAIAAASPRLETIVFGPADFMASINMKSLVVGRQPPGYPADAYHYILMRILMAARTHDVQAIDGPFLQIRDVDAFREVAGRSAALGFDGKWVLHPGQIEAANEIYSPAQEDYDHAEMILDAYAWCTSEAGGAKGSAMLGDEMIDEASRKMALVVAGKGRAAGMTRTTSFTPPEA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
117 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
177 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
178 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
187 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
195 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
198 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
204 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
205 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
210 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
226 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
230 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
231 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
232 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
233 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
234 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
235 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
236 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
237 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
238 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
239 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
240 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
241 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
242 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
243 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
244 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
245 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
246 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
247 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
248 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
249 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
250 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
251 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
252 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
259 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
262 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
263 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
264 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
265 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
266 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
267 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
268 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
269 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
270 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
274 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
277 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
278 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
279 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
280 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
281 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
282 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
283 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
284 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
285 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
286 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
287 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
288 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
289 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
290 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
291 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
292 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
293 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
294 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
295 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
296 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
297 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
298 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
299 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
300 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
301 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
302 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
303 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
306 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
307 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
308 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
309 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
310 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
311 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
312 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
313 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
314 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
315 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
316 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
317 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
318 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
319 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
320 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
321 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
322 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
323 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
324 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
325 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
326 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
331 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
332 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
333 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
334 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
335 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
338 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
339 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
340 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
343 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
344 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
345 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
346 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
347 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
348 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
349 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
350 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
362 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
363 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
364 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
365 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
367 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
368 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
369 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
370 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
371 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
372 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
373 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
374 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
375 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
376 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
377 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
378 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
379 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
380 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
381 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
382 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
383 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
384 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
385 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
386 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
387 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
388 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
389 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
390 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
391 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
392 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
393 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
394 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
395 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
396 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
397 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
399 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
400 2501939600 Micromonospora sp. L5 Isolate Unclassified
401 2508501039 Frankia saprophytica CN3 Isolate Nodule
402 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
403 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
404 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
405 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
406 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
407 2517572101 Frankia sp. DC12 Isolate Nodule
408 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
409 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
410 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
411 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
412 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
413 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
414 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
415 2619618881 Frankia sp. ACN1ag Isolate Unclassified
416 2619619003 Frankia sp. CpI1-P Isolate Nodule
417 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
418 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
419 2643221548 Streptomyces sp. Root55 Isolate Unclassified
420 2643221578 Streptomyces sp. Root63 Isolate Unclassified
421 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
422 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
423 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
424 2643221647 Streptomyces sp. Root369 Isolate Unclassified
425 2643221670 Streptomyces sp. Root431 Isolate Unclassified
426 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
427 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
428 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
429 2643221679 Angustibacter sp. Root456 Isolate Unclassified
430 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
431 2643221714 Streptomyces sp. Root264 Isolate Unclassified
432 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
433 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
434 2687453737 Frankia sp. BMG5.36 Isolate Nodule
435 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
436 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
437 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
438 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
439 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
440 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
441 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
442 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
443 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
444 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
445 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
446 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
447 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
448 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
449 2808606448 Streptomyces sp. 193411 Isolate Unclassified
450 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
451 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
452 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
453 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
454 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
455 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
456 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
457 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
458 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
459 2855683550 Micromonospora sp. RP3T Isolate Unclassified
460 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
461 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
462 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
463 2858868258 Micromonospora sp. MH33 Isolate Unclassified
464 2858882152 Micromonospora noduli MED15 Isolate Nodule
465 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
466 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
467 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
468 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
469 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
470 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
471 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
472 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
473 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
474 2862574272 Streptomyces sp. AcE210 Isolate Nodule
475 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
476 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
477 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
478 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
479 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
480 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
481 2867369537 Streptomyces sp. Z26 Isolate Unclassified
482 2867428634 Streptomyces sp. RP5T Isolate Unclassified
483 2867475112 Streptomyces sp. TM32 Isolate Unclassified
484 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
485 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
486 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
487 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
488 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
489 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
490 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
491 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
492 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
493 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
494 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
495 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
496 2902582711 Micromonospora sp. AP08 Isolate Unclassified
497 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
498 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
499 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
500 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
501 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
502 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
503 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
504 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
505 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
506 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
507 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
508 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
509 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
510 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
511 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
512 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
513 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
514 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
515 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
516 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
517 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
518 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
519 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
520 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
521 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
522 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
523 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
524 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
525 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
526 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
527 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
528 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
529 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
530 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
531 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
532 649633069 Micromonospora sp. L5 Isolate Unclassified
533 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
534 8002775197 Frankia nepalensis CN7 Isolate Nodule
535 8002784119 Frankia sp. AgB1.9 Isolate Nodule
536 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
537 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
538 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
539 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
540 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
541 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
542 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
543 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
544 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
545 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
546 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
547 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
548 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
549 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
550 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
551 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
552 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
553 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
554 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
555 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
556 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
557 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
558 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
559 8054920844 Frankia tisae Agncl-8 Isolate Nodule
560 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
561 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
562 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
563 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
564 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
565 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.53
Metatranscriptomes 0.79
Isolates 14.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.06
Nodule 1.57
Rhizoplane 6.47
Rhizosphere 78.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10031249 3300001979 Bacteria 1720
2 JGI24739J22299_10014962 3300001989 Bacteria 2821
3 JGI24737J22298_10003773 3300001990 Bacteria 5333
4 JGI24735J21928_10006190 3300002067 Bacteria 3950
5 JGI25406J46586_10052624 3300003203 Bacteria 1356
6 Ga0070658_10046686 3300005327 Bacteria 3504
7 Ga0070658_10079963 3300005327 Bacteria 2684
8 Ga0070658_10182182 3300005327 Bacteria 1768
9 Ga0070683_100051410 3300005329 Bacteria 3816
10 Ga0070683_100086529 3300005329 Bacteria 2938
11 Ga0070683_100136449 3300005329 Bacteria 2323
12 Ga0068869_100098240 3300005334 Bacteria 2211
13 Ga0070666_10058747 3300005335 Bacteria 2601
14 Ga0070682_100049397 3300005337 Bacteria 2622
15 Ga0068868_100015603 3300005338 Bacteria 5624
16 Ga0070689_100023274 3300005340 Bacteria 4636
17 Ga0070661_100019223 3300005344 Bacteria 4866
18 Ga0070692_10029693 3300005345 Bacteria 2727
19 Ga0070668_100024409 3300005347 Bacteria 4581
20 Ga0070668_100150113 3300005347 Bacteria 1884
21 Ga0070669_100261871 3300005353 Bacteria 1380
22 Ga0070675_100015301 3300005354 Bacteria 6062
23 Ga0070671_100000423 3300005355 Bacteria 29409
24 Ga0070671_100027777 3300005355 Bacteria 4659
25 Ga0070671_100033282 3300005355 Bacteria 4261
26 Ga0070674_100107123 3300005356 Bacteria 2046
27 Ga0070674_100187149 3300005356 Bacteria 1590
28 Ga0070673_100073041 3300005364 Bacteria 2760
29 Ga0070659_100015592 3300005366 Bacteria 5692
30 Ga0070667_100000107 3300005367 Bacteria 105338
31 Ga0070709_10000214 3300005434 Bacteria 37458
32 Ga0070709_10011998 3300005434 Bacteria 4844
33 Ga0070709_10020061 3300005434 Bacteria 3874
34 Ga0070709_10155492 3300005434 Bacteria 1585
35 Ga0070714_100000057 3300005435 Bacteria 103150
36 Ga0070714_100004897 3300005435 Bacteria 10167
37 Ga0070714_100011815 3300005435 Bacteria 6940
38 Ga0070714_100069853 3300005435 Bacteria 3034
39 Ga0070714_100101756 3300005435 Bacteria 2532
40 Ga0070714_100602084 3300005435 Bacteria 1055
41 Ga0070713_100008107 3300005436 Bacteria 7430
42 Ga0070713_100060309 3300005436 Bacteria 3171
43 Ga0070713_100075005 3300005436 Bacteria 2868
44 Ga0070713_100075215 3300005436 Bacteria 2864
45 Ga0070710_10000110 3300005437 Bacteria 38306
46 Ga0070710_10028434 3300005437 Bacteria 2991
47 Ga0070710_10217422 3300005437 Bacteria 1214
48 Ga0070711_100015408 3300005439 Bacteria 4839
49 Ga0070711_100103921 3300005439 Bacteria 2071
50 Ga0070705_100014490 3300005440 Bacteria 4058
51 Ga0070700_100088204 3300005441 Bacteria 2019
52 Ga0070708_100058281 3300005445 Bacteria 3440
53 Ga0070708_100330443 3300005445 Bacteria 1436
54 Ga0070663_100022237 3300005455 Bacteria 4236
55 Ga0070678_100001811 3300005456 Bacteria 11520
56 Ga0070681_10021940 3300005458 Bacteria 6406
57 Ga0070681_10236863 3300005458 Bacteria 1739
58 Ga0070685_10080411 3300005466 Bacteria 1953
59 Ga0070685_10174963 3300005466 Bacteria 1378
60 Ga0070706_100026494 3300005467 Bacteria 5333
61 Ga0070707_100059415 3300005468 Bacteria 3668
62 Ga0070707_100143892 3300005468 Bacteria 2320
63 Ga0070698_100099365 3300005471 Bacteria 2883
64 Ga0070699_100000384 3300005518 Bacteria 42993
65 Ga0070679_100023224 3300005530 Bacteria 6069
66 Ga0070684_100010145 3300005535 Bacteria 7448
67 Ga0070684_100021126 3300005535 Bacteria 5410
68 Ga0070697_100184277 3300005536 Bacteria 1770
69 Ga0068853_100220319 3300005539 Bacteria 1733
70 Ga0070686_100141588 3300005544 Bacteria 1675
71 Ga0070696_100005128 3300005546 Bacteria 8752
72 Ga0070665_100015231 3300005548 Bacteria 7720
73 Ga0070665_100053585 3300005548 Bacteria 4046
74 Ga0070665_100055726 3300005548 Bacteria 3965
75 Ga0070665_100398968 3300005548 Bacteria 1383
76 Ga0070704_100071102 3300005549 Bacteria 2527
77 Ga0070704_100388678 3300005549 Bacteria 1187
78 Ga0068855_100141925 3300005563 Bacteria 2737
79 Ga0068855_100173016 3300005563 Bacteria 2445
80 Ga0070664_100092976 3300005564 Bacteria 2612
81 Ga0070664_100533815 3300005564 Bacteria 1084
82 Ga0068857_100035113 3300005577 Bacteria 4438
83 Ga0068854_100006340 3300005578 Bacteria 7523
84 Ga0068854_100016608 3300005578 Bacteria 4911
85 Ga0068854_100190747 3300005578 Bacteria 1606
86 Ga0068856_100030994 3300005614 Bacteria 5230
87 Ga0068856_100091705 3300005614 Bacteria 3022
88 Ga0068856_100164550 3300005614 Bacteria 2229
89 Ga0068856_100166502 3300005614 Bacteria 2215
90 Ga0068856_100191478 3300005614 Bacteria 2059
91 Ga0068856_100300290 3300005614 Bacteria 1623
92 Ga0070702_100001124 3300005615 Bacteria 10736
93 Ga0070702_100007054 3300005615 Bacteria 5360
94 Ga0068852_100003907 3300005616 Bacteria 10471
95 Ga0068852_100013889 3300005616 Bacteria 6176
96 Ga0068859_100000301 3300005617 Bacteria 49173
97 Ga0068859_100018104 3300005617 Bacteria 7081
98 Ga0068859_100724964 3300005617 Bacteria 1084
99 Ga0068864_100001934 3300005618 Bacteria 17015
100 Ga0068864_100028442 3300005618 Bacteria 4725
101 Ga0068851_10019796 3300005834 Bacteria 3252
102 Ga0068870_10000378 3300005840 Bacteria 16740
103 Ga0068863_100000163 3300005841 Bacteria 71286
104 Ga0068863_100001505 3300005841 Bacteria 23071
105 Ga0068863_100042732 3300005841 Bacteria 4306
106 Ga0068863_100044881 3300005841 Bacteria 4194
107 Ga0068863_100339283 3300005841 Bacteria 1462
108 Ga0068858_100000071 3300005842 Bacteria 105192
109 Ga0068858_100009793 3300005842 Bacteria 9122
110 Ga0068858_100055569 3300005842 Bacteria 3659
111 Ga0068860_100072600 3300005843 Bacteria 3270
112 Ga0068862_100000049 3300005844 Bacteria 149792
113 Ga0068862_100155262 3300005844 Bacteria 2040
114 Ga0081455_10000436 3300005937 Bacteria 54915
115 Ga0081455_10012252 3300005937 Bacteria 8559
116 Ga0081455_10046773 3300005937 Bacteria 3751
117 Ga0081455_10130375 3300005937 Bacteria 1967
118 Ga0081538_10000120 3300005981 Bacteria 79021
119 Ga0081538_10027673 3300005981 Bacteria 3922
120 Ga0081540_1049020 3300005983 Bacteria 2110
121 Ga0081539_10000094 3300005985 Bacteria 206102
122 Ga0070717_10006278 3300006028 Bacteria 8729
123 Ga0070717_10060107 3300006028 Bacteria 3146
124 Ga0075368_10011215 3300006042 Bacteria 3257
125 Ga0075363_100057075 3300006048 Bacteria 2094
126 Ga0075363_100221265 3300006048 Bacteria 1085
127 Ga0075364_10041167 3300006051 Bacteria 2999
128 Ga0070716_100024466 3300006173 Bacteria 3214
129 Ga0070712_100077576 3300006175 Bacteria 2395
130 Ga0075362_10075251 3300006177 Bacteria 1548
131 Ga0075367_10024053 3300006178 Bacteria 3433
132 Ga0075369_10004469 3300006186 Bacteria 5169
133 Ga0075369_10037118 3300006186 Bacteria 2075
134 Ga0075369_10048349 3300006186 Bacteria 1835
135 Ga0097621_100018176 3300006237 Bacteria 5363
136 Ga0097621_100047019 3300006237 Bacteria 3494
137 Ga0075370_10024496 3300006353 Bacteria 3335
138 Ga0075428_100001540 3300006844 Bacteria 24687
139 Ga0075428_100007363 3300006844 Bacteria 12199
140 Ga0075428_100107885 3300006844 Bacteria 3034
141 Ga0075430_100004383 3300006846 Bacteria 11913
142 Ga0075430_100032198 3300006846 Bacteria 4451
143 Ga0075430_100113458 3300006846 Bacteria 2259
144 Ga0075431_100001429 3300006847 Bacteria 21961
145 Ga0075431_100014993 3300006847 Bacteria 7846
146 Ga0075431_100058914 3300006847 Bacteria 3963
147 Ga0075431_100085491 3300006847 Bacteria 3256
148 Ga0075433_10234417 3300006852 Bacteria 1629
149 Ga0075433_10246032 3300006852 Bacteria 1587
150 Ga0075434_100016866 3300006871 Bacteria 7026
151 Ga0075429_100002452 3300006880 Bacteria 15614
152 Ga0075429_100016645 3300006880 Bacteria 6368
153 Ga0075436_100060147 3300006914 Bacteria 2624
154 Ga0075436_100062018 3300006914 Bacteria 2584
155 Ga0097620_100000301 3300006931 Bacteria 49173
156 Ga0097620_100003956 3300006931 Bacteria 15123
157 Ga0097620_100018103 3300006931 Bacteria 7081
158 Ga0097620_100725047 3300006931 Bacteria 1084
159 Ga0075435_100000179 3300007076 Bacteria 37419
160 Ga0075435_100054488 3300007076 Bacteria 3227
161 Ga0105251_10027499 3300009011 Bacteria 2883
162 Ga0111539_10186344 3300009094 Bacteria 2423
163 Ga0111539_10190759 3300009094 Bacteria 2391
164 Ga0105245_10015407 3300009098 Bacteria 6665
165 Ga0105245_10433783 3300009098 Bacteria 1319
166 Ga0105247_10006623 3300009101 Bacteria 7158
167 Ga0105247_10106351 3300009101 Bacteria 1800
168 Ga0114129_10000114 3300009147 Bacteria 80730
169 Ga0114129_10006796 3300009147 Bacteria 16240
170 Ga0114129_10021079 3300009147 Bacteria 9254
171 Ga0114129_10128746 3300009147 Bacteria 3479
172 Ga0114129_10169894 3300009147 Bacteria 2973
173 Ga0114129_10681924 3300009147 Bacteria 1323
174 Ga0105243_10018141 3300009148 Bacteria 5326
175 Ga0105243_10173052 3300009148 Bacteria 1872
176 Ga0105241_10004674 3300009174 Bacteria 10118
177 Ga0105241_10036208 3300009174 Bacteria 3713
178 Ga0105242_10258286 3300009176 Bacteria 1573
179 Ga0105248_10000147 3300009177 Bacteria 81699
180 Ga0105248_10045177 3300009177 Bacteria 4940
181 Ga0105237_10060326 3300009545 Bacteria 3795
182 Ga0105237_10127652 3300009545 Bacteria 2537
183 Ga0105237_10703775 3300009545 Bacteria 1017
184 Ga0105238_10007937 3300009551 Bacteria 10618
185 Ga0105238_10010755 3300009551 Bacteria 9192
186 Ga0105239_10070182 3300010375 Bacteria 3848
187 Ga0105246_10072065 3300011119 Bacteria 2435
188 Ga0157347_1001020 3300012502 Bacteria 2069
189 Ga0157370_10051790 3300013104 Bacteria 3920
190 Ga0157369_10002237 3300013105 Bacteria 23285
191 Ga0157369_10058286 3300013105 Bacteria 4166
192 Ga0157369_10073964 3300013105 Bacteria 3655
193 Ga0157369_10122628 3300013105 Bacteria 2757
194 Ga0157369_10512748 3300013105 Bacteria 1241
195 Ga0157374_10073710 3300013296 Bacteria 3222
196 Ga0157378_10181261 3300013297 Bacteria 1981
197 Ga0163162_10441959 3300013306 Bacteria 1433
198 Ga0163162_10721092 3300013306 Bacteria 1118
199 Ga0157372_10191723 3300013307 Bacteria 2367
200 Ga0157372_10387649 3300013307 Bacteria 1628
201 Ga0157372_10639252 3300013307 Bacteria 1239
202 Ga0157375_10013269 3300013308 Bacteria 7326
203 Ga0157375_10036863 3300013308 Bacteria 4682
204 Ga0157375_10296018 3300013308 Bacteria 1781
205 Ga0157375_10543177 3300013308 Bacteria 1324
206 Ga0163163_10009454 3300014325 Bacteria 8706
207 Ga0163163_10056866 3300014325 Bacteria 3867
208 Ga0163163_10074970 3300014325 Bacteria 3376
209 Ga0163163_10349925 3300014325 Bacteria 1533
210 Ga0163163_10376133 3300014325 Bacteria 1478
211 Ga0182008_10006605 3300014497 Bacteria 6467
212 Ga0157379_10004275 3300014968 Bacteria 12199
213 Ga0157379_10019486 3300014968 Bacteria 5992
214 Ga0157376_10227272 3300014969 Bacteria 1732
215 Ga0182006_1015903 3300015261 Bacteria 3217
216 Ga0182007_10000483 3300015262 Bacteria 23980
217 Ga0183367_1001 3300015688 Bacteria 1225545
218 Ga0163161_10349450 3300017792 Bacteria 1175
219 Ga0206354_10776292 3300020081 Bacteria 2073
220 Ga0206354_11017713 3300020081 Bacteria 1468
221 Ga0213872_10135785 3300021361 Bacteria 1081
222 Ga0213874_10005715 3300021377 Bacteria 2910
223 Ga0213875_10000917 3300021388 Bacteria 21338
224 Ga0213875_10106535 3300021388 Bacteria 1308
225 Ga0224712_10087932 3300022467 Bacteria 1296
226 Ga0224712_10138368 3300022467 Bacteria 1069
227 Ga0209758_1007704 3300025297 Bacteria 7233
228 Ga0207426_1000849 3300025302 Bacteria 32135
229 Ga0207426_1002327 3300025302 Bacteria 12424
230 Ga0207426_1012862 3300025302 Bacteria 3126
231 Ga0207426_1021649 3300025302 Bacteria 2220
232 Ga0207692_10211366 3300025898 Bacteria 1146
233 Ga0207688_10011941 3300025901 Bacteria 4728
234 Ga0207647_10002261 3300025904 Bacteria 14677
235 Ga0207647_10009502 3300025904 Bacteria 6905
236 Ga0207699_10000045 3300025906 Bacteria 112158
237 Ga0207699_10016909 3300025906 Bacteria 3826
238 Ga0207699_10057723 3300025906 Bacteria 2319
239 Ga0207699_10101050 3300025906 Bacteria 1830
240 Ga0207645_10200563 3300025907 Bacteria 1312
241 Ga0207643_10000027 3300025908 Bacteria 99423
242 Ga0207684_10048311 3300025910 Bacteria 3609
243 Ga0207684_10073144 3300025910 Bacteria 2911
244 Ga0207684_10182251 3300025910 Bacteria 1811
245 Ga0207654_10046636 3300025911 Bacteria 2472
246 Ga0207707_10072390 3300025912 Bacteria 3004
247 Ga0207695_10000679 3300025913 Bacteria 66777
248 Ga0207671_10000052 3300025914 Bacteria 188462
249 Ga0207693_10044047 3300025915 Bacteria 3507
250 Ga0207693_10085433 3300025915 Bacteria 2472
251 Ga0207657_10024194 3300025919 Bacteria 5635
252 Ga0207657_10214499 3300025919 Bacteria 1543
253 Ga0207649_10281023 3300025920 Bacteria 1210
254 Ga0207652_10033501 3300025921 Bacteria 4326
255 Ga0207652_10198519 3300025921 Bacteria 1805
256 Ga0207646_10018631 3300025922 Bacteria 6472
257 Ga0207646_10052294 3300025922 Bacteria 3655
258 Ga0207646_10173970 3300025922 Bacteria 1944
259 Ga0207694_10000079 3300025924 Bacteria 111767
260 Ga0207650_10379901 3300025925 Bacteria 1166
261 Ga0207659_10000900 3300025926 Bacteria 17696
262 Ga0207659_10046499 3300025926 Bacteria 3065
263 Ga0207687_10004998 3300025927 Bacteria 8784
264 Ga0207687_10014787 3300025927 Bacteria 5111
265 Ga0207700_10001094 3300025928 Bacteria 15621
266 Ga0207700_10077230 3300025928 Bacteria 2586
267 Ga0207700_10289546 3300025928 Bacteria 1411
268 Ga0207700_10408527 3300025928 Bacteria 1191
269 Ga0207664_10015691 3300025929 Bacteria 5507
270 Ga0207690_10035103 3300025932 Bacteria 3236
271 Ga0207690_10359613 3300025932 Bacteria 1153
272 Ga0207706_10058789 3300025933 Bacteria 3386
273 Ga0207706_10090727 3300025933 Bacteria 2687
274 Ga0207686_10122039 3300025934 Bacteria 1775
275 Ga0207670_10018350 3300025936 Bacteria 4252
276 Ga0207669_10240851 3300025937 Bacteria 1341
277 Ga0207665_10017388 3300025939 Bacteria 4725
278 Ga0207665_10039284 3300025939 Bacteria 3155
279 Ga0207691_10062022 3300025940 Bacteria 3394
280 Ga0207711_10000056 3300025941 Bacteria 135485
281 Ga0207711_10093249 3300025941 Bacteria 2652
282 Ga0207711_10440661 3300025941 Bacteria 1212
283 Ga0207689_10000694 3300025942 Bacteria 32241
284 Ga0207689_10021188 3300025942 Bacteria 5465
285 Ga0207661_10007868 3300025944 Bacteria 7597
286 Ga0207661_10013863 3300025944 Bacteria 5890
287 Ga0207661_10054987 3300025944 Bacteria 3190
288 Ga0207661_10105630 3300025944 Bacteria 2373
289 Ga0207679_10001380 3300025945 Bacteria 15313
290 Ga0207679_10006279 3300025945 Bacteria 7499
291 Ga0207679_10521671 3300025945 Bacteria 1063
292 Ga0207667_10162082 3300025949 Bacteria 2300
293 Ga0207668_10008379 3300025972 Bacteria 6159
294 Ga0207668_10081751 3300025972 Bacteria 2345
295 Ga0207640_10181546 3300025981 Bacteria 1578
296 Ga0207658_10183242 3300025986 Bacteria 1735
297 Ga0207677_10002817 3300026023 Bacteria 9175
298 Ga0207703_10027365 3300026035 Bacteria 4491
299 Ga0207703_10031087 3300026035 Bacteria 4220
300 Ga0207703_10257060 3300026035 Bacteria 1577
301 Ga0207639_10072740 3300026041 Bacteria 2693
302 Ga0207678_10000488 3300026067 Bacteria 35948
303 Ga0207678_10003800 3300026067 Bacteria 13579
304 Ga0207708_10049841 3300026075 Bacteria 3189
305 Ga0207702_10001273 3300026078 Bacteria 25311
306 Ga0207702_10001529 3300026078 Bacteria 22893
307 Ga0207702_10031656 3300026078 Bacteria 4409
308 Ga0207641_10004949 3300026088 Bacteria 11434
309 Ga0207641_10048601 3300026088 Bacteria 3581
310 Ga0207676_10000549 3300026095 Bacteria 31348
311 Ga0207676_10007940 3300026095 Bacteria 7547
312 Ga0207676_10122269 3300026095 Bacteria 2197
313 Ga0207676_10297645 3300026095 Bacteria 1472
314 Ga0207674_10006778 3300026116 Bacteria 13439
315 Ga0207674_10018991 3300026116 Bacteria 7451
316 Ga0207674_10049188 3300026116 Bacteria 4313
317 Ga0207675_100249787 3300026118 Bacteria 1716
318 Ga0207683_10001061 3300026121 Bacteria 25052
319 Ga0207683_10004644 3300026121 Bacteria 11838
320 Ga0207683_10046231 3300026121 Bacteria 3809
321 Ga0207683_10499159 3300026121 Bacteria 1124
322 Ga0207698_10010709 3300026142 Bacteria 5915
323 Ga0207698_10057408 3300026142 Bacteria 3011
324 Ga0207428_10083312 3300027907 Bacteria 2495
325 Ga0207428_10137930 3300027907 Bacteria 1864
326 Ga0268265_10000017 3300028380 Bacteria 293875
327 Ga0268265_10121731 3300028380 Bacteria 2151
328 Ga0268264_10315938 3300028381 Bacteria 1475
329 Ga0307517_10002786 3300028786 Bacteria 27793
330 Ga0307515_10000055 3300028794 Bacteria 264365
331 Ga0307515_10008569 3300028794 Bacteria 19910
332 Ga0307515_10142298 3300028794 Bacteria 2564
333 Ga0307511_10001943 3300030521 Bacteria 21735
334 Ga0307511_10029818 3300030521 Bacteria 4914
335 Ga0316176_1141749 3300030732 Bacteria 3088
336 Ga0265776_100008 3300030880 Bacteria 6194
337 Ga0265764_100820 3300030882 Bacteria 1267
338 Ga0265773_1000473 3300031018 Bacteria 1649
339 Ga0265327_10000329 3300031251 Bacteria 90292
340 Ga0265327_10027323 3300031251 Bacteria 3287
341 Ga0307513_10014342 3300031456 Bacteria 9678
342 Ga0307513_10136084 3300031456 Bacteria 2392
343 Ga0307513_10339511 3300031456 Bacteria 1253
344 Ga0307509_10051822 3300031507 Bacteria 4384
345 Ga0307408_100188893 3300031548 Bacteria 1658
346 Ga0307508_10003092 3300031616 Bacteria 17092
347 Ga0316575_10002683 3300031665 Bacteria 6001
348 Ga0316576_10002106 3300031727 Bacteria 11203
349 Ga0316576_10251049 3300031727 Bacteria 1328
350 Ga0307516_10037213 3300031730 Bacteria 4866
351 Ga0307516_10071167 3300031730 Bacteria 3339
352 Ga0307516_10076688 3300031730 Bacteria 3194
353 Ga0307406_10169044 3300031901 Bacteria 1580
354 Ga0307412_10113832 3300031911 Bacteria 1936
355 Ga0307409_100098457 3300031995 Bacteria 2418
356 Ga0307409_100542132 3300031995 Bacteria 1140
357 Ga0307411_10058483 3300032005 Bacteria 2551
358 Ga0307415_100009278 3300032126 Bacteria 5503
359 Ga0307415_100044916 3300032126 Bacteria 2958
360 Ga0307415_100090192 3300032126 Bacteria 2216
361 Ga0307415_100310339 3300032126 Bacteria 1310
362 Ga0307507_10007023 3300033179 Bacteria 16688
363 Ga0307510_10075231 3300033180 Bacteria 3330
364 Ga0307510_10172608 3300033180 Bacteria 1738
365 Ga0373934_0000067 3300035086 Bacteria 35483
366 Ga0373934_0006812 3300035086 Bacteria 4242
367 Ga0373934_0010114 3300035086 Bacteria 3542
368 Ga0373934_0016221 3300035086 Bacteria 2831
369 Ga0373944_0002039 3300035089 Bacteria 5120
370 Ga0373944_0016332 3300035089 Bacteria 2092
371 Ga0373923_0000852 3300035111 Bacteria 8074
372 Ga0373923_0002822 3300035111 Bacteria 5443
373 Ga0373923_0032650 3300035111 Bacteria 2104
374 Ga0373923_0038968 3300035111 Bacteria 1949
375 Ga0373936_0009870 3300035113 Bacteria 3603
376 Ga0373936_0031090 3300035113 Bacteria 2107
377 Ga0373941_0083581 3300035115 Bacteria 1083
378 Ga0373945_0002168 3300035116 Bacteria 6124
379 Ga0373953_0065770 3300035117 Bacteria 1489
380 Ga0373953_0067502 3300035117 Bacteria 1471
381 Ga0373954_0009816 3300035118 Bacteria 4212
382 Ga0373956_0000258 3300035119 Bacteria 21190
383 Ga0373956_0015501 3300035119 Bacteria 3192
384 Ga0373956_0082362 3300035119 Bacteria 1477
385 Ga0373957_0000388 3300035120 Bacteria 11160
386 Ga0373957_0007302 3300035120 Bacteria 3532
387 Ga0373957_0010416 3300035120 Bacteria 3074
388 Ga0373957_0010520 3300035120 Bacteria 3061
389 Ga0373957_0034218 3300035120 Bacteria 1880
390 Ga0373943_0000066 3300035170 Bacteria 36871
391 Ga0373943_0089716 3300035170 Bacteria 1590
392 Ga0373946_0000019 3300035171 Bacteria 44508
393 Ga0373946_0144640 3300035171 Bacteria 1105
394 Ga0373955_0000019 3300035172 Bacteria 64700
395 Ga0373955_0031714 3300035172 Bacteria 2769
396 Ga0316574_0005553 3300035398 Bacteria 6734
397 Ga0316574_0117169 3300035398 Bacteria 1709
398 Ga0316574_0170936 3300035398 Bacteria 1399
399 Ga0373924_0004826 3300035410 Bacteria 4739
400 Ga0373924_0033155 3300035410 Bacteria 2083
401 Ga0373924_0087759 3300035410 Bacteria 1328
402 Ga0373931_0000846 3300035691 Bacteria 12888
403 Ga0373931_0106768 3300035691 Bacteria 1583
404 Ga0373935_0013238 3300035692 Bacteria 4975
405 Ga0373935_0079052 3300035692 Bacteria 2134
406 Ga0373927_0009825 3300035695 Bacteria 6413
407 Ga0373927_0204465 3300035695 Bacteria 1296
408 Ga0373933_0000120 3300035724 Bacteria 50864
409 Ga0373933_0003631 3300035724 Bacteria 8548
410 Ga0373933_0007380 3300035724 Bacteria 5994
411 Ga0373933_0010673 3300035724 Bacteria 5037
412 Ga0373933_0061185 3300035724 Bacteria 2271
413 Ga0373947_0000197 3300035725 Bacteria 33311
414 Ga0373947_0164982 3300035725 Bacteria 1434
415 Ga0373937_0000147 3300036401 Bacteria 68258
416 Ga0373937_0001943 3300036401 Bacteria 17293
417 Ga0373937_0084878 3300036401 Bacteria 2930
418 Ga0373937_0089250 3300036401 Bacteria 2854
419 Ga0373937_0541126 3300036401 Bacteria 1106
420 Ga0265778_000478 3300036457 Bacteria 3138
421 Ga0373925_0000869 3300037068 Bacteria 27621
422 Ga0373925_0022121 3300037068 Bacteria 4634
423 Ga0373925_0089754 3300037068 Bacteria 2348
424 Ga0373925_0299305 3300037068 Bacteria 1298
425 Ga0395899_0270692 3300037312 Bacteria 1159
426 Ga0395900_0053423 3300037418 Bacteria 4158
427 Ga0395898_0030129 3300037466 Bacteria 5432
428 Ga0395898_0041335 3300037466 Bacteria 4555
429 Ga0395898_0086423 3300037466 Bacteria 3022
430 Ga0395905_0344806 3300037471 Bacteria 1381
431 Ga0436364_0199487 3300037853 Bacteria 23161
432 Ga0436364_0332506 3300037853 Bacteria 1205
433 Ga0436364_0351592 3300037853 Bacteria 1418
434 Ga0436364_0501469 3300037853 Bacteria 1505
435 Ga0395901_0005116 3300038443 Bacteria 13244
436 Ga0395901_0483000 3300038443 Bacteria 1263
437 Ga0400485_08257 3300038735 Bacteria 12826
438 Ga0400488_00407 3300038741 Bacteria 8581
439 Ga0436361_1211127 3300039447 Bacteria 3595
440 Ga0436363_0319333 3300039450 Bacteria 5118
441 Ga0436363_0578534 3300039450 Bacteria 3342
442 Ga0436362_1109190 3300039453 Bacteria 1042
443 Ga0439436_0010941 3300041404 Bacteria 2761
444 Ga0451841_0483166 3300041498 Bacteria 1562
445 Ga0451853_0512039 3300041512 Bacteria 1442
446 Ga0439433_0003699 3300041999 Bacteria 3286
447 Ga0439442_007081 3300042002 Bacteria 2252
448 Ga0439448_0029424 3300042005 Bacteria 1739
449 Ga0439448_0053566 3300042005 Bacteria 1324
450 Ga0439449_0005876 3300042007 Bacteria 4688
451 Ga0439457_000906 3300042014 Bacteria 8947
452 Ga0450894_000084 3300042131 Bacteria 15364
453 Ga0450896_003054 3300042133 Bacteria 2201
454 Ga0450899_002814 3300042135 Bacteria 1881
455 Ga0439460_0032788 3300042461 Bacteria 1490
456 Ga0466969_0002252 3300044656 Bacteria 10314
457 Ga0466969_0003530 3300044656 Bacteria 8315
458 Ga0466969_0005190 3300044656 Bacteria 6926
459 Ga0466969_0010323 3300044656 Bacteria 4954
460 Ga0466972_0024478 3300044658 Bacteria 2995
461 Ga0466972_0024819 3300044658 Bacteria 2975
462 Ga0466972_0062248 3300044658 Bacteria 1788
463 Ga0466972_0069005 3300044658 Bacteria 1688
464 Ga0466965_0004182 3300044683 Bacteria 6413
465 Ga0466965_0006273 3300044683 Bacteria 5383
466 Ga0466965_0007599 3300044683 Bacteria 4987
467 Ga0466966_0002064 3300044684 Bacteria 13030
468 Ga0466966_0022938 3300044684 Bacteria 4089
469 Ga0466966_0031046 3300044684 Bacteria 3465
470 Ga0466966_0041306 3300044684 Bacteria 2963
471 Ga0466966_0041941 3300044684 Bacteria 2939
472 Ga0466961_0001303 3300044693 Bacteria 15391
473 Ga0466961_0006030 3300044693 Bacteria 7685
474 Ga0466961_0010306 3300044693 Bacteria 5958
475 Ga0466961_0011703 3300044693 Bacteria 5609
476 Ga0466961_0029102 3300044693 Bacteria 3552
477 Ga0466961_0038583 3300044693 Bacteria 3064
478 Ga0466961_0052929 3300044693 Bacteria 2591
479 Ga0466963_0001025 3300044694 Bacteria 14497
480 Ga0466963_0011650 3300044694 Bacteria 5357
481 Ga0466963_0035665 3300044694 Bacteria 3241
482 Ga0466963_0052124 3300044694 Bacteria 2714
483 Ga0466964_0005930 3300044706 Bacteria 4550
484 Ga0466971_0000360 3300044719 Bacteria 17428
485 Ga0466971_0001585 3300044719 Bacteria 9601
486 Ga0466971_0140520 3300044719 Bacteria 1124
487 Ga0466971_0144953 3300044719 Bacteria 1107
488 Ga0466970_0006767 3300044765 Bacteria 5738
489 Ga0466970_0008296 3300044765 Bacteria 5224
490 Ga0466970_0015913 3300044765 Bacteria 3873
491 Ga0466970_0068179 3300044765 Bacteria 1911
492 Ga0466957_0000665 3300044842 Bacteria 17463
493 Ga0466957_0087652 3300044842 Bacteria 1946
494 Ga0466957_0114810 3300044842 Bacteria 1711
495 Ga0466957_0306276 3300044842 Bacteria 1068
496 Ga0466960_0002372 3300044901 Bacteria 7089
497 Ga0466960_0003337 3300044901 Bacteria 6159
498 Ga0466960_0013645 3300044901 Bacteria 3457
499 Ga0466960_0104426 3300044901 Bacteria 1464
500 Ga0466959_0001547 3300045049 Bacteria 14146
501 Ga0466959_0004284 3300045049 Bacteria 9516
502 Ga0466959_0004866 3300045049 Bacteria 9086
503 Ga0466959_0030100 3300045049 Bacteria 4020
504 Ga0466959_0175124 3300045049 Bacteria 1503
505 Ga0466958_0002860 3300045836 Bacteria 8789
506 Ga0466958_0004749 3300045836 Bacteria 7226
507 Ga0466958_0039394 3300045836 Bacteria 2839
508 Ga0466958_0040735 3300045836 Bacteria 2792
509 Ga0466967_0001389 3300045976 Bacteria 13984
510 Ga0466967_0002745 3300045976 Bacteria 11136
511 Ga0466967_0023964 3300045976 Bacteria 5011
512 Ga0466967_0077166 3300045976 Bacteria 2998
513 Ga0466967_0080319 3300045976 Bacteria 2942
514 Ga0466967_0162259 3300045976 Bacteria 2099
515 Ga0466967_0191741 3300045976 Bacteria 1932
516 Ga0466967_0223884 3300045976 Bacteria 1789
517 Ga0466967_0458693 3300045976 Bacteria 1246
518 Ga0466967_0526196 3300045976 Bacteria 1162
519 Ga0495617_033820 3300046452 Bacteria 1715
520 Ga0495592_0000019 3300046454 Bacteria 140749
521 Ga0495592_0003593 3300046454 Bacteria 11151
522 Ga0495592_0010881 3300046454 Bacteria 6864
523 Ga0495592_0089028 3300046454 Bacteria 2217
524 Ga0495592_0174068 3300046454 Bacteria 1471
525 Ga0495603_0001229 3300046455 Bacteria 14941
526 Ga0495603_0002852 3300046455 Bacteria 10207
527 Ga0495603_0003655 3300046455 Bacteria 9148
528 Ga0495603_0008888 3300046455 Bacteria 6074
529 Ga0495603_0092702 3300046455 Bacteria 1765
530 Ga0495590_0028363 3300046457 Bacteria 1964
531 Ga0495629_0008178 3300046459 Bacteria 7691
532 Ga0495629_0023067 3300046459 Bacteria 4435
533 Ga0495629_0023084 3300046459 Bacteria 4433
534 Ga0495629_0044497 3300046459 Bacteria 3115
535 Ga0495629_0111475 3300046459 Bacteria 1907
536 Ga0495629_0142163 3300046459 Bacteria 1669
537 Ga0495629_0215729 3300046459 Bacteria 1324
538 Ga0495638_0002049 3300046460 Bacteria 17130
539 Ga0495638_0009798 3300046460 Bacteria 6690
540 Ga0495641_0018013 3300046461 Bacteria 3658
541 Ga0495641_0020191 3300046461 Bacteria 3387
542 Ga0495641_0070130 3300046461 Bacteria 1574
543 Ga0495651_0000012 3300046462 Bacteria 138280
544 Ga0495651_0002041 3300046462 Bacteria 15607
545 Ga0495651_0003580 3300046462 Bacteria 11916
546 Ga0495651_0005598 3300046462 Bacteria 9575
547 Ga0495651_0007219 3300046462 Bacteria 8492
548 Ga0495651_0022043 3300046462 Bacteria 4953
549 Ga0495651_0077942 3300046462 Bacteria 2507
550 Ga0495651_0199045 3300046462 Bacteria 1403
551 Ga0495653_0000497 3300046463 Bacteria 30342
552 Ga0495653_0000696 3300046463 Bacteria 25659
553 Ga0495653_0012957 3300046463 Bacteria 6802
554 Ga0495653_0016927 3300046463 Bacteria 5930
555 Ga0495653_0017204 3300046463 Bacteria 5879
556 Ga0495653_0037425 3300046463 Bacteria 3813
557 Ga0495653_0104562 3300046463 Bacteria 2046
558 Ga0495653_0188052 3300046463 Bacteria 1411
559 Ga0495653_0212503 3300046463 Bacteria 1305
560 Ga0495580_0063633 3300046472 Bacteria 2586
561 Ga0495582_0010999 3300046473 Bacteria 4981
562 Ga0495582_0058264 3300046473 Bacteria 2130
563 Ga0495582_0060350 3300046473 Bacteria 2092
564 Ga0495582_0271843 3300046473 Bacteria 973
565 Ga0495605_0016056 3300046474 Bacteria 4060
566 Ga0495662_0000796 3300046476 Bacteria 15310
567 Ga0495662_0002243 3300046476 Bacteria 9743
568 Ga0495662_0007504 3300046476 Bacteria 5388
569 Ga0495662_0040960 3300046476 Bacteria 2236
570 Ga0495664_0000137 3300046477 Bacteria 36467
571 Ga0495664_0000402 3300046477 Bacteria 21128
572 Ga0495664_0002832 3300046477 Bacteria 9330
573 Ga0495664_0018470 3300046477 Bacteria 3996
574 Ga0495664_0033230 3300046477 Bacteria 3032
575 Ga0495664_0068246 3300046477 Bacteria 2121
576 Ga0495584_0037231 3300046491 Bacteria 2458
577 Ga0495585_0082299 3300046492 Bacteria 1743
578 Ga0495585_0097627 3300046492 Bacteria 1575
579 Ga0495594_0000330 3300046499 Bacteria 23485
580 Ga0495594_0097326 3300046499 Bacteria 1653
581 Ga0495594_0209223 3300046499 Bacteria 1112
582 Ga0495583_0017226 3300046506 Bacteria 3846
583 Ga0495606_0002365 3300046507 Bacteria 22146
584 Ga0495608_0000048 3300046511 Bacteria 97364
585 Ga0495608_0003917 3300046511 Bacteria 10704
586 Ga0495608_0005268 3300046511 Bacteria 9239
587 Ga0495608_0005881 3300046511 Bacteria 8731
588 Ga0495608_0013736 3300046511 Bacteria 5617
589 Ga0495608_0027406 3300046511 Bacteria 3876
590 Ga0495608_0030091 3300046511 Bacteria 3679
591 Ga0495608_0112618 3300046511 Bacteria 1749
592 Ga0495608_0157535 3300046511 Bacteria 1445
593 Ga0495616_0004907 3300046513 Bacteria 8359
594 Ga0495616_0050858 3300046513 Bacteria 2070
595 Ga0495618_0007183 3300046514 Bacteria 6745
596 Ga0495618_0022588 3300046514 Bacteria 3886
597 Ga0495618_0027140 3300046514 Bacteria 3564
598 Ga0495618_0044914 3300046514 Bacteria 2786
599 Ga0495618_0097562 3300046514 Bacteria 1880
600 Ga0495618_0174011 3300046514 Bacteria 1369
601 Ga0495628_0000053 3300046516 Bacteria 91080
602 Ga0495628_0005859 3300046516 Bacteria 10765
603 Ga0495628_0011415 3300046516 Bacteria 7515
604 Ga0495628_0078137 3300046516 Bacteria 2574
605 Ga0495630_0003361 3300046517 Bacteria 11137
606 Ga0495630_0065731 3300046517 Bacteria 2725
607 Ga0495630_0212194 3300046517 Bacteria 1477
608 Ga0495630_0360225 3300046517 Bacteria 1113
609 Ga0495631_0008298 3300046518 Bacteria 5236
610 Ga0495632_0112030 3300046519 Bacteria 1281
611 Ga0495637_0043071 3300046520 Bacteria 1929
612 Ga0495643_0003140 3300046522 Bacteria 12314
613 Ga0495666_0002368 3300046526 Bacteria 9399
614 Ga0495666_0156408 3300046526 Bacteria 1058
615 Ga0495652_0000230 3300046529 Bacteria 65344
616 Ga0495652_0000972 3300046529 Bacteria 32777
617 Ga0495652_0002018 3300046529 Bacteria 21596
618 Ga0495652_0005735 3300046529 Bacteria 11632
619 Ga0495652_0022908 3300046529 Bacteria 5540
620 Ga0495652_0052783 3300046529 Bacteria 3466
621 Ga0495652_0231768 3300046529 Bacteria 1380
622 Ga0495665_0016688 3300046531 Bacteria 3956
623 Ga0495665_0020854 3300046531 Bacteria 3520
624 Ga0495665_0034897 3300046531 Bacteria 2689
625 Ga0495665_0057320 3300046531 Bacteria 2056
626 Ga0495665_0106404 3300046531 Bacteria 1472
627 Ga0495640_0003531 3300046533 Bacteria 12572
628 Ga0495640_0011170 3300046533 Bacteria 6913
629 Ga0495640_0020000 3300046533 Bacteria 4935
630 Ga0495640_0021436 3300046533 Bacteria 4741
631 Ga0495586_0041353 3300046535 Bacteria 2482
632 Ga0495587_0000027 3300046536 Bacteria 140741
633 Ga0495587_0002554 3300046536 Bacteria 12163
634 Ga0495587_0009018 3300046536 Bacteria 6403
635 Ga0495587_0009578 3300046536 Bacteria 6201
636 Ga0495587_0026388 3300046536 Bacteria 3543
637 Ga0495587_0046245 3300046536 Bacteria 2584
638 Ga0495597_0006920 3300046542 Bacteria 5817
639 Ga0495645_0006144 3300046543 Bacteria 8312
640 Ga0495645_0009859 3300046543 Bacteria 6685
641 Ga0495645_0016194 3300046543 Bacteria 5316
642 Ga0495645_0048011 3300046543 Bacteria 3110
643 Ga0495645_0247270 3300046543 Bacteria 1187
644 Ga0495622_0028552 3300046557 Bacteria 2605
645 Ga0495622_0075803 3300046557 Bacteria 1550
646 Ga0495633_0009835 3300046558 Bacteria 5256
647 Ga0495667_0000089 3300046559 Bacteria 66700
648 Ga0495667_0001134 3300046559 Bacteria 17354
649 Ga0495667_0006353 3300046559 Bacteria 8016
650 Ga0495667_0011246 3300046559 Bacteria 6058
651 Ga0495667_0015057 3300046559 Bacteria 5220
652 Ga0495667_0028436 3300046559 Bacteria 3764
653 Ga0495667_0091129 3300046559 Bacteria 1974
654 Ga0495667_0104174 3300046559 Bacteria 1834
655 Ga0495667_0233508 3300046559 Bacteria 1172
656 Ga0495668_0000169 3300046616 Bacteria 97150
657 Ga0495668_0023813 3300046616 Bacteria 3487
658 Ga0495634_0000714 3300046642 Bacteria 32209
659 Ga0495634_0012007 3300046642 Bacteria 6279
660 Ga0495634_0017924 3300046642 Bacteria 5046
661 Ga0495634_0056827 3300046642 Bacteria 2613
662 Ga0495634_0058665 3300046642 Bacteria 2564
663 Ga0495625_0002435 3300046660 Bacteria 20135
664 Ga0495625_0004532 3300046660 Bacteria 13098
665 Ga0495625_0024976 3300046660 Bacteria 4539
666 Ga0495625_0039421 3300046660 Bacteria 3449
667 Ga0495635_0001652 3300046663 Bacteria 15030
668 Ga0495635_0006862 3300046663 Bacteria 7955
669 Ga0495635_0015459 3300046663 Bacteria 5335
670 Ga0495635_0018259 3300046663 Bacteria 4896
671 Ga0495635_0022932 3300046663 Bacteria 4351
672 Ga0495635_0111505 3300046663 Bacteria 1868
673 Ga0495588_0107471 3300046674 Bacteria 1469
674 Ga0495657_0000025 3300046675 Bacteria 140749
675 Ga0495657_0000195 3300046675 Bacteria 54506
676 Ga0495657_0009221 3300046675 Bacteria 7488
677 Ga0495657_0012336 3300046675 Bacteria 6350
678 Ga0495657_0023829 3300046675 Bacteria 4368
679 Ga0495657_0028696 3300046675 Bacteria 3910
680 Ga0495657_0059351 3300046675 Bacteria 2537
681 Ga0495657_0075125 3300046675 Bacteria 2197
682 Ga0495657_0085116 3300046675 Bacteria 2038
683 Ga0495657_0194788 3300046675 Bacteria 1237
684 Ga0495657_0251959 3300046675 Bacteria 1063
685 Ga0495599_0000026 3300046678 Bacteria 117515
686 Ga0495599_0001894 3300046678 Bacteria 12120
687 Ga0495599_0006909 3300046678 Bacteria 6860
688 Ga0495599_0007812 3300046678 Bacteria 6491
689 Ga0495599_0099820 3300046678 Bacteria 1809
690 Ga0495623_0045566 3300046679 Bacteria 2785
691 Ga0495623_0140167 3300046679 Bacteria 1439
692 Ga0495646_0000700 3300046680 Bacteria 18542
693 Ga0495646_0010700 3300046680 Bacteria 5828
694 Ga0495658_0008090 3300046683 Bacteria 5206
695 Ga0495658_0038714 3300046683 Bacteria 2641
696 Ga0495658_0113522 3300046683 Bacteria 1631
697 Ga0495613_0000717 3300046689 Bacteria 25942
698 Ga0495613_0002765 3300046689 Bacteria 13182
699 Ga0495613_0012604 3300046689 Bacteria 6286
700 Ga0495613_0027176 3300046689 Bacteria 4258
701 Ga0495613_0148445 3300046689 Bacteria 1673
702 Ga0495613_0246591 3300046689 Bacteria 1247
703 Ga0495624_0003962 3300046690 Bacteria 10899
704 Ga0495624_0060720 3300046690 Bacteria 2369
705 Ga0495624_0077953 3300046690 Bacteria 2055
706 Ga0495624_0114796 3300046690 Bacteria 1655
707 Ga0495649_0075682 3300046694 Bacteria 1802
708 Ga0495589_0010321 3300046794 Bacteria 4851
709 Ga0495589_0025928 3300046794 Bacteria 2971
710 Ga0495600_0009348 3300046809 Bacteria 6054
711 Ga0495600_0013905 3300046809 Bacteria 5070
712 Ga0495600_0014301 3300046809 Bacteria 4999
713 Ga0495600_0020695 3300046809 Bacteria 4207
714 Ga0495600_0037550 3300046809 Bacteria 3149
715 Ga0495600_0045893 3300046809 Bacteria 2851
716 Ga0495600_0111210 3300046809 Bacteria 1783
717 Ga0495581_0010738 3300047315 Bacteria 5295
718 Ga0495581_0013027 3300047315 Bacteria 4820
719 Ga0495581_0094286 3300047315 Bacteria 1737
720 Ga0495581_0254428 3300047315 Bacteria 1027
721 Ga0495604_0000029 3300047317 Bacteria 140740
722 Ga0495604_0000534 3300047317 Bacteria 33497
723 Ga0495604_0000925 3300047317 Bacteria 24435
724 Ga0495604_0001249 3300047317 Bacteria 20835
725 Ga0495604_0003276 3300047317 Bacteria 12940
726 Ga0495604_0030620 3300047317 Bacteria 4272
727 Ga0495604_0074499 3300047317 Bacteria 2558
728 Ga0495604_0203796 3300047317 Bacteria 1370
729 Ga0495636_0000712 3300047318 Bacteria 12181
730 Ga0495636_0028497 3300047318 Bacteria 2278
731 Ga0495636_0106307 3300047318 Bacteria 1231
732 Ga0495674_0000418 3300047319 Bacteria 38152
733 Ga0495674_0009916 3300047319 Bacteria 9034
734 Ga0495674_0011013 3300047319 Bacteria 8539
735 Ga0495674_0059230 3300047319 Bacteria 3345
736 Ga0495674_0190548 3300047319 Bacteria 1704
737 Ga0495674_0385812 3300047319 Bacteria 1133
738 Ga0495674_0407650 3300047319 Bacteria 1097
739 Ga0495674_0521689 3300047319 Bacteria 948
740 Ga0495676_0002965 3300047321 Bacteria 15343
741 Ga0495676_0004077 3300047321 Bacteria 13313
742 Ga0495676_0006734 3300047321 Bacteria 10570
743 Ga0495676_0036843 3300047321 Bacteria 4079
744 Ga0495676_0040254 3300047321 Bacteria 3858
745 Ga0495676_0048957 3300047321 Bacteria 3402
746 Ga0495676_0095649 3300047321 Bacteria 2210
747 Ga0495680_0000011 3300047322 Bacteria 140733
748 Ga0495680_0001927 3300047322 Bacteria 21805
749 Ga0495680_0007791 3300047322 Bacteria 9779
750 Ga0495680_0028397 3300047322 Bacteria 4586
751 Ga0495680_0035864 3300047322 Bacteria 3988
752 Ga0495680_0065117 3300047322 Bacteria 2792
753 Ga0495683_0052979 3300047323 Bacteria 2024
754 Ga0495687_000608 3300047443 Bacteria 41847
755 Ga0495687_088642 3300047443 Bacteria 1190
756 Ga0495675_0000433 3300047444 Bacteria 27885
757 Ga0495675_0011016 3300047444 Bacteria 5668
758 Ga0495675_0017354 3300047444 Bacteria 4561
759 Ga0495675_0044058 3300047444 Bacteria 2842
760 Ga0495675_0230257 3300047444 Bacteria 1118
761 Ga0495685_008511 3300047447 Bacteria 3409
762 Ga0495685_019259 3300047447 Bacteria 2344
763 Ga0495673_0010530 3300047469 Bacteria 5021
764 Ga0495681_0008184 3300047470 Bacteria 6581
765 Ga0495684_0002379 3300047471 Bacteria 15039
766 Ga0495684_0009203 3300047471 Bacteria 7624
767 Ga0495684_0009423 3300047471 Bacteria 7538
768 Ga0495684_0033942 3300047471 Bacteria 3914
769 Ga0495684_0040950 3300047471 Bacteria 3550
770 Ga0495684_0053280 3300047471 Bacteria 3087
771 Ga0495593_0000887 3300047673 Bacteria 17377
772 Ga0495593_0010699 3300047673 Bacteria 5290
773 Ga0495593_0029343 3300047673 Bacteria 3016
774 Ga0495593_0044705 3300047673 Bacteria 2367
775 Ga0495593_0055596 3300047673 Bacteria 2082
776 Ga0495593_0219178 3300047673 Bacteria 955
777 Ga0495602_0000033 3300048088 Bacteria 140750
778 Ga0495602_0008923 3300048088 Bacteria 10453
779 Ga0495602_0025991 3300048088 Bacteria 5656
780 Ga0495602_0034110 3300048088 Bacteria 4765
781 Ga0495602_0041711 3300048088 Bacteria 4189
782 Ga0495602_0082865 3300048088 Bacteria 2689
783 Ga0495602_0117582 3300048088 Bacteria 2145
784 Ga0495602_0218171 3300048088 Bacteria 1442
785 Ga0495614_0000867 3300048089 Bacteria 12804
786 Ga0495614_0040522 3300048089 Bacteria 1999
787 Ga0495626_0000312 3300048091 Bacteria 51412
788 Ga0496100_0002392 3300048903 Bacteria 9498
789 Ga0496100_0028480 3300048903 Bacteria 3446
790 Ga0496100_0281981 3300048903 Bacteria 1239
791 Ga0496101_0023626 3300048904 Bacteria 4248
792 Ga0496101_0067450 3300048904 Bacteria 2612
793 Ga0496101_0098842 3300048904 Bacteria 2181
794 Ga0496101_0331134 3300048904 Bacteria 1195
795 Ga0496102_0000015 3300048905 Bacteria 304524
796 Ga0496102_0028001 3300048905 Bacteria 5035
797 Ga0496102_0184126 3300048905 Bacteria 1968
798 Ga0496102_0239042 3300048905 Bacteria 1713
799 Ga0496102_0494401 3300048905 Bacteria 1145
800 Ga0496102_0544360 3300048905 Bacteria 1083
801 Ga0496103_0000020 3300048906 Bacteria 234050
802 Ga0496103_0031363 3300048906 Bacteria 3238
803 Ga0496103_0061889 3300048906 Bacteria 2329
804 Ga0496104_0002885 3300048907 Bacteria 14814
805 Ga0496104_0049412 3300048907 Bacteria 3967
806 Ga0496104_0062899 3300048907 Bacteria 3519
807 Ga0496104_0090847 3300048907 Bacteria 2918
808 Ga0496104_0285433 3300048907 Bacteria 1563
809 Ga0496104_0342867 3300048907 Bacteria 1407
810 Ga0496104_0409830 3300048907 Bacteria 1268
811 Ga0496104_0432867 3300048907 Bacteria 1227
812 Ga0496105_0005328 3300048908 Bacteria 9746
813 Ga0496105_0021995 3300048908 Bacteria 5163
814 Ga0496105_0066508 3300048908 Bacteria 2976
815 Ga0496105_0192074 3300048908 Bacteria 1669
816 Ga0496105_0481919 3300048908 Bacteria 976
817 Ga0496106_0004227 3300048909 Bacteria 10690
818 Ga0496106_0039541 3300048909 Bacteria 3533
819 Ga0496107_0169257 3300048910 Bacteria 1621
820 Ga0496107_0217732 3300048910 Bacteria 1420
821 Ga0496108_0001463 3300048911 Bacteria 18677
822 Ga0496108_0009686 3300048911 Bacteria 7807
823 Ga0496108_0056412 3300048911 Bacteria 3300
824 Ga0496108_0108130 3300048911 Bacteria 2375
825 Ga0496108_0438640 3300048911 Bacteria 1141
826 Ga0496108_0446658 3300048911 Bacteria 1130
827 Ga0496109_0012459 3300048912 Bacteria 7341
828 Ga0496109_0054926 3300048912 Bacteria 3633
829 Ga0496109_0067956 3300048912 Bacteria 3265
830 Ga0496109_0164494 3300048912 Bacteria 2079
831 Ga0496109_0324019 3300048912 Bacteria 1454
832 Ga0496109_0324479 3300048912 Bacteria 1453
833 Ga0496109_0468173 3300048912 Bacteria 1190
834 Ga0496110_0007465 3300048913 Bacteria 8737
835 Ga0496110_0093651 3300048913 Bacteria 2689
836 Ga0496110_0316402 3300048913 Bacteria 1422
837 Ga0496110_0354310 3300048913 Bacteria 1337
838 Ga0496111_0003426 3300048914 Bacteria 9808
839 Ga0496111_0010528 3300048914 Bacteria 6211
840 Ga0496111_0040256 3300048914 Bacteria 3352
841 Ga0496111_0302517 3300048914 Bacteria 1186
842 Ga0496112_0002097 3300048915 Bacteria 15828
843 Ga0496112_0007119 3300048915 Bacteria 9895
844 Ga0496112_0011019 3300048915 Bacteria 8240
845 Ga0496112_0036248 3300048915 Bacteria 4811
846 Ga0496112_0038349 3300048915 Bacteria 4677
847 Ga0496112_0273936 3300048915 Bacteria 1635
848 Ga0496113_0014747 3300048916 Bacteria 5345
849 Ga0496113_0078815 3300048916 Bacteria 2521
850 Ga0496113_0083138 3300048916 Bacteria 2456
851 Ga0496113_0130374 3300048916 Bacteria 1972
852 Ga0496113_0170885 3300048916 Bacteria 1721
853 Ga0496113_0320833 3300048916 Bacteria 1242
854 Ga0496113_0326298 3300048916 Bacteria 1231
855 Ga0496113_0397313 3300048916 Bacteria 1107
856 Ga0496113_0407706 3300048916 Bacteria 1091
857 Ga0496114_0004897 3300048917 Bacteria 10429
858 Ga0496114_0073236 3300048917 Bacteria 2883
859 Ga0496114_0094297 3300048917 Bacteria 2546
860 Ga0496115_0028213 3300048918 Bacteria 4398
861 Ga0496116_0000178 3300048919 Bacteria 128023
862 Ga0496116_0000578 3300048919 Bacteria 48938
863 Ga0496117_0000047 3300048920 Bacteria 299632
864 Ga0496117_0021310 3300048920 Bacteria 5248
865 Ga0496117_0028936 3300048920 Bacteria 4281
866 Ga0496118_0000050 3300048921 Bacteria 244124
867 Ga0496118_0002249 3300048921 Bacteria 26504
868 Ga0496118_0012121 3300048921 Bacteria 8321
869 Ga0496119_0001789 3300048922 Bacteria 25038
870 Ga0496121_0000537 3300048924 Bacteria 72149
871 Ga0496121_0003059 3300048924 Bacteria 24255
872 Ga0496126_0000049 3300048929 Bacteria 317568
873 Ga0496126_0000208 3300048929 Bacteria 131604
874 Ga0496126_0132085 3300048929 Bacteria 2157
875 Ga0495682_0076482 3300049460 Bacteria 1204
876 Ga0501031_0006054 3300049568 Bacteria 7898
877 Ga0501031_0020167 3300049568 Bacteria 4345
878 Ga0501032_0062566 3300049569 Bacteria 2493
879 Ga0501033_0002605 3300049570 Bacteria 15201
880 Ga0501033_0009265 3300049570 Bacteria 7584
881 Ga0501034_0022734 3300049571 Bacteria 6387
882 Ga0501034_0025515 3300049571 Bacteria 6018
883 Ga0501034_0046104 3300049571 Bacteria 4404
884 Ga0501034_0218602 3300049571 Bacteria 1858
885 Ga0501036_0004252 3300049572 Bacteria 11547
886 Ga0501036_0041897 3300049572 Bacteria 3875
887 Ga0501036_0051220 3300049572 Bacteria 3496
888 Ga0501036_0158391 3300049572 Bacteria 1909
889 Ga0501037_0011090 3300049573 Bacteria 6631
890 Ga0501037_0031773 3300049573 Bacteria 3898
891 Ga0501037_0048042 3300049573 Bacteria 3128
892 Ga0501038_0002308 3300049574 Bacteria 17738
893 Ga0501038_0056214 3300049574 Bacteria 3379
894 Ga0501038_0109434 3300049574 Bacteria 2289
895 Ga0501043_0006999 3300049579 Bacteria 8984
896 Ga0501043_0117350 3300049579 Bacteria 2088
897 Ga0501046_0006667 3300049580 Bacteria 10196
898 Ga0501046_0025038 3300049580 Bacteria 4888
899 Ga0501046_0072421 3300049580 Bacteria 2675
900 Ga0501047_0021299 3300049581 Bacteria 6223
901 Ga0501047_0040398 3300049581 Bacteria 4511
902 Ga0501048_0009146 3300049582 Bacteria 7451
903 Ga0501048_0130490 3300049582 Bacteria 1777
904 Ga0501048_0190629 3300049582 Bacteria 1453
905 Ga0501070_0006172 3300049586 Bacteria 10214
906 Ga0501070_0025187 3300049586 Bacteria 4989
907 Ga0501071_0199153 3300049587 Bacteria 1504
908 Ga0501074_0011988 3300049590 Bacteria 6300
909 Ga0501080_0029005 3300049742 Bacteria 5151
910 Ga0501080_0133479 3300049742 Bacteria 2298
911 Ga0501035_0137464 3300049822 Bacteria 2126
912 Ga0501044_0000295 3300049823 Bacteria 63284
913 Ga0501044_0015121 3300049823 Bacteria 8317
914 Ga0501044_0182718 3300049823 Bacteria 2063
915 nmdc:mga03n38_179837_c1 3300050490 Bacteria 1083
916 nmdc:mga03n38_88896_c1 3300050490 Bacteria 1466
917 nmdc:mga00v17_64444_c1 3300050491 Bacteria 2258
918 nmdc:mga06z11_13052_c1 3300050494 Bacteria 3634
919 nmdc:mga06z11_3612_c1 3300050494 Bacteria 5996
920 nmdc:mga05p37_115575_c1 3300050507 Bacteria 3298
921 nmdc:mga05p37_12425_c1 3300050507 Bacteria 10168
922 nmdc:mga05p37_136264_c1 3300050507 Bacteria 3010
923 nmdc:mga05p37_16765_c1 3300050507 Bacteria 8832
924 nmdc:mga05p37_194570_c1 3300050507 Bacteria 2460
925 nmdc:mga09592_345008_c1 3300050508 Bacteria 1289
926 nmdc:mga09592_3971_c1 3300050508 Bacteria 11914
927 nmdc:mga0qj67_135935_c1 3300050509 Bacteria 1992
928 nmdc:mga0qj67_18776_c1 3300050509 Bacteria 5272
929 nmdc:mga0qj67_33491_c1 3300050509 Bacteria 4009
930 nmdc:mga0qj67_4927_c1 3300050509 Bacteria 9710
931 nmdc:mga06r32_25_c7 3300050510 Bacteria 11552
932 nmdc:mga06r32_5649_c1 3300050510 Bacteria 11252
933 nmdc:mga06r32_9570_c1 3300050510 Bacteria 8752
934 nmdc:mga08y16_20936_c1 3300050511 Bacteria 6905
935 nmdc:mga08y16_39719_c1 3300050511 Bacteria 4936
936 nmdc:mga0rr50_2888_c1 3300050513 Bacteria 9800
937 nmdc:mga08x19_111186_c1 3300050514 Bacteria 1828
938 nmdc:mga08x19_40499_c1 3300050514 Bacteria 2965
939 nmdc:mga0a205_229823_c1 3300050515 Bacteria 1738
940 nmdc:mga0a205_272376_c1 3300050515 Bacteria 1570
941 nmdc:mga0a205_394690_c1 3300050515 Bacteria 1247
942 nmdc:mga0sz30_43096_c1 3300050516 Bacteria 1899
943 Ga0495601_0014240 3300053077 Bacteria 4791
944 Ga0495601_0029692 3300053077 Bacteria 3393
945 Ga0495601_0094699 3300053077 Bacteria 1925
946 Ga0495601_0126424 3300053077 Bacteria 1663
947 Ga0495612_0011203 3300053078 Bacteria 3619
948 Ga0495612_0094570 3300053078 Bacteria 1269
949 Ga0500610_0001046 3300053079 Bacteria 9068
950 Ga0495595_0005426 3300053084 Bacteria 5163
951 Ga0495595_0006450 3300053084 Bacteria 4786
952 Ga0495595_0131474 3300053084 Bacteria 1224
953 Ga0495619_0019537 3300053085 Bacteria 4309
954 Ga0495619_0028622 3300053085 Bacteria 3595
955 Ga0495619_0031353 3300053085 Bacteria 3445
956 Ga0495619_0042612 3300053085 Bacteria 2973
957 Ga0495619_0172223 3300053085 Bacteria 1497
958 Ga0495619_0174895 3300053085 Bacteria 1485
959 Ga0500643_041856 3300053087 Bacteria 1343
960 Ga0500644_0025657 3300053088 Bacteria 1816
961 Ga0500646_0000211 3300053090 Bacteria 17430
962 Ga0500583_0023020 3300053092 Bacteria 2620
963 Ga0500651_0176919 3300053093 Bacteria 1269
964 Ga0500556_0001025 3300053104 Bacteria 14612
965 Ga0500562_025807 3300053108 Bacteria 1539
966 Ga0500608_071255 3300053122 Bacteria 1652
967 Ga0500652_000353 3300053131 Bacteria 16458
968 Ga0500652_081031 3300053131 Bacteria 1351
969 Ga0500561_0050482 3300053137 Bacteria 1133
970 Ga0500568_0004813 3300053139 Bacteria 7136
971 Ga0500645_000016 3300053730 Bacteria 147392
972 Ga0501084_0269990 3300054114 Bacteria 1436
973 Ga0587073_0010886 3300059492 Bacteria 1540
974 Ga0466962_0001673 3300061719 Bacteria 10405
975 Ga0466962_0046521 3300061719 Bacteria 2073
976 Ga0466962_0175076 3300061719 Bacteria 1045
977 3006427120 3006425503 Bacteria 6491253
978 2501941838 2501939600 Bacteria 6907073
979 2508672363 2508501039 Bacteria 9978592
980 2515493927 2515154088 Bacteria 5526283
981 2515720613 2515154129 Bacteria 5584369
982 2515755303 2515154137 Bacteria 5711575
983 2516086763 2515154202 Bacteria 5471270
984 2516092349 2515154203 Bacteria 5458536
985 2517760698 2517572101 Bacteria 6884336
986 2547410287 2547132111 Bacteria 8013147
987 2554260713 2554235005 Bacteria 6457341
988 2585298140 2582581312 Bacteria 7308206
989 2585304637 2582581313 Bacteria 10042643
990 2585314746 2582581314 Bacteria 11452267
991 2585320742 2582581314 Bacteria 11452267
992 2616698179 2616644814 Bacteria 11555299
993 2616901487 2616644941 Bacteria 8510691
994 2619856603 2619618881 Bacteria 7521104
995 2620348831 2619619003 Bacteria 7619552
996 2623502296 2622736605 Bacteria 4992138
997 2623586429 2622736626 Bacteria 7181580
998 2643762049 2643221548 Bacteria 8053412
999 2643901989 2643221578 Bacteria 9213798
1000 2643946239 2643221587 Bacteria 7586415
1001 2644017983 2643221601 Bacteria 7493239
1002 2644180729 2643221631 Bacteria 8168043
1003 2644261972 2643221647 Bacteria 10741251
1004 2644388009 2643221670 Bacteria 6497041
1005 2644408133 2643221673 Bacteria 9196637
1006 2644433028 2643221677 Bacteria 7584031
1007 2644442826 2643221678 Bacteria 9540101
1008 2644445919 2643221679 Bacteria 3839507
1009 2644460524 2643221682 Bacteria 6743283
1010 2644631319 2643221714 Bacteria 9015452
1011 2676198228 2675902999 Bacteria 9438463
1012 2686537434 2684623035 Bacteria 8032739
1013 2689959502 2687453737 Bacteria 11203906
1014 2738704581 2738541274 Bacteria 6909446
1015 2739330936 2738543028 Bacteria 6917070
1016 2753073310 2751185734 Bacteria 8863695
1017 2768645653 2767802112 Bacteria 6465194
1018 2772641666 2772190715 Bacteria 6959372
1019 2774842806 2773857921 Bacteria 9435764
1020 2784591631 2784132148 Bacteria 8627943
1021 2785340102 2784746763 Bacteria 9783172
1022 2785372635 2784746768 Bacteria 10036182
1023 2786675348 2786546132 Bacteria 10419719
1024 2793983360 2791355406 Bacteria 11364898
1025 2804848905 2802429296 Bacteria 7227771
1026 2808844990 2808606359 Bacteria 9866990
1027 2808914589 2808606375 Bacteria 9466072
1028 2809235262 2808606448 Bacteria 8656184
1029 2811843532 2808606982 Bacteria 7791042
1030 2812354698 2811994879 Bacteria 9313447
1031 2812477667 2811994917 Bacteria 7761064
1032 2819698790 2818991463 Bacteria 7948711
1033 2819740052 2818991472 Bacteria 10089953
1034 2831939901 2831935698 Bacteria 5963223
1035 2852636318 2852635781 Bacteria 8251373
1036 2855672222 2855670206 Bacteria 7120389
1037 2855678861 2855676851 Bacteria 7063653
1038 2855685287 2855683550 Bacteria 7134265
1039 2856860347 2856858025 Bacteria 7255264
1040 2857295166 2857288857 Bacteria 7189066
1041 2858854529 2858848962 Bacteria 6963058
1042 2858874080 2858868258 Bacteria 7683772
1043 2858888531 2858882152 Bacteria 7230291
1044 2858890763 2858888857 Bacteria 7060307
1045 2858898549 2858895516 Bacteria 7378898
1046 2858905637 2858902515 Bacteria 7086037
1047 2861520752 2861520306 Bacteria 8348283
1048 2862183994 2862178590 Bacteria 8583590
1049 2862283411 2862281513 Bacteria 9621493
1050 2862294886 2862290372 Bacteria 7471434
1051 2862390353 2862382967 Bacteria 10317375
1052 2862507768 2862507626 Bacteria 9425308
1053 2862576440 2862574272 Bacteria 10567477
1054 2862708960 2862705112 Bacteria 6563286
1055 2863409865 2863404153 Bacteria 9672205
1056 2867303801 2867302475 Bacteria 7087181
1057 2867313361 2867312974 Bacteria 7058875
1058 2867322820 2867319477 Bacteria 7069771
1059 2867350709 2867346516 Bacteria 7608576
1060 2867374650 2867369537 Bacteria 6501581
1061 2867432042 2867428634 Bacteria 9590268
1062 2867475208 2867475112 Bacteria 6909112
1063 2869054196 2869048445 Bacteria 6875584
1064 2869065818 2869061728 Bacteria 7112407
1065 2869070630 2869068681 Bacteria 7205615
1066 2870729135 2870721527 Bacteria 9689237
1067 2873152939 2873151551 Bacteria 8625867
1068 2873316937 2873314349 Bacteria 8512634
1069 2875397702 2875391855 Bacteria 7600475
1070 2877678080 2877676314 Bacteria 9512378
1071 2880493752 2880489317 Bacteria 7096270
1072 2880498570 2880495981 Bacteria 7340502
1073 2887483702 2887478801 Bacteria 8972725
1074 2895882362 2895880812 Bacteria 11255272
1075 2902586400 2902582711 Bacteria 6187705
1076 2912716319 2912715099 Bacteria 9460473
1077 2912729231 2912723979 Bacteria 8557534
1078 2912763904 2912757875 Bacteria 7940295
1079 2915363200 2915358134 Bacteria 6050864
1080 2918507480 2918501144 Bacteria 8668083
1081 2919471213 2919468124 Bacteria 9133025
1082 2929220562 2929219909 Bacteria 6984360
1083 2929227149 2929226422 Bacteria 7248583
1084 2935395381 2935390628 Bacteria 7043367
1085 2946046823 2946045630 Bacteria 8527308
1086 2946070965 2946064051 Bacteria 8957905
1087 2946078896 2946072368 Bacteria 8999607
1088 2947225758 2947224130 Bacteria 9938529
1089 2954009929 2954002825 Bacteria 9173742
1090 2954382865 2954380949 Bacteria 10050426
1091 2954680025 2954673503 Bacteria 9685905
1092 2954684125 2954682443 Bacteria 9862841
1093 2954693686 2954691527 Bacteria 10720516
1094 2954708782 2954701450 Bacteria 10834262
1095 2954713332 2954711539 Bacteria 10867210
1096 2954723292 2954721474 Bacteria 10456478
1097 2954738536 2954731030 Bacteria 10243860
1098 2954742199 2954740390 Bacteria 10229294
1099 2954757394 2954749733 Bacteria 10366972
1100 2954761177 2954759201 Bacteria 9358192
1101 2966599832 2966598605 Bacteria 7676064
1102 2990049080 2990044586 Bacteria 6603797
1103 2990061816 2990059506 Bacteria 9321252
1104 2990090597 2990088156 Bacteria 6657676
1105 2995464977 2995463766 Bacteria 8577691
1106 2996224790 2996221748 Bacteria 6799777
1107 2997603497 2997600082 Bacteria 9896405
1108 3006393739 3006393351 Bacteria 6615579
1109 3006488800 3006486233 Bacteria 8157040
1110 3006494213 3006493962 Bacteria 8825450
1111 649811086 649633069 Bacteria 6962533
1112 8001782516 8001781756 Bacteria 9586736
1113 8002782595 8002775197 Bacteria 10728764
1114 8002789206 8002784119 Bacteria 9788632
1115 8003835340 8003830390 Bacteria 6541657
1116 8003859362 8003856774 Bacteria 7675274
1117 8003873527 8003870546 Bacteria 7396674
1118 8008489881 8008485437 Bacteria 7198341
1119 8008563958 8008558824 Bacteria 10610750
1120 8008576105 8008574985 Bacteria 7815457
1121 8025417518 8025413630 Bacteria 7014048
1122 8025479388 8025478263 Bacteria 8209203
1123 8025529387 8025524527 Bacteria 7197316
1124 8025533058 8025530807 Bacteria 8495698
1125 8033687519 8033684223 Bacteria 6906479
1126 8047715083 8047710418 Bacteria 11023148
1127 8047895314 8047893842 Bacteria 11723082
1128 8048130607 8048127548 Bacteria 11053136
1129 8048363639 8048356638 Bacteria 11044339
1130 8048372340 8048369669 Bacteria 11666822
1131 8048381274 8048379754 Bacteria 11877923
1132 8048407049 8048406513 Bacteria 8936924
1133 8054161891 8054160619 Bacteria 7783213
1134 8054472266 8054472261 Bacteria 7464355
1135 8054708083 8054704163 Bacteria 7247792
1136 8054730994 8054727385 Bacteria 7558670
1137 8054735125 8054734606 Bacteria 6947278
1138 8054922261 8054920844 Bacteria 7068637
1139 8055177335 8055172936 Bacteria 9305943
1140 8055414779 8055412473 Bacteria 6257500
1141 8056448711 8056447290 Bacteria 7680491
1142 8056667265 8056667051 Bacteria 6953971
1143 8056837022 8056829672 Bacteria 9045328
1144 8057568881 8057568493 Bacteria 7221719
1145 JGI24740J21852_10031249
1146 JGI24739J22299_10014962
1147 JGI24737J22298_10003773
1148 JGI24735J21928_10006190
1149 JGI25406J46586_10052624
1150 Ga0070658_10046686
1151 Ga0070658_10079963
1152 Ga0070658_10182182
1153 Ga0070683_100051410
1154 Ga0070683_100086529
1155 Ga0070683_100136449
1156 Ga0068869_100098240
1157 Ga0070666_10058747
1158 Ga0070682_100049397
1159 Ga0068868_100015603
1160 Ga0070689_100023274
1161 Ga0070661_100019223
1162 Ga0070692_10029693
1163 Ga0070668_100024409
1164 Ga0070668_100150113
1165 Ga0070669_100261871
1166 Ga0070675_100015301
1167 Ga0070671_100000423
1168 Ga0070671_100027777
1169 Ga0070671_100033282
1170 Ga0070674_100107123
1171 Ga0070674_100187149
1172 Ga0070673_100073041
1173 Ga0070659_100015592
1174 Ga0070667_100000107
1175 Ga0070709_10000214
1176 Ga0070709_10011998
1177 Ga0070709_10020061
1178 Ga0070709_10155492
1179 Ga0070714_100000057
1180 Ga0070714_100004897
1181 Ga0070714_100011815
1182 Ga0070714_100069853
1183 Ga0070714_100101756
1184 Ga0070714_100602084
1185 Ga0070713_100008107
1186 Ga0070713_100060309
1187 Ga0070713_100075005
1188 Ga0070713_100075215
1189 Ga0070710_10000110
1190 Ga0070710_10028434
1191 Ga0070710_10217422
1192 Ga0070711_100015408
1193 Ga0070711_100103921
1194 Ga0070705_100014490
1195 Ga0070700_100088204
1196 Ga0070708_100058281
1197 Ga0070708_100330443
1198 Ga0070663_100022237
1199 Ga0070678_100001811
1200 Ga0070681_10021940
1201 Ga0070681_10236863
1202 Ga0070685_10080411
1203 Ga0070685_10174963
1204 Ga0070706_100026494
1205 Ga0070707_100059415
1206 Ga0070707_100143892
1207 Ga0070698_100099365
1208 Ga0070699_100000384
1209 Ga0070679_100023224
1210 Ga0070684_100010145
1211 Ga0070684_100021126
1212 Ga0070697_100184277
1213 Ga0068853_100220319
1214 Ga0070686_100141588
1215 Ga0070696_100005128
1216 Ga0070665_100015231
1217 Ga0070665_100053585
1218 Ga0070665_100055726
1219 Ga0070665_100398968
1220 Ga0070704_100071102
1221 Ga0070704_100388678
1222 Ga0068855_100141925
1223 Ga0068855_100173016
1224 Ga0070664_100092976
1225 Ga0070664_100533815
1226 Ga0068857_100035113
1227 Ga0068854_100006340
1228 Ga0068854_100016608
1229 Ga0068854_100190747
1230 Ga0068856_100030994
1231 Ga0068856_100091705
1232 Ga0068856_100164550
1233 Ga0068856_100166502
1234 Ga0068856_100191478
1235 Ga0068856_100300290
1236 Ga0070702_100001124
1237 Ga0070702_100007054
1238 Ga0068852_100003907
1239 Ga0068852_100013889
1240 Ga0068859_100000301
1241 Ga0068859_100018104
1242 Ga0068859_100724964
1243 Ga0068864_100001934
1244 Ga0068864_100028442
1245 Ga0068851_10019796
1246 Ga0068870_10000378
1247 Ga0068863_100000163
1248 Ga0068863_100001505
1249 Ga0068863_100042732
1250 Ga0068863_100044881
1251 Ga0068863_100339283
1252 Ga0068858_100000071
1253 Ga0068858_100009793
1254 Ga0068858_100055569
1255 Ga0068860_100072600
1256 Ga0068862_100000049
1257 Ga0068862_100155262
1258 Ga0081455_10000436
1259 Ga0081455_10012252
1260 Ga0081455_10046773
1261 Ga0081455_10130375
1262 Ga0081538_10000120
1263 Ga0081538_10027673
1264 Ga0081540_1049020
1265 Ga0081539_10000094
1266 Ga0070717_10006278
1267 Ga0070717_10060107
1268 Ga0075368_10011215
1269 Ga0075363_100057075
1270 Ga0075363_100221265
1271 Ga0075364_10041167
1272 Ga0070716_100024466
1273 Ga0070712_100077576
1274 Ga0075362_10075251
1275 Ga0075367_10024053
1276 Ga0075369_10004469
1277 Ga0075369_10037118
1278 Ga0075369_10048349
1279 Ga0097621_100018176
1280 Ga0097621_100047019
1281 Ga0075370_10024496
1282 Ga0075428_100001540
1283 Ga0075428_100007363
1284 Ga0075428_100107885
1285 Ga0075430_100004383
1286 Ga0075430_100032198
1287 Ga0075430_100113458
1288 Ga0075431_100001429
1289 Ga0075431_100014993
1290 Ga0075431_100058914
1291 Ga0075431_100085491
1292 Ga0075433_10234417
1293 Ga0075433_10246032
1294 Ga0075434_100016866
1295 Ga0075429_100002452
1296 Ga0075429_100016645
1297 Ga0075436_100060147
1298 Ga0075436_100062018
1299 Ga0097620_100000301
1300 Ga0097620_100003956
1301 Ga0097620_100018103
1302 Ga0097620_100725047
1303 Ga0075435_100000179
1304 Ga0075435_100054488
1305 Ga0105251_10027499
1306 Ga0111539_10186344
1307 Ga0111539_10190759
1308 Ga0105245_10015407
1309 Ga0105245_10433783
1310 Ga0105247_10006623
1311 Ga0105247_10106351
1312 Ga0114129_10000114
1313 Ga0114129_10006796
1314 Ga0114129_10021079
1315 Ga0114129_10128746
1316 Ga0114129_10169894
1317 Ga0114129_10681924
1318 Ga0105243_10018141
1319 Ga0105243_10173052
1320 Ga0105241_10004674
1321 Ga0105241_10036208
1322 Ga0105242_10258286
1323 Ga0105248_10000147
1324 Ga0105248_10045177
1325 Ga0105237_10060326
1326 Ga0105237_10127652
1327 Ga0105237_10703775
1328 Ga0105238_10007937
1329 Ga0105238_10010755
1330 Ga0105239_10070182
1331 Ga0105246_10072065
1332 Ga0157347_1001020
1333 Ga0157370_10051790
1334 Ga0157369_10002237
1335 Ga0157369_10058286
1336 Ga0157369_10073964
1337 Ga0157369_10122628
1338 Ga0157369_10512748
1339 Ga0157374_10073710
1340 Ga0157378_10181261
1341 Ga0163162_10441959
1342 Ga0163162_10721092
1343 Ga0157372_10191723
1344 Ga0157372_10387649
1345 Ga0157372_10639252
1346 Ga0157375_10013269
1347 Ga0157375_10036863
1348 Ga0157375_10296018
1349 Ga0157375_10543177
1350 Ga0163163_10009454
1351 Ga0163163_10056866
1352 Ga0163163_10074970
1353 Ga0163163_10349925
1354 Ga0163163_10376133
1355 Ga0182008_10006605
1356 Ga0157379_10004275
1357 Ga0157379_10019486
1358 Ga0157376_10227272
1359 Ga0182006_1015903
1360 Ga0182007_10000483
1361 Ga0183367_1001
1362 Ga0163161_10349450
1363 Ga0206354_10776292
1364 Ga0206354_11017713
1365 Ga0213872_10135785
1366 Ga0213874_10005715
1367 Ga0213875_10000917
1368 Ga0213875_10106535
1369 Ga0224712_10087932
1370 Ga0224712_10138368
1371 Ga0209758_1007704
1372 Ga0207426_1000849
1373 Ga0207426_1002327
1374 Ga0207426_1012862
1375 Ga0207426_1021649
1376 Ga0207692_10211366
1377 Ga0207688_10011941
1378 Ga0207647_10002261
1379 Ga0207647_10009502
1380 Ga0207699_10000045
1381 Ga0207699_10016909
1382 Ga0207699_10057723
1383 Ga0207699_10101050
1384 Ga0207645_10200563
1385 Ga0207643_10000027
1386 Ga0207684_10048311
1387 Ga0207684_10073144
1388 Ga0207684_10182251
1389 Ga0207654_10046636
1390 Ga0207707_10072390
1391 Ga0207695_10000679
1392 Ga0207671_10000052
1393 Ga0207693_10044047
1394 Ga0207693_10085433
1395 Ga0207657_10024194
1396 Ga0207657_10214499
1397 Ga0207649_10281023
1398 Ga0207652_10033501
1399 Ga0207652_10198519
1400 Ga0207646_10018631
1401 Ga0207646_10052294
1402 Ga0207646_10173970
1403 Ga0207694_10000079
1404 Ga0207650_10379901
1405 Ga0207659_10000900
1406 Ga0207659_10046499
1407 Ga0207687_10004998
1408 Ga0207687_10014787
1409 Ga0207700_10001094
1410 Ga0207700_10077230
1411 Ga0207700_10289546
1412 Ga0207700_10408527
1413 Ga0207664_10015691
1414 Ga0207690_10035103
1415 Ga0207690_10359613
1416 Ga0207706_10058789
1417 Ga0207706_10090727
1418 Ga0207686_10122039
1419 Ga0207670_10018350
1420 Ga0207669_10240851
1421 Ga0207665_10017388
1422 Ga0207665_10039284
1423 Ga0207691_10062022
1424 Ga0207711_10000056
1425 Ga0207711_10093249
1426 Ga0207711_10440661
1427 Ga0207689_10000694
1428 Ga0207689_10021188
1429 Ga0207661_10007868
1430 Ga0207661_10013863
1431 Ga0207661_10054987
1432 Ga0207661_10105630
1433 Ga0207679_10001380
1434 Ga0207679_10006279
1435 Ga0207679_10521671
1436 Ga0207667_10162082
1437 Ga0207668_10008379
1438 Ga0207668_10081751
1439 Ga0207640_10181546
1440 Ga0207658_10183242
1441 Ga0207677_10002817
1442 Ga0207703_10027365
1443 Ga0207703_10031087
1444 Ga0207703_10257060
1445 Ga0207639_10072740
1446 Ga0207678_10000488
1447 Ga0207678_10003800
1448 Ga0207708_10049841
1449 Ga0207702_10001273
1450 Ga0207702_10001529
1451 Ga0207702_10031656
1452 Ga0207641_10004949
1453 Ga0207641_10048601
1454 Ga0207676_10000549
1455 Ga0207676_10007940
1456 Ga0207676_10122269
1457 Ga0207676_10297645
1458 Ga0207674_10006778
1459 Ga0207674_10018991
1460 Ga0207674_10049188
1461 Ga0207675_100249787
1462 Ga0207683_10001061
1463 Ga0207683_10004644
1464 Ga0207683_10046231
1465 Ga0207683_10499159
1466 Ga0207698_10010709
1467 Ga0207698_10057408
1468 Ga0207428_10083312
1469 Ga0207428_10137930
1470 Ga0268265_10000017
1471 Ga0268265_10121731
1472 Ga0268264_10315938
1473 Ga0307517_10002786
1474 Ga0307515_10000055
1475 Ga0307515_10008569
1476 Ga0307515_10142298
1477 Ga0307511_10001943
1478 Ga0307511_10029818
1479 Ga0316176_1141749
1480 Ga0265776_100008
1481 Ga0265764_100820
1482 Ga0265773_1000473
1483 Ga0265327_10000329
1484 Ga0265327_10027323
1485 Ga0307513_10014342
1486 Ga0307513_10136084
1487 Ga0307513_10339511
1488 Ga0307509_10051822
1489 Ga0307408_100188893
1490 Ga0307508_10003092
1491 Ga0316575_10002683
1492 Ga0316576_10002106
1493 Ga0316576_10251049
1494 Ga0307516_10037213
1495 Ga0307516_10071167
1496 Ga0307516_10076688
1497 Ga0307406_10169044
1498 Ga0307412_10113832
1499 Ga0307409_100098457
1500 Ga0307409_100542132
1501 Ga0307411_10058483
1502 Ga0307415_100009278
1503 Ga0307415_100044916
1504 Ga0307415_100090192
1505 Ga0307415_100310339
1506 Ga0307507_10007023
1507 Ga0307510_10075231
1508 Ga0307510_10172608
1509 Ga0373934_0000067
1510 Ga0373934_0006812
1511 Ga0373934_0010114
1512 Ga0373934_0016221
1513 Ga0373944_0002039
1514 Ga0373944_0016332
1515 Ga0373923_0000852
1516 Ga0373923_0002822
1517 Ga0373923_0032650
1518 Ga0373923_0038968
1519 Ga0373936_0009870
1520 Ga0373936_0031090
1521 Ga0373941_0083581
1522 Ga0373945_0002168
1523 Ga0373953_0065770
1524 Ga0373953_0067502
1525 Ga0373954_0009816
1526 Ga0373956_0000258
1527 Ga0373956_0015501
1528 Ga0373956_0082362
1529 Ga0373957_0000388
1530 Ga0373957_0007302
1531 Ga0373957_0010416
1532 Ga0373957_0010520
1533 Ga0373957_0034218
1534 Ga0373943_0000066
1535 Ga0373943_0089716
1536 Ga0373946_0000019
1537 Ga0373946_0144640
1538 Ga0373955_0000019
1539 Ga0373955_0031714
1540 Ga0316574_0005553
1541 Ga0316574_0117169
1542 Ga0316574_0170936
1543 Ga0373924_0004826
1544 Ga0373924_0033155
1545 Ga0373924_0087759
1546 Ga0373931_0000846
1547 Ga0373931_0106768
1548 Ga0373935_0013238
1549 Ga0373935_0079052
1550 Ga0373927_0009825
1551 Ga0373927_0204465
1552 Ga0373933_0000120
1553 Ga0373933_0003631
1554 Ga0373933_0007380
1555 Ga0373933_0010673
1556 Ga0373933_0061185
1557 Ga0373947_0000197
1558 Ga0373947_0164982
1559 Ga0373937_0000147
1560 Ga0373937_0001943
1561 Ga0373937_0084878
1562 Ga0373937_0089250
1563 Ga0373937_0541126
1564 Ga0265778_000478
1565 Ga0373925_0000869
1566 Ga0373925_0022121
1567 Ga0373925_0089754
1568 Ga0373925_0299305
1569 Ga0395899_0270692
1570 Ga0395900_0053423
1571 Ga0395898_0030129
1572 Ga0395898_0041335
1573 Ga0395898_0086423
1574 Ga0395905_0344806
1575 Ga0436364_0199487
1576 Ga0436364_0332506
1577 Ga0436364_0351592
1578 Ga0436364_0501469
1579 Ga0395901_0005116
1580 Ga0395901_0483000
1581 Ga0400485_08257
1582 Ga0400488_00407
1583 Ga0436361_1211127
1584 Ga0436363_0319333
1585 Ga0436363_0578534
1586 Ga0436362_1109190
1587 Ga0439436_0010941
1588 Ga0451841_0483166
1589 Ga0451853_0512039
1590 Ga0439433_0003699
1591 Ga0439442_007081
1592 Ga0439448_0029424
1593 Ga0439448_0053566
1594 Ga0439449_0005876
1595 Ga0439457_000906
1596 Ga0450894_000084
1597 Ga0450896_003054
1598 Ga0450899_002814
1599 Ga0439460_0032788
1600 Ga0466969_0002252
1601 Ga0466969_0003530
1602 Ga0466969_0005190
1603 Ga0466969_0010323
1604 Ga0466972_0024478
1605 Ga0466972_0024819
1606 Ga0466972_0062248
1607 Ga0466972_0069005
1608 Ga0466965_0004182
1609 Ga0466965_0006273
1610 Ga0466965_0007599
1611 Ga0466966_0002064
1612 Ga0466966_0022938
1613 Ga0466966_0031046
1614 Ga0466966_0041306
1615 Ga0466966_0041941
1616 Ga0466961_0001303
1617 Ga0466961_0006030
1618 Ga0466961_0010306
1619 Ga0466961_0011703
1620 Ga0466961_0029102
1621 Ga0466961_0038583
1622 Ga0466961_0052929
1623 Ga0466963_0001025
1624 Ga0466963_0011650
1625 Ga0466963_0035665
1626 Ga0466963_0052124
1627 Ga0466964_0005930
1628 Ga0466971_0000360
1629 Ga0466971_0001585
1630 Ga0466971_0140520
1631 Ga0466971_0144953
1632 Ga0466970_0006767
1633 Ga0466970_0008296
1634 Ga0466970_0015913
1635 Ga0466970_0068179
1636 Ga0466957_0000665
1637 Ga0466957_0087652
1638 Ga0466957_0114810
1639 Ga0466957_0306276
1640 Ga0466960_0002372
1641 Ga0466960_0003337
1642 Ga0466960_0013645
1643 Ga0466960_0104426
1644 Ga0466959_0001547
1645 Ga0466959_0004284
1646 Ga0466959_0004866
1647 Ga0466959_0030100
1648 Ga0466959_0175124
1649 Ga0466958_0002860
1650 Ga0466958_0004749
1651 Ga0466958_0039394
1652 Ga0466958_0040735
1653 Ga0466967_0001389
1654 Ga0466967_0002745
1655 Ga0466967_0023964
1656 Ga0466967_0077166
1657 Ga0466967_0080319
1658 Ga0466967_0162259
1659 Ga0466967_0191741
1660 Ga0466967_0223884
1661 Ga0466967_0458693
1662 Ga0466967_0526196
1663 Ga0495617_033820
1664 Ga0495592_0000019
1665 Ga0495592_0003593
1666 Ga0495592_0010881
1667 Ga0495592_0089028
1668 Ga0495592_0174068
1669 Ga0495603_0001229
1670 Ga0495603_0002852
1671 Ga0495603_0003655
1672 Ga0495603_0008888
1673 Ga0495603_0092702
1674 Ga0495590_0028363
1675 Ga0495629_0008178
1676 Ga0495629_0023067
1677 Ga0495629_0023084
1678 Ga0495629_0044497
1679 Ga0495629_0111475
1680 Ga0495629_0142163
1681 Ga0495629_0215729
1682 Ga0495638_0002049
1683 Ga0495638_0009798
1684 Ga0495641_0018013
1685 Ga0495641_0020191
1686 Ga0495641_0070130
1687 Ga0495651_0000012
1688 Ga0495651_0002041
1689 Ga0495651_0003580
1690 Ga0495651_0005598
1691 Ga0495651_0007219
1692 Ga0495651_0022043
1693 Ga0495651_0077942
1694 Ga0495651_0199045
1695 Ga0495653_0000497
1696 Ga0495653_0000696
1697 Ga0495653_0012957
1698 Ga0495653_0016927
1699 Ga0495653_0017204
1700 Ga0495653_0037425
1701 Ga0495653_0104562
1702 Ga0495653_0188052
1703 Ga0495653_0212503
1704 Ga0495580_0063633
1705 Ga0495582_0010999
1706 Ga0495582_0058264
1707 Ga0495582_0060350
1708 Ga0495582_0271843
1709 Ga0495605_0016056
1710 Ga0495662_0000796
1711 Ga0495662_0002243
1712 Ga0495662_0007504
1713 Ga0495662_0040960
1714 Ga0495664_0000137
1715 Ga0495664_0000402
1716 Ga0495664_0002832
1717 Ga0495664_0018470
1718 Ga0495664_0033230
1719 Ga0495664_0068246
1720 Ga0495584_0037231
1721 Ga0495585_0082299
1722 Ga0495585_0097627
1723 Ga0495594_0000330
1724 Ga0495594_0097326
1725 Ga0495594_0209223
1726 Ga0495583_0017226
1727 Ga0495606_0002365
1728 Ga0495608_0000048
1729 Ga0495608_0003917
1730 Ga0495608_0005268
1731 Ga0495608_0005881
1732 Ga0495608_0013736
1733 Ga0495608_0027406
1734 Ga0495608_0030091
1735 Ga0495608_0112618
1736 Ga0495608_0157535
1737 Ga0495616_0004907
1738 Ga0495616_0050858
1739 Ga0495618_0007183
1740 Ga0495618_0022588
1741 Ga0495618_0027140
1742 Ga0495618_0044914
1743 Ga0495618_0097562
1744 Ga0495618_0174011
1745 Ga0495628_0000053
1746 Ga0495628_0005859
1747 Ga0495628_0011415
1748 Ga0495628_0078137
1749 Ga0495630_0003361
1750 Ga0495630_0065731
1751 Ga0495630_0212194
1752 Ga0495630_0360225
1753 Ga0495631_0008298
1754 Ga0495632_0112030
1755 Ga0495637_0043071
1756 Ga0495643_0003140
1757 Ga0495666_0002368
1758 Ga0495666_0156408
1759 Ga0495652_0000230
1760 Ga0495652_0000972
1761 Ga0495652_0002018
1762 Ga0495652_0005735
1763 Ga0495652_0022908
1764 Ga0495652_0052783
1765 Ga0495652_0231768
1766 Ga0495665_0016688
1767 Ga0495665_0020854
1768 Ga0495665_0034897
1769 Ga0495665_0057320
1770 Ga0495665_0106404
1771 Ga0495640_0003531
1772 Ga0495640_0011170
1773 Ga0495640_0020000
1774 Ga0495640_0021436
1775 Ga0495586_0041353
1776 Ga0495587_0000027
1777 Ga0495587_0002554
1778 Ga0495587_0009018
1779 Ga0495587_0009578
1780 Ga0495587_0026388
1781 Ga0495587_0046245
1782 Ga0495597_0006920
1783 Ga0495645_0006144
1784 Ga0495645_0009859
1785 Ga0495645_0016194
1786 Ga0495645_0048011
1787 Ga0495645_0247270
1788 Ga0495622_0028552
1789 Ga0495622_0075803
1790 Ga0495633_0009835
1791 Ga0495667_0000089
1792 Ga0495667_0001134
1793 Ga0495667_0006353
1794 Ga0495667_0011246
1795 Ga0495667_0015057
1796 Ga0495667_0028436
1797 Ga0495667_0091129
1798 Ga0495667_0104174
1799 Ga0495667_0233508
1800 Ga0495668_0000169
1801 Ga0495668_0023813
1802 Ga0495634_0000714
1803 Ga0495634_0012007
1804 Ga0495634_0017924
1805 Ga0495634_0056827
1806 Ga0495634_0058665
1807 Ga0495625_0002435
1808 Ga0495625_0004532
1809 Ga0495625_0024976
1810 Ga0495625_0039421
1811 Ga0495635_0001652
1812 Ga0495635_0006862
1813 Ga0495635_0015459
1814 Ga0495635_0018259
1815 Ga0495635_0022932
1816 Ga0495635_0111505
1817 Ga0495588_0107471
1818 Ga0495657_0000025
1819 Ga0495657_0000195
1820 Ga0495657_0009221
1821 Ga0495657_0012336
1822 Ga0495657_0023829
1823 Ga0495657_0028696
1824 Ga0495657_0059351
1825 Ga0495657_0075125
1826 Ga0495657_0085116
1827 Ga0495657_0194788
1828 Ga0495657_0251959
1829 Ga0495599_0000026
1830 Ga0495599_0001894
1831 Ga0495599_0006909
1832 Ga0495599_0007812
1833 Ga0495599_0099820
1834 Ga0495623_0045566
1835 Ga0495623_0140167
1836 Ga0495646_0000700
1837 Ga0495646_0010700
1838 Ga0495658_0008090
1839 Ga0495658_0038714
1840 Ga0495658_0113522
1841 Ga0495613_0000717
1842 Ga0495613_0002765
1843 Ga0495613_0012604
1844 Ga0495613_0027176
1845 Ga0495613_0148445
1846 Ga0495613_0246591
1847 Ga0495624_0003962
1848 Ga0495624_0060720
1849 Ga0495624_0077953
1850 Ga0495624_0114796
1851 Ga0495649_0075682
1852 Ga0495589_0010321
1853 Ga0495589_0025928
1854 Ga0495600_0009348
1855 Ga0495600_0013905
1856 Ga0495600_0014301
1857 Ga0495600_0020695
1858 Ga0495600_0037550
1859 Ga0495600_0045893
1860 Ga0495600_0111210
1861 Ga0495581_0010738
1862 Ga0495581_0013027
1863 Ga0495581_0094286
1864 Ga0495581_0254428
1865 Ga0495604_0000029
1866 Ga0495604_0000534
1867 Ga0495604_0000925
1868 Ga0495604_0001249
1869 Ga0495604_0003276
1870 Ga0495604_0030620
1871 Ga0495604_0074499
1872 Ga0495604_0203796
1873 Ga0495636_0000712
1874 Ga0495636_0028497
1875 Ga0495636_0106307
1876 Ga0495674_0000418
1877 Ga0495674_0009916
1878 Ga0495674_0011013
1879 Ga0495674_0059230
1880 Ga0495674_0190548
1881 Ga0495674_0385812
1882 Ga0495674_0407650
1883 Ga0495674_0521689
1884 Ga0495676_0002965
1885 Ga0495676_0004077
1886 Ga0495676_0006734
1887 Ga0495676_0036843
1888 Ga0495676_0040254
1889 Ga0495676_0048957
1890 Ga0495676_0095649
1891 Ga0495680_0000011
1892 Ga0495680_0001927
1893 Ga0495680_0007791
1894 Ga0495680_0028397
1895 Ga0495680_0035864
1896 Ga0495680_0065117
1897 Ga0495683_0052979
1898 Ga0495687_000608
1899 Ga0495687_088642
1900 Ga0495675_0000433
1901 Ga0495675_0011016
1902 Ga0495675_0017354
1903 Ga0495675_0044058
1904 Ga0495675_0230257
1905 Ga0495685_008511
1906 Ga0495685_019259
1907 Ga0495673_0010530
1908 Ga0495681_0008184
1909 Ga0495684_0002379
1910 Ga0495684_0009203
1911 Ga0495684_0009423
1912 Ga0495684_0033942
1913 Ga0495684_0040950
1914 Ga0495684_0053280
1915 Ga0495593_0000887
1916 Ga0495593_0010699
1917 Ga0495593_0029343
1918 Ga0495593_0044705
1919 Ga0495593_0055596
1920 Ga0495593_0219178
1921 Ga0495602_0000033
1922 Ga0495602_0008923
1923 Ga0495602_0025991
1924 Ga0495602_0034110
1925 Ga0495602_0041711
1926 Ga0495602_0082865
1927 Ga0495602_0117582
1928 Ga0495602_0218171
1929 Ga0495614_0000867
1930 Ga0495614_0040522
1931 Ga0495626_0000312
1932 Ga0496100_0002392
1933 Ga0496100_0028480
1934 Ga0496100_0281981
1935 Ga0496101_0023626
1936 Ga0496101_0067450
1937 Ga0496101_0098842
1938 Ga0496101_0331134
1939 Ga0496102_0000015
1940 Ga0496102_0028001
1941 Ga0496102_0184126
1942 Ga0496102_0239042
1943 Ga0496102_0494401
1944 Ga0496102_0544360
1945 Ga0496103_0000020
1946 Ga0496103_0031363
1947 Ga0496103_0061889
1948 Ga0496104_0002885
1949 Ga0496104_0049412
1950 Ga0496104_0062899
1951 Ga0496104_0090847
1952 Ga0496104_0285433
1953 Ga0496104_0342867
1954 Ga0496104_0409830
1955 Ga0496104_0432867
1956 Ga0496105_0005328
1957 Ga0496105_0021995
1958 Ga0496105_0066508
1959 Ga0496105_0192074
1960 Ga0496105_0481919
1961 Ga0496106_0004227
1962 Ga0496106_0039541
1963 Ga0496107_0169257
1964 Ga0496107_0217732
1965 Ga0496108_0001463
1966 Ga0496108_0009686
1967 Ga0496108_0056412
1968 Ga0496108_0108130
1969 Ga0496108_0438640
1970 Ga0496108_0446658
1971 Ga0496109_0012459
1972 Ga0496109_0054926
1973 Ga0496109_0067956
1974 Ga0496109_0164494
1975 Ga0496109_0324019
1976 Ga0496109_0324479
1977 Ga0496109_0468173
1978 Ga0496110_0007465
1979 Ga0496110_0093651
1980 Ga0496110_0316402
1981 Ga0496110_0354310
1982 Ga0496111_0003426
1983 Ga0496111_0010528
1984 Ga0496111_0040256
1985 Ga0496111_0302517
1986 Ga0496112_0002097
1987 Ga0496112_0007119
1988 Ga0496112_0011019
1989 Ga0496112_0036248
1990 Ga0496112_0038349
1991 Ga0496112_0273936
1992 Ga0496113_0014747
1993 Ga0496113_0078815
1994 Ga0496113_0083138
1995 Ga0496113_0130374
1996 Ga0496113_0170885
1997 Ga0496113_0320833
1998 Ga0496113_0326298
1999 Ga0496113_0397313
2000 Ga0496113_0407706
2001 Ga0496114_0004897
2002 Ga0496114_0073236
2003 Ga0496114_0094297
2004 Ga0496115_0028213
2005 Ga0496116_0000178
2006 Ga0496116_0000578
2007 Ga0496117_0000047
2008 Ga0496117_0021310
2009 Ga0496117_0028936
2010 Ga0496118_0000050
2011 Ga0496118_0002249
2012 Ga0496118_0012121
2013 Ga0496119_0001789
2014 Ga0496121_0000537
2015 Ga0496121_0003059
2016 Ga0496126_0000049
2017 Ga0496126_0000208
2018 Ga0496126_0132085
2019 Ga0495682_0076482
2020 Ga0501031_0006054
2021 Ga0501031_0020167
2022 Ga0501032_0062566
2023 Ga0501033_0002605
2024 Ga0501033_0009265
2025 Ga0501034_0022734
2026 Ga0501034_0025515
2027 Ga0501034_0046104
2028 Ga0501034_0218602
2029 Ga0501036_0004252
2030 Ga0501036_0041897
2031 Ga0501036_0051220
2032 Ga0501036_0158391
2033 Ga0501037_0011090
2034 Ga0501037_0031773
2035 Ga0501037_0048042
2036 Ga0501038_0002308
2037 Ga0501038_0056214
2038 Ga0501038_0109434
2039 Ga0501043_0006999
2040 Ga0501043_0117350
2041 Ga0501046_0006667
2042 Ga0501046_0025038
2043 Ga0501046_0072421
2044 Ga0501047_0021299
2045 Ga0501047_0040398
2046 Ga0501048_0009146
2047 Ga0501048_0130490
2048 Ga0501048_0190629
2049 Ga0501070_0006172
2050 Ga0501070_0025187
2051 Ga0501071_0199153
2052 Ga0501074_0011988
2053 Ga0501080_0029005
2054 Ga0501080_0133479
2055 Ga0501035_0137464
2056 Ga0501044_0000295
2057 Ga0501044_0015121
2058 Ga0501044_0182718
2059 nmdc:mga03n38_179837_c1
2060 nmdc:mga03n38_88896_c1
2061 nmdc:mga00v17_64444_c1
2062 nmdc:mga06z11_13052_c1
2063 nmdc:mga06z11_3612_c1
2064 nmdc:mga05p37_115575_c1
2065 nmdc:mga05p37_12425_c1
2066 nmdc:mga05p37_136264_c1
2067 nmdc:mga05p37_16765_c1
2068 nmdc:mga05p37_194570_c1
2069 nmdc:mga09592_345008_c1
2070 nmdc:mga09592_3971_c1
2071 nmdc:mga0qj67_135935_c1
2072 nmdc:mga0qj67_18776_c1
2073 nmdc:mga0qj67_33491_c1
2074 nmdc:mga0qj67_4927_c1
2075 nmdc:mga06r32_25_c7
2076 nmdc:mga06r32_5649_c1
2077 nmdc:mga06r32_9570_c1
2078 nmdc:mga08y16_20936_c1
2079 nmdc:mga08y16_39719_c1
2080 nmdc:mga0rr50_2888_c1
2081 nmdc:mga08x19_111186_c1
2082 nmdc:mga08x19_40499_c1
2083 nmdc:mga0a205_229823_c1
2084 nmdc:mga0a205_272376_c1
2085 nmdc:mga0a205_394690_c1
2086 nmdc:mga0sz30_43096_c1
2087 Ga0495601_0014240
2088 Ga0495601_0029692
2089 Ga0495601_0094699
2090 Ga0495601_0126424
2091 Ga0495612_0011203
2092 Ga0495612_0094570
2093 Ga0500610_0001046
2094 Ga0495595_0005426
2095 Ga0495595_0006450
2096 Ga0495595_0131474
2097 Ga0495619_0019537
2098 Ga0495619_0028622
2099 Ga0495619_0031353
2100 Ga0495619_0042612
2101 Ga0495619_0172223
2102 Ga0495619_0174895
2103 Ga0500643_041856
2104 Ga0500644_0025657
2105 Ga0500646_0000211
2106 Ga0500583_0023020
2107 Ga0500651_0176919
2108 Ga0500556_0001025
2109 Ga0500562_025807
2110 Ga0500608_071255
2111 Ga0500652_000353
2112 Ga0500652_081031
2113 Ga0500561_0050482
2114 Ga0500568_0004813
2115 Ga0500645_000016
2116 Ga0501084_0269990
2117 Ga0587073_0010886
2118 Ga0466962_0001673
2119 Ga0466962_0046521
2120 Ga0466962_0175076
2121 3006427120
2122 2501941838
2123 2508672363
2124 2515493927
2125 2515720613
2126 2515755303
2127 2516086763
2128 2516092349
2129 2517760698
2130 2547410287
2131 2554260713
2132 2585298140
2133 2585304637
2134 2585314746
2135 2585320742
2136 2616698179
2137 2616901487
2138 2619856603
2139 2620348831
2140 2623502296
2141 2623586429
2142 2643762049
2143 2643901989
2144 2643946239
2145 2644017983
2146 2644180729
2147 2644261972
2148 2644388009
2149 2644408133
2150 2644433028
2151 2644442826
2152 2644445919
2153 2644460524
2154 2644631319
2155 2676198228
2156 2686537434
2157 2689959502
2158 2738704581
2159 2739330936
2160 2753073310
2161 2768645653
2162 2772641666
2163 2774842806
2164 2784591631
2165 2785340102
2166 2785372635
2167 2786675348
2168 2793983360
2169 2804848905
2170 2808844990
2171 2808914589
2172 2809235262
2173 2811843532
2174 2812354698
2175 2812477667
2176 2819698790
2177 2819740052
2178 2831939901
2179 2852636318
2180 2855672222
2181 2855678861
2182 2855685287
2183 2856860347
2184 2857295166
2185 2858854529
2186 2858874080
2187 2858888531
2188 2858890763
2189 2858898549
2190 2858905637
2191 2861520752
2192 2862183994
2193 2862283411
2194 2862294886
2195 2862390353
2196 2862507768
2197 2862576440
2198 2862708960
2199 2863409865
2200 2867303801
2201 2867313361
2202 2867322820
2203 2867350709
2204 2867374650
2205 2867432042
2206 2867475208
2207 2869054196
2208 2869065818
2209 2869070630
2210 2870729135
2211 2873152939
2212 2873316937
2213 2875397702
2214 2877678080
2215 2880493752
2216 2880498570
2217 2887483702
2218 2895882362
2219 2902586400
2220 2912716319
2221 2912729231
2222 2912763904
2223 2915363200
2224 2918507480
2225 2919471213
2226 2929220562
2227 2929227149
2228 2935395381
2229 2946046823
2230 2946070965
2231 2946078896
2232 2947225758
2233 2954009929
2234 2954382865
2235 2954680025
2236 2954684125
2237 2954693686
2238 2954708782
2239 2954713332
2240 2954723292
2241 2954738536
2242 2954742199
2243 2954757394
2244 2954761177
2245 2966599832
2246 2990049080
2247 2990061816
2248 2990090597
2249 2995464977
2250 2996224790
2251 2997603497
2252 3006393739
2253 3006488800
2254 3006494213
2255 649811086
2256 8001782516
2257 8002782595
2258 8002789206
2259 8003835340
2260 8003859362
2261 8003873527
2262 8008489881
2263 8008563958
2264 8008576105
2265 8025417518
2266 8025479388
2267 8025529387
2268 8025533058
2269 8033687519
2270 8047715083
2271 8047895314
2272 8048130607
2273 8048363639
2274 8048372340
2275 8048381274
2276 8048407049
2277 8054161891
2278 8054472266
2279 8054708083
2280 8054730994
2281 8054735125
2282 8054922261
2283 8055177335
2284 8055414779
2285 8056448711
2286 8056667265
2287 8056837022
2288 8057568881

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

48

278

0.93

PF22484

DUF6986

Domain of unknown function (DUF6986)

119

350

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l9y-assembly1.cif.gz_B crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa 0.9685 6 253
3qll-assembly1.cif.gz_A crystal structure of ripc from yersinia pestis 0.9243 4 254
4l9z-assembly1.cif.gz_A crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, oxalate, and coa 0.9207 7 305
6kkh-assembly1.cif.gz_A crystal structure of the oxalate bound malyl-coa lyase from roseiflexus castenholzii 0.9075 6 306
4l9y-assembly1.cif.gz_B crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa 0.9071 6 253
ID Description Score Start End Superfamily
4l9yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9685 6 253 3.20.20.60
af_P0A9I1_3_299_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9384 3 309 3.20.20.60
af_P0A9I1_3_299_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9202 3 309 3.20.20.60
4l9yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9071 6 253 3.20.20.60
3qllC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9009 4 254 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A2P6FXQ0-F1-model_v4 CoA ester lyase 0.9993 23 240 GO:0000287
GO:0006107
GO:0016829
AF-A0A6B3I1H3-F1-model_v4 CoA ester lyase 0.9967 19 103 GO:0000287
GO:0006107
GO:0016829
AF-D3D852-F1-model_v4 HpcH/HpaI aldolase 0.9966 6 144 GO:0000287
GO:0003824
GO:0006107
AF-A0A6V8K9F4-F1-model_v4 HpcH/HpaI aldolase/citrate lyase domain-containing protein 0.9947 102 320 GO:0000287
GO:0003824
GO:0006107
AF-A0A7K0PZM1-F1-model_v4 CoA ester lyase 0.9929 61 320 GO:0000287
GO:0006107
GO:0016829

Map