F490763
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1144 | 565 | 2288 | 317 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|3006425503|3006427120 |
| Length | 357 |
| Sequence | APVPSASSASSASSSSSPASPSSPSPSAPAPSPGTGAGAGAHRLRPRRSCLAVPGSNPRFLEKAQGLPADQVFLDLEDACAPLAKEGARHTIVDALNQGDWSGKTRVVRVNDWTTHWTYRDVVTVVEGAGANLDCVMLPKVQSAEQVVALDLLLTQIEKTMGFEVGRIGIEAQIENAAGLVAVDAIAAASPRLETIVFGPADFMASINMKSLVVGRQPPGYPADAYHYILMRILMAARTHDVQAIDGPFLQIRDVDAFREVAGRSAALGFDGKWVLHPGQIEAANEIYSPAQEDYDHAEMILDAYAWCTSEAGGAKGSAMLGDEMIDEASRKMALVVAGKGRAAGMTRTTSFTPPEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 117 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 118 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 119 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 175 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 176 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 177 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 178 | 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 182 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 183 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 184 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 185 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 186 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 187 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 188 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 189 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 192 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 193 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 194 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 195 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 196 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 210 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 222 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 223 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 226 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 227 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 230 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 231 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 232 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 233 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 234 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 235 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 236 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 237 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 238 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 239 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 240 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 241 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 242 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 243 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 244 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 245 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 246 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 247 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 248 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 249 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 250 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 251 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 252 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 253 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 254 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 330 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 331 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 332 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 333 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 334 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 335 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 338 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 339 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 340 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 341 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 342 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 343 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 344 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 345 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 346 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 347 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 348 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 349 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 370 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 379 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 382 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 385 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 386 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 387 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 388 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 389 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 390 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 391 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 392 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 393 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 394 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 395 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 396 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 399 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 400 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 401 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 402 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 403 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 404 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 405 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 406 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 407 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 408 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 409 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 410 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 411 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 412 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 413 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 414 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 415 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 416 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 417 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 418 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 419 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 420 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 421 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 422 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 423 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 424 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 425 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 426 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 427 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 428 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 429 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 430 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 431 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 432 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 433 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 434 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 435 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 436 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 437 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 438 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 439 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 440 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 441 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 442 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 443 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 444 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 445 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 446 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 447 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 448 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 449 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 450 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 451 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 452 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 453 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 454 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 455 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 456 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 457 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 458 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 459 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 460 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 461 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 462 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 463 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 464 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 465 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 466 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 467 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 468 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 469 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 470 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 471 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 472 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 473 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 474 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 475 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 476 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 477 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 478 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 479 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 480 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 481 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 482 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 483 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 484 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 485 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 486 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 487 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 488 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 489 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 490 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 491 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 492 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 493 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 494 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 495 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 496 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 497 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 498 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 499 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 500 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 501 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 502 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 503 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 504 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 505 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 506 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 507 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 508 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 509 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 510 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 511 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 512 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 513 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 514 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 515 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 516 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 517 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 518 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 519 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 520 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 521 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 522 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 523 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 524 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 525 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 526 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 527 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 528 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 529 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 530 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 531 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 532 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 533 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 534 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 535 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 536 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 537 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 538 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 539 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 540 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 541 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 542 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 543 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 544 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 545 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 546 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 547 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 548 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 549 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 550 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 551 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 552 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 553 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 554 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 555 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 556 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 557 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 558 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 559 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 560 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 561 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 562 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 563 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 564 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
| 565 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.53 |
| Metatranscriptomes | 0.79 |
| Isolates | 14.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.06 |
| Nodule | 1.57 |
| Rhizoplane | 6.47 |
| Rhizosphere | 78.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10031249 | 3300001979 | Bacteria | 1720 |
| 2 | JGI24739J22299_10014962 | 3300001989 | Bacteria | 2821 |
| 3 | JGI24737J22298_10003773 | 3300001990 | Bacteria | 5333 |
| 4 | JGI24735J21928_10006190 | 3300002067 | Bacteria | 3950 |
| 5 | JGI25406J46586_10052624 | 3300003203 | Bacteria | 1356 |
| 6 | Ga0070658_10046686 | 3300005327 | Bacteria | 3504 |
| 7 | Ga0070658_10079963 | 3300005327 | Bacteria | 2684 |
| 8 | Ga0070658_10182182 | 3300005327 | Bacteria | 1768 |
| 9 | Ga0070683_100051410 | 3300005329 | Bacteria | 3816 |
| 10 | Ga0070683_100086529 | 3300005329 | Bacteria | 2938 |
| 11 | Ga0070683_100136449 | 3300005329 | Bacteria | 2323 |
| 12 | Ga0068869_100098240 | 3300005334 | Bacteria | 2211 |
| 13 | Ga0070666_10058747 | 3300005335 | Bacteria | 2601 |
| 14 | Ga0070682_100049397 | 3300005337 | Bacteria | 2622 |
| 15 | Ga0068868_100015603 | 3300005338 | Bacteria | 5624 |
| 16 | Ga0070689_100023274 | 3300005340 | Bacteria | 4636 |
| 17 | Ga0070661_100019223 | 3300005344 | Bacteria | 4866 |
| 18 | Ga0070692_10029693 | 3300005345 | Bacteria | 2727 |
| 19 | Ga0070668_100024409 | 3300005347 | Bacteria | 4581 |
| 20 | Ga0070668_100150113 | 3300005347 | Bacteria | 1884 |
| 21 | Ga0070669_100261871 | 3300005353 | Bacteria | 1380 |
| 22 | Ga0070675_100015301 | 3300005354 | Bacteria | 6062 |
| 23 | Ga0070671_100000423 | 3300005355 | Bacteria | 29409 |
| 24 | Ga0070671_100027777 | 3300005355 | Bacteria | 4659 |
| 25 | Ga0070671_100033282 | 3300005355 | Bacteria | 4261 |
| 26 | Ga0070674_100107123 | 3300005356 | Bacteria | 2046 |
| 27 | Ga0070674_100187149 | 3300005356 | Bacteria | 1590 |
| 28 | Ga0070673_100073041 | 3300005364 | Bacteria | 2760 |
| 29 | Ga0070659_100015592 | 3300005366 | Bacteria | 5692 |
| 30 | Ga0070667_100000107 | 3300005367 | Bacteria | 105338 |
| 31 | Ga0070709_10000214 | 3300005434 | Bacteria | 37458 |
| 32 | Ga0070709_10011998 | 3300005434 | Bacteria | 4844 |
| 33 | Ga0070709_10020061 | 3300005434 | Bacteria | 3874 |
| 34 | Ga0070709_10155492 | 3300005434 | Bacteria | 1585 |
| 35 | Ga0070714_100000057 | 3300005435 | Bacteria | 103150 |
| 36 | Ga0070714_100004897 | 3300005435 | Bacteria | 10167 |
| 37 | Ga0070714_100011815 | 3300005435 | Bacteria | 6940 |
| 38 | Ga0070714_100069853 | 3300005435 | Bacteria | 3034 |
| 39 | Ga0070714_100101756 | 3300005435 | Bacteria | 2532 |
| 40 | Ga0070714_100602084 | 3300005435 | Bacteria | 1055 |
| 41 | Ga0070713_100008107 | 3300005436 | Bacteria | 7430 |
| 42 | Ga0070713_100060309 | 3300005436 | Bacteria | 3171 |
| 43 | Ga0070713_100075005 | 3300005436 | Bacteria | 2868 |
| 44 | Ga0070713_100075215 | 3300005436 | Bacteria | 2864 |
| 45 | Ga0070710_10000110 | 3300005437 | Bacteria | 38306 |
| 46 | Ga0070710_10028434 | 3300005437 | Bacteria | 2991 |
| 47 | Ga0070710_10217422 | 3300005437 | Bacteria | 1214 |
| 48 | Ga0070711_100015408 | 3300005439 | Bacteria | 4839 |
| 49 | Ga0070711_100103921 | 3300005439 | Bacteria | 2071 |
| 50 | Ga0070705_100014490 | 3300005440 | Bacteria | 4058 |
| 51 | Ga0070700_100088204 | 3300005441 | Bacteria | 2019 |
| 52 | Ga0070708_100058281 | 3300005445 | Bacteria | 3440 |
| 53 | Ga0070708_100330443 | 3300005445 | Bacteria | 1436 |
| 54 | Ga0070663_100022237 | 3300005455 | Bacteria | 4236 |
| 55 | Ga0070678_100001811 | 3300005456 | Bacteria | 11520 |
| 56 | Ga0070681_10021940 | 3300005458 | Bacteria | 6406 |
| 57 | Ga0070681_10236863 | 3300005458 | Bacteria | 1739 |
| 58 | Ga0070685_10080411 | 3300005466 | Bacteria | 1953 |
| 59 | Ga0070685_10174963 | 3300005466 | Bacteria | 1378 |
| 60 | Ga0070706_100026494 | 3300005467 | Bacteria | 5333 |
| 61 | Ga0070707_100059415 | 3300005468 | Bacteria | 3668 |
| 62 | Ga0070707_100143892 | 3300005468 | Bacteria | 2320 |
| 63 | Ga0070698_100099365 | 3300005471 | Bacteria | 2883 |
| 64 | Ga0070699_100000384 | 3300005518 | Bacteria | 42993 |
| 65 | Ga0070679_100023224 | 3300005530 | Bacteria | 6069 |
| 66 | Ga0070684_100010145 | 3300005535 | Bacteria | 7448 |
| 67 | Ga0070684_100021126 | 3300005535 | Bacteria | 5410 |
| 68 | Ga0070697_100184277 | 3300005536 | Bacteria | 1770 |
| 69 | Ga0068853_100220319 | 3300005539 | Bacteria | 1733 |
| 70 | Ga0070686_100141588 | 3300005544 | Bacteria | 1675 |
| 71 | Ga0070696_100005128 | 3300005546 | Bacteria | 8752 |
| 72 | Ga0070665_100015231 | 3300005548 | Bacteria | 7720 |
| 73 | Ga0070665_100053585 | 3300005548 | Bacteria | 4046 |
| 74 | Ga0070665_100055726 | 3300005548 | Bacteria | 3965 |
| 75 | Ga0070665_100398968 | 3300005548 | Bacteria | 1383 |
| 76 | Ga0070704_100071102 | 3300005549 | Bacteria | 2527 |
| 77 | Ga0070704_100388678 | 3300005549 | Bacteria | 1187 |
| 78 | Ga0068855_100141925 | 3300005563 | Bacteria | 2737 |
| 79 | Ga0068855_100173016 | 3300005563 | Bacteria | 2445 |
| 80 | Ga0070664_100092976 | 3300005564 | Bacteria | 2612 |
| 81 | Ga0070664_100533815 | 3300005564 | Bacteria | 1084 |
| 82 | Ga0068857_100035113 | 3300005577 | Bacteria | 4438 |
| 83 | Ga0068854_100006340 | 3300005578 | Bacteria | 7523 |
| 84 | Ga0068854_100016608 | 3300005578 | Bacteria | 4911 |
| 85 | Ga0068854_100190747 | 3300005578 | Bacteria | 1606 |
| 86 | Ga0068856_100030994 | 3300005614 | Bacteria | 5230 |
| 87 | Ga0068856_100091705 | 3300005614 | Bacteria | 3022 |
| 88 | Ga0068856_100164550 | 3300005614 | Bacteria | 2229 |
| 89 | Ga0068856_100166502 | 3300005614 | Bacteria | 2215 |
| 90 | Ga0068856_100191478 | 3300005614 | Bacteria | 2059 |
| 91 | Ga0068856_100300290 | 3300005614 | Bacteria | 1623 |
| 92 | Ga0070702_100001124 | 3300005615 | Bacteria | 10736 |
| 93 | Ga0070702_100007054 | 3300005615 | Bacteria | 5360 |
| 94 | Ga0068852_100003907 | 3300005616 | Bacteria | 10471 |
| 95 | Ga0068852_100013889 | 3300005616 | Bacteria | 6176 |
| 96 | Ga0068859_100000301 | 3300005617 | Bacteria | 49173 |
| 97 | Ga0068859_100018104 | 3300005617 | Bacteria | 7081 |
| 98 | Ga0068859_100724964 | 3300005617 | Bacteria | 1084 |
| 99 | Ga0068864_100001934 | 3300005618 | Bacteria | 17015 |
| 100 | Ga0068864_100028442 | 3300005618 | Bacteria | 4725 |
| 101 | Ga0068851_10019796 | 3300005834 | Bacteria | 3252 |
| 102 | Ga0068870_10000378 | 3300005840 | Bacteria | 16740 |
| 103 | Ga0068863_100000163 | 3300005841 | Bacteria | 71286 |
| 104 | Ga0068863_100001505 | 3300005841 | Bacteria | 23071 |
| 105 | Ga0068863_100042732 | 3300005841 | Bacteria | 4306 |
| 106 | Ga0068863_100044881 | 3300005841 | Bacteria | 4194 |
| 107 | Ga0068863_100339283 | 3300005841 | Bacteria | 1462 |
| 108 | Ga0068858_100000071 | 3300005842 | Bacteria | 105192 |
| 109 | Ga0068858_100009793 | 3300005842 | Bacteria | 9122 |
| 110 | Ga0068858_100055569 | 3300005842 | Bacteria | 3659 |
| 111 | Ga0068860_100072600 | 3300005843 | Bacteria | 3270 |
| 112 | Ga0068862_100000049 | 3300005844 | Bacteria | 149792 |
| 113 | Ga0068862_100155262 | 3300005844 | Bacteria | 2040 |
| 114 | Ga0081455_10000436 | 3300005937 | Bacteria | 54915 |
| 115 | Ga0081455_10012252 | 3300005937 | Bacteria | 8559 |
| 116 | Ga0081455_10046773 | 3300005937 | Bacteria | 3751 |
| 117 | Ga0081455_10130375 | 3300005937 | Bacteria | 1967 |
| 118 | Ga0081538_10000120 | 3300005981 | Bacteria | 79021 |
| 119 | Ga0081538_10027673 | 3300005981 | Bacteria | 3922 |
| 120 | Ga0081540_1049020 | 3300005983 | Bacteria | 2110 |
| 121 | Ga0081539_10000094 | 3300005985 | Bacteria | 206102 |
| 122 | Ga0070717_10006278 | 3300006028 | Bacteria | 8729 |
| 123 | Ga0070717_10060107 | 3300006028 | Bacteria | 3146 |
| 124 | Ga0075368_10011215 | 3300006042 | Bacteria | 3257 |
| 125 | Ga0075363_100057075 | 3300006048 | Bacteria | 2094 |
| 126 | Ga0075363_100221265 | 3300006048 | Bacteria | 1085 |
| 127 | Ga0075364_10041167 | 3300006051 | Bacteria | 2999 |
| 128 | Ga0070716_100024466 | 3300006173 | Bacteria | 3214 |
| 129 | Ga0070712_100077576 | 3300006175 | Bacteria | 2395 |
| 130 | Ga0075362_10075251 | 3300006177 | Bacteria | 1548 |
| 131 | Ga0075367_10024053 | 3300006178 | Bacteria | 3433 |
| 132 | Ga0075369_10004469 | 3300006186 | Bacteria | 5169 |
| 133 | Ga0075369_10037118 | 3300006186 | Bacteria | 2075 |
| 134 | Ga0075369_10048349 | 3300006186 | Bacteria | 1835 |
| 135 | Ga0097621_100018176 | 3300006237 | Bacteria | 5363 |
| 136 | Ga0097621_100047019 | 3300006237 | Bacteria | 3494 |
| 137 | Ga0075370_10024496 | 3300006353 | Bacteria | 3335 |
| 138 | Ga0075428_100001540 | 3300006844 | Bacteria | 24687 |
| 139 | Ga0075428_100007363 | 3300006844 | Bacteria | 12199 |
| 140 | Ga0075428_100107885 | 3300006844 | Bacteria | 3034 |
| 141 | Ga0075430_100004383 | 3300006846 | Bacteria | 11913 |
| 142 | Ga0075430_100032198 | 3300006846 | Bacteria | 4451 |
| 143 | Ga0075430_100113458 | 3300006846 | Bacteria | 2259 |
| 144 | Ga0075431_100001429 | 3300006847 | Bacteria | 21961 |
| 145 | Ga0075431_100014993 | 3300006847 | Bacteria | 7846 |
| 146 | Ga0075431_100058914 | 3300006847 | Bacteria | 3963 |
| 147 | Ga0075431_100085491 | 3300006847 | Bacteria | 3256 |
| 148 | Ga0075433_10234417 | 3300006852 | Bacteria | 1629 |
| 149 | Ga0075433_10246032 | 3300006852 | Bacteria | 1587 |
| 150 | Ga0075434_100016866 | 3300006871 | Bacteria | 7026 |
| 151 | Ga0075429_100002452 | 3300006880 | Bacteria | 15614 |
| 152 | Ga0075429_100016645 | 3300006880 | Bacteria | 6368 |
| 153 | Ga0075436_100060147 | 3300006914 | Bacteria | 2624 |
| 154 | Ga0075436_100062018 | 3300006914 | Bacteria | 2584 |
| 155 | Ga0097620_100000301 | 3300006931 | Bacteria | 49173 |
| 156 | Ga0097620_100003956 | 3300006931 | Bacteria | 15123 |
| 157 | Ga0097620_100018103 | 3300006931 | Bacteria | 7081 |
| 158 | Ga0097620_100725047 | 3300006931 | Bacteria | 1084 |
| 159 | Ga0075435_100000179 | 3300007076 | Bacteria | 37419 |
| 160 | Ga0075435_100054488 | 3300007076 | Bacteria | 3227 |
| 161 | Ga0105251_10027499 | 3300009011 | Bacteria | 2883 |
| 162 | Ga0111539_10186344 | 3300009094 | Bacteria | 2423 |
| 163 | Ga0111539_10190759 | 3300009094 | Bacteria | 2391 |
| 164 | Ga0105245_10015407 | 3300009098 | Bacteria | 6665 |
| 165 | Ga0105245_10433783 | 3300009098 | Bacteria | 1319 |
| 166 | Ga0105247_10006623 | 3300009101 | Bacteria | 7158 |
| 167 | Ga0105247_10106351 | 3300009101 | Bacteria | 1800 |
| 168 | Ga0114129_10000114 | 3300009147 | Bacteria | 80730 |
| 169 | Ga0114129_10006796 | 3300009147 | Bacteria | 16240 |
| 170 | Ga0114129_10021079 | 3300009147 | Bacteria | 9254 |
| 171 | Ga0114129_10128746 | 3300009147 | Bacteria | 3479 |
| 172 | Ga0114129_10169894 | 3300009147 | Bacteria | 2973 |
| 173 | Ga0114129_10681924 | 3300009147 | Bacteria | 1323 |
| 174 | Ga0105243_10018141 | 3300009148 | Bacteria | 5326 |
| 175 | Ga0105243_10173052 | 3300009148 | Bacteria | 1872 |
| 176 | Ga0105241_10004674 | 3300009174 | Bacteria | 10118 |
| 177 | Ga0105241_10036208 | 3300009174 | Bacteria | 3713 |
| 178 | Ga0105242_10258286 | 3300009176 | Bacteria | 1573 |
| 179 | Ga0105248_10000147 | 3300009177 | Bacteria | 81699 |
| 180 | Ga0105248_10045177 | 3300009177 | Bacteria | 4940 |
| 181 | Ga0105237_10060326 | 3300009545 | Bacteria | 3795 |
| 182 | Ga0105237_10127652 | 3300009545 | Bacteria | 2537 |
| 183 | Ga0105237_10703775 | 3300009545 | Bacteria | 1017 |
| 184 | Ga0105238_10007937 | 3300009551 | Bacteria | 10618 |
| 185 | Ga0105238_10010755 | 3300009551 | Bacteria | 9192 |
| 186 | Ga0105239_10070182 | 3300010375 | Bacteria | 3848 |
| 187 | Ga0105246_10072065 | 3300011119 | Bacteria | 2435 |
| 188 | Ga0157347_1001020 | 3300012502 | Bacteria | 2069 |
| 189 | Ga0157370_10051790 | 3300013104 | Bacteria | 3920 |
| 190 | Ga0157369_10002237 | 3300013105 | Bacteria | 23285 |
| 191 | Ga0157369_10058286 | 3300013105 | Bacteria | 4166 |
| 192 | Ga0157369_10073964 | 3300013105 | Bacteria | 3655 |
| 193 | Ga0157369_10122628 | 3300013105 | Bacteria | 2757 |
| 194 | Ga0157369_10512748 | 3300013105 | Bacteria | 1241 |
| 195 | Ga0157374_10073710 | 3300013296 | Bacteria | 3222 |
| 196 | Ga0157378_10181261 | 3300013297 | Bacteria | 1981 |
| 197 | Ga0163162_10441959 | 3300013306 | Bacteria | 1433 |
| 198 | Ga0163162_10721092 | 3300013306 | Bacteria | 1118 |
| 199 | Ga0157372_10191723 | 3300013307 | Bacteria | 2367 |
| 200 | Ga0157372_10387649 | 3300013307 | Bacteria | 1628 |
| 201 | Ga0157372_10639252 | 3300013307 | Bacteria | 1239 |
| 202 | Ga0157375_10013269 | 3300013308 | Bacteria | 7326 |
| 203 | Ga0157375_10036863 | 3300013308 | Bacteria | 4682 |
| 204 | Ga0157375_10296018 | 3300013308 | Bacteria | 1781 |
| 205 | Ga0157375_10543177 | 3300013308 | Bacteria | 1324 |
| 206 | Ga0163163_10009454 | 3300014325 | Bacteria | 8706 |
| 207 | Ga0163163_10056866 | 3300014325 | Bacteria | 3867 |
| 208 | Ga0163163_10074970 | 3300014325 | Bacteria | 3376 |
| 209 | Ga0163163_10349925 | 3300014325 | Bacteria | 1533 |
| 210 | Ga0163163_10376133 | 3300014325 | Bacteria | 1478 |
| 211 | Ga0182008_10006605 | 3300014497 | Bacteria | 6467 |
| 212 | Ga0157379_10004275 | 3300014968 | Bacteria | 12199 |
| 213 | Ga0157379_10019486 | 3300014968 | Bacteria | 5992 |
| 214 | Ga0157376_10227272 | 3300014969 | Bacteria | 1732 |
| 215 | Ga0182006_1015903 | 3300015261 | Bacteria | 3217 |
| 216 | Ga0182007_10000483 | 3300015262 | Bacteria | 23980 |
| 217 | Ga0183367_1001 | 3300015688 | Bacteria | 1225545 |
| 218 | Ga0163161_10349450 | 3300017792 | Bacteria | 1175 |
| 219 | Ga0206354_10776292 | 3300020081 | Bacteria | 2073 |
| 220 | Ga0206354_11017713 | 3300020081 | Bacteria | 1468 |
| 221 | Ga0213872_10135785 | 3300021361 | Bacteria | 1081 |
| 222 | Ga0213874_10005715 | 3300021377 | Bacteria | 2910 |
| 223 | Ga0213875_10000917 | 3300021388 | Bacteria | 21338 |
| 224 | Ga0213875_10106535 | 3300021388 | Bacteria | 1308 |
| 225 | Ga0224712_10087932 | 3300022467 | Bacteria | 1296 |
| 226 | Ga0224712_10138368 | 3300022467 | Bacteria | 1069 |
| 227 | Ga0209758_1007704 | 3300025297 | Bacteria | 7233 |
| 228 | Ga0207426_1000849 | 3300025302 | Bacteria | 32135 |
| 229 | Ga0207426_1002327 | 3300025302 | Bacteria | 12424 |
| 230 | Ga0207426_1012862 | 3300025302 | Bacteria | 3126 |
| 231 | Ga0207426_1021649 | 3300025302 | Bacteria | 2220 |
| 232 | Ga0207692_10211366 | 3300025898 | Bacteria | 1146 |
| 233 | Ga0207688_10011941 | 3300025901 | Bacteria | 4728 |
| 234 | Ga0207647_10002261 | 3300025904 | Bacteria | 14677 |
| 235 | Ga0207647_10009502 | 3300025904 | Bacteria | 6905 |
| 236 | Ga0207699_10000045 | 3300025906 | Bacteria | 112158 |
| 237 | Ga0207699_10016909 | 3300025906 | Bacteria | 3826 |
| 238 | Ga0207699_10057723 | 3300025906 | Bacteria | 2319 |
| 239 | Ga0207699_10101050 | 3300025906 | Bacteria | 1830 |
| 240 | Ga0207645_10200563 | 3300025907 | Bacteria | 1312 |
| 241 | Ga0207643_10000027 | 3300025908 | Bacteria | 99423 |
| 242 | Ga0207684_10048311 | 3300025910 | Bacteria | 3609 |
| 243 | Ga0207684_10073144 | 3300025910 | Bacteria | 2911 |
| 244 | Ga0207684_10182251 | 3300025910 | Bacteria | 1811 |
| 245 | Ga0207654_10046636 | 3300025911 | Bacteria | 2472 |
| 246 | Ga0207707_10072390 | 3300025912 | Bacteria | 3004 |
| 247 | Ga0207695_10000679 | 3300025913 | Bacteria | 66777 |
| 248 | Ga0207671_10000052 | 3300025914 | Bacteria | 188462 |
| 249 | Ga0207693_10044047 | 3300025915 | Bacteria | 3507 |
| 250 | Ga0207693_10085433 | 3300025915 | Bacteria | 2472 |
| 251 | Ga0207657_10024194 | 3300025919 | Bacteria | 5635 |
| 252 | Ga0207657_10214499 | 3300025919 | Bacteria | 1543 |
| 253 | Ga0207649_10281023 | 3300025920 | Bacteria | 1210 |
| 254 | Ga0207652_10033501 | 3300025921 | Bacteria | 4326 |
| 255 | Ga0207652_10198519 | 3300025921 | Bacteria | 1805 |
| 256 | Ga0207646_10018631 | 3300025922 | Bacteria | 6472 |
| 257 | Ga0207646_10052294 | 3300025922 | Bacteria | 3655 |
| 258 | Ga0207646_10173970 | 3300025922 | Bacteria | 1944 |
| 259 | Ga0207694_10000079 | 3300025924 | Bacteria | 111767 |
| 260 | Ga0207650_10379901 | 3300025925 | Bacteria | 1166 |
| 261 | Ga0207659_10000900 | 3300025926 | Bacteria | 17696 |
| 262 | Ga0207659_10046499 | 3300025926 | Bacteria | 3065 |
| 263 | Ga0207687_10004998 | 3300025927 | Bacteria | 8784 |
| 264 | Ga0207687_10014787 | 3300025927 | Bacteria | 5111 |
| 265 | Ga0207700_10001094 | 3300025928 | Bacteria | 15621 |
| 266 | Ga0207700_10077230 | 3300025928 | Bacteria | 2586 |
| 267 | Ga0207700_10289546 | 3300025928 | Bacteria | 1411 |
| 268 | Ga0207700_10408527 | 3300025928 | Bacteria | 1191 |
| 269 | Ga0207664_10015691 | 3300025929 | Bacteria | 5507 |
| 270 | Ga0207690_10035103 | 3300025932 | Bacteria | 3236 |
| 271 | Ga0207690_10359613 | 3300025932 | Bacteria | 1153 |
| 272 | Ga0207706_10058789 | 3300025933 | Bacteria | 3386 |
| 273 | Ga0207706_10090727 | 3300025933 | Bacteria | 2687 |
| 274 | Ga0207686_10122039 | 3300025934 | Bacteria | 1775 |
| 275 | Ga0207670_10018350 | 3300025936 | Bacteria | 4252 |
| 276 | Ga0207669_10240851 | 3300025937 | Bacteria | 1341 |
| 277 | Ga0207665_10017388 | 3300025939 | Bacteria | 4725 |
| 278 | Ga0207665_10039284 | 3300025939 | Bacteria | 3155 |
| 279 | Ga0207691_10062022 | 3300025940 | Bacteria | 3394 |
| 280 | Ga0207711_10000056 | 3300025941 | Bacteria | 135485 |
| 281 | Ga0207711_10093249 | 3300025941 | Bacteria | 2652 |
| 282 | Ga0207711_10440661 | 3300025941 | Bacteria | 1212 |
| 283 | Ga0207689_10000694 | 3300025942 | Bacteria | 32241 |
| 284 | Ga0207689_10021188 | 3300025942 | Bacteria | 5465 |
| 285 | Ga0207661_10007868 | 3300025944 | Bacteria | 7597 |
| 286 | Ga0207661_10013863 | 3300025944 | Bacteria | 5890 |
| 287 | Ga0207661_10054987 | 3300025944 | Bacteria | 3190 |
| 288 | Ga0207661_10105630 | 3300025944 | Bacteria | 2373 |
| 289 | Ga0207679_10001380 | 3300025945 | Bacteria | 15313 |
| 290 | Ga0207679_10006279 | 3300025945 | Bacteria | 7499 |
| 291 | Ga0207679_10521671 | 3300025945 | Bacteria | 1063 |
| 292 | Ga0207667_10162082 | 3300025949 | Bacteria | 2300 |
| 293 | Ga0207668_10008379 | 3300025972 | Bacteria | 6159 |
| 294 | Ga0207668_10081751 | 3300025972 | Bacteria | 2345 |
| 295 | Ga0207640_10181546 | 3300025981 | Bacteria | 1578 |
| 296 | Ga0207658_10183242 | 3300025986 | Bacteria | 1735 |
| 297 | Ga0207677_10002817 | 3300026023 | Bacteria | 9175 |
| 298 | Ga0207703_10027365 | 3300026035 | Bacteria | 4491 |
| 299 | Ga0207703_10031087 | 3300026035 | Bacteria | 4220 |
| 300 | Ga0207703_10257060 | 3300026035 | Bacteria | 1577 |
| 301 | Ga0207639_10072740 | 3300026041 | Bacteria | 2693 |
| 302 | Ga0207678_10000488 | 3300026067 | Bacteria | 35948 |
| 303 | Ga0207678_10003800 | 3300026067 | Bacteria | 13579 |
| 304 | Ga0207708_10049841 | 3300026075 | Bacteria | 3189 |
| 305 | Ga0207702_10001273 | 3300026078 | Bacteria | 25311 |
| 306 | Ga0207702_10001529 | 3300026078 | Bacteria | 22893 |
| 307 | Ga0207702_10031656 | 3300026078 | Bacteria | 4409 |
| 308 | Ga0207641_10004949 | 3300026088 | Bacteria | 11434 |
| 309 | Ga0207641_10048601 | 3300026088 | Bacteria | 3581 |
| 310 | Ga0207676_10000549 | 3300026095 | Bacteria | 31348 |
| 311 | Ga0207676_10007940 | 3300026095 | Bacteria | 7547 |
| 312 | Ga0207676_10122269 | 3300026095 | Bacteria | 2197 |
| 313 | Ga0207676_10297645 | 3300026095 | Bacteria | 1472 |
| 314 | Ga0207674_10006778 | 3300026116 | Bacteria | 13439 |
| 315 | Ga0207674_10018991 | 3300026116 | Bacteria | 7451 |
| 316 | Ga0207674_10049188 | 3300026116 | Bacteria | 4313 |
| 317 | Ga0207675_100249787 | 3300026118 | Bacteria | 1716 |
| 318 | Ga0207683_10001061 | 3300026121 | Bacteria | 25052 |
| 319 | Ga0207683_10004644 | 3300026121 | Bacteria | 11838 |
| 320 | Ga0207683_10046231 | 3300026121 | Bacteria | 3809 |
| 321 | Ga0207683_10499159 | 3300026121 | Bacteria | 1124 |
| 322 | Ga0207698_10010709 | 3300026142 | Bacteria | 5915 |
| 323 | Ga0207698_10057408 | 3300026142 | Bacteria | 3011 |
| 324 | Ga0207428_10083312 | 3300027907 | Bacteria | 2495 |
| 325 | Ga0207428_10137930 | 3300027907 | Bacteria | 1864 |
| 326 | Ga0268265_10000017 | 3300028380 | Bacteria | 293875 |
| 327 | Ga0268265_10121731 | 3300028380 | Bacteria | 2151 |
| 328 | Ga0268264_10315938 | 3300028381 | Bacteria | 1475 |
| 329 | Ga0307517_10002786 | 3300028786 | Bacteria | 27793 |
| 330 | Ga0307515_10000055 | 3300028794 | Bacteria | 264365 |
| 331 | Ga0307515_10008569 | 3300028794 | Bacteria | 19910 |
| 332 | Ga0307515_10142298 | 3300028794 | Bacteria | 2564 |
| 333 | Ga0307511_10001943 | 3300030521 | Bacteria | 21735 |
| 334 | Ga0307511_10029818 | 3300030521 | Bacteria | 4914 |
| 335 | Ga0316176_1141749 | 3300030732 | Bacteria | 3088 |
| 336 | Ga0265776_100008 | 3300030880 | Bacteria | 6194 |
| 337 | Ga0265764_100820 | 3300030882 | Bacteria | 1267 |
| 338 | Ga0265773_1000473 | 3300031018 | Bacteria | 1649 |
| 339 | Ga0265327_10000329 | 3300031251 | Bacteria | 90292 |
| 340 | Ga0265327_10027323 | 3300031251 | Bacteria | 3287 |
| 341 | Ga0307513_10014342 | 3300031456 | Bacteria | 9678 |
| 342 | Ga0307513_10136084 | 3300031456 | Bacteria | 2392 |
| 343 | Ga0307513_10339511 | 3300031456 | Bacteria | 1253 |
| 344 | Ga0307509_10051822 | 3300031507 | Bacteria | 4384 |
| 345 | Ga0307408_100188893 | 3300031548 | Bacteria | 1658 |
| 346 | Ga0307508_10003092 | 3300031616 | Bacteria | 17092 |
| 347 | Ga0316575_10002683 | 3300031665 | Bacteria | 6001 |
| 348 | Ga0316576_10002106 | 3300031727 | Bacteria | 11203 |
| 349 | Ga0316576_10251049 | 3300031727 | Bacteria | 1328 |
| 350 | Ga0307516_10037213 | 3300031730 | Bacteria | 4866 |
| 351 | Ga0307516_10071167 | 3300031730 | Bacteria | 3339 |
| 352 | Ga0307516_10076688 | 3300031730 | Bacteria | 3194 |
| 353 | Ga0307406_10169044 | 3300031901 | Bacteria | 1580 |
| 354 | Ga0307412_10113832 | 3300031911 | Bacteria | 1936 |
| 355 | Ga0307409_100098457 | 3300031995 | Bacteria | 2418 |
| 356 | Ga0307409_100542132 | 3300031995 | Bacteria | 1140 |
| 357 | Ga0307411_10058483 | 3300032005 | Bacteria | 2551 |
| 358 | Ga0307415_100009278 | 3300032126 | Bacteria | 5503 |
| 359 | Ga0307415_100044916 | 3300032126 | Bacteria | 2958 |
| 360 | Ga0307415_100090192 | 3300032126 | Bacteria | 2216 |
| 361 | Ga0307415_100310339 | 3300032126 | Bacteria | 1310 |
| 362 | Ga0307507_10007023 | 3300033179 | Bacteria | 16688 |
| 363 | Ga0307510_10075231 | 3300033180 | Bacteria | 3330 |
| 364 | Ga0307510_10172608 | 3300033180 | Bacteria | 1738 |
| 365 | Ga0373934_0000067 | 3300035086 | Bacteria | 35483 |
| 366 | Ga0373934_0006812 | 3300035086 | Bacteria | 4242 |
| 367 | Ga0373934_0010114 | 3300035086 | Bacteria | 3542 |
| 368 | Ga0373934_0016221 | 3300035086 | Bacteria | 2831 |
| 369 | Ga0373944_0002039 | 3300035089 | Bacteria | 5120 |
| 370 | Ga0373944_0016332 | 3300035089 | Bacteria | 2092 |
| 371 | Ga0373923_0000852 | 3300035111 | Bacteria | 8074 |
| 372 | Ga0373923_0002822 | 3300035111 | Bacteria | 5443 |
| 373 | Ga0373923_0032650 | 3300035111 | Bacteria | 2104 |
| 374 | Ga0373923_0038968 | 3300035111 | Bacteria | 1949 |
| 375 | Ga0373936_0009870 | 3300035113 | Bacteria | 3603 |
| 376 | Ga0373936_0031090 | 3300035113 | Bacteria | 2107 |
| 377 | Ga0373941_0083581 | 3300035115 | Bacteria | 1083 |
| 378 | Ga0373945_0002168 | 3300035116 | Bacteria | 6124 |
| 379 | Ga0373953_0065770 | 3300035117 | Bacteria | 1489 |
| 380 | Ga0373953_0067502 | 3300035117 | Bacteria | 1471 |
| 381 | Ga0373954_0009816 | 3300035118 | Bacteria | 4212 |
| 382 | Ga0373956_0000258 | 3300035119 | Bacteria | 21190 |
| 383 | Ga0373956_0015501 | 3300035119 | Bacteria | 3192 |
| 384 | Ga0373956_0082362 | 3300035119 | Bacteria | 1477 |
| 385 | Ga0373957_0000388 | 3300035120 | Bacteria | 11160 |
| 386 | Ga0373957_0007302 | 3300035120 | Bacteria | 3532 |
| 387 | Ga0373957_0010416 | 3300035120 | Bacteria | 3074 |
| 388 | Ga0373957_0010520 | 3300035120 | Bacteria | 3061 |
| 389 | Ga0373957_0034218 | 3300035120 | Bacteria | 1880 |
| 390 | Ga0373943_0000066 | 3300035170 | Bacteria | 36871 |
| 391 | Ga0373943_0089716 | 3300035170 | Bacteria | 1590 |
| 392 | Ga0373946_0000019 | 3300035171 | Bacteria | 44508 |
| 393 | Ga0373946_0144640 | 3300035171 | Bacteria | 1105 |
| 394 | Ga0373955_0000019 | 3300035172 | Bacteria | 64700 |
| 395 | Ga0373955_0031714 | 3300035172 | Bacteria | 2769 |
| 396 | Ga0316574_0005553 | 3300035398 | Bacteria | 6734 |
| 397 | Ga0316574_0117169 | 3300035398 | Bacteria | 1709 |
| 398 | Ga0316574_0170936 | 3300035398 | Bacteria | 1399 |
| 399 | Ga0373924_0004826 | 3300035410 | Bacteria | 4739 |
| 400 | Ga0373924_0033155 | 3300035410 | Bacteria | 2083 |
| 401 | Ga0373924_0087759 | 3300035410 | Bacteria | 1328 |
| 402 | Ga0373931_0000846 | 3300035691 | Bacteria | 12888 |
| 403 | Ga0373931_0106768 | 3300035691 | Bacteria | 1583 |
| 404 | Ga0373935_0013238 | 3300035692 | Bacteria | 4975 |
| 405 | Ga0373935_0079052 | 3300035692 | Bacteria | 2134 |
| 406 | Ga0373927_0009825 | 3300035695 | Bacteria | 6413 |
| 407 | Ga0373927_0204465 | 3300035695 | Bacteria | 1296 |
| 408 | Ga0373933_0000120 | 3300035724 | Bacteria | 50864 |
| 409 | Ga0373933_0003631 | 3300035724 | Bacteria | 8548 |
| 410 | Ga0373933_0007380 | 3300035724 | Bacteria | 5994 |
| 411 | Ga0373933_0010673 | 3300035724 | Bacteria | 5037 |
| 412 | Ga0373933_0061185 | 3300035724 | Bacteria | 2271 |
| 413 | Ga0373947_0000197 | 3300035725 | Bacteria | 33311 |
| 414 | Ga0373947_0164982 | 3300035725 | Bacteria | 1434 |
| 415 | Ga0373937_0000147 | 3300036401 | Bacteria | 68258 |
| 416 | Ga0373937_0001943 | 3300036401 | Bacteria | 17293 |
| 417 | Ga0373937_0084878 | 3300036401 | Bacteria | 2930 |
| 418 | Ga0373937_0089250 | 3300036401 | Bacteria | 2854 |
| 419 | Ga0373937_0541126 | 3300036401 | Bacteria | 1106 |
| 420 | Ga0265778_000478 | 3300036457 | Bacteria | 3138 |
| 421 | Ga0373925_0000869 | 3300037068 | Bacteria | 27621 |
| 422 | Ga0373925_0022121 | 3300037068 | Bacteria | 4634 |
| 423 | Ga0373925_0089754 | 3300037068 | Bacteria | 2348 |
| 424 | Ga0373925_0299305 | 3300037068 | Bacteria | 1298 |
| 425 | Ga0395899_0270692 | 3300037312 | Bacteria | 1159 |
| 426 | Ga0395900_0053423 | 3300037418 | Bacteria | 4158 |
| 427 | Ga0395898_0030129 | 3300037466 | Bacteria | 5432 |
| 428 | Ga0395898_0041335 | 3300037466 | Bacteria | 4555 |
| 429 | Ga0395898_0086423 | 3300037466 | Bacteria | 3022 |
| 430 | Ga0395905_0344806 | 3300037471 | Bacteria | 1381 |
| 431 | Ga0436364_0199487 | 3300037853 | Bacteria | 23161 |
| 432 | Ga0436364_0332506 | 3300037853 | Bacteria | 1205 |
| 433 | Ga0436364_0351592 | 3300037853 | Bacteria | 1418 |
| 434 | Ga0436364_0501469 | 3300037853 | Bacteria | 1505 |
| 435 | Ga0395901_0005116 | 3300038443 | Bacteria | 13244 |
| 436 | Ga0395901_0483000 | 3300038443 | Bacteria | 1263 |
| 437 | Ga0400485_08257 | 3300038735 | Bacteria | 12826 |
| 438 | Ga0400488_00407 | 3300038741 | Bacteria | 8581 |
| 439 | Ga0436361_1211127 | 3300039447 | Bacteria | 3595 |
| 440 | Ga0436363_0319333 | 3300039450 | Bacteria | 5118 |
| 441 | Ga0436363_0578534 | 3300039450 | Bacteria | 3342 |
| 442 | Ga0436362_1109190 | 3300039453 | Bacteria | 1042 |
| 443 | Ga0439436_0010941 | 3300041404 | Bacteria | 2761 |
| 444 | Ga0451841_0483166 | 3300041498 | Bacteria | 1562 |
| 445 | Ga0451853_0512039 | 3300041512 | Bacteria | 1442 |
| 446 | Ga0439433_0003699 | 3300041999 | Bacteria | 3286 |
| 447 | Ga0439442_007081 | 3300042002 | Bacteria | 2252 |
| 448 | Ga0439448_0029424 | 3300042005 | Bacteria | 1739 |
| 449 | Ga0439448_0053566 | 3300042005 | Bacteria | 1324 |
| 450 | Ga0439449_0005876 | 3300042007 | Bacteria | 4688 |
| 451 | Ga0439457_000906 | 3300042014 | Bacteria | 8947 |
| 452 | Ga0450894_000084 | 3300042131 | Bacteria | 15364 |
| 453 | Ga0450896_003054 | 3300042133 | Bacteria | 2201 |
| 454 | Ga0450899_002814 | 3300042135 | Bacteria | 1881 |
| 455 | Ga0439460_0032788 | 3300042461 | Bacteria | 1490 |
| 456 | Ga0466969_0002252 | 3300044656 | Bacteria | 10314 |
| 457 | Ga0466969_0003530 | 3300044656 | Bacteria | 8315 |
| 458 | Ga0466969_0005190 | 3300044656 | Bacteria | 6926 |
| 459 | Ga0466969_0010323 | 3300044656 | Bacteria | 4954 |
| 460 | Ga0466972_0024478 | 3300044658 | Bacteria | 2995 |
| 461 | Ga0466972_0024819 | 3300044658 | Bacteria | 2975 |
| 462 | Ga0466972_0062248 | 3300044658 | Bacteria | 1788 |
| 463 | Ga0466972_0069005 | 3300044658 | Bacteria | 1688 |
| 464 | Ga0466965_0004182 | 3300044683 | Bacteria | 6413 |
| 465 | Ga0466965_0006273 | 3300044683 | Bacteria | 5383 |
| 466 | Ga0466965_0007599 | 3300044683 | Bacteria | 4987 |
| 467 | Ga0466966_0002064 | 3300044684 | Bacteria | 13030 |
| 468 | Ga0466966_0022938 | 3300044684 | Bacteria | 4089 |
| 469 | Ga0466966_0031046 | 3300044684 | Bacteria | 3465 |
| 470 | Ga0466966_0041306 | 3300044684 | Bacteria | 2963 |
| 471 | Ga0466966_0041941 | 3300044684 | Bacteria | 2939 |
| 472 | Ga0466961_0001303 | 3300044693 | Bacteria | 15391 |
| 473 | Ga0466961_0006030 | 3300044693 | Bacteria | 7685 |
| 474 | Ga0466961_0010306 | 3300044693 | Bacteria | 5958 |
| 475 | Ga0466961_0011703 | 3300044693 | Bacteria | 5609 |
| 476 | Ga0466961_0029102 | 3300044693 | Bacteria | 3552 |
| 477 | Ga0466961_0038583 | 3300044693 | Bacteria | 3064 |
| 478 | Ga0466961_0052929 | 3300044693 | Bacteria | 2591 |
| 479 | Ga0466963_0001025 | 3300044694 | Bacteria | 14497 |
| 480 | Ga0466963_0011650 | 3300044694 | Bacteria | 5357 |
| 481 | Ga0466963_0035665 | 3300044694 | Bacteria | 3241 |
| 482 | Ga0466963_0052124 | 3300044694 | Bacteria | 2714 |
| 483 | Ga0466964_0005930 | 3300044706 | Bacteria | 4550 |
| 484 | Ga0466971_0000360 | 3300044719 | Bacteria | 17428 |
| 485 | Ga0466971_0001585 | 3300044719 | Bacteria | 9601 |
| 486 | Ga0466971_0140520 | 3300044719 | Bacteria | 1124 |
| 487 | Ga0466971_0144953 | 3300044719 | Bacteria | 1107 |
| 488 | Ga0466970_0006767 | 3300044765 | Bacteria | 5738 |
| 489 | Ga0466970_0008296 | 3300044765 | Bacteria | 5224 |
| 490 | Ga0466970_0015913 | 3300044765 | Bacteria | 3873 |
| 491 | Ga0466970_0068179 | 3300044765 | Bacteria | 1911 |
| 492 | Ga0466957_0000665 | 3300044842 | Bacteria | 17463 |
| 493 | Ga0466957_0087652 | 3300044842 | Bacteria | 1946 |
| 494 | Ga0466957_0114810 | 3300044842 | Bacteria | 1711 |
| 495 | Ga0466957_0306276 | 3300044842 | Bacteria | 1068 |
| 496 | Ga0466960_0002372 | 3300044901 | Bacteria | 7089 |
| 497 | Ga0466960_0003337 | 3300044901 | Bacteria | 6159 |
| 498 | Ga0466960_0013645 | 3300044901 | Bacteria | 3457 |
| 499 | Ga0466960_0104426 | 3300044901 | Bacteria | 1464 |
| 500 | Ga0466959_0001547 | 3300045049 | Bacteria | 14146 |
| 501 | Ga0466959_0004284 | 3300045049 | Bacteria | 9516 |
| 502 | Ga0466959_0004866 | 3300045049 | Bacteria | 9086 |
| 503 | Ga0466959_0030100 | 3300045049 | Bacteria | 4020 |
| 504 | Ga0466959_0175124 | 3300045049 | Bacteria | 1503 |
| 505 | Ga0466958_0002860 | 3300045836 | Bacteria | 8789 |
| 506 | Ga0466958_0004749 | 3300045836 | Bacteria | 7226 |
| 507 | Ga0466958_0039394 | 3300045836 | Bacteria | 2839 |
| 508 | Ga0466958_0040735 | 3300045836 | Bacteria | 2792 |
| 509 | Ga0466967_0001389 | 3300045976 | Bacteria | 13984 |
| 510 | Ga0466967_0002745 | 3300045976 | Bacteria | 11136 |
| 511 | Ga0466967_0023964 | 3300045976 | Bacteria | 5011 |
| 512 | Ga0466967_0077166 | 3300045976 | Bacteria | 2998 |
| 513 | Ga0466967_0080319 | 3300045976 | Bacteria | 2942 |
| 514 | Ga0466967_0162259 | 3300045976 | Bacteria | 2099 |
| 515 | Ga0466967_0191741 | 3300045976 | Bacteria | 1932 |
| 516 | Ga0466967_0223884 | 3300045976 | Bacteria | 1789 |
| 517 | Ga0466967_0458693 | 3300045976 | Bacteria | 1246 |
| 518 | Ga0466967_0526196 | 3300045976 | Bacteria | 1162 |
| 519 | Ga0495617_033820 | 3300046452 | Bacteria | 1715 |
| 520 | Ga0495592_0000019 | 3300046454 | Bacteria | 140749 |
| 521 | Ga0495592_0003593 | 3300046454 | Bacteria | 11151 |
| 522 | Ga0495592_0010881 | 3300046454 | Bacteria | 6864 |
| 523 | Ga0495592_0089028 | 3300046454 | Bacteria | 2217 |
| 524 | Ga0495592_0174068 | 3300046454 | Bacteria | 1471 |
| 525 | Ga0495603_0001229 | 3300046455 | Bacteria | 14941 |
| 526 | Ga0495603_0002852 | 3300046455 | Bacteria | 10207 |
| 527 | Ga0495603_0003655 | 3300046455 | Bacteria | 9148 |
| 528 | Ga0495603_0008888 | 3300046455 | Bacteria | 6074 |
| 529 | Ga0495603_0092702 | 3300046455 | Bacteria | 1765 |
| 530 | Ga0495590_0028363 | 3300046457 | Bacteria | 1964 |
| 531 | Ga0495629_0008178 | 3300046459 | Bacteria | 7691 |
| 532 | Ga0495629_0023067 | 3300046459 | Bacteria | 4435 |
| 533 | Ga0495629_0023084 | 3300046459 | Bacteria | 4433 |
| 534 | Ga0495629_0044497 | 3300046459 | Bacteria | 3115 |
| 535 | Ga0495629_0111475 | 3300046459 | Bacteria | 1907 |
| 536 | Ga0495629_0142163 | 3300046459 | Bacteria | 1669 |
| 537 | Ga0495629_0215729 | 3300046459 | Bacteria | 1324 |
| 538 | Ga0495638_0002049 | 3300046460 | Bacteria | 17130 |
| 539 | Ga0495638_0009798 | 3300046460 | Bacteria | 6690 |
| 540 | Ga0495641_0018013 | 3300046461 | Bacteria | 3658 |
| 541 | Ga0495641_0020191 | 3300046461 | Bacteria | 3387 |
| 542 | Ga0495641_0070130 | 3300046461 | Bacteria | 1574 |
| 543 | Ga0495651_0000012 | 3300046462 | Bacteria | 138280 |
| 544 | Ga0495651_0002041 | 3300046462 | Bacteria | 15607 |
| 545 | Ga0495651_0003580 | 3300046462 | Bacteria | 11916 |
| 546 | Ga0495651_0005598 | 3300046462 | Bacteria | 9575 |
| 547 | Ga0495651_0007219 | 3300046462 | Bacteria | 8492 |
| 548 | Ga0495651_0022043 | 3300046462 | Bacteria | 4953 |
| 549 | Ga0495651_0077942 | 3300046462 | Bacteria | 2507 |
| 550 | Ga0495651_0199045 | 3300046462 | Bacteria | 1403 |
| 551 | Ga0495653_0000497 | 3300046463 | Bacteria | 30342 |
| 552 | Ga0495653_0000696 | 3300046463 | Bacteria | 25659 |
| 553 | Ga0495653_0012957 | 3300046463 | Bacteria | 6802 |
| 554 | Ga0495653_0016927 | 3300046463 | Bacteria | 5930 |
| 555 | Ga0495653_0017204 | 3300046463 | Bacteria | 5879 |
| 556 | Ga0495653_0037425 | 3300046463 | Bacteria | 3813 |
| 557 | Ga0495653_0104562 | 3300046463 | Bacteria | 2046 |
| 558 | Ga0495653_0188052 | 3300046463 | Bacteria | 1411 |
| 559 | Ga0495653_0212503 | 3300046463 | Bacteria | 1305 |
| 560 | Ga0495580_0063633 | 3300046472 | Bacteria | 2586 |
| 561 | Ga0495582_0010999 | 3300046473 | Bacteria | 4981 |
| 562 | Ga0495582_0058264 | 3300046473 | Bacteria | 2130 |
| 563 | Ga0495582_0060350 | 3300046473 | Bacteria | 2092 |
| 564 | Ga0495582_0271843 | 3300046473 | Bacteria | 973 |
| 565 | Ga0495605_0016056 | 3300046474 | Bacteria | 4060 |
| 566 | Ga0495662_0000796 | 3300046476 | Bacteria | 15310 |
| 567 | Ga0495662_0002243 | 3300046476 | Bacteria | 9743 |
| 568 | Ga0495662_0007504 | 3300046476 | Bacteria | 5388 |
| 569 | Ga0495662_0040960 | 3300046476 | Bacteria | 2236 |
| 570 | Ga0495664_0000137 | 3300046477 | Bacteria | 36467 |
| 571 | Ga0495664_0000402 | 3300046477 | Bacteria | 21128 |
| 572 | Ga0495664_0002832 | 3300046477 | Bacteria | 9330 |
| 573 | Ga0495664_0018470 | 3300046477 | Bacteria | 3996 |
| 574 | Ga0495664_0033230 | 3300046477 | Bacteria | 3032 |
| 575 | Ga0495664_0068246 | 3300046477 | Bacteria | 2121 |
| 576 | Ga0495584_0037231 | 3300046491 | Bacteria | 2458 |
| 577 | Ga0495585_0082299 | 3300046492 | Bacteria | 1743 |
| 578 | Ga0495585_0097627 | 3300046492 | Bacteria | 1575 |
| 579 | Ga0495594_0000330 | 3300046499 | Bacteria | 23485 |
| 580 | Ga0495594_0097326 | 3300046499 | Bacteria | 1653 |
| 581 | Ga0495594_0209223 | 3300046499 | Bacteria | 1112 |
| 582 | Ga0495583_0017226 | 3300046506 | Bacteria | 3846 |
| 583 | Ga0495606_0002365 | 3300046507 | Bacteria | 22146 |
| 584 | Ga0495608_0000048 | 3300046511 | Bacteria | 97364 |
| 585 | Ga0495608_0003917 | 3300046511 | Bacteria | 10704 |
| 586 | Ga0495608_0005268 | 3300046511 | Bacteria | 9239 |
| 587 | Ga0495608_0005881 | 3300046511 | Bacteria | 8731 |
| 588 | Ga0495608_0013736 | 3300046511 | Bacteria | 5617 |
| 589 | Ga0495608_0027406 | 3300046511 | Bacteria | 3876 |
| 590 | Ga0495608_0030091 | 3300046511 | Bacteria | 3679 |
| 591 | Ga0495608_0112618 | 3300046511 | Bacteria | 1749 |
| 592 | Ga0495608_0157535 | 3300046511 | Bacteria | 1445 |
| 593 | Ga0495616_0004907 | 3300046513 | Bacteria | 8359 |
| 594 | Ga0495616_0050858 | 3300046513 | Bacteria | 2070 |
| 595 | Ga0495618_0007183 | 3300046514 | Bacteria | 6745 |
| 596 | Ga0495618_0022588 | 3300046514 | Bacteria | 3886 |
| 597 | Ga0495618_0027140 | 3300046514 | Bacteria | 3564 |
| 598 | Ga0495618_0044914 | 3300046514 | Bacteria | 2786 |
| 599 | Ga0495618_0097562 | 3300046514 | Bacteria | 1880 |
| 600 | Ga0495618_0174011 | 3300046514 | Bacteria | 1369 |
| 601 | Ga0495628_0000053 | 3300046516 | Bacteria | 91080 |
| 602 | Ga0495628_0005859 | 3300046516 | Bacteria | 10765 |
| 603 | Ga0495628_0011415 | 3300046516 | Bacteria | 7515 |
| 604 | Ga0495628_0078137 | 3300046516 | Bacteria | 2574 |
| 605 | Ga0495630_0003361 | 3300046517 | Bacteria | 11137 |
| 606 | Ga0495630_0065731 | 3300046517 | Bacteria | 2725 |
| 607 | Ga0495630_0212194 | 3300046517 | Bacteria | 1477 |
| 608 | Ga0495630_0360225 | 3300046517 | Bacteria | 1113 |
| 609 | Ga0495631_0008298 | 3300046518 | Bacteria | 5236 |
| 610 | Ga0495632_0112030 | 3300046519 | Bacteria | 1281 |
| 611 | Ga0495637_0043071 | 3300046520 | Bacteria | 1929 |
| 612 | Ga0495643_0003140 | 3300046522 | Bacteria | 12314 |
| 613 | Ga0495666_0002368 | 3300046526 | Bacteria | 9399 |
| 614 | Ga0495666_0156408 | 3300046526 | Bacteria | 1058 |
| 615 | Ga0495652_0000230 | 3300046529 | Bacteria | 65344 |
| 616 | Ga0495652_0000972 | 3300046529 | Bacteria | 32777 |
| 617 | Ga0495652_0002018 | 3300046529 | Bacteria | 21596 |
| 618 | Ga0495652_0005735 | 3300046529 | Bacteria | 11632 |
| 619 | Ga0495652_0022908 | 3300046529 | Bacteria | 5540 |
| 620 | Ga0495652_0052783 | 3300046529 | Bacteria | 3466 |
| 621 | Ga0495652_0231768 | 3300046529 | Bacteria | 1380 |
| 622 | Ga0495665_0016688 | 3300046531 | Bacteria | 3956 |
| 623 | Ga0495665_0020854 | 3300046531 | Bacteria | 3520 |
| 624 | Ga0495665_0034897 | 3300046531 | Bacteria | 2689 |
| 625 | Ga0495665_0057320 | 3300046531 | Bacteria | 2056 |
| 626 | Ga0495665_0106404 | 3300046531 | Bacteria | 1472 |
| 627 | Ga0495640_0003531 | 3300046533 | Bacteria | 12572 |
| 628 | Ga0495640_0011170 | 3300046533 | Bacteria | 6913 |
| 629 | Ga0495640_0020000 | 3300046533 | Bacteria | 4935 |
| 630 | Ga0495640_0021436 | 3300046533 | Bacteria | 4741 |
| 631 | Ga0495586_0041353 | 3300046535 | Bacteria | 2482 |
| 632 | Ga0495587_0000027 | 3300046536 | Bacteria | 140741 |
| 633 | Ga0495587_0002554 | 3300046536 | Bacteria | 12163 |
| 634 | Ga0495587_0009018 | 3300046536 | Bacteria | 6403 |
| 635 | Ga0495587_0009578 | 3300046536 | Bacteria | 6201 |
| 636 | Ga0495587_0026388 | 3300046536 | Bacteria | 3543 |
| 637 | Ga0495587_0046245 | 3300046536 | Bacteria | 2584 |
| 638 | Ga0495597_0006920 | 3300046542 | Bacteria | 5817 |
| 639 | Ga0495645_0006144 | 3300046543 | Bacteria | 8312 |
| 640 | Ga0495645_0009859 | 3300046543 | Bacteria | 6685 |
| 641 | Ga0495645_0016194 | 3300046543 | Bacteria | 5316 |
| 642 | Ga0495645_0048011 | 3300046543 | Bacteria | 3110 |
| 643 | Ga0495645_0247270 | 3300046543 | Bacteria | 1187 |
| 644 | Ga0495622_0028552 | 3300046557 | Bacteria | 2605 |
| 645 | Ga0495622_0075803 | 3300046557 | Bacteria | 1550 |
| 646 | Ga0495633_0009835 | 3300046558 | Bacteria | 5256 |
| 647 | Ga0495667_0000089 | 3300046559 | Bacteria | 66700 |
| 648 | Ga0495667_0001134 | 3300046559 | Bacteria | 17354 |
| 649 | Ga0495667_0006353 | 3300046559 | Bacteria | 8016 |
| 650 | Ga0495667_0011246 | 3300046559 | Bacteria | 6058 |
| 651 | Ga0495667_0015057 | 3300046559 | Bacteria | 5220 |
| 652 | Ga0495667_0028436 | 3300046559 | Bacteria | 3764 |
| 653 | Ga0495667_0091129 | 3300046559 | Bacteria | 1974 |
| 654 | Ga0495667_0104174 | 3300046559 | Bacteria | 1834 |
| 655 | Ga0495667_0233508 | 3300046559 | Bacteria | 1172 |
| 656 | Ga0495668_0000169 | 3300046616 | Bacteria | 97150 |
| 657 | Ga0495668_0023813 | 3300046616 | Bacteria | 3487 |
| 658 | Ga0495634_0000714 | 3300046642 | Bacteria | 32209 |
| 659 | Ga0495634_0012007 | 3300046642 | Bacteria | 6279 |
| 660 | Ga0495634_0017924 | 3300046642 | Bacteria | 5046 |
| 661 | Ga0495634_0056827 | 3300046642 | Bacteria | 2613 |
| 662 | Ga0495634_0058665 | 3300046642 | Bacteria | 2564 |
| 663 | Ga0495625_0002435 | 3300046660 | Bacteria | 20135 |
| 664 | Ga0495625_0004532 | 3300046660 | Bacteria | 13098 |
| 665 | Ga0495625_0024976 | 3300046660 | Bacteria | 4539 |
| 666 | Ga0495625_0039421 | 3300046660 | Bacteria | 3449 |
| 667 | Ga0495635_0001652 | 3300046663 | Bacteria | 15030 |
| 668 | Ga0495635_0006862 | 3300046663 | Bacteria | 7955 |
| 669 | Ga0495635_0015459 | 3300046663 | Bacteria | 5335 |
| 670 | Ga0495635_0018259 | 3300046663 | Bacteria | 4896 |
| 671 | Ga0495635_0022932 | 3300046663 | Bacteria | 4351 |
| 672 | Ga0495635_0111505 | 3300046663 | Bacteria | 1868 |
| 673 | Ga0495588_0107471 | 3300046674 | Bacteria | 1469 |
| 674 | Ga0495657_0000025 | 3300046675 | Bacteria | 140749 |
| 675 | Ga0495657_0000195 | 3300046675 | Bacteria | 54506 |
| 676 | Ga0495657_0009221 | 3300046675 | Bacteria | 7488 |
| 677 | Ga0495657_0012336 | 3300046675 | Bacteria | 6350 |
| 678 | Ga0495657_0023829 | 3300046675 | Bacteria | 4368 |
| 679 | Ga0495657_0028696 | 3300046675 | Bacteria | 3910 |
| 680 | Ga0495657_0059351 | 3300046675 | Bacteria | 2537 |
| 681 | Ga0495657_0075125 | 3300046675 | Bacteria | 2197 |
| 682 | Ga0495657_0085116 | 3300046675 | Bacteria | 2038 |
| 683 | Ga0495657_0194788 | 3300046675 | Bacteria | 1237 |
| 684 | Ga0495657_0251959 | 3300046675 | Bacteria | 1063 |
| 685 | Ga0495599_0000026 | 3300046678 | Bacteria | 117515 |
| 686 | Ga0495599_0001894 | 3300046678 | Bacteria | 12120 |
| 687 | Ga0495599_0006909 | 3300046678 | Bacteria | 6860 |
| 688 | Ga0495599_0007812 | 3300046678 | Bacteria | 6491 |
| 689 | Ga0495599_0099820 | 3300046678 | Bacteria | 1809 |
| 690 | Ga0495623_0045566 | 3300046679 | Bacteria | 2785 |
| 691 | Ga0495623_0140167 | 3300046679 | Bacteria | 1439 |
| 692 | Ga0495646_0000700 | 3300046680 | Bacteria | 18542 |
| 693 | Ga0495646_0010700 | 3300046680 | Bacteria | 5828 |
| 694 | Ga0495658_0008090 | 3300046683 | Bacteria | 5206 |
| 695 | Ga0495658_0038714 | 3300046683 | Bacteria | 2641 |
| 696 | Ga0495658_0113522 | 3300046683 | Bacteria | 1631 |
| 697 | Ga0495613_0000717 | 3300046689 | Bacteria | 25942 |
| 698 | Ga0495613_0002765 | 3300046689 | Bacteria | 13182 |
| 699 | Ga0495613_0012604 | 3300046689 | Bacteria | 6286 |
| 700 | Ga0495613_0027176 | 3300046689 | Bacteria | 4258 |
| 701 | Ga0495613_0148445 | 3300046689 | Bacteria | 1673 |
| 702 | Ga0495613_0246591 | 3300046689 | Bacteria | 1247 |
| 703 | Ga0495624_0003962 | 3300046690 | Bacteria | 10899 |
| 704 | Ga0495624_0060720 | 3300046690 | Bacteria | 2369 |
| 705 | Ga0495624_0077953 | 3300046690 | Bacteria | 2055 |
| 706 | Ga0495624_0114796 | 3300046690 | Bacteria | 1655 |
| 707 | Ga0495649_0075682 | 3300046694 | Bacteria | 1802 |
| 708 | Ga0495589_0010321 | 3300046794 | Bacteria | 4851 |
| 709 | Ga0495589_0025928 | 3300046794 | Bacteria | 2971 |
| 710 | Ga0495600_0009348 | 3300046809 | Bacteria | 6054 |
| 711 | Ga0495600_0013905 | 3300046809 | Bacteria | 5070 |
| 712 | Ga0495600_0014301 | 3300046809 | Bacteria | 4999 |
| 713 | Ga0495600_0020695 | 3300046809 | Bacteria | 4207 |
| 714 | Ga0495600_0037550 | 3300046809 | Bacteria | 3149 |
| 715 | Ga0495600_0045893 | 3300046809 | Bacteria | 2851 |
| 716 | Ga0495600_0111210 | 3300046809 | Bacteria | 1783 |
| 717 | Ga0495581_0010738 | 3300047315 | Bacteria | 5295 |
| 718 | Ga0495581_0013027 | 3300047315 | Bacteria | 4820 |
| 719 | Ga0495581_0094286 | 3300047315 | Bacteria | 1737 |
| 720 | Ga0495581_0254428 | 3300047315 | Bacteria | 1027 |
| 721 | Ga0495604_0000029 | 3300047317 | Bacteria | 140740 |
| 722 | Ga0495604_0000534 | 3300047317 | Bacteria | 33497 |
| 723 | Ga0495604_0000925 | 3300047317 | Bacteria | 24435 |
| 724 | Ga0495604_0001249 | 3300047317 | Bacteria | 20835 |
| 725 | Ga0495604_0003276 | 3300047317 | Bacteria | 12940 |
| 726 | Ga0495604_0030620 | 3300047317 | Bacteria | 4272 |
| 727 | Ga0495604_0074499 | 3300047317 | Bacteria | 2558 |
| 728 | Ga0495604_0203796 | 3300047317 | Bacteria | 1370 |
| 729 | Ga0495636_0000712 | 3300047318 | Bacteria | 12181 |
| 730 | Ga0495636_0028497 | 3300047318 | Bacteria | 2278 |
| 731 | Ga0495636_0106307 | 3300047318 | Bacteria | 1231 |
| 732 | Ga0495674_0000418 | 3300047319 | Bacteria | 38152 |
| 733 | Ga0495674_0009916 | 3300047319 | Bacteria | 9034 |
| 734 | Ga0495674_0011013 | 3300047319 | Bacteria | 8539 |
| 735 | Ga0495674_0059230 | 3300047319 | Bacteria | 3345 |
| 736 | Ga0495674_0190548 | 3300047319 | Bacteria | 1704 |
| 737 | Ga0495674_0385812 | 3300047319 | Bacteria | 1133 |
| 738 | Ga0495674_0407650 | 3300047319 | Bacteria | 1097 |
| 739 | Ga0495674_0521689 | 3300047319 | Bacteria | 948 |
| 740 | Ga0495676_0002965 | 3300047321 | Bacteria | 15343 |
| 741 | Ga0495676_0004077 | 3300047321 | Bacteria | 13313 |
| 742 | Ga0495676_0006734 | 3300047321 | Bacteria | 10570 |
| 743 | Ga0495676_0036843 | 3300047321 | Bacteria | 4079 |
| 744 | Ga0495676_0040254 | 3300047321 | Bacteria | 3858 |
| 745 | Ga0495676_0048957 | 3300047321 | Bacteria | 3402 |
| 746 | Ga0495676_0095649 | 3300047321 | Bacteria | 2210 |
| 747 | Ga0495680_0000011 | 3300047322 | Bacteria | 140733 |
| 748 | Ga0495680_0001927 | 3300047322 | Bacteria | 21805 |
| 749 | Ga0495680_0007791 | 3300047322 | Bacteria | 9779 |
| 750 | Ga0495680_0028397 | 3300047322 | Bacteria | 4586 |
| 751 | Ga0495680_0035864 | 3300047322 | Bacteria | 3988 |
| 752 | Ga0495680_0065117 | 3300047322 | Bacteria | 2792 |
| 753 | Ga0495683_0052979 | 3300047323 | Bacteria | 2024 |
| 754 | Ga0495687_000608 | 3300047443 | Bacteria | 41847 |
| 755 | Ga0495687_088642 | 3300047443 | Bacteria | 1190 |
| 756 | Ga0495675_0000433 | 3300047444 | Bacteria | 27885 |
| 757 | Ga0495675_0011016 | 3300047444 | Bacteria | 5668 |
| 758 | Ga0495675_0017354 | 3300047444 | Bacteria | 4561 |
| 759 | Ga0495675_0044058 | 3300047444 | Bacteria | 2842 |
| 760 | Ga0495675_0230257 | 3300047444 | Bacteria | 1118 |
| 761 | Ga0495685_008511 | 3300047447 | Bacteria | 3409 |
| 762 | Ga0495685_019259 | 3300047447 | Bacteria | 2344 |
| 763 | Ga0495673_0010530 | 3300047469 | Bacteria | 5021 |
| 764 | Ga0495681_0008184 | 3300047470 | Bacteria | 6581 |
| 765 | Ga0495684_0002379 | 3300047471 | Bacteria | 15039 |
| 766 | Ga0495684_0009203 | 3300047471 | Bacteria | 7624 |
| 767 | Ga0495684_0009423 | 3300047471 | Bacteria | 7538 |
| 768 | Ga0495684_0033942 | 3300047471 | Bacteria | 3914 |
| 769 | Ga0495684_0040950 | 3300047471 | Bacteria | 3550 |
| 770 | Ga0495684_0053280 | 3300047471 | Bacteria | 3087 |
| 771 | Ga0495593_0000887 | 3300047673 | Bacteria | 17377 |
| 772 | Ga0495593_0010699 | 3300047673 | Bacteria | 5290 |
| 773 | Ga0495593_0029343 | 3300047673 | Bacteria | 3016 |
| 774 | Ga0495593_0044705 | 3300047673 | Bacteria | 2367 |
| 775 | Ga0495593_0055596 | 3300047673 | Bacteria | 2082 |
| 776 | Ga0495593_0219178 | 3300047673 | Bacteria | 955 |
| 777 | Ga0495602_0000033 | 3300048088 | Bacteria | 140750 |
| 778 | Ga0495602_0008923 | 3300048088 | Bacteria | 10453 |
| 779 | Ga0495602_0025991 | 3300048088 | Bacteria | 5656 |
| 780 | Ga0495602_0034110 | 3300048088 | Bacteria | 4765 |
| 781 | Ga0495602_0041711 | 3300048088 | Bacteria | 4189 |
| 782 | Ga0495602_0082865 | 3300048088 | Bacteria | 2689 |
| 783 | Ga0495602_0117582 | 3300048088 | Bacteria | 2145 |
| 784 | Ga0495602_0218171 | 3300048088 | Bacteria | 1442 |
| 785 | Ga0495614_0000867 | 3300048089 | Bacteria | 12804 |
| 786 | Ga0495614_0040522 | 3300048089 | Bacteria | 1999 |
| 787 | Ga0495626_0000312 | 3300048091 | Bacteria | 51412 |
| 788 | Ga0496100_0002392 | 3300048903 | Bacteria | 9498 |
| 789 | Ga0496100_0028480 | 3300048903 | Bacteria | 3446 |
| 790 | Ga0496100_0281981 | 3300048903 | Bacteria | 1239 |
| 791 | Ga0496101_0023626 | 3300048904 | Bacteria | 4248 |
| 792 | Ga0496101_0067450 | 3300048904 | Bacteria | 2612 |
| 793 | Ga0496101_0098842 | 3300048904 | Bacteria | 2181 |
| 794 | Ga0496101_0331134 | 3300048904 | Bacteria | 1195 |
| 795 | Ga0496102_0000015 | 3300048905 | Bacteria | 304524 |
| 796 | Ga0496102_0028001 | 3300048905 | Bacteria | 5035 |
| 797 | Ga0496102_0184126 | 3300048905 | Bacteria | 1968 |
| 798 | Ga0496102_0239042 | 3300048905 | Bacteria | 1713 |
| 799 | Ga0496102_0494401 | 3300048905 | Bacteria | 1145 |
| 800 | Ga0496102_0544360 | 3300048905 | Bacteria | 1083 |
| 801 | Ga0496103_0000020 | 3300048906 | Bacteria | 234050 |
| 802 | Ga0496103_0031363 | 3300048906 | Bacteria | 3238 |
| 803 | Ga0496103_0061889 | 3300048906 | Bacteria | 2329 |
| 804 | Ga0496104_0002885 | 3300048907 | Bacteria | 14814 |
| 805 | Ga0496104_0049412 | 3300048907 | Bacteria | 3967 |
| 806 | Ga0496104_0062899 | 3300048907 | Bacteria | 3519 |
| 807 | Ga0496104_0090847 | 3300048907 | Bacteria | 2918 |
| 808 | Ga0496104_0285433 | 3300048907 | Bacteria | 1563 |
| 809 | Ga0496104_0342867 | 3300048907 | Bacteria | 1407 |
| 810 | Ga0496104_0409830 | 3300048907 | Bacteria | 1268 |
| 811 | Ga0496104_0432867 | 3300048907 | Bacteria | 1227 |
| 812 | Ga0496105_0005328 | 3300048908 | Bacteria | 9746 |
| 813 | Ga0496105_0021995 | 3300048908 | Bacteria | 5163 |
| 814 | Ga0496105_0066508 | 3300048908 | Bacteria | 2976 |
| 815 | Ga0496105_0192074 | 3300048908 | Bacteria | 1669 |
| 816 | Ga0496105_0481919 | 3300048908 | Bacteria | 976 |
| 817 | Ga0496106_0004227 | 3300048909 | Bacteria | 10690 |
| 818 | Ga0496106_0039541 | 3300048909 | Bacteria | 3533 |
| 819 | Ga0496107_0169257 | 3300048910 | Bacteria | 1621 |
| 820 | Ga0496107_0217732 | 3300048910 | Bacteria | 1420 |
| 821 | Ga0496108_0001463 | 3300048911 | Bacteria | 18677 |
| 822 | Ga0496108_0009686 | 3300048911 | Bacteria | 7807 |
| 823 | Ga0496108_0056412 | 3300048911 | Bacteria | 3300 |
| 824 | Ga0496108_0108130 | 3300048911 | Bacteria | 2375 |
| 825 | Ga0496108_0438640 | 3300048911 | Bacteria | 1141 |
| 826 | Ga0496108_0446658 | 3300048911 | Bacteria | 1130 |
| 827 | Ga0496109_0012459 | 3300048912 | Bacteria | 7341 |
| 828 | Ga0496109_0054926 | 3300048912 | Bacteria | 3633 |
| 829 | Ga0496109_0067956 | 3300048912 | Bacteria | 3265 |
| 830 | Ga0496109_0164494 | 3300048912 | Bacteria | 2079 |
| 831 | Ga0496109_0324019 | 3300048912 | Bacteria | 1454 |
| 832 | Ga0496109_0324479 | 3300048912 | Bacteria | 1453 |
| 833 | Ga0496109_0468173 | 3300048912 | Bacteria | 1190 |
| 834 | Ga0496110_0007465 | 3300048913 | Bacteria | 8737 |
| 835 | Ga0496110_0093651 | 3300048913 | Bacteria | 2689 |
| 836 | Ga0496110_0316402 | 3300048913 | Bacteria | 1422 |
| 837 | Ga0496110_0354310 | 3300048913 | Bacteria | 1337 |
| 838 | Ga0496111_0003426 | 3300048914 | Bacteria | 9808 |
| 839 | Ga0496111_0010528 | 3300048914 | Bacteria | 6211 |
| 840 | Ga0496111_0040256 | 3300048914 | Bacteria | 3352 |
| 841 | Ga0496111_0302517 | 3300048914 | Bacteria | 1186 |
| 842 | Ga0496112_0002097 | 3300048915 | Bacteria | 15828 |
| 843 | Ga0496112_0007119 | 3300048915 | Bacteria | 9895 |
| 844 | Ga0496112_0011019 | 3300048915 | Bacteria | 8240 |
| 845 | Ga0496112_0036248 | 3300048915 | Bacteria | 4811 |
| 846 | Ga0496112_0038349 | 3300048915 | Bacteria | 4677 |
| 847 | Ga0496112_0273936 | 3300048915 | Bacteria | 1635 |
| 848 | Ga0496113_0014747 | 3300048916 | Bacteria | 5345 |
| 849 | Ga0496113_0078815 | 3300048916 | Bacteria | 2521 |
| 850 | Ga0496113_0083138 | 3300048916 | Bacteria | 2456 |
| 851 | Ga0496113_0130374 | 3300048916 | Bacteria | 1972 |
| 852 | Ga0496113_0170885 | 3300048916 | Bacteria | 1721 |
| 853 | Ga0496113_0320833 | 3300048916 | Bacteria | 1242 |
| 854 | Ga0496113_0326298 | 3300048916 | Bacteria | 1231 |
| 855 | Ga0496113_0397313 | 3300048916 | Bacteria | 1107 |
| 856 | Ga0496113_0407706 | 3300048916 | Bacteria | 1091 |
| 857 | Ga0496114_0004897 | 3300048917 | Bacteria | 10429 |
| 858 | Ga0496114_0073236 | 3300048917 | Bacteria | 2883 |
| 859 | Ga0496114_0094297 | 3300048917 | Bacteria | 2546 |
| 860 | Ga0496115_0028213 | 3300048918 | Bacteria | 4398 |
| 861 | Ga0496116_0000178 | 3300048919 | Bacteria | 128023 |
| 862 | Ga0496116_0000578 | 3300048919 | Bacteria | 48938 |
| 863 | Ga0496117_0000047 | 3300048920 | Bacteria | 299632 |
| 864 | Ga0496117_0021310 | 3300048920 | Bacteria | 5248 |
| 865 | Ga0496117_0028936 | 3300048920 | Bacteria | 4281 |
| 866 | Ga0496118_0000050 | 3300048921 | Bacteria | 244124 |
| 867 | Ga0496118_0002249 | 3300048921 | Bacteria | 26504 |
| 868 | Ga0496118_0012121 | 3300048921 | Bacteria | 8321 |
| 869 | Ga0496119_0001789 | 3300048922 | Bacteria | 25038 |
| 870 | Ga0496121_0000537 | 3300048924 | Bacteria | 72149 |
| 871 | Ga0496121_0003059 | 3300048924 | Bacteria | 24255 |
| 872 | Ga0496126_0000049 | 3300048929 | Bacteria | 317568 |
| 873 | Ga0496126_0000208 | 3300048929 | Bacteria | 131604 |
| 874 | Ga0496126_0132085 | 3300048929 | Bacteria | 2157 |
| 875 | Ga0495682_0076482 | 3300049460 | Bacteria | 1204 |
| 876 | Ga0501031_0006054 | 3300049568 | Bacteria | 7898 |
| 877 | Ga0501031_0020167 | 3300049568 | Bacteria | 4345 |
| 878 | Ga0501032_0062566 | 3300049569 | Bacteria | 2493 |
| 879 | Ga0501033_0002605 | 3300049570 | Bacteria | 15201 |
| 880 | Ga0501033_0009265 | 3300049570 | Bacteria | 7584 |
| 881 | Ga0501034_0022734 | 3300049571 | Bacteria | 6387 |
| 882 | Ga0501034_0025515 | 3300049571 | Bacteria | 6018 |
| 883 | Ga0501034_0046104 | 3300049571 | Bacteria | 4404 |
| 884 | Ga0501034_0218602 | 3300049571 | Bacteria | 1858 |
| 885 | Ga0501036_0004252 | 3300049572 | Bacteria | 11547 |
| 886 | Ga0501036_0041897 | 3300049572 | Bacteria | 3875 |
| 887 | Ga0501036_0051220 | 3300049572 | Bacteria | 3496 |
| 888 | Ga0501036_0158391 | 3300049572 | Bacteria | 1909 |
| 889 | Ga0501037_0011090 | 3300049573 | Bacteria | 6631 |
| 890 | Ga0501037_0031773 | 3300049573 | Bacteria | 3898 |
| 891 | Ga0501037_0048042 | 3300049573 | Bacteria | 3128 |
| 892 | Ga0501038_0002308 | 3300049574 | Bacteria | 17738 |
| 893 | Ga0501038_0056214 | 3300049574 | Bacteria | 3379 |
| 894 | Ga0501038_0109434 | 3300049574 | Bacteria | 2289 |
| 895 | Ga0501043_0006999 | 3300049579 | Bacteria | 8984 |
| 896 | Ga0501043_0117350 | 3300049579 | Bacteria | 2088 |
| 897 | Ga0501046_0006667 | 3300049580 | Bacteria | 10196 |
| 898 | Ga0501046_0025038 | 3300049580 | Bacteria | 4888 |
| 899 | Ga0501046_0072421 | 3300049580 | Bacteria | 2675 |
| 900 | Ga0501047_0021299 | 3300049581 | Bacteria | 6223 |
| 901 | Ga0501047_0040398 | 3300049581 | Bacteria | 4511 |
| 902 | Ga0501048_0009146 | 3300049582 | Bacteria | 7451 |
| 903 | Ga0501048_0130490 | 3300049582 | Bacteria | 1777 |
| 904 | Ga0501048_0190629 | 3300049582 | Bacteria | 1453 |
| 905 | Ga0501070_0006172 | 3300049586 | Bacteria | 10214 |
| 906 | Ga0501070_0025187 | 3300049586 | Bacteria | 4989 |
| 907 | Ga0501071_0199153 | 3300049587 | Bacteria | 1504 |
| 908 | Ga0501074_0011988 | 3300049590 | Bacteria | 6300 |
| 909 | Ga0501080_0029005 | 3300049742 | Bacteria | 5151 |
| 910 | Ga0501080_0133479 | 3300049742 | Bacteria | 2298 |
| 911 | Ga0501035_0137464 | 3300049822 | Bacteria | 2126 |
| 912 | Ga0501044_0000295 | 3300049823 | Bacteria | 63284 |
| 913 | Ga0501044_0015121 | 3300049823 | Bacteria | 8317 |
| 914 | Ga0501044_0182718 | 3300049823 | Bacteria | 2063 |
| 915 | nmdc:mga03n38_179837_c1 | 3300050490 | Bacteria | 1083 |
| 916 | nmdc:mga03n38_88896_c1 | 3300050490 | Bacteria | 1466 |
| 917 | nmdc:mga00v17_64444_c1 | 3300050491 | Bacteria | 2258 |
| 918 | nmdc:mga06z11_13052_c1 | 3300050494 | Bacteria | 3634 |
| 919 | nmdc:mga06z11_3612_c1 | 3300050494 | Bacteria | 5996 |
| 920 | nmdc:mga05p37_115575_c1 | 3300050507 | Bacteria | 3298 |
| 921 | nmdc:mga05p37_12425_c1 | 3300050507 | Bacteria | 10168 |
| 922 | nmdc:mga05p37_136264_c1 | 3300050507 | Bacteria | 3010 |
| 923 | nmdc:mga05p37_16765_c1 | 3300050507 | Bacteria | 8832 |
| 924 | nmdc:mga05p37_194570_c1 | 3300050507 | Bacteria | 2460 |
| 925 | nmdc:mga09592_345008_c1 | 3300050508 | Bacteria | 1289 |
| 926 | nmdc:mga09592_3971_c1 | 3300050508 | Bacteria | 11914 |
| 927 | nmdc:mga0qj67_135935_c1 | 3300050509 | Bacteria | 1992 |
| 928 | nmdc:mga0qj67_18776_c1 | 3300050509 | Bacteria | 5272 |
| 929 | nmdc:mga0qj67_33491_c1 | 3300050509 | Bacteria | 4009 |
| 930 | nmdc:mga0qj67_4927_c1 | 3300050509 | Bacteria | 9710 |
| 931 | nmdc:mga06r32_25_c7 | 3300050510 | Bacteria | 11552 |
| 932 | nmdc:mga06r32_5649_c1 | 3300050510 | Bacteria | 11252 |
| 933 | nmdc:mga06r32_9570_c1 | 3300050510 | Bacteria | 8752 |
| 934 | nmdc:mga08y16_20936_c1 | 3300050511 | Bacteria | 6905 |
| 935 | nmdc:mga08y16_39719_c1 | 3300050511 | Bacteria | 4936 |
| 936 | nmdc:mga0rr50_2888_c1 | 3300050513 | Bacteria | 9800 |
| 937 | nmdc:mga08x19_111186_c1 | 3300050514 | Bacteria | 1828 |
| 938 | nmdc:mga08x19_40499_c1 | 3300050514 | Bacteria | 2965 |
| 939 | nmdc:mga0a205_229823_c1 | 3300050515 | Bacteria | 1738 |
| 940 | nmdc:mga0a205_272376_c1 | 3300050515 | Bacteria | 1570 |
| 941 | nmdc:mga0a205_394690_c1 | 3300050515 | Bacteria | 1247 |
| 942 | nmdc:mga0sz30_43096_c1 | 3300050516 | Bacteria | 1899 |
| 943 | Ga0495601_0014240 | 3300053077 | Bacteria | 4791 |
| 944 | Ga0495601_0029692 | 3300053077 | Bacteria | 3393 |
| 945 | Ga0495601_0094699 | 3300053077 | Bacteria | 1925 |
| 946 | Ga0495601_0126424 | 3300053077 | Bacteria | 1663 |
| 947 | Ga0495612_0011203 | 3300053078 | Bacteria | 3619 |
| 948 | Ga0495612_0094570 | 3300053078 | Bacteria | 1269 |
| 949 | Ga0500610_0001046 | 3300053079 | Bacteria | 9068 |
| 950 | Ga0495595_0005426 | 3300053084 | Bacteria | 5163 |
| 951 | Ga0495595_0006450 | 3300053084 | Bacteria | 4786 |
| 952 | Ga0495595_0131474 | 3300053084 | Bacteria | 1224 |
| 953 | Ga0495619_0019537 | 3300053085 | Bacteria | 4309 |
| 954 | Ga0495619_0028622 | 3300053085 | Bacteria | 3595 |
| 955 | Ga0495619_0031353 | 3300053085 | Bacteria | 3445 |
| 956 | Ga0495619_0042612 | 3300053085 | Bacteria | 2973 |
| 957 | Ga0495619_0172223 | 3300053085 | Bacteria | 1497 |
| 958 | Ga0495619_0174895 | 3300053085 | Bacteria | 1485 |
| 959 | Ga0500643_041856 | 3300053087 | Bacteria | 1343 |
| 960 | Ga0500644_0025657 | 3300053088 | Bacteria | 1816 |
| 961 | Ga0500646_0000211 | 3300053090 | Bacteria | 17430 |
| 962 | Ga0500583_0023020 | 3300053092 | Bacteria | 2620 |
| 963 | Ga0500651_0176919 | 3300053093 | Bacteria | 1269 |
| 964 | Ga0500556_0001025 | 3300053104 | Bacteria | 14612 |
| 965 | Ga0500562_025807 | 3300053108 | Bacteria | 1539 |
| 966 | Ga0500608_071255 | 3300053122 | Bacteria | 1652 |
| 967 | Ga0500652_000353 | 3300053131 | Bacteria | 16458 |
| 968 | Ga0500652_081031 | 3300053131 | Bacteria | 1351 |
| 969 | Ga0500561_0050482 | 3300053137 | Bacteria | 1133 |
| 970 | Ga0500568_0004813 | 3300053139 | Bacteria | 7136 |
| 971 | Ga0500645_000016 | 3300053730 | Bacteria | 147392 |
| 972 | Ga0501084_0269990 | 3300054114 | Bacteria | 1436 |
| 973 | Ga0587073_0010886 | 3300059492 | Bacteria | 1540 |
| 974 | Ga0466962_0001673 | 3300061719 | Bacteria | 10405 |
| 975 | Ga0466962_0046521 | 3300061719 | Bacteria | 2073 |
| 976 | Ga0466962_0175076 | 3300061719 | Bacteria | 1045 |
| 977 | 3006427120 | 3006425503 | Bacteria | 6491253 |
| 978 | 2501941838 | 2501939600 | Bacteria | 6907073 |
| 979 | 2508672363 | 2508501039 | Bacteria | 9978592 |
| 980 | 2515493927 | 2515154088 | Bacteria | 5526283 |
| 981 | 2515720613 | 2515154129 | Bacteria | 5584369 |
| 982 | 2515755303 | 2515154137 | Bacteria | 5711575 |
| 983 | 2516086763 | 2515154202 | Bacteria | 5471270 |
| 984 | 2516092349 | 2515154203 | Bacteria | 5458536 |
| 985 | 2517760698 | 2517572101 | Bacteria | 6884336 |
| 986 | 2547410287 | 2547132111 | Bacteria | 8013147 |
| 987 | 2554260713 | 2554235005 | Bacteria | 6457341 |
| 988 | 2585298140 | 2582581312 | Bacteria | 7308206 |
| 989 | 2585304637 | 2582581313 | Bacteria | 10042643 |
| 990 | 2585314746 | 2582581314 | Bacteria | 11452267 |
| 991 | 2585320742 | 2582581314 | Bacteria | 11452267 |
| 992 | 2616698179 | 2616644814 | Bacteria | 11555299 |
| 993 | 2616901487 | 2616644941 | Bacteria | 8510691 |
| 994 | 2619856603 | 2619618881 | Bacteria | 7521104 |
| 995 | 2620348831 | 2619619003 | Bacteria | 7619552 |
| 996 | 2623502296 | 2622736605 | Bacteria | 4992138 |
| 997 | 2623586429 | 2622736626 | Bacteria | 7181580 |
| 998 | 2643762049 | 2643221548 | Bacteria | 8053412 |
| 999 | 2643901989 | 2643221578 | Bacteria | 9213798 |
| 1000 | 2643946239 | 2643221587 | Bacteria | 7586415 |
| 1001 | 2644017983 | 2643221601 | Bacteria | 7493239 |
| 1002 | 2644180729 | 2643221631 | Bacteria | 8168043 |
| 1003 | 2644261972 | 2643221647 | Bacteria | 10741251 |
| 1004 | 2644388009 | 2643221670 | Bacteria | 6497041 |
| 1005 | 2644408133 | 2643221673 | Bacteria | 9196637 |
| 1006 | 2644433028 | 2643221677 | Bacteria | 7584031 |
| 1007 | 2644442826 | 2643221678 | Bacteria | 9540101 |
| 1008 | 2644445919 | 2643221679 | Bacteria | 3839507 |
| 1009 | 2644460524 | 2643221682 | Bacteria | 6743283 |
| 1010 | 2644631319 | 2643221714 | Bacteria | 9015452 |
| 1011 | 2676198228 | 2675902999 | Bacteria | 9438463 |
| 1012 | 2686537434 | 2684623035 | Bacteria | 8032739 |
| 1013 | 2689959502 | 2687453737 | Bacteria | 11203906 |
| 1014 | 2738704581 | 2738541274 | Bacteria | 6909446 |
| 1015 | 2739330936 | 2738543028 | Bacteria | 6917070 |
| 1016 | 2753073310 | 2751185734 | Bacteria | 8863695 |
| 1017 | 2768645653 | 2767802112 | Bacteria | 6465194 |
| 1018 | 2772641666 | 2772190715 | Bacteria | 6959372 |
| 1019 | 2774842806 | 2773857921 | Bacteria | 9435764 |
| 1020 | 2784591631 | 2784132148 | Bacteria | 8627943 |
| 1021 | 2785340102 | 2784746763 | Bacteria | 9783172 |
| 1022 | 2785372635 | 2784746768 | Bacteria | 10036182 |
| 1023 | 2786675348 | 2786546132 | Bacteria | 10419719 |
| 1024 | 2793983360 | 2791355406 | Bacteria | 11364898 |
| 1025 | 2804848905 | 2802429296 | Bacteria | 7227771 |
| 1026 | 2808844990 | 2808606359 | Bacteria | 9866990 |
| 1027 | 2808914589 | 2808606375 | Bacteria | 9466072 |
| 1028 | 2809235262 | 2808606448 | Bacteria | 8656184 |
| 1029 | 2811843532 | 2808606982 | Bacteria | 7791042 |
| 1030 | 2812354698 | 2811994879 | Bacteria | 9313447 |
| 1031 | 2812477667 | 2811994917 | Bacteria | 7761064 |
| 1032 | 2819698790 | 2818991463 | Bacteria | 7948711 |
| 1033 | 2819740052 | 2818991472 | Bacteria | 10089953 |
| 1034 | 2831939901 | 2831935698 | Bacteria | 5963223 |
| 1035 | 2852636318 | 2852635781 | Bacteria | 8251373 |
| 1036 | 2855672222 | 2855670206 | Bacteria | 7120389 |
| 1037 | 2855678861 | 2855676851 | Bacteria | 7063653 |
| 1038 | 2855685287 | 2855683550 | Bacteria | 7134265 |
| 1039 | 2856860347 | 2856858025 | Bacteria | 7255264 |
| 1040 | 2857295166 | 2857288857 | Bacteria | 7189066 |
| 1041 | 2858854529 | 2858848962 | Bacteria | 6963058 |
| 1042 | 2858874080 | 2858868258 | Bacteria | 7683772 |
| 1043 | 2858888531 | 2858882152 | Bacteria | 7230291 |
| 1044 | 2858890763 | 2858888857 | Bacteria | 7060307 |
| 1045 | 2858898549 | 2858895516 | Bacteria | 7378898 |
| 1046 | 2858905637 | 2858902515 | Bacteria | 7086037 |
| 1047 | 2861520752 | 2861520306 | Bacteria | 8348283 |
| 1048 | 2862183994 | 2862178590 | Bacteria | 8583590 |
| 1049 | 2862283411 | 2862281513 | Bacteria | 9621493 |
| 1050 | 2862294886 | 2862290372 | Bacteria | 7471434 |
| 1051 | 2862390353 | 2862382967 | Bacteria | 10317375 |
| 1052 | 2862507768 | 2862507626 | Bacteria | 9425308 |
| 1053 | 2862576440 | 2862574272 | Bacteria | 10567477 |
| 1054 | 2862708960 | 2862705112 | Bacteria | 6563286 |
| 1055 | 2863409865 | 2863404153 | Bacteria | 9672205 |
| 1056 | 2867303801 | 2867302475 | Bacteria | 7087181 |
| 1057 | 2867313361 | 2867312974 | Bacteria | 7058875 |
| 1058 | 2867322820 | 2867319477 | Bacteria | 7069771 |
| 1059 | 2867350709 | 2867346516 | Bacteria | 7608576 |
| 1060 | 2867374650 | 2867369537 | Bacteria | 6501581 |
| 1061 | 2867432042 | 2867428634 | Bacteria | 9590268 |
| 1062 | 2867475208 | 2867475112 | Bacteria | 6909112 |
| 1063 | 2869054196 | 2869048445 | Bacteria | 6875584 |
| 1064 | 2869065818 | 2869061728 | Bacteria | 7112407 |
| 1065 | 2869070630 | 2869068681 | Bacteria | 7205615 |
| 1066 | 2870729135 | 2870721527 | Bacteria | 9689237 |
| 1067 | 2873152939 | 2873151551 | Bacteria | 8625867 |
| 1068 | 2873316937 | 2873314349 | Bacteria | 8512634 |
| 1069 | 2875397702 | 2875391855 | Bacteria | 7600475 |
| 1070 | 2877678080 | 2877676314 | Bacteria | 9512378 |
| 1071 | 2880493752 | 2880489317 | Bacteria | 7096270 |
| 1072 | 2880498570 | 2880495981 | Bacteria | 7340502 |
| 1073 | 2887483702 | 2887478801 | Bacteria | 8972725 |
| 1074 | 2895882362 | 2895880812 | Bacteria | 11255272 |
| 1075 | 2902586400 | 2902582711 | Bacteria | 6187705 |
| 1076 | 2912716319 | 2912715099 | Bacteria | 9460473 |
| 1077 | 2912729231 | 2912723979 | Bacteria | 8557534 |
| 1078 | 2912763904 | 2912757875 | Bacteria | 7940295 |
| 1079 | 2915363200 | 2915358134 | Bacteria | 6050864 |
| 1080 | 2918507480 | 2918501144 | Bacteria | 8668083 |
| 1081 | 2919471213 | 2919468124 | Bacteria | 9133025 |
| 1082 | 2929220562 | 2929219909 | Bacteria | 6984360 |
| 1083 | 2929227149 | 2929226422 | Bacteria | 7248583 |
| 1084 | 2935395381 | 2935390628 | Bacteria | 7043367 |
| 1085 | 2946046823 | 2946045630 | Bacteria | 8527308 |
| 1086 | 2946070965 | 2946064051 | Bacteria | 8957905 |
| 1087 | 2946078896 | 2946072368 | Bacteria | 8999607 |
| 1088 | 2947225758 | 2947224130 | Bacteria | 9938529 |
| 1089 | 2954009929 | 2954002825 | Bacteria | 9173742 |
| 1090 | 2954382865 | 2954380949 | Bacteria | 10050426 |
| 1091 | 2954680025 | 2954673503 | Bacteria | 9685905 |
| 1092 | 2954684125 | 2954682443 | Bacteria | 9862841 |
| 1093 | 2954693686 | 2954691527 | Bacteria | 10720516 |
| 1094 | 2954708782 | 2954701450 | Bacteria | 10834262 |
| 1095 | 2954713332 | 2954711539 | Bacteria | 10867210 |
| 1096 | 2954723292 | 2954721474 | Bacteria | 10456478 |
| 1097 | 2954738536 | 2954731030 | Bacteria | 10243860 |
| 1098 | 2954742199 | 2954740390 | Bacteria | 10229294 |
| 1099 | 2954757394 | 2954749733 | Bacteria | 10366972 |
| 1100 | 2954761177 | 2954759201 | Bacteria | 9358192 |
| 1101 | 2966599832 | 2966598605 | Bacteria | 7676064 |
| 1102 | 2990049080 | 2990044586 | Bacteria | 6603797 |
| 1103 | 2990061816 | 2990059506 | Bacteria | 9321252 |
| 1104 | 2990090597 | 2990088156 | Bacteria | 6657676 |
| 1105 | 2995464977 | 2995463766 | Bacteria | 8577691 |
| 1106 | 2996224790 | 2996221748 | Bacteria | 6799777 |
| 1107 | 2997603497 | 2997600082 | Bacteria | 9896405 |
| 1108 | 3006393739 | 3006393351 | Bacteria | 6615579 |
| 1109 | 3006488800 | 3006486233 | Bacteria | 8157040 |
| 1110 | 3006494213 | 3006493962 | Bacteria | 8825450 |
| 1111 | 649811086 | 649633069 | Bacteria | 6962533 |
| 1112 | 8001782516 | 8001781756 | Bacteria | 9586736 |
| 1113 | 8002782595 | 8002775197 | Bacteria | 10728764 |
| 1114 | 8002789206 | 8002784119 | Bacteria | 9788632 |
| 1115 | 8003835340 | 8003830390 | Bacteria | 6541657 |
| 1116 | 8003859362 | 8003856774 | Bacteria | 7675274 |
| 1117 | 8003873527 | 8003870546 | Bacteria | 7396674 |
| 1118 | 8008489881 | 8008485437 | Bacteria | 7198341 |
| 1119 | 8008563958 | 8008558824 | Bacteria | 10610750 |
| 1120 | 8008576105 | 8008574985 | Bacteria | 7815457 |
| 1121 | 8025417518 | 8025413630 | Bacteria | 7014048 |
| 1122 | 8025479388 | 8025478263 | Bacteria | 8209203 |
| 1123 | 8025529387 | 8025524527 | Bacteria | 7197316 |
| 1124 | 8025533058 | 8025530807 | Bacteria | 8495698 |
| 1125 | 8033687519 | 8033684223 | Bacteria | 6906479 |
| 1126 | 8047715083 | 8047710418 | Bacteria | 11023148 |
| 1127 | 8047895314 | 8047893842 | Bacteria | 11723082 |
| 1128 | 8048130607 | 8048127548 | Bacteria | 11053136 |
| 1129 | 8048363639 | 8048356638 | Bacteria | 11044339 |
| 1130 | 8048372340 | 8048369669 | Bacteria | 11666822 |
| 1131 | 8048381274 | 8048379754 | Bacteria | 11877923 |
| 1132 | 8048407049 | 8048406513 | Bacteria | 8936924 |
| 1133 | 8054161891 | 8054160619 | Bacteria | 7783213 |
| 1134 | 8054472266 | 8054472261 | Bacteria | 7464355 |
| 1135 | 8054708083 | 8054704163 | Bacteria | 7247792 |
| 1136 | 8054730994 | 8054727385 | Bacteria | 7558670 |
| 1137 | 8054735125 | 8054734606 | Bacteria | 6947278 |
| 1138 | 8054922261 | 8054920844 | Bacteria | 7068637 |
| 1139 | 8055177335 | 8055172936 | Bacteria | 9305943 |
| 1140 | 8055414779 | 8055412473 | Bacteria | 6257500 |
| 1141 | 8056448711 | 8056447290 | Bacteria | 7680491 |
| 1142 | 8056667265 | 8056667051 | Bacteria | 6953971 |
| 1143 | 8056837022 | 8056829672 | Bacteria | 9045328 |
| 1144 | 8057568881 | 8057568493 | Bacteria | 7221719 |
| 1145 | JGI24740J21852_10031249 | |||
| 1146 | JGI24739J22299_10014962 | |||
| 1147 | JGI24737J22298_10003773 | |||
| 1148 | JGI24735J21928_10006190 | |||
| 1149 | JGI25406J46586_10052624 | |||
| 1150 | Ga0070658_10046686 | |||
| 1151 | Ga0070658_10079963 | |||
| 1152 | Ga0070658_10182182 | |||
| 1153 | Ga0070683_100051410 | |||
| 1154 | Ga0070683_100086529 | |||
| 1155 | Ga0070683_100136449 | |||
| 1156 | Ga0068869_100098240 | |||
| 1157 | Ga0070666_10058747 | |||
| 1158 | Ga0070682_100049397 | |||
| 1159 | Ga0068868_100015603 | |||
| 1160 | Ga0070689_100023274 | |||
| 1161 | Ga0070661_100019223 | |||
| 1162 | Ga0070692_10029693 | |||
| 1163 | Ga0070668_100024409 | |||
| 1164 | Ga0070668_100150113 | |||
| 1165 | Ga0070669_100261871 | |||
| 1166 | Ga0070675_100015301 | |||
| 1167 | Ga0070671_100000423 | |||
| 1168 | Ga0070671_100027777 | |||
| 1169 | Ga0070671_100033282 | |||
| 1170 | Ga0070674_100107123 | |||
| 1171 | Ga0070674_100187149 | |||
| 1172 | Ga0070673_100073041 | |||
| 1173 | Ga0070659_100015592 | |||
| 1174 | Ga0070667_100000107 | |||
| 1175 | Ga0070709_10000214 | |||
| 1176 | Ga0070709_10011998 | |||
| 1177 | Ga0070709_10020061 | |||
| 1178 | Ga0070709_10155492 | |||
| 1179 | Ga0070714_100000057 | |||
| 1180 | Ga0070714_100004897 | |||
| 1181 | Ga0070714_100011815 | |||
| 1182 | Ga0070714_100069853 | |||
| 1183 | Ga0070714_100101756 | |||
| 1184 | Ga0070714_100602084 | |||
| 1185 | Ga0070713_100008107 | |||
| 1186 | Ga0070713_100060309 | |||
| 1187 | Ga0070713_100075005 | |||
| 1188 | Ga0070713_100075215 | |||
| 1189 | Ga0070710_10000110 | |||
| 1190 | Ga0070710_10028434 | |||
| 1191 | Ga0070710_10217422 | |||
| 1192 | Ga0070711_100015408 | |||
| 1193 | Ga0070711_100103921 | |||
| 1194 | Ga0070705_100014490 | |||
| 1195 | Ga0070700_100088204 | |||
| 1196 | Ga0070708_100058281 | |||
| 1197 | Ga0070708_100330443 | |||
| 1198 | Ga0070663_100022237 | |||
| 1199 | Ga0070678_100001811 | |||
| 1200 | Ga0070681_10021940 | |||
| 1201 | Ga0070681_10236863 | |||
| 1202 | Ga0070685_10080411 | |||
| 1203 | Ga0070685_10174963 | |||
| 1204 | Ga0070706_100026494 | |||
| 1205 | Ga0070707_100059415 | |||
| 1206 | Ga0070707_100143892 | |||
| 1207 | Ga0070698_100099365 | |||
| 1208 | Ga0070699_100000384 | |||
| 1209 | Ga0070679_100023224 | |||
| 1210 | Ga0070684_100010145 | |||
| 1211 | Ga0070684_100021126 | |||
| 1212 | Ga0070697_100184277 | |||
| 1213 | Ga0068853_100220319 | |||
| 1214 | Ga0070686_100141588 | |||
| 1215 | Ga0070696_100005128 | |||
| 1216 | Ga0070665_100015231 | |||
| 1217 | Ga0070665_100053585 | |||
| 1218 | Ga0070665_100055726 | |||
| 1219 | Ga0070665_100398968 | |||
| 1220 | Ga0070704_100071102 | |||
| 1221 | Ga0070704_100388678 | |||
| 1222 | Ga0068855_100141925 | |||
| 1223 | Ga0068855_100173016 | |||
| 1224 | Ga0070664_100092976 | |||
| 1225 | Ga0070664_100533815 | |||
| 1226 | Ga0068857_100035113 | |||
| 1227 | Ga0068854_100006340 | |||
| 1228 | Ga0068854_100016608 | |||
| 1229 | Ga0068854_100190747 | |||
| 1230 | Ga0068856_100030994 | |||
| 1231 | Ga0068856_100091705 | |||
| 1232 | Ga0068856_100164550 | |||
| 1233 | Ga0068856_100166502 | |||
| 1234 | Ga0068856_100191478 | |||
| 1235 | Ga0068856_100300290 | |||
| 1236 | Ga0070702_100001124 | |||
| 1237 | Ga0070702_100007054 | |||
| 1238 | Ga0068852_100003907 | |||
| 1239 | Ga0068852_100013889 | |||
| 1240 | Ga0068859_100000301 | |||
| 1241 | Ga0068859_100018104 | |||
| 1242 | Ga0068859_100724964 | |||
| 1243 | Ga0068864_100001934 | |||
| 1244 | Ga0068864_100028442 | |||
| 1245 | Ga0068851_10019796 | |||
| 1246 | Ga0068870_10000378 | |||
| 1247 | Ga0068863_100000163 | |||
| 1248 | Ga0068863_100001505 | |||
| 1249 | Ga0068863_100042732 | |||
| 1250 | Ga0068863_100044881 | |||
| 1251 | Ga0068863_100339283 | |||
| 1252 | Ga0068858_100000071 | |||
| 1253 | Ga0068858_100009793 | |||
| 1254 | Ga0068858_100055569 | |||
| 1255 | Ga0068860_100072600 | |||
| 1256 | Ga0068862_100000049 | |||
| 1257 | Ga0068862_100155262 | |||
| 1258 | Ga0081455_10000436 | |||
| 1259 | Ga0081455_10012252 | |||
| 1260 | Ga0081455_10046773 | |||
| 1261 | Ga0081455_10130375 | |||
| 1262 | Ga0081538_10000120 | |||
| 1263 | Ga0081538_10027673 | |||
| 1264 | Ga0081540_1049020 | |||
| 1265 | Ga0081539_10000094 | |||
| 1266 | Ga0070717_10006278 | |||
| 1267 | Ga0070717_10060107 | |||
| 1268 | Ga0075368_10011215 | |||
| 1269 | Ga0075363_100057075 | |||
| 1270 | Ga0075363_100221265 | |||
| 1271 | Ga0075364_10041167 | |||
| 1272 | Ga0070716_100024466 | |||
| 1273 | Ga0070712_100077576 | |||
| 1274 | Ga0075362_10075251 | |||
| 1275 | Ga0075367_10024053 | |||
| 1276 | Ga0075369_10004469 | |||
| 1277 | Ga0075369_10037118 | |||
| 1278 | Ga0075369_10048349 | |||
| 1279 | Ga0097621_100018176 | |||
| 1280 | Ga0097621_100047019 | |||
| 1281 | Ga0075370_10024496 | |||
| 1282 | Ga0075428_100001540 | |||
| 1283 | Ga0075428_100007363 | |||
| 1284 | Ga0075428_100107885 | |||
| 1285 | Ga0075430_100004383 | |||
| 1286 | Ga0075430_100032198 | |||
| 1287 | Ga0075430_100113458 | |||
| 1288 | Ga0075431_100001429 | |||
| 1289 | Ga0075431_100014993 | |||
| 1290 | Ga0075431_100058914 | |||
| 1291 | Ga0075431_100085491 | |||
| 1292 | Ga0075433_10234417 | |||
| 1293 | Ga0075433_10246032 | |||
| 1294 | Ga0075434_100016866 | |||
| 1295 | Ga0075429_100002452 | |||
| 1296 | Ga0075429_100016645 | |||
| 1297 | Ga0075436_100060147 | |||
| 1298 | Ga0075436_100062018 | |||
| 1299 | Ga0097620_100000301 | |||
| 1300 | Ga0097620_100003956 | |||
| 1301 | Ga0097620_100018103 | |||
| 1302 | Ga0097620_100725047 | |||
| 1303 | Ga0075435_100000179 | |||
| 1304 | Ga0075435_100054488 | |||
| 1305 | Ga0105251_10027499 | |||
| 1306 | Ga0111539_10186344 | |||
| 1307 | Ga0111539_10190759 | |||
| 1308 | Ga0105245_10015407 | |||
| 1309 | Ga0105245_10433783 | |||
| 1310 | Ga0105247_10006623 | |||
| 1311 | Ga0105247_10106351 | |||
| 1312 | Ga0114129_10000114 | |||
| 1313 | Ga0114129_10006796 | |||
| 1314 | Ga0114129_10021079 | |||
| 1315 | Ga0114129_10128746 | |||
| 1316 | Ga0114129_10169894 | |||
| 1317 | Ga0114129_10681924 | |||
| 1318 | Ga0105243_10018141 | |||
| 1319 | Ga0105243_10173052 | |||
| 1320 | Ga0105241_10004674 | |||
| 1321 | Ga0105241_10036208 | |||
| 1322 | Ga0105242_10258286 | |||
| 1323 | Ga0105248_10000147 | |||
| 1324 | Ga0105248_10045177 | |||
| 1325 | Ga0105237_10060326 | |||
| 1326 | Ga0105237_10127652 | |||
| 1327 | Ga0105237_10703775 | |||
| 1328 | Ga0105238_10007937 | |||
| 1329 | Ga0105238_10010755 | |||
| 1330 | Ga0105239_10070182 | |||
| 1331 | Ga0105246_10072065 | |||
| 1332 | Ga0157347_1001020 | |||
| 1333 | Ga0157370_10051790 | |||
| 1334 | Ga0157369_10002237 | |||
| 1335 | Ga0157369_10058286 | |||
| 1336 | Ga0157369_10073964 | |||
| 1337 | Ga0157369_10122628 | |||
| 1338 | Ga0157369_10512748 | |||
| 1339 | Ga0157374_10073710 | |||
| 1340 | Ga0157378_10181261 | |||
| 1341 | Ga0163162_10441959 | |||
| 1342 | Ga0163162_10721092 | |||
| 1343 | Ga0157372_10191723 | |||
| 1344 | Ga0157372_10387649 | |||
| 1345 | Ga0157372_10639252 | |||
| 1346 | Ga0157375_10013269 | |||
| 1347 | Ga0157375_10036863 | |||
| 1348 | Ga0157375_10296018 | |||
| 1349 | Ga0157375_10543177 | |||
| 1350 | Ga0163163_10009454 | |||
| 1351 | Ga0163163_10056866 | |||
| 1352 | Ga0163163_10074970 | |||
| 1353 | Ga0163163_10349925 | |||
| 1354 | Ga0163163_10376133 | |||
| 1355 | Ga0182008_10006605 | |||
| 1356 | Ga0157379_10004275 | |||
| 1357 | Ga0157379_10019486 | |||
| 1358 | Ga0157376_10227272 | |||
| 1359 | Ga0182006_1015903 | |||
| 1360 | Ga0182007_10000483 | |||
| 1361 | Ga0183367_1001 | |||
| 1362 | Ga0163161_10349450 | |||
| 1363 | Ga0206354_10776292 | |||
| 1364 | Ga0206354_11017713 | |||
| 1365 | Ga0213872_10135785 | |||
| 1366 | Ga0213874_10005715 | |||
| 1367 | Ga0213875_10000917 | |||
| 1368 | Ga0213875_10106535 | |||
| 1369 | Ga0224712_10087932 | |||
| 1370 | Ga0224712_10138368 | |||
| 1371 | Ga0209758_1007704 | |||
| 1372 | Ga0207426_1000849 | |||
| 1373 | Ga0207426_1002327 | |||
| 1374 | Ga0207426_1012862 | |||
| 1375 | Ga0207426_1021649 | |||
| 1376 | Ga0207692_10211366 | |||
| 1377 | Ga0207688_10011941 | |||
| 1378 | Ga0207647_10002261 | |||
| 1379 | Ga0207647_10009502 | |||
| 1380 | Ga0207699_10000045 | |||
| 1381 | Ga0207699_10016909 | |||
| 1382 | Ga0207699_10057723 | |||
| 1383 | Ga0207699_10101050 | |||
| 1384 | Ga0207645_10200563 | |||
| 1385 | Ga0207643_10000027 | |||
| 1386 | Ga0207684_10048311 | |||
| 1387 | Ga0207684_10073144 | |||
| 1388 | Ga0207684_10182251 | |||
| 1389 | Ga0207654_10046636 | |||
| 1390 | Ga0207707_10072390 | |||
| 1391 | Ga0207695_10000679 | |||
| 1392 | Ga0207671_10000052 | |||
| 1393 | Ga0207693_10044047 | |||
| 1394 | Ga0207693_10085433 | |||
| 1395 | Ga0207657_10024194 | |||
| 1396 | Ga0207657_10214499 | |||
| 1397 | Ga0207649_10281023 | |||
| 1398 | Ga0207652_10033501 | |||
| 1399 | Ga0207652_10198519 | |||
| 1400 | Ga0207646_10018631 | |||
| 1401 | Ga0207646_10052294 | |||
| 1402 | Ga0207646_10173970 | |||
| 1403 | Ga0207694_10000079 | |||
| 1404 | Ga0207650_10379901 | |||
| 1405 | Ga0207659_10000900 | |||
| 1406 | Ga0207659_10046499 | |||
| 1407 | Ga0207687_10004998 | |||
| 1408 | Ga0207687_10014787 | |||
| 1409 | Ga0207700_10001094 | |||
| 1410 | Ga0207700_10077230 | |||
| 1411 | Ga0207700_10289546 | |||
| 1412 | Ga0207700_10408527 | |||
| 1413 | Ga0207664_10015691 | |||
| 1414 | Ga0207690_10035103 | |||
| 1415 | Ga0207690_10359613 | |||
| 1416 | Ga0207706_10058789 | |||
| 1417 | Ga0207706_10090727 | |||
| 1418 | Ga0207686_10122039 | |||
| 1419 | Ga0207670_10018350 | |||
| 1420 | Ga0207669_10240851 | |||
| 1421 | Ga0207665_10017388 | |||
| 1422 | Ga0207665_10039284 | |||
| 1423 | Ga0207691_10062022 | |||
| 1424 | Ga0207711_10000056 | |||
| 1425 | Ga0207711_10093249 | |||
| 1426 | Ga0207711_10440661 | |||
| 1427 | Ga0207689_10000694 | |||
| 1428 | Ga0207689_10021188 | |||
| 1429 | Ga0207661_10007868 | |||
| 1430 | Ga0207661_10013863 | |||
| 1431 | Ga0207661_10054987 | |||
| 1432 | Ga0207661_10105630 | |||
| 1433 | Ga0207679_10001380 | |||
| 1434 | Ga0207679_10006279 | |||
| 1435 | Ga0207679_10521671 | |||
| 1436 | Ga0207667_10162082 | |||
| 1437 | Ga0207668_10008379 | |||
| 1438 | Ga0207668_10081751 | |||
| 1439 | Ga0207640_10181546 | |||
| 1440 | Ga0207658_10183242 | |||
| 1441 | Ga0207677_10002817 | |||
| 1442 | Ga0207703_10027365 | |||
| 1443 | Ga0207703_10031087 | |||
| 1444 | Ga0207703_10257060 | |||
| 1445 | Ga0207639_10072740 | |||
| 1446 | Ga0207678_10000488 | |||
| 1447 | Ga0207678_10003800 | |||
| 1448 | Ga0207708_10049841 | |||
| 1449 | Ga0207702_10001273 | |||
| 1450 | Ga0207702_10001529 | |||
| 1451 | Ga0207702_10031656 | |||
| 1452 | Ga0207641_10004949 | |||
| 1453 | Ga0207641_10048601 | |||
| 1454 | Ga0207676_10000549 | |||
| 1455 | Ga0207676_10007940 | |||
| 1456 | Ga0207676_10122269 | |||
| 1457 | Ga0207676_10297645 | |||
| 1458 | Ga0207674_10006778 | |||
| 1459 | Ga0207674_10018991 | |||
| 1460 | Ga0207674_10049188 | |||
| 1461 | Ga0207675_100249787 | |||
| 1462 | Ga0207683_10001061 | |||
| 1463 | Ga0207683_10004644 | |||
| 1464 | Ga0207683_10046231 | |||
| 1465 | Ga0207683_10499159 | |||
| 1466 | Ga0207698_10010709 | |||
| 1467 | Ga0207698_10057408 | |||
| 1468 | Ga0207428_10083312 | |||
| 1469 | Ga0207428_10137930 | |||
| 1470 | Ga0268265_10000017 | |||
| 1471 | Ga0268265_10121731 | |||
| 1472 | Ga0268264_10315938 | |||
| 1473 | Ga0307517_10002786 | |||
| 1474 | Ga0307515_10000055 | |||
| 1475 | Ga0307515_10008569 | |||
| 1476 | Ga0307515_10142298 | |||
| 1477 | Ga0307511_10001943 | |||
| 1478 | Ga0307511_10029818 | |||
| 1479 | Ga0316176_1141749 | |||
| 1480 | Ga0265776_100008 | |||
| 1481 | Ga0265764_100820 | |||
| 1482 | Ga0265773_1000473 | |||
| 1483 | Ga0265327_10000329 | |||
| 1484 | Ga0265327_10027323 | |||
| 1485 | Ga0307513_10014342 | |||
| 1486 | Ga0307513_10136084 | |||
| 1487 | Ga0307513_10339511 | |||
| 1488 | Ga0307509_10051822 | |||
| 1489 | Ga0307408_100188893 | |||
| 1490 | Ga0307508_10003092 | |||
| 1491 | Ga0316575_10002683 | |||
| 1492 | Ga0316576_10002106 | |||
| 1493 | Ga0316576_10251049 | |||
| 1494 | Ga0307516_10037213 | |||
| 1495 | Ga0307516_10071167 | |||
| 1496 | Ga0307516_10076688 | |||
| 1497 | Ga0307406_10169044 | |||
| 1498 | Ga0307412_10113832 | |||
| 1499 | Ga0307409_100098457 | |||
| 1500 | Ga0307409_100542132 | |||
| 1501 | Ga0307411_10058483 | |||
| 1502 | Ga0307415_100009278 | |||
| 1503 | Ga0307415_100044916 | |||
| 1504 | Ga0307415_100090192 | |||
| 1505 | Ga0307415_100310339 | |||
| 1506 | Ga0307507_10007023 | |||
| 1507 | Ga0307510_10075231 | |||
| 1508 | Ga0307510_10172608 | |||
| 1509 | Ga0373934_0000067 | |||
| 1510 | Ga0373934_0006812 | |||
| 1511 | Ga0373934_0010114 | |||
| 1512 | Ga0373934_0016221 | |||
| 1513 | Ga0373944_0002039 | |||
| 1514 | Ga0373944_0016332 | |||
| 1515 | Ga0373923_0000852 | |||
| 1516 | Ga0373923_0002822 | |||
| 1517 | Ga0373923_0032650 | |||
| 1518 | Ga0373923_0038968 | |||
| 1519 | Ga0373936_0009870 | |||
| 1520 | Ga0373936_0031090 | |||
| 1521 | Ga0373941_0083581 | |||
| 1522 | Ga0373945_0002168 | |||
| 1523 | Ga0373953_0065770 | |||
| 1524 | Ga0373953_0067502 | |||
| 1525 | Ga0373954_0009816 | |||
| 1526 | Ga0373956_0000258 | |||
| 1527 | Ga0373956_0015501 | |||
| 1528 | Ga0373956_0082362 | |||
| 1529 | Ga0373957_0000388 | |||
| 1530 | Ga0373957_0007302 | |||
| 1531 | Ga0373957_0010416 | |||
| 1532 | Ga0373957_0010520 | |||
| 1533 | Ga0373957_0034218 | |||
| 1534 | Ga0373943_0000066 | |||
| 1535 | Ga0373943_0089716 | |||
| 1536 | Ga0373946_0000019 | |||
| 1537 | Ga0373946_0144640 | |||
| 1538 | Ga0373955_0000019 | |||
| 1539 | Ga0373955_0031714 | |||
| 1540 | Ga0316574_0005553 | |||
| 1541 | Ga0316574_0117169 | |||
| 1542 | Ga0316574_0170936 | |||
| 1543 | Ga0373924_0004826 | |||
| 1544 | Ga0373924_0033155 | |||
| 1545 | Ga0373924_0087759 | |||
| 1546 | Ga0373931_0000846 | |||
| 1547 | Ga0373931_0106768 | |||
| 1548 | Ga0373935_0013238 | |||
| 1549 | Ga0373935_0079052 | |||
| 1550 | Ga0373927_0009825 | |||
| 1551 | Ga0373927_0204465 | |||
| 1552 | Ga0373933_0000120 | |||
| 1553 | Ga0373933_0003631 | |||
| 1554 | Ga0373933_0007380 | |||
| 1555 | Ga0373933_0010673 | |||
| 1556 | Ga0373933_0061185 | |||
| 1557 | Ga0373947_0000197 | |||
| 1558 | Ga0373947_0164982 | |||
| 1559 | Ga0373937_0000147 | |||
| 1560 | Ga0373937_0001943 | |||
| 1561 | Ga0373937_0084878 | |||
| 1562 | Ga0373937_0089250 | |||
| 1563 | Ga0373937_0541126 | |||
| 1564 | Ga0265778_000478 | |||
| 1565 | Ga0373925_0000869 | |||
| 1566 | Ga0373925_0022121 | |||
| 1567 | Ga0373925_0089754 | |||
| 1568 | Ga0373925_0299305 | |||
| 1569 | Ga0395899_0270692 | |||
| 1570 | Ga0395900_0053423 | |||
| 1571 | Ga0395898_0030129 | |||
| 1572 | Ga0395898_0041335 | |||
| 1573 | Ga0395898_0086423 | |||
| 1574 | Ga0395905_0344806 | |||
| 1575 | Ga0436364_0199487 | |||
| 1576 | Ga0436364_0332506 | |||
| 1577 | Ga0436364_0351592 | |||
| 1578 | Ga0436364_0501469 | |||
| 1579 | Ga0395901_0005116 | |||
| 1580 | Ga0395901_0483000 | |||
| 1581 | Ga0400485_08257 | |||
| 1582 | Ga0400488_00407 | |||
| 1583 | Ga0436361_1211127 | |||
| 1584 | Ga0436363_0319333 | |||
| 1585 | Ga0436363_0578534 | |||
| 1586 | Ga0436362_1109190 | |||
| 1587 | Ga0439436_0010941 | |||
| 1588 | Ga0451841_0483166 | |||
| 1589 | Ga0451853_0512039 | |||
| 1590 | Ga0439433_0003699 | |||
| 1591 | Ga0439442_007081 | |||
| 1592 | Ga0439448_0029424 | |||
| 1593 | Ga0439448_0053566 | |||
| 1594 | Ga0439449_0005876 | |||
| 1595 | Ga0439457_000906 | |||
| 1596 | Ga0450894_000084 | |||
| 1597 | Ga0450896_003054 | |||
| 1598 | Ga0450899_002814 | |||
| 1599 | Ga0439460_0032788 | |||
| 1600 | Ga0466969_0002252 | |||
| 1601 | Ga0466969_0003530 | |||
| 1602 | Ga0466969_0005190 | |||
| 1603 | Ga0466969_0010323 | |||
| 1604 | Ga0466972_0024478 | |||
| 1605 | Ga0466972_0024819 | |||
| 1606 | Ga0466972_0062248 | |||
| 1607 | Ga0466972_0069005 | |||
| 1608 | Ga0466965_0004182 | |||
| 1609 | Ga0466965_0006273 | |||
| 1610 | Ga0466965_0007599 | |||
| 1611 | Ga0466966_0002064 | |||
| 1612 | Ga0466966_0022938 | |||
| 1613 | Ga0466966_0031046 | |||
| 1614 | Ga0466966_0041306 | |||
| 1615 | Ga0466966_0041941 | |||
| 1616 | Ga0466961_0001303 | |||
| 1617 | Ga0466961_0006030 | |||
| 1618 | Ga0466961_0010306 | |||
| 1619 | Ga0466961_0011703 | |||
| 1620 | Ga0466961_0029102 | |||
| 1621 | Ga0466961_0038583 | |||
| 1622 | Ga0466961_0052929 | |||
| 1623 | Ga0466963_0001025 | |||
| 1624 | Ga0466963_0011650 | |||
| 1625 | Ga0466963_0035665 | |||
| 1626 | Ga0466963_0052124 | |||
| 1627 | Ga0466964_0005930 | |||
| 1628 | Ga0466971_0000360 | |||
| 1629 | Ga0466971_0001585 | |||
| 1630 | Ga0466971_0140520 | |||
| 1631 | Ga0466971_0144953 | |||
| 1632 | Ga0466970_0006767 | |||
| 1633 | Ga0466970_0008296 | |||
| 1634 | Ga0466970_0015913 | |||
| 1635 | Ga0466970_0068179 | |||
| 1636 | Ga0466957_0000665 | |||
| 1637 | Ga0466957_0087652 | |||
| 1638 | Ga0466957_0114810 | |||
| 1639 | Ga0466957_0306276 | |||
| 1640 | Ga0466960_0002372 | |||
| 1641 | Ga0466960_0003337 | |||
| 1642 | Ga0466960_0013645 | |||
| 1643 | Ga0466960_0104426 | |||
| 1644 | Ga0466959_0001547 | |||
| 1645 | Ga0466959_0004284 | |||
| 1646 | Ga0466959_0004866 | |||
| 1647 | Ga0466959_0030100 | |||
| 1648 | Ga0466959_0175124 | |||
| 1649 | Ga0466958_0002860 | |||
| 1650 | Ga0466958_0004749 | |||
| 1651 | Ga0466958_0039394 | |||
| 1652 | Ga0466958_0040735 | |||
| 1653 | Ga0466967_0001389 | |||
| 1654 | Ga0466967_0002745 | |||
| 1655 | Ga0466967_0023964 | |||
| 1656 | Ga0466967_0077166 | |||
| 1657 | Ga0466967_0080319 | |||
| 1658 | Ga0466967_0162259 | |||
| 1659 | Ga0466967_0191741 | |||
| 1660 | Ga0466967_0223884 | |||
| 1661 | Ga0466967_0458693 | |||
| 1662 | Ga0466967_0526196 | |||
| 1663 | Ga0495617_033820 | |||
| 1664 | Ga0495592_0000019 | |||
| 1665 | Ga0495592_0003593 | |||
| 1666 | Ga0495592_0010881 | |||
| 1667 | Ga0495592_0089028 | |||
| 1668 | Ga0495592_0174068 | |||
| 1669 | Ga0495603_0001229 | |||
| 1670 | Ga0495603_0002852 | |||
| 1671 | Ga0495603_0003655 | |||
| 1672 | Ga0495603_0008888 | |||
| 1673 | Ga0495603_0092702 | |||
| 1674 | Ga0495590_0028363 | |||
| 1675 | Ga0495629_0008178 | |||
| 1676 | Ga0495629_0023067 | |||
| 1677 | Ga0495629_0023084 | |||
| 1678 | Ga0495629_0044497 | |||
| 1679 | Ga0495629_0111475 | |||
| 1680 | Ga0495629_0142163 | |||
| 1681 | Ga0495629_0215729 | |||
| 1682 | Ga0495638_0002049 | |||
| 1683 | Ga0495638_0009798 | |||
| 1684 | Ga0495641_0018013 | |||
| 1685 | Ga0495641_0020191 | |||
| 1686 | Ga0495641_0070130 | |||
| 1687 | Ga0495651_0000012 | |||
| 1688 | Ga0495651_0002041 | |||
| 1689 | Ga0495651_0003580 | |||
| 1690 | Ga0495651_0005598 | |||
| 1691 | Ga0495651_0007219 | |||
| 1692 | Ga0495651_0022043 | |||
| 1693 | Ga0495651_0077942 | |||
| 1694 | Ga0495651_0199045 | |||
| 1695 | Ga0495653_0000497 | |||
| 1696 | Ga0495653_0000696 | |||
| 1697 | Ga0495653_0012957 | |||
| 1698 | Ga0495653_0016927 | |||
| 1699 | Ga0495653_0017204 | |||
| 1700 | Ga0495653_0037425 | |||
| 1701 | Ga0495653_0104562 | |||
| 1702 | Ga0495653_0188052 | |||
| 1703 | Ga0495653_0212503 | |||
| 1704 | Ga0495580_0063633 | |||
| 1705 | Ga0495582_0010999 | |||
| 1706 | Ga0495582_0058264 | |||
| 1707 | Ga0495582_0060350 | |||
| 1708 | Ga0495582_0271843 | |||
| 1709 | Ga0495605_0016056 | |||
| 1710 | Ga0495662_0000796 | |||
| 1711 | Ga0495662_0002243 | |||
| 1712 | Ga0495662_0007504 | |||
| 1713 | Ga0495662_0040960 | |||
| 1714 | Ga0495664_0000137 | |||
| 1715 | Ga0495664_0000402 | |||
| 1716 | Ga0495664_0002832 | |||
| 1717 | Ga0495664_0018470 | |||
| 1718 | Ga0495664_0033230 | |||
| 1719 | Ga0495664_0068246 | |||
| 1720 | Ga0495584_0037231 | |||
| 1721 | Ga0495585_0082299 | |||
| 1722 | Ga0495585_0097627 | |||
| 1723 | Ga0495594_0000330 | |||
| 1724 | Ga0495594_0097326 | |||
| 1725 | Ga0495594_0209223 | |||
| 1726 | Ga0495583_0017226 | |||
| 1727 | Ga0495606_0002365 | |||
| 1728 | Ga0495608_0000048 | |||
| 1729 | Ga0495608_0003917 | |||
| 1730 | Ga0495608_0005268 | |||
| 1731 | Ga0495608_0005881 | |||
| 1732 | Ga0495608_0013736 | |||
| 1733 | Ga0495608_0027406 | |||
| 1734 | Ga0495608_0030091 | |||
| 1735 | Ga0495608_0112618 | |||
| 1736 | Ga0495608_0157535 | |||
| 1737 | Ga0495616_0004907 | |||
| 1738 | Ga0495616_0050858 | |||
| 1739 | Ga0495618_0007183 | |||
| 1740 | Ga0495618_0022588 | |||
| 1741 | Ga0495618_0027140 | |||
| 1742 | Ga0495618_0044914 | |||
| 1743 | Ga0495618_0097562 | |||
| 1744 | Ga0495618_0174011 | |||
| 1745 | Ga0495628_0000053 | |||
| 1746 | Ga0495628_0005859 | |||
| 1747 | Ga0495628_0011415 | |||
| 1748 | Ga0495628_0078137 | |||
| 1749 | Ga0495630_0003361 | |||
| 1750 | Ga0495630_0065731 | |||
| 1751 | Ga0495630_0212194 | |||
| 1752 | Ga0495630_0360225 | |||
| 1753 | Ga0495631_0008298 | |||
| 1754 | Ga0495632_0112030 | |||
| 1755 | Ga0495637_0043071 | |||
| 1756 | Ga0495643_0003140 | |||
| 1757 | Ga0495666_0002368 | |||
| 1758 | Ga0495666_0156408 | |||
| 1759 | Ga0495652_0000230 | |||
| 1760 | Ga0495652_0000972 | |||
| 1761 | Ga0495652_0002018 | |||
| 1762 | Ga0495652_0005735 | |||
| 1763 | Ga0495652_0022908 | |||
| 1764 | Ga0495652_0052783 | |||
| 1765 | Ga0495652_0231768 | |||
| 1766 | Ga0495665_0016688 | |||
| 1767 | Ga0495665_0020854 | |||
| 1768 | Ga0495665_0034897 | |||
| 1769 | Ga0495665_0057320 | |||
| 1770 | Ga0495665_0106404 | |||
| 1771 | Ga0495640_0003531 | |||
| 1772 | Ga0495640_0011170 | |||
| 1773 | Ga0495640_0020000 | |||
| 1774 | Ga0495640_0021436 | |||
| 1775 | Ga0495586_0041353 | |||
| 1776 | Ga0495587_0000027 | |||
| 1777 | Ga0495587_0002554 | |||
| 1778 | Ga0495587_0009018 | |||
| 1779 | Ga0495587_0009578 | |||
| 1780 | Ga0495587_0026388 | |||
| 1781 | Ga0495587_0046245 | |||
| 1782 | Ga0495597_0006920 | |||
| 1783 | Ga0495645_0006144 | |||
| 1784 | Ga0495645_0009859 | |||
| 1785 | Ga0495645_0016194 | |||
| 1786 | Ga0495645_0048011 | |||
| 1787 | Ga0495645_0247270 | |||
| 1788 | Ga0495622_0028552 | |||
| 1789 | Ga0495622_0075803 | |||
| 1790 | Ga0495633_0009835 | |||
| 1791 | Ga0495667_0000089 | |||
| 1792 | Ga0495667_0001134 | |||
| 1793 | Ga0495667_0006353 | |||
| 1794 | Ga0495667_0011246 | |||
| 1795 | Ga0495667_0015057 | |||
| 1796 | Ga0495667_0028436 | |||
| 1797 | Ga0495667_0091129 | |||
| 1798 | Ga0495667_0104174 | |||
| 1799 | Ga0495667_0233508 | |||
| 1800 | Ga0495668_0000169 | |||
| 1801 | Ga0495668_0023813 | |||
| 1802 | Ga0495634_0000714 | |||
| 1803 | Ga0495634_0012007 | |||
| 1804 | Ga0495634_0017924 | |||
| 1805 | Ga0495634_0056827 | |||
| 1806 | Ga0495634_0058665 | |||
| 1807 | Ga0495625_0002435 | |||
| 1808 | Ga0495625_0004532 | |||
| 1809 | Ga0495625_0024976 | |||
| 1810 | Ga0495625_0039421 | |||
| 1811 | Ga0495635_0001652 | |||
| 1812 | Ga0495635_0006862 | |||
| 1813 | Ga0495635_0015459 | |||
| 1814 | Ga0495635_0018259 | |||
| 1815 | Ga0495635_0022932 | |||
| 1816 | Ga0495635_0111505 | |||
| 1817 | Ga0495588_0107471 | |||
| 1818 | Ga0495657_0000025 | |||
| 1819 | Ga0495657_0000195 | |||
| 1820 | Ga0495657_0009221 | |||
| 1821 | Ga0495657_0012336 | |||
| 1822 | Ga0495657_0023829 | |||
| 1823 | Ga0495657_0028696 | |||
| 1824 | Ga0495657_0059351 | |||
| 1825 | Ga0495657_0075125 | |||
| 1826 | Ga0495657_0085116 | |||
| 1827 | Ga0495657_0194788 | |||
| 1828 | Ga0495657_0251959 | |||
| 1829 | Ga0495599_0000026 | |||
| 1830 | Ga0495599_0001894 | |||
| 1831 | Ga0495599_0006909 | |||
| 1832 | Ga0495599_0007812 | |||
| 1833 | Ga0495599_0099820 | |||
| 1834 | Ga0495623_0045566 | |||
| 1835 | Ga0495623_0140167 | |||
| 1836 | Ga0495646_0000700 | |||
| 1837 | Ga0495646_0010700 | |||
| 1838 | Ga0495658_0008090 | |||
| 1839 | Ga0495658_0038714 | |||
| 1840 | Ga0495658_0113522 | |||
| 1841 | Ga0495613_0000717 | |||
| 1842 | Ga0495613_0002765 | |||
| 1843 | Ga0495613_0012604 | |||
| 1844 | Ga0495613_0027176 | |||
| 1845 | Ga0495613_0148445 | |||
| 1846 | Ga0495613_0246591 | |||
| 1847 | Ga0495624_0003962 | |||
| 1848 | Ga0495624_0060720 | |||
| 1849 | Ga0495624_0077953 | |||
| 1850 | Ga0495624_0114796 | |||
| 1851 | Ga0495649_0075682 | |||
| 1852 | Ga0495589_0010321 | |||
| 1853 | Ga0495589_0025928 | |||
| 1854 | Ga0495600_0009348 | |||
| 1855 | Ga0495600_0013905 | |||
| 1856 | Ga0495600_0014301 | |||
| 1857 | Ga0495600_0020695 | |||
| 1858 | Ga0495600_0037550 | |||
| 1859 | Ga0495600_0045893 | |||
| 1860 | Ga0495600_0111210 | |||
| 1861 | Ga0495581_0010738 | |||
| 1862 | Ga0495581_0013027 | |||
| 1863 | Ga0495581_0094286 | |||
| 1864 | Ga0495581_0254428 | |||
| 1865 | Ga0495604_0000029 | |||
| 1866 | Ga0495604_0000534 | |||
| 1867 | Ga0495604_0000925 | |||
| 1868 | Ga0495604_0001249 | |||
| 1869 | Ga0495604_0003276 | |||
| 1870 | Ga0495604_0030620 | |||
| 1871 | Ga0495604_0074499 | |||
| 1872 | Ga0495604_0203796 | |||
| 1873 | Ga0495636_0000712 | |||
| 1874 | Ga0495636_0028497 | |||
| 1875 | Ga0495636_0106307 | |||
| 1876 | Ga0495674_0000418 | |||
| 1877 | Ga0495674_0009916 | |||
| 1878 | Ga0495674_0011013 | |||
| 1879 | Ga0495674_0059230 | |||
| 1880 | Ga0495674_0190548 | |||
| 1881 | Ga0495674_0385812 | |||
| 1882 | Ga0495674_0407650 | |||
| 1883 | Ga0495674_0521689 | |||
| 1884 | Ga0495676_0002965 | |||
| 1885 | Ga0495676_0004077 | |||
| 1886 | Ga0495676_0006734 | |||
| 1887 | Ga0495676_0036843 | |||
| 1888 | Ga0495676_0040254 | |||
| 1889 | Ga0495676_0048957 | |||
| 1890 | Ga0495676_0095649 | |||
| 1891 | Ga0495680_0000011 | |||
| 1892 | Ga0495680_0001927 | |||
| 1893 | Ga0495680_0007791 | |||
| 1894 | Ga0495680_0028397 | |||
| 1895 | Ga0495680_0035864 | |||
| 1896 | Ga0495680_0065117 | |||
| 1897 | Ga0495683_0052979 | |||
| 1898 | Ga0495687_000608 | |||
| 1899 | Ga0495687_088642 | |||
| 1900 | Ga0495675_0000433 | |||
| 1901 | Ga0495675_0011016 | |||
| 1902 | Ga0495675_0017354 | |||
| 1903 | Ga0495675_0044058 | |||
| 1904 | Ga0495675_0230257 | |||
| 1905 | Ga0495685_008511 | |||
| 1906 | Ga0495685_019259 | |||
| 1907 | Ga0495673_0010530 | |||
| 1908 | Ga0495681_0008184 | |||
| 1909 | Ga0495684_0002379 | |||
| 1910 | Ga0495684_0009203 | |||
| 1911 | Ga0495684_0009423 | |||
| 1912 | Ga0495684_0033942 | |||
| 1913 | Ga0495684_0040950 | |||
| 1914 | Ga0495684_0053280 | |||
| 1915 | Ga0495593_0000887 | |||
| 1916 | Ga0495593_0010699 | |||
| 1917 | Ga0495593_0029343 | |||
| 1918 | Ga0495593_0044705 | |||
| 1919 | Ga0495593_0055596 | |||
| 1920 | Ga0495593_0219178 | |||
| 1921 | Ga0495602_0000033 | |||
| 1922 | Ga0495602_0008923 | |||
| 1923 | Ga0495602_0025991 | |||
| 1924 | Ga0495602_0034110 | |||
| 1925 | Ga0495602_0041711 | |||
| 1926 | Ga0495602_0082865 | |||
| 1927 | Ga0495602_0117582 | |||
| 1928 | Ga0495602_0218171 | |||
| 1929 | Ga0495614_0000867 | |||
| 1930 | Ga0495614_0040522 | |||
| 1931 | Ga0495626_0000312 | |||
| 1932 | Ga0496100_0002392 | |||
| 1933 | Ga0496100_0028480 | |||
| 1934 | Ga0496100_0281981 | |||
| 1935 | Ga0496101_0023626 | |||
| 1936 | Ga0496101_0067450 | |||
| 1937 | Ga0496101_0098842 | |||
| 1938 | Ga0496101_0331134 | |||
| 1939 | Ga0496102_0000015 | |||
| 1940 | Ga0496102_0028001 | |||
| 1941 | Ga0496102_0184126 | |||
| 1942 | Ga0496102_0239042 | |||
| 1943 | Ga0496102_0494401 | |||
| 1944 | Ga0496102_0544360 | |||
| 1945 | Ga0496103_0000020 | |||
| 1946 | Ga0496103_0031363 | |||
| 1947 | Ga0496103_0061889 | |||
| 1948 | Ga0496104_0002885 | |||
| 1949 | Ga0496104_0049412 | |||
| 1950 | Ga0496104_0062899 | |||
| 1951 | Ga0496104_0090847 | |||
| 1952 | Ga0496104_0285433 | |||
| 1953 | Ga0496104_0342867 | |||
| 1954 | Ga0496104_0409830 | |||
| 1955 | Ga0496104_0432867 | |||
| 1956 | Ga0496105_0005328 | |||
| 1957 | Ga0496105_0021995 | |||
| 1958 | Ga0496105_0066508 | |||
| 1959 | Ga0496105_0192074 | |||
| 1960 | Ga0496105_0481919 | |||
| 1961 | Ga0496106_0004227 | |||
| 1962 | Ga0496106_0039541 | |||
| 1963 | Ga0496107_0169257 | |||
| 1964 | Ga0496107_0217732 | |||
| 1965 | Ga0496108_0001463 | |||
| 1966 | Ga0496108_0009686 | |||
| 1967 | Ga0496108_0056412 | |||
| 1968 | Ga0496108_0108130 | |||
| 1969 | Ga0496108_0438640 | |||
| 1970 | Ga0496108_0446658 | |||
| 1971 | Ga0496109_0012459 | |||
| 1972 | Ga0496109_0054926 | |||
| 1973 | Ga0496109_0067956 | |||
| 1974 | Ga0496109_0164494 | |||
| 1975 | Ga0496109_0324019 | |||
| 1976 | Ga0496109_0324479 | |||
| 1977 | Ga0496109_0468173 | |||
| 1978 | Ga0496110_0007465 | |||
| 1979 | Ga0496110_0093651 | |||
| 1980 | Ga0496110_0316402 | |||
| 1981 | Ga0496110_0354310 | |||
| 1982 | Ga0496111_0003426 | |||
| 1983 | Ga0496111_0010528 | |||
| 1984 | Ga0496111_0040256 | |||
| 1985 | Ga0496111_0302517 | |||
| 1986 | Ga0496112_0002097 | |||
| 1987 | Ga0496112_0007119 | |||
| 1988 | Ga0496112_0011019 | |||
| 1989 | Ga0496112_0036248 | |||
| 1990 | Ga0496112_0038349 | |||
| 1991 | Ga0496112_0273936 | |||
| 1992 | Ga0496113_0014747 | |||
| 1993 | Ga0496113_0078815 | |||
| 1994 | Ga0496113_0083138 | |||
| 1995 | Ga0496113_0130374 | |||
| 1996 | Ga0496113_0170885 | |||
| 1997 | Ga0496113_0320833 | |||
| 1998 | Ga0496113_0326298 | |||
| 1999 | Ga0496113_0397313 | |||
| 2000 | Ga0496113_0407706 | |||
| 2001 | Ga0496114_0004897 | |||
| 2002 | Ga0496114_0073236 | |||
| 2003 | Ga0496114_0094297 | |||
| 2004 | Ga0496115_0028213 | |||
| 2005 | Ga0496116_0000178 | |||
| 2006 | Ga0496116_0000578 | |||
| 2007 | Ga0496117_0000047 | |||
| 2008 | Ga0496117_0021310 | |||
| 2009 | Ga0496117_0028936 | |||
| 2010 | Ga0496118_0000050 | |||
| 2011 | Ga0496118_0002249 | |||
| 2012 | Ga0496118_0012121 | |||
| 2013 | Ga0496119_0001789 | |||
| 2014 | Ga0496121_0000537 | |||
| 2015 | Ga0496121_0003059 | |||
| 2016 | Ga0496126_0000049 | |||
| 2017 | Ga0496126_0000208 | |||
| 2018 | Ga0496126_0132085 | |||
| 2019 | Ga0495682_0076482 | |||
| 2020 | Ga0501031_0006054 | |||
| 2021 | Ga0501031_0020167 | |||
| 2022 | Ga0501032_0062566 | |||
| 2023 | Ga0501033_0002605 | |||
| 2024 | Ga0501033_0009265 | |||
| 2025 | Ga0501034_0022734 | |||
| 2026 | Ga0501034_0025515 | |||
| 2027 | Ga0501034_0046104 | |||
| 2028 | Ga0501034_0218602 | |||
| 2029 | Ga0501036_0004252 | |||
| 2030 | Ga0501036_0041897 | |||
| 2031 | Ga0501036_0051220 | |||
| 2032 | Ga0501036_0158391 | |||
| 2033 | Ga0501037_0011090 | |||
| 2034 | Ga0501037_0031773 | |||
| 2035 | Ga0501037_0048042 | |||
| 2036 | Ga0501038_0002308 | |||
| 2037 | Ga0501038_0056214 | |||
| 2038 | Ga0501038_0109434 | |||
| 2039 | Ga0501043_0006999 | |||
| 2040 | Ga0501043_0117350 | |||
| 2041 | Ga0501046_0006667 | |||
| 2042 | Ga0501046_0025038 | |||
| 2043 | Ga0501046_0072421 | |||
| 2044 | Ga0501047_0021299 | |||
| 2045 | Ga0501047_0040398 | |||
| 2046 | Ga0501048_0009146 | |||
| 2047 | Ga0501048_0130490 | |||
| 2048 | Ga0501048_0190629 | |||
| 2049 | Ga0501070_0006172 | |||
| 2050 | Ga0501070_0025187 | |||
| 2051 | Ga0501071_0199153 | |||
| 2052 | Ga0501074_0011988 | |||
| 2053 | Ga0501080_0029005 | |||
| 2054 | Ga0501080_0133479 | |||
| 2055 | Ga0501035_0137464 | |||
| 2056 | Ga0501044_0000295 | |||
| 2057 | Ga0501044_0015121 | |||
| 2058 | Ga0501044_0182718 | |||
| 2059 | nmdc:mga03n38_179837_c1 | |||
| 2060 | nmdc:mga03n38_88896_c1 | |||
| 2061 | nmdc:mga00v17_64444_c1 | |||
| 2062 | nmdc:mga06z11_13052_c1 | |||
| 2063 | nmdc:mga06z11_3612_c1 | |||
| 2064 | nmdc:mga05p37_115575_c1 | |||
| 2065 | nmdc:mga05p37_12425_c1 | |||
| 2066 | nmdc:mga05p37_136264_c1 | |||
| 2067 | nmdc:mga05p37_16765_c1 | |||
| 2068 | nmdc:mga05p37_194570_c1 | |||
| 2069 | nmdc:mga09592_345008_c1 | |||
| 2070 | nmdc:mga09592_3971_c1 | |||
| 2071 | nmdc:mga0qj67_135935_c1 | |||
| 2072 | nmdc:mga0qj67_18776_c1 | |||
| 2073 | nmdc:mga0qj67_33491_c1 | |||
| 2074 | nmdc:mga0qj67_4927_c1 | |||
| 2075 | nmdc:mga06r32_25_c7 | |||
| 2076 | nmdc:mga06r32_5649_c1 | |||
| 2077 | nmdc:mga06r32_9570_c1 | |||
| 2078 | nmdc:mga08y16_20936_c1 | |||
| 2079 | nmdc:mga08y16_39719_c1 | |||
| 2080 | nmdc:mga0rr50_2888_c1 | |||
| 2081 | nmdc:mga08x19_111186_c1 | |||
| 2082 | nmdc:mga08x19_40499_c1 | |||
| 2083 | nmdc:mga0a205_229823_c1 | |||
| 2084 | nmdc:mga0a205_272376_c1 | |||
| 2085 | nmdc:mga0a205_394690_c1 | |||
| 2086 | nmdc:mga0sz30_43096_c1 | |||
| 2087 | Ga0495601_0014240 | |||
| 2088 | Ga0495601_0029692 | |||
| 2089 | Ga0495601_0094699 | |||
| 2090 | Ga0495601_0126424 | |||
| 2091 | Ga0495612_0011203 | |||
| 2092 | Ga0495612_0094570 | |||
| 2093 | Ga0500610_0001046 | |||
| 2094 | Ga0495595_0005426 | |||
| 2095 | Ga0495595_0006450 | |||
| 2096 | Ga0495595_0131474 | |||
| 2097 | Ga0495619_0019537 | |||
| 2098 | Ga0495619_0028622 | |||
| 2099 | Ga0495619_0031353 | |||
| 2100 | Ga0495619_0042612 | |||
| 2101 | Ga0495619_0172223 | |||
| 2102 | Ga0495619_0174895 | |||
| 2103 | Ga0500643_041856 | |||
| 2104 | Ga0500644_0025657 | |||
| 2105 | Ga0500646_0000211 | |||
| 2106 | Ga0500583_0023020 | |||
| 2107 | Ga0500651_0176919 | |||
| 2108 | Ga0500556_0001025 | |||
| 2109 | Ga0500562_025807 | |||
| 2110 | Ga0500608_071255 | |||
| 2111 | Ga0500652_000353 | |||
| 2112 | Ga0500652_081031 | |||
| 2113 | Ga0500561_0050482 | |||
| 2114 | Ga0500568_0004813 | |||
| 2115 | Ga0500645_000016 | |||
| 2116 | Ga0501084_0269990 | |||
| 2117 | Ga0587073_0010886 | |||
| 2118 | Ga0466962_0001673 | |||
| 2119 | Ga0466962_0046521 | |||
| 2120 | Ga0466962_0175076 | |||
| 2121 | 3006427120 | |||
| 2122 | 2501941838 | |||
| 2123 | 2508672363 | |||
| 2124 | 2515493927 | |||
| 2125 | 2515720613 | |||
| 2126 | 2515755303 | |||
| 2127 | 2516086763 | |||
| 2128 | 2516092349 | |||
| 2129 | 2517760698 | |||
| 2130 | 2547410287 | |||
| 2131 | 2554260713 | |||
| 2132 | 2585298140 | |||
| 2133 | 2585304637 | |||
| 2134 | 2585314746 | |||
| 2135 | 2585320742 | |||
| 2136 | 2616698179 | |||
| 2137 | 2616901487 | |||
| 2138 | 2619856603 | |||
| 2139 | 2620348831 | |||
| 2140 | 2623502296 | |||
| 2141 | 2623586429 | |||
| 2142 | 2643762049 | |||
| 2143 | 2643901989 | |||
| 2144 | 2643946239 | |||
| 2145 | 2644017983 | |||
| 2146 | 2644180729 | |||
| 2147 | 2644261972 | |||
| 2148 | 2644388009 | |||
| 2149 | 2644408133 | |||
| 2150 | 2644433028 | |||
| 2151 | 2644442826 | |||
| 2152 | 2644445919 | |||
| 2153 | 2644460524 | |||
| 2154 | 2644631319 | |||
| 2155 | 2676198228 | |||
| 2156 | 2686537434 | |||
| 2157 | 2689959502 | |||
| 2158 | 2738704581 | |||
| 2159 | 2739330936 | |||
| 2160 | 2753073310 | |||
| 2161 | 2768645653 | |||
| 2162 | 2772641666 | |||
| 2163 | 2774842806 | |||
| 2164 | 2784591631 | |||
| 2165 | 2785340102 | |||
| 2166 | 2785372635 | |||
| 2167 | 2786675348 | |||
| 2168 | 2793983360 | |||
| 2169 | 2804848905 | |||
| 2170 | 2808844990 | |||
| 2171 | 2808914589 | |||
| 2172 | 2809235262 | |||
| 2173 | 2811843532 | |||
| 2174 | 2812354698 | |||
| 2175 | 2812477667 | |||
| 2176 | 2819698790 | |||
| 2177 | 2819740052 | |||
| 2178 | 2831939901 | |||
| 2179 | 2852636318 | |||
| 2180 | 2855672222 | |||
| 2181 | 2855678861 | |||
| 2182 | 2855685287 | |||
| 2183 | 2856860347 | |||
| 2184 | 2857295166 | |||
| 2185 | 2858854529 | |||
| 2186 | 2858874080 | |||
| 2187 | 2858888531 | |||
| 2188 | 2858890763 | |||
| 2189 | 2858898549 | |||
| 2190 | 2858905637 | |||
| 2191 | 2861520752 | |||
| 2192 | 2862183994 | |||
| 2193 | 2862283411 | |||
| 2194 | 2862294886 | |||
| 2195 | 2862390353 | |||
| 2196 | 2862507768 | |||
| 2197 | 2862576440 | |||
| 2198 | 2862708960 | |||
| 2199 | 2863409865 | |||
| 2200 | 2867303801 | |||
| 2201 | 2867313361 | |||
| 2202 | 2867322820 | |||
| 2203 | 2867350709 | |||
| 2204 | 2867374650 | |||
| 2205 | 2867432042 | |||
| 2206 | 2867475208 | |||
| 2207 | 2869054196 | |||
| 2208 | 2869065818 | |||
| 2209 | 2869070630 | |||
| 2210 | 2870729135 | |||
| 2211 | 2873152939 | |||
| 2212 | 2873316937 | |||
| 2213 | 2875397702 | |||
| 2214 | 2877678080 | |||
| 2215 | 2880493752 | |||
| 2216 | 2880498570 | |||
| 2217 | 2887483702 | |||
| 2218 | 2895882362 | |||
| 2219 | 2902586400 | |||
| 2220 | 2912716319 | |||
| 2221 | 2912729231 | |||
| 2222 | 2912763904 | |||
| 2223 | 2915363200 | |||
| 2224 | 2918507480 | |||
| 2225 | 2919471213 | |||
| 2226 | 2929220562 | |||
| 2227 | 2929227149 | |||
| 2228 | 2935395381 | |||
| 2229 | 2946046823 | |||
| 2230 | 2946070965 | |||
| 2231 | 2946078896 | |||
| 2232 | 2947225758 | |||
| 2233 | 2954009929 | |||
| 2234 | 2954382865 | |||
| 2235 | 2954680025 | |||
| 2236 | 2954684125 | |||
| 2237 | 2954693686 | |||
| 2238 | 2954708782 | |||
| 2239 | 2954713332 | |||
| 2240 | 2954723292 | |||
| 2241 | 2954738536 | |||
| 2242 | 2954742199 | |||
| 2243 | 2954757394 | |||
| 2244 | 2954761177 | |||
| 2245 | 2966599832 | |||
| 2246 | 2990049080 | |||
| 2247 | 2990061816 | |||
| 2248 | 2990090597 | |||
| 2249 | 2995464977 | |||
| 2250 | 2996224790 | |||
| 2251 | 2997603497 | |||
| 2252 | 3006393739 | |||
| 2253 | 3006488800 | |||
| 2254 | 3006494213 | |||
| 2255 | 649811086 | |||
| 2256 | 8001782516 | |||
| 2257 | 8002782595 | |||
| 2258 | 8002789206 | |||
| 2259 | 8003835340 | |||
| 2260 | 8003859362 | |||
| 2261 | 8003873527 | |||
| 2262 | 8008489881 | |||
| 2263 | 8008563958 | |||
| 2264 | 8008576105 | |||
| 2265 | 8025417518 | |||
| 2266 | 8025479388 | |||
| 2267 | 8025529387 | |||
| 2268 | 8025533058 | |||
| 2269 | 8033687519 | |||
| 2270 | 8047715083 | |||
| 2271 | 8047895314 | |||
| 2272 | 8048130607 | |||
| 2273 | 8048363639 | |||
| 2274 | 8048372340 | |||
| 2275 | 8048381274 | |||
| 2276 | 8048407049 | |||
| 2277 | 8054161891 | |||
| 2278 | 8054472266 | |||
| 2279 | 8054708083 | |||
| 2280 | 8054730994 | |||
| 2281 | 8054735125 | |||
| 2282 | 8054922261 | |||
| 2283 | 8055177335 | |||
| 2284 | 8055414779 | |||
| 2285 | 8056448711 | |||
| 2286 | 8056667265 | |||
| 2287 | 8056837022 | |||
| 2288 | 8057568881 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4l9y-assembly1.cif.gz_B | crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa | 0.9685 | 6 | 253 |
| 3qll-assembly1.cif.gz_A | crystal structure of ripc from yersinia pestis | 0.9243 | 4 | 254 |
| 4l9z-assembly1.cif.gz_A | crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, oxalate, and coa | 0.9207 | 7 | 305 |
| 6kkh-assembly1.cif.gz_A | crystal structure of the oxalate bound malyl-coa lyase from roseiflexus castenholzii | 0.9075 | 6 | 306 |
| 4l9y-assembly1.cif.gz_B | crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa | 0.9071 | 6 | 253 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4l9yB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9685 | 6 | 253 | 3.20.20.60 |
| af_P0A9I1_3_299_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9384 | 3 | 309 | 3.20.20.60 |
| af_P0A9I1_3_299_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9202 | 3 | 309 | 3.20.20.60 |
| 4l9yB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9071 | 6 | 253 | 3.20.20.60 |
| 3qllC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9009 | 4 | 254 | 3.20.20.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2P6FXQ0-F1-model_v4 | CoA ester lyase | 0.9993 | 23 | 240 |
GO:0000287
GO:0006107 GO:0016829 |
| AF-A0A6B3I1H3-F1-model_v4 | CoA ester lyase | 0.9967 | 19 | 103 |
GO:0000287
GO:0006107 GO:0016829 |
| AF-D3D852-F1-model_v4 | HpcH/HpaI aldolase | 0.9966 | 6 | 144 |
GO:0000287
GO:0003824 GO:0006107 |
| AF-A0A6V8K9F4-F1-model_v4 | HpcH/HpaI aldolase/citrate lyase domain-containing protein | 0.9947 | 102 | 320 |
GO:0000287
GO:0003824 GO:0006107 |
| AF-A0A7K0PZM1-F1-model_v4 | CoA ester lyase | 0.9929 | 61 | 320 |
GO:0000287
GO:0006107 GO:0016829 |