F490754

General Info

Members Datasets Scaffolds Average Seq Length
1144 612 2288 214

Family's Representative Sequence

Representative Sequence 3300035111|Ga0373923_0035595|Ga0373923_0035595_775_1554
Length 259
Sequence VISRVLSGKNAAGKNEPAELPASPLFPKFASGDAAKNSELRKRGHSLKPASVASQSAASAIPLYTNGMRIGLLGGSFNPPHVAHRAISLFAIKRLKLDRVWWLITPGNPLKDGGALHDLDERAEAARRMAGDPRIDISCLESVIGTRYTVDTVRYLRRRASGLRFVWIMGADNLAQFHRWQDWRRIASEVPIAVIDRPPQSFRALASPAAQALARYRMPENQAGRLADEKAPAWVFLTGMKLSLSSTGLRNLDGSWRTK

Samples

Sample ID Description Type Environment
1 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
185 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
186 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
187 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
193 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
194 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
195 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
200 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
215 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
216 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
217 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
218 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
220 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
221 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
225 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
226 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
227 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
243 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
244 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
245 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
246 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
247 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
248 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
249 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
250 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
251 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
252 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
256 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
260 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
263 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
264 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
265 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
266 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
267 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
268 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
269 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
270 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
271 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
272 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
273 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
274 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
275 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
276 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
277 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
278 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
279 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
280 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
281 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
282 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
283 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
284 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
285 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
286 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
287 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
288 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
289 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
290 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
291 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
292 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
293 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
294 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
295 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
296 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
297 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
298 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
299 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
300 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
301 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
302 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
303 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
304 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
305 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
306 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
307 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
308 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
309 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
310 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
311 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
312 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
313 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
314 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
315 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
316 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
317 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
318 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
319 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
320 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
321 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
322 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
323 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
324 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
325 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
326 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
327 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
328 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
329 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
330 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
331 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
332 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
333 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
334 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
335 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
336 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
354 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
355 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
356 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
357 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
358 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
359 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
360 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
361 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
362 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
363 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
364 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
375 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
378 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
379 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
380 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
381 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
383 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
384 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
385 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
386 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
387 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
388 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
389 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
390 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
391 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
392 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
393 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
394 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
395 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
396 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
397 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
398 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
399 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
400 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
401 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
402 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
403 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
404 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
405 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
406 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
407 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
408 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
409 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
410 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
411 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
412 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
413 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
414 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
415 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
416 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
417 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
418 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
419 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
420 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
421 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
422 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
423 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
424 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
425 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
426 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
427 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
428 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
429 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
430 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
431 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
432 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
433 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
434 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
435 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
436 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
437 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
438 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
439 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
440 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
441 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
442 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
443 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
444 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
445 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
446 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
447 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
448 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
449 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
450 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
451 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
452 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
453 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
454 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
455 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
456 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
457 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
458 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
459 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
460 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
461 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
462 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
463 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
464 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
465 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
466 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
467 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
468 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
469 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
470 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
471 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
472 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
473 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
474 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
475 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
476 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
477 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
478 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
479 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
480 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
481 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
482 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
483 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
484 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
485 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
486 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
487 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
488 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
489 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
490 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
491 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
492 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
493 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
494 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
495 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
496 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
497 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
498 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
499 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
500 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
501 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
502 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
503 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
504 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
505 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
506 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
507 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
508 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
509 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
510 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
511 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
512 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
513 2904699407
514 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
515 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
516 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
517 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
518 2922368715
519 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
520 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
521 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
522 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
523 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
524 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
525 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
526 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
527 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
528 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
529 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
530 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
531 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
532 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
533 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
534 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
535 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
536 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
537 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
538 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
539 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
540 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
541 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
542 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
543 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
544 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
545 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
546 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
547 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
548 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
549 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
550 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
551 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
552 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
553 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
554 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
555 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
556 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
557 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
558 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
559 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
560 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
561 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
562 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
563 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
564 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
565 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
566 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
567 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
568 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
569 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
570 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
571 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
572 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
573 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
574 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
575 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
576 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
577 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
578 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
579 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
580 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
581 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
582 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
583 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
584 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
585 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
586 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
587 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
588 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
589 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
590 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
591 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
592 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
593 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
594 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
595 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
596 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
597 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
598 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
599 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
600 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
601 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
602 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
603 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
604 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
605 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
606 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
607 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
608 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
609 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
610 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
611 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
612 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.85
Metatranscriptomes 0
Isolates 15.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.89
Nodule 11.63
Rhizoplane 6.73
Rhizosphere 59.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373923_0035595 3300035111 Bacteria 2028
2 JGI25406J46586_10000364 3300003203 Bacteria 20635
3 JGI25153J46596_10008527 3300003215 Bacteria 4885
4 JGI25153J46596_10023803 3300003215 Bacteria 2223
5 JGI25160J50197_1005464 3300003354 Bacteria 5285
6 JGI25160J50197_1013128 3300003354 Bacteria 2838
7 JGI25160J50197_1017285 3300003354 Bacteria 2291
8 JGI25404J52841_10044352 3300003659 Bacteria 938
9 Ga0055529_1012617 3300003763 Bacteria 1080
10 Ga0055543_1002453 3300004625 Bacteria 6121
11 Ga0065165_1018348 3300005262 Bacteria 2535
12 Ga0065165_1030140 3300005262 Bacteria 1729
13 Ga0070683_100504803 3300005329 Bacteria 1155
14 Ga0070690_100459413 3300005330 Bacteria 946
15 Ga0070670_100949250 3300005331 Bacteria 781
16 Ga0068869_100431957 3300005334 Bacteria 1088
17 Ga0070666_10142591 3300005335 Bacteria 1669
18 Ga0070666_10179745 3300005335 Bacteria 1483
19 Ga0070682_100115845 3300005337 Bacteria 1792
20 Ga0070682_100225491 3300005337 Bacteria 1337
21 Ga0068868_100271192 3300005338 Bacteria 1433
22 Ga0070660_100453970 3300005339 Bacteria 1063
23 Ga0070660_100759423 3300005339 Bacteria 814
24 Ga0070689_100101308 3300005340 Bacteria 2279
25 Ga0070687_100155833 3300005343 Bacteria 1345
26 Ga0070661_100223677 3300005344 Bacteria 1444
27 Ga0070668_100179797 3300005347 Bacteria 1727
28 Ga0070669_100408239 3300005353 Bacteria 1113
29 Ga0070675_100209414 3300005354 Bacteria 1694
30 Ga0070675_100211310 3300005354 Bacteria 1686
31 Ga0070671_100319260 3300005355 Bacteria 1323
32 Ga0070671_100727714 3300005355 Bacteria 862
33 Ga0070674_100057289 3300005356 Bacteria 2705
34 Ga0070674_100231012 3300005356 Bacteria 1444
35 Ga0070674_100352941 3300005356 Bacteria 1188
36 Ga0070674_100385310 3300005356 Bacteria 1141
37 Ga0070688_100494379 3300005365 Bacteria 922
38 Ga0070659_100091579 3300005366 Bacteria 2437
39 Ga0070659_100164937 3300005366 Bacteria 1812
40 Ga0070659_100258130 3300005366 Bacteria 1446
41 Ga0070659_100449700 3300005366 Bacteria 1093
42 Ga0070667_100146017 3300005367 Bacteria 2075
43 Ga0070667_100241603 3300005367 Bacteria 1613
44 Ga0070714_100001570 3300005435 Bacteria 16615
45 Ga0070714_100015683 3300005435 Bacteria 6100
46 Ga0070714_100020448 3300005435 Bacteria 5405
47 Ga0070714_100725284 3300005435 Bacteria 960
48 Ga0070713_100008285 3300005436 Bacteria 7370
49 Ga0070713_100081550 3300005436 Bacteria 2760
50 Ga0070713_100179686 3300005436 Bacteria 1900
51 Ga0070713_100213771 3300005436 Bacteria 1747
52 Ga0070710_10001859 3300005437 Bacteria 9943
53 Ga0070710_10085827 3300005437 Bacteria 1847
54 Ga0070711_100013892 3300005439 Bacteria 5066
55 Ga0070711_100121742 3300005439 Bacteria 1931
56 Ga0070711_100206529 3300005439 Bacteria 1519
57 Ga0070705_100148406 3300005440 Bacteria 1552
58 Ga0070663_100089391 3300005455 Bacteria 2279
59 Ga0070663_100093853 3300005455 Bacteria 2227
60 Ga0070663_100323687 3300005455 Bacteria 1240
61 Ga0070663_100376385 3300005455 Bacteria 1155
62 Ga0070663_100669300 3300005455 Bacteria 880
63 Ga0070678_100333205 3300005456 Bacteria 1299
64 Ga0070681_10012682 3300005458 Bacteria 8361
65 Ga0070681_10014900 3300005458 Bacteria 7730
66 Ga0070681_10059272 3300005458 Bacteria 3808
67 Ga0068867_100667780 3300005459 Bacteria 914
68 Ga0070685_10161771 3300005466 Bacteria 1427
69 Ga0070707_100026862 3300005468 Bacteria 5470
70 Ga0070698_100305874 3300005471 Bacteria 1520
71 Ga0070699_100160173 3300005518 Bacteria 1991
72 Ga0070679_100103628 3300005530 Bacteria 2831
73 Ga0070679_100174271 3300005530 Bacteria 2123
74 Ga0070684_100347298 3300005535 Bacteria 1364
75 Ga0068853_100010595 3300005539 Bacteria 7456
76 Ga0068853_100013156 3300005539 Bacteria 6753
77 Ga0068853_100113574 3300005539 Bacteria 2408
78 Ga0068853_100297217 3300005539 Bacteria 1492
79 Ga0070672_100092290 3300005543 Bacteria 2444
80 Ga0070672_100508765 3300005543 Bacteria 1042
81 Ga0070686_100123856 3300005544 Bacteria 1778
82 Ga0070686_100561180 3300005544 Bacteria 895
83 Ga0070665_100092776 3300005548 Bacteria 3024
84 Ga0070665_100400513 3300005548 Bacteria 1380
85 Ga0070665_100414613 3300005548 Bacteria 1355
86 Ga0070665_101151804 3300005548 Bacteria 787
87 Ga0068855_100023359 3300005563 Bacteria 7405
88 Ga0068855_100058220 3300005563 Bacteria 4526
89 Ga0068855_100101537 3300005563 Bacteria 3311
90 Ga0068855_100249162 3300005563 Bacteria 1981
91 Ga0068855_100495448 3300005563 Bacteria 1328
92 Ga0070664_100424039 3300005564 Bacteria 1219
93 Ga0070664_100792560 3300005564 Bacteria 886
94 Ga0068857_100012785 3300005577 Bacteria 7317
95 Ga0068857_100062694 3300005577 Bacteria 3305
96 Ga0068857_100593569 3300005577 Bacteria 1046
97 Ga0068854_100280803 3300005578 Bacteria 1341
98 Ga0068856_100026080 3300005614 Bacteria 5698
99 Ga0068856_100256563 3300005614 Bacteria 1763
100 Ga0068856_100349331 3300005614 Bacteria 1497
101 Ga0070702_100150153 3300005615 Bacteria 1495
102 Ga0068852_100025281 3300005616 Bacteria 4809
103 Ga0068852_100247267 3300005616 Bacteria 1707
104 Ga0068852_100410545 3300005616 Bacteria 1334
105 Ga0068852_100579835 3300005616 Bacteria 1124
106 Ga0068859_100235253 3300005617 Bacteria 1920
107 Ga0068864_100067650 3300005618 Bacteria 3102
108 Ga0068864_100068559 3300005618 Bacteria 3082
109 Ga0068866_10096225 3300005718 Bacteria 1623
110 Ga0068861_100086139 3300005719 Bacteria 2469
111 Ga0068861_100262018 3300005719 Bacteria 1480
112 Ga0068861_100478497 3300005719 Bacteria 1121
113 Ga0068851_10041453 3300005834 Bacteria 2314
114 Ga0068870_10222774 3300005840 Bacteria 1155
115 Ga0068863_100047085 3300005841 Bacteria 4092
116 Ga0068863_100269322 3300005841 Bacteria 1648
117 Ga0068858_100169723 3300005842 Bacteria 2057
118 Ga0068858_100180795 3300005842 Bacteria 1991
119 Ga0068858_100218274 3300005842 Bacteria 1805
120 Ga0068860_100225901 3300005843 Bacteria 1818
121 Ga0068860_100359355 3300005843 Bacteria 1434
122 Ga0068860_100365935 3300005843 Bacteria 1421
123 Ga0068860_100482574 3300005843 Bacteria 1236
124 Ga0068860_100569843 3300005843 Bacteria 1136
125 Ga0068860_100617494 3300005843 Bacteria 1090
126 Ga0068862_100118329 3300005844 Bacteria 2332
127 Ga0068862_100521364 3300005844 Bacteria 1131
128 Ga0068862_100793073 3300005844 Bacteria 924
129 Ga0081455_10027393 3300005937 Bacteria 5223
130 Ga0081455_10107291 3300005937 Bacteria 2227
131 Ga0081455_10109972 3300005937 Bacteria 2192
132 Ga0081455_10244865 3300005937 Bacteria 1315
133 Ga0081538_10040708 3300005981 Bacteria 2959
134 Ga0081540_1008955 3300005983 Bacteria 6929
135 Ga0081540_1023424 3300005983 Bacteria 3612
136 Ga0081540_1033253 3300005983 Bacteria 2803
137 Ga0081540_1038528 3300005983 Bacteria 2518
138 Ga0081540_1074886 3300005983 Bacteria 1549
139 Ga0081540_1084152 3300005983 Bacteria 1421
140 Ga0081539_10000048 3300005985 Bacteria 272906
141 Ga0081539_10036075 3300005985 Bacteria 2964
142 Ga0070717_10011435 3300006028 Bacteria 6741
143 Ga0070717_10012018 3300006028 Bacteria 6593
144 Ga0070717_10732534 3300006028 Bacteria 899
145 Ga0075365_10196779 3300006038 Bacteria 1411
146 Ga0075365_10280147 3300006038 Bacteria 1173
147 Ga0075363_100002635 3300006048 Bacteria 7396
148 Ga0075363_100071771 3300006048 Bacteria 1882
149 Ga0075363_100142227 3300006048 Bacteria 1351
150 Ga0075363_100159479 3300006048 Bacteria 1277
151 Ga0075364_10043997 3300006051 Bacteria 2903
152 Ga0075364_10144848 3300006051 Bacteria 1599
153 Ga0070716_100001724 3300006173 Bacteria 9859
154 Ga0070716_100005301 3300006173 Bacteria 6233
155 Ga0070712_100002575 3300006175 Bacteria 11202
156 Ga0070712_100008167 3300006175 Bacteria 6571
157 Ga0070712_100018957 3300006175 Bacteria 4478
158 Ga0070712_100022704 3300006175 Bacteria 4136
159 Ga0070712_100048715 3300006175 Bacteria 2939
160 Ga0070712_100569961 3300006175 Bacteria 956
161 Ga0075362_10048007 3300006177 Bacteria 1903
162 Ga0075362_10099154 3300006177 Bacteria 1360
163 Ga0075367_10076702 3300006178 Bacteria 2017
164 Ga0075367_10178837 3300006178 Bacteria 1322
165 Ga0075367_10278412 3300006178 Bacteria 1051
166 Ga0075369_10009532 3300006186 Bacteria 3776
167 Ga0075369_10069537 3300006186 Bacteria 1548
168 Ga0075369_10105043 3300006186 Bacteria 1269
169 Ga0075366_10040639 3300006195 Bacteria 2751
170 Ga0075366_10090039 3300006195 Bacteria 1837
171 Ga0075366_10259752 3300006195 Bacteria 1060
172 Ga0097621_100187595 3300006237 Bacteria 1789
173 Ga0075370_10053268 3300006353 Bacteria 2296
174 Ga0075370_10078556 3300006353 Bacteria 1895
175 Ga0075370_10221854 3300006353 Bacteria 1117
176 Ga0068871_100132076 3300006358 Bacteria 2118
177 Ga0068871_100196138 3300006358 Bacteria 1741
178 Ga0068871_100411789 3300006358 Bacteria 1206
179 Ga0075428_100778165 3300006844 Bacteria 1018
180 Ga0075434_100080096 3300006871 Bacteria 3262
181 Ga0075434_100572900 3300006871 Bacteria 1148
182 Ga0068865_100080664 3300006881 Bacteria 2334
183 Ga0068865_100209227 3300006881 Bacteria 1519
184 Ga0068865_100329938 3300006881 Bacteria 1230
185 Ga0068865_100621010 3300006881 Bacteria 916
186 Ga0075436_100192108 3300006914 Bacteria 1445
187 Ga0097620_100235271 3300006931 Bacteria 1920
188 Ga0097620_100671719 3300006931 Bacteria 1127
189 Ga0099795_10006522 3300007788 Bacteria 3190
190 Ga0105240_10006144 3300009093 Bacteria 17713
191 Ga0105240_10026751 3300009093 Bacteria 7566
192 Ga0105240_10031683 3300009093 Bacteria 6851
193 Ga0105240_10204399 3300009093 Bacteria 2313
194 Ga0105240_10280515 3300009093 Bacteria 1914
195 Ga0111539_10685995 3300009094 Bacteria 1192
196 Ga0105245_10109815 3300009098 Bacteria 2563
197 Ga0114129_10225048 3300009147 Bacteria 2529
198 Ga0105243_10229080 3300009148 Bacteria 1647
199 Ga0105243_10253946 3300009148 Bacteria 1571
200 Ga0105241_10148686 3300009174 Bacteria 1914
201 Ga0105241_10374259 3300009174 Bacteria 1243
202 Ga0105242_10649739 3300009176 Bacteria 1025
203 Ga0105242_10777263 3300009176 Bacteria 945
204 Ga0105248_10123069 3300009177 Bacteria 2926
205 Ga0105248_10869908 3300009177 Bacteria 1017
206 Ga0105237_10031550 3300009545 Bacteria 5369
207 Ga0105237_10283060 3300009545 Bacteria 1661
208 Ga0105237_10328722 3300009545 Bacteria 1533
209 Ga0105237_10645400 3300009545 Bacteria 1065
210 Ga0105237_10921115 3300009545 Bacteria 881
211 Ga0105237_10926396 3300009545 Bacteria 878
212 Ga0105238_10040832 3300009551 Bacteria 4700
213 Ga0105238_10198728 3300009551 Bacteria 1980
214 Ga0105238_10219633 3300009551 Bacteria 1877
215 Ga0105238_10351617 3300009551 Bacteria 1463
216 Ga0105238_10477278 3300009551 Bacteria 1246
217 Ga0105238_10546089 3300009551 Bacteria 1163
218 Ga0105249_10198830 3300009553 Bacteria 1961
219 Ga0105249_10312530 3300009553 Bacteria 1580
220 Ga0099796_10039157 3300010159 Bacteria 1594
221 Ga0105239_10022471 3300010375 Bacteria 6953
222 Ga0105239_10084117 3300010375 Bacteria 3504
223 Ga0105239_10090895 3300010375 Bacteria 3368
224 Ga0105239_10238920 3300010375 Bacteria 2039
225 Ga0105239_10252813 3300010375 Bacteria 1979
226 Ga0105239_10533040 3300010375 Bacteria 1336
227 Ga0105239_10602347 3300010375 Bacteria 1253
228 Ga0157370_10113104 3300013104 Bacteria 2537
229 Ga0157370_10557354 3300013104 Bacteria 1050
230 Ga0157369_10026404 3300013105 Bacteria 6442
231 Ga0157369_10046781 3300013105 Bacteria 4701
232 Ga0157374_10089923 3300013296 Bacteria 2926
233 Ga0157378_10002715 3300013297 Bacteria 15762
234 Ga0157378_10608512 3300013297 Bacteria 1105
235 Ga0163162_10127470 3300013306 Bacteria 2652
236 Ga0163162_10265281 3300013306 Bacteria 1849
237 Ga0163162_11530500 3300013306 Bacteria 760
238 Ga0157372_10031372 3300013307 Bacteria 5819
239 Ga0157372_10545492 3300013307 Bacteria 1352
240 Ga0157375_10130145 3300013308 Bacteria 2635
241 Ga0157375_10231195 3300013308 Bacteria 2008
242 Ga0157375_10314222 3300013308 Bacteria 1731
243 Ga0157375_10632810 3300013308 Bacteria 1227
244 Ga0163163_10262185 3300014325 Bacteria 1779
245 Ga0163163_10329184 3300014325 Bacteria 1582
246 Ga0163163_10406084 3300014325 Bacteria 1421
247 Ga0163163_10430380 3300014325 Bacteria 1379
248 Ga0163163_10791603 3300014325 Bacteria 1011
249 Ga0163163_10839309 3300014325 Bacteria 982
250 Ga0157380_11078668 3300014326 Bacteria 841
251 Ga0157377_10250121 3300014745 Bacteria 1148
252 Ga0157379_10285083 3300014968 Bacteria 1503
253 Ga0157379_10439921 3300014968 Bacteria 1202
254 Ga0157379_10534279 3300014968 Bacteria 1090
255 Ga0157376_10604550 3300014969 Bacteria 1092
256 Ga0163161_10779974 3300017792 Bacteria 802
257 Ga0213875_10056365 3300021388 Bacteria 1841
258 Ga0209563_105488 3300025230 Bacteria 2293
259 Ga0209677_101407 3300025253 Bacteria 10444
260 Ga0209148_1000418 3300025254 Bacteria 47611
261 Ga0209233_1006320 3300025261 Bacteria 3829
262 Ga0209233_1018369 3300025261 Bacteria 1883
263 Ga0209455_1002667 3300025272 Bacteria 6723
264 Ga0209130_1039697 3300025284 Bacteria 915
265 Ga0209564_1004051 3300025295 Bacteria 9245
266 Ga0209564_1004930 3300025295 Bacteria 7891
267 Ga0209758_1000992 3300025297 Bacteria 37900
268 Ga0209758_1003988 3300025297 Bacteria 12774
269 Ga0209758_1006211 3300025297 Bacteria 8724
270 Ga0209758_1016088 3300025297 Bacteria 3821
271 Ga0209256_1014609 3300025299 Bacteria 2811
272 Ga0207426_1002389 3300025302 Bacteria 12105
273 Ga0207426_1002931 3300025302 Bacteria 10046
274 Ga0207426_1024113 3300025302 Bacteria 2067
275 Ga0209257_1010825 3300025304 Bacteria 4521
276 Ga0207697_10011788 3300025315 Bacteria 3688
277 Ga0207697_10110796 3300025315 Bacteria 1175
278 Ga0207656_10007112 3300025321 Bacteria 4066
279 Ga0207682_10071672 3300025893 Bacteria 1469
280 Ga0207692_10001084 3300025898 Bacteria 9986
281 Ga0207692_10020867 3300025898 Bacteria 2988
282 Ga0207692_10023041 3300025898 Bacteria 2875
283 Ga0207642_10137028 3300025899 Bacteria 1285
284 Ga0207710_10033533 3300025900 Bacteria 2253
285 Ga0207710_10144449 3300025900 Bacteria 1151
286 Ga0207688_10016201 3300025901 Bacteria 4042
287 Ga0207688_10215987 3300025901 Bacteria 1154
288 Ga0207680_10477429 3300025903 Bacteria 887
289 Ga0207647_10012688 3300025904 Bacteria 5856
290 Ga0207685_10088793 3300025905 Bacteria 1296
291 Ga0207699_10000184 3300025906 Bacteria 37990
292 Ga0207643_10188074 3300025908 Bacteria 1252
293 Ga0207705_10031180 3300025909 Bacteria 3803
294 Ga0207654_10054988 3300025911 Bacteria 2303
295 Ga0207654_10089494 3300025911 Bacteria 1873
296 Ga0207654_10501923 3300025911 Bacteria 857
297 Ga0207707_10001217 3300025912 Bacteria 24173
298 Ga0207707_10004329 3300025912 Bacteria 12571
299 Ga0207707_10012573 3300025912 Bacteria 7357
300 Ga0207707_10029874 3300025912 Bacteria 4766
301 Ga0207707_10275996 3300025912 Bacteria 1456
302 Ga0207695_10000148 3300025913 Bacteria 208344
303 Ga0207695_10010844 3300025913 Bacteria 11100
304 Ga0207695_10064739 3300025913 Bacteria 3762
305 Ga0207695_10100215 3300025913 Bacteria 2893
306 Ga0207695_10141903 3300025913 Bacteria 2350
307 Ga0207695_10256594 3300025913 Bacteria 1647
308 Ga0207671_10009621 3300025914 Bacteria 8057
309 Ga0207671_10069645 3300025914 Bacteria 2622
310 Ga0207693_10004934 3300025915 Bacteria 11209
311 Ga0207693_10006712 3300025915 Bacteria 9502
312 Ga0207693_10044439 3300025915 Bacteria 3492
313 Ga0207693_10318068 3300025915 Bacteria 1218
314 Ga0207693_10337130 3300025915 Bacteria 1180
315 Ga0207663_10000585 3300025916 Bacteria 16125
316 Ga0207663_10000680 3300025916 Bacteria 15063
317 Ga0207663_10009659 3300025916 Bacteria 5106
318 Ga0207663_10024585 3300025916 Bacteria 3470
319 Ga0207663_10051159 3300025916 Bacteria 2571
320 Ga0207660_10014328 3300025917 Bacteria 5211
321 Ga0207662_10269986 3300025918 Bacteria 1122
322 Ga0207657_10000700 3300025919 Bacteria 35601
323 Ga0207657_10305575 3300025919 Bacteria 1259
324 Ga0207649_10284126 3300025920 Bacteria 1204
325 Ga0207649_10389782 3300025920 Bacteria 1040
326 Ga0207652_10002661 3300025921 Bacteria 14988
327 Ga0207652_10007721 3300025921 Bacteria 8642
328 Ga0207652_10013904 3300025921 Bacteria 6515
329 Ga0207681_10147193 3300025923 Bacteria 1761
330 Ga0207694_10055995 3300025924 Bacteria 3062
331 Ga0207694_10102197 3300025924 Bacteria 2272
332 Ga0207694_10109141 3300025924 Bacteria 2200
333 Ga0207694_10396572 3300025924 Bacteria 1147
334 Ga0207650_10091363 3300025925 Bacteria 2327
335 Ga0207650_10812283 3300025925 Bacteria 793
336 Ga0207687_10709527 3300025927 Bacteria 854
337 Ga0207700_10015244 3300025928 Bacteria 5061
338 Ga0207700_10134873 3300025928 Bacteria 2021
339 Ga0207700_10146977 3300025928 Bacteria 1944
340 Ga0207700_10165427 3300025928 Bacteria 1840
341 Ga0207664_10003622 3300025929 Bacteria 10338
342 Ga0207664_10012251 3300025929 Bacteria 6129
343 Ga0207664_10068749 3300025929 Bacteria 2846
344 Ga0207664_10094211 3300025929 Bacteria 2461
345 Ga0207664_10532916 3300025929 Bacteria 1053
346 Ga0207644_10155611 3300025931 Bacteria 1772
347 Ga0207690_10046755 3300025932 Bacteria 2868
348 Ga0207706_10053577 3300025933 Bacteria 3561
349 Ga0207706_10161302 3300025933 Bacteria 1971
350 Ga0207706_10550892 3300025933 Bacteria 993
351 Ga0207686_10564059 3300025934 Bacteria 892
352 Ga0207686_10755804 3300025934 Bacteria 776
353 Ga0207709_10017861 3300025935 Bacteria 3966
354 Ga0207709_10159778 3300025935 Bacteria 1570
355 Ga0207709_10341866 3300025935 Bacteria 1127
356 Ga0207669_10285598 3300025937 Bacteria 1247
357 Ga0207669_10365577 3300025937 Bacteria 1119
358 Ga0207704_10280309 3300025938 Bacteria 1267
359 Ga0207704_10445090 3300025938 Bacteria 1033
360 Ga0207704_10580008 3300025938 Bacteria 915
361 Ga0207704_10582708 3300025938 Bacteria 913
362 Ga0207665_10002484 3300025939 Bacteria 12418
363 Ga0207665_10007064 3300025939 Bacteria 7434
364 Ga0207665_10163728 3300025939 Bacteria 1602
365 Ga0207691_10479073 3300025940 Bacteria 1058
366 Ga0207711_10045483 3300025941 Bacteria 3751
367 Ga0207711_10913739 3300025941 Bacteria 816
368 Ga0207689_10136965 3300025942 Bacteria 2016
369 Ga0207661_10001291 3300025944 Bacteria 16759
370 Ga0207661_10397557 3300025944 Bacteria 1249
371 Ga0207667_10001909 3300025949 Bacteria 26170
372 Ga0207667_10030060 3300025949 Bacteria 5881
373 Ga0207667_10237390 3300025949 Bacteria 1866
374 Ga0207667_10326029 3300025949 Bacteria 1568
375 Ga0207667_10407962 3300025949 Bacteria 1383
376 Ga0207667_10420887 3300025949 Bacteria 1359
377 Ga0207667_10448463 3300025949 Bacteria 1311
378 Ga0207712_10199502 3300025961 Bacteria 1586
379 Ga0207668_10051032 3300025972 Bacteria 2854
380 Ga0207668_10245744 3300025972 Bacteria 1450
381 Ga0207668_10506330 3300025972 Bacteria 1039
382 Ga0207640_10266437 3300025981 Bacteria 1338
383 Ga0207640_10308400 3300025981 Bacteria 1255
384 Ga0207640_10405229 3300025981 Bacteria 1112
385 Ga0207677_10100007 3300026023 Bacteria 2131
386 Ga0207703_10032875 3300026035 Bacteria 4109
387 Ga0207703_10164381 3300026035 Bacteria 1946
388 Ga0207703_10418455 3300026035 Bacteria 1246
389 Ga0207703_10447648 3300026035 Bacteria 1206
390 Ga0207639_10002676 3300026041 Bacteria 11963
391 Ga0207639_10042968 3300026041 Bacteria 3390
392 Ga0207639_10081860 3300026041 Bacteria 2558
393 Ga0207639_10274325 3300026041 Bacteria 1480
394 Ga0207678_10018564 3300026067 Bacteria 6107
395 Ga0207678_10044801 3300026067 Bacteria 3825
396 Ga0207708_10170608 3300026075 Bacteria 1723
397 Ga0207702_10000546 3300026078 Bacteria 42023
398 Ga0207702_10148445 3300026078 Bacteria 2130
399 Ga0207702_10185504 3300026078 Bacteria 1918
400 Ga0207702_10741297 3300026078 Bacteria 969
401 Ga0207702_10885931 3300026078 Bacteria 884
402 Ga0207641_10285304 3300026088 Bacteria 1554
403 Ga0207641_10333260 3300026088 Bacteria 1442
404 Ga0207648_10075157 3300026089 Bacteria 2946
405 Ga0207648_10120862 3300026089 Bacteria 2303
406 Ga0207648_10317421 3300026089 Bacteria 1400
407 Ga0207676_10352687 3300026095 Bacteria 1361
408 Ga0207676_10482211 3300026095 Bacteria 1174
409 Ga0207674_10028047 3300026116 Bacteria 5948
410 Ga0207674_10048764 3300026116 Bacteria 4333
411 Ga0207674_10530378 3300026116 Bacteria 1137
412 Ga0207675_100209834 3300026118 Bacteria 1873
413 Ga0207675_100622266 3300026118 Bacteria 1084
414 Ga0207683_10164315 3300026121 Bacteria 2008
415 Ga0207683_10168846 3300026121 Bacteria 1981
416 Ga0207698_10254092 3300026142 Bacteria 1610
417 Ga0209389_1000142 3300027296 Bacteria 62072
418 Ga0209589_1000331 3300027357 Bacteria 62072
419 Ga0209489_100818 3300027361 Bacteria 62070
420 Ga0209813_10010674 3300027866 Bacteria 2383
421 Ga0207428_10485609 3300027907 Bacteria 898
422 Ga0268266_10001335 3300028379 Bacteria 29884
423 Ga0268266_10438309 3300028379 Bacteria 1240
424 Ga0268265_10512415 3300028380 Bacteria 1132
425 Ga0268265_10580303 3300028380 Bacteria 1068
426 Ga0268265_10807968 3300028380 Bacteria 914
427 Ga0268265_11075820 3300028380 Bacteria 797
428 Ga0268264_10191625 3300028381 Bacteria 1864
429 Ga0268264_10366852 3300028381 Bacteria 1375
430 Ga0268264_10579964 3300028381 Bacteria 1103
431 Ga0268264_10727049 3300028381 Bacteria 987
432 Ga0307517_10000232 3300028786 Bacteria 94332
433 Ga0307517_10223864 3300028786 Bacteria 1139
434 Ga0307515_10157960 3300028794 Bacteria 2329
435 Ga0307511_10045310 3300030521 Bacteria 3636
436 Ga0265330_10105977 3300031235 Bacteria 1202
437 Ga0265325_10026243 3300031241 Bacteria 3158
438 Ga0265316_10048928 3300031344 Bacteria 3333
439 Ga0307513_10183023 3300031456 Bacteria 1956
440 Ga0307509_10038863 3300031507 Bacteria 5187
441 Ga0307509_10170593 3300031507 Bacteria 2056
442 Ga0307509_10372470 3300031507 Bacteria 1144
443 Ga0307508_10085301 3300031616 Bacteria 2741
444 Ga0265314_10021118 3300031711 Bacteria 5015
445 Ga0265314_10081447 3300031711 Bacteria 2133
446 Ga0265342_10017967 3300031712 Bacteria 4592
447 Ga0265342_10122093 3300031712 Bacteria 1466
448 Ga0307516_10011325 3300031730 Bacteria 9707
449 Ga0307516_10255965 3300031730 Bacteria 1443
450 Ga0307516_10365399 3300031730 Bacteria 1107
451 Ga0307405_10108057 3300031731 Bacteria 1879
452 Ga0307413_10026553 3300031824 Bacteria 3193
453 Ga0307406_10184148 3300031901 Bacteria 1523
454 Ga0307406_10260630 3300031901 Bacteria 1311
455 Ga0307406_10363163 3300031901 Bacteria 1136
456 Ga0307407_10266860 3300031903 Bacteria 1180
457 Ga0307412_10041444 3300031911 Bacteria 2984
458 Ga0307412_10281166 3300031911 Bacteria 1307
459 Ga0307409_100808243 3300031995 Bacteria 946
460 Ga0307416_100542984 3300032002 Bacteria 1234
461 Ga0307414_10617857 3300032004 Bacteria 974
462 Ga0307411_10052199 3300032005 Bacteria 2672
463 Ga0307411_10129259 3300032005 Bacteria 1843
464 Ga0307415_100258015 3300032126 Bacteria 1420
465 Ga0307415_100318916 3300032126 Bacteria 1295
466 Ga0307510_10010850 3300033180 Bacteria 10828
467 Ga0307510_10019009 3300033180 Bacteria 8062
468 Ga0307510_10101854 3300033180 Bacteria 2657
469 Ga0373926_0162609 3300035083 Bacteria 853
470 Ga0373928_0069102 3300035084 Bacteria 869
471 Ga0373928_0111700 3300035084 Bacteria 724
472 Ga0373940_0108324 3300035088 Bacteria 850
473 Ga0373936_0002293 3300035113 Bacteria 7163
474 Ga0373953_0008406 3300035117 Bacteria 3505
475 Ga0373954_0006447 3300035118 Bacteria 5117
476 Ga0373954_0074360 3300035118 Bacteria 1617
477 Ga0373956_0015957 3300035119 Bacteria 3151
478 Ga0373943_0229359 3300035170 Bacteria 1037
479 Ga0373943_0281041 3300035170 Bacteria 941
480 Ga0373946_0012943 3300035171 Bacteria 3130
481 Ga0373946_0333097 3300035171 Bacteria 756
482 Ga0373955_0008311 3300035172 Bacteria 4815
483 Ga0373955_0136081 3300035172 Bacteria 1437
484 Ga0373955_0192633 3300035172 Bacteria 1212
485 Ga0373955_0381978 3300035172 Bacteria 855
486 Ga0373942_0025500 3300035207 Bacteria 1525
487 Ga0373961_0023631 3300035241 Bacteria 1656
488 Ga0373924_0003894 3300035410 Bacteria 5175
489 Ga0373924_0103433 3300035410 Bacteria 1227
490 Ga0373931_0015989 3300035691 Bacteria 3687
491 Ga0373931_0395554 3300035691 Bacteria 874
492 Ga0373935_0000595 3300035692 Bacteria 18877
493 Ga0373935_0012443 3300035692 Bacteria 5118
494 Ga0373935_0053467 3300035692 Bacteria 2569
495 Ga0373927_0001021 3300035695 Bacteria 21303
496 Ga0373927_0036138 3300035695 Bacteria 3213
497 Ga0373927_0217715 3300035695 Bacteria 1254
498 Ga0373927_0267405 3300035695 Bacteria 1124
499 Ga0373933_0001113 3300035724 Bacteria 16004
500 Ga0373933_0010410 3300035724 Bacteria 5098
501 Ga0373933_0339803 3300035724 Bacteria 975
502 Ga0373947_0000970 3300035725 Bacteria 17506
503 Ga0373937_0095132 3300036401 Bacteria 2762
504 Ga0373925_0006983 3300037068 Bacteria 8255
505 Ga0373925_0027554 3300037068 Bacteria 4158
506 Ga0373925_0253367 3300037068 Bacteria 1412
507 Ga0395900_0055668 3300037418 Bacteria 4073
508 Ga0395900_0650153 3300037418 Bacteria 991
509 Ga0395898_0010317 3300037466 Bacteria 9773
510 Ga0395898_0251530 3300037466 Bacteria 1685
511 Ga0395905_0019136 3300037471 Bacteria 6495
512 Ga0395905_0109230 3300037471 Bacteria 2597
513 Ga0436364_0738152 3300037853 Bacteria 2964
514 Ga0436364_0984470 3300037853 Bacteria 2585
515 Ga0395901_0035089 3300038443 Bacteria 5183
516 Ga0395901_0039676 3300038443 Bacteria 4874
517 Ga0436365_0265605 3300039437 Bacteria 1126
518 Ga0436365_0303379 3300039437 Bacteria 847
519 Ga0436365_0411209 3300039437 Bacteria 10910
520 Ga0436361_0532765 3300039447 Bacteria 985
521 Ga0436363_1287774 3300039450 Bacteria 1847
522 Ga0436362_1005505 3300039453 Bacteria 3174
523 Ga0466969_0141349 3300044656 Bacteria 1112
524 Ga0466969_0162377 3300044656 Bacteria 1026
525 Ga0466972_0000306 3300044658 Bacteria 28921
526 Ga0466972_0000804 3300044658 Bacteria 14929
527 Ga0466972_0102091 3300044658 Bacteria 1357
528 Ga0466972_0199137 3300044658 Bacteria 938
529 Ga0466965_0161057 3300044683 Bacteria 1177
530 Ga0466966_0007733 3300044684 Bacteria 7118
531 Ga0466966_0043550 3300044684 Bacteria 2877
532 Ga0466961_0000770 3300044693 Bacteria 20096
533 Ga0466961_0391074 3300044693 Bacteria 844
534 Ga0466964_0102741 3300044706 Bacteria 1262
535 Ga0466964_0279370 3300044706 Bacteria 834
536 Ga0466968_0028571 3300044735 Bacteria 2300
537 Ga0466970_0117082 3300044765 Bacteria 1457
538 Ga0466970_0218130 3300044765 Bacteria 1064
539 Ga0466970_0222244 3300044765 Bacteria 1054
540 Ga0466957_0228418 3300044842 Bacteria 1231
541 Ga0466959_0003303 3300045049 Bacteria 10524
542 Ga0466959_0047779 3300045049 Bacteria 3147
543 Ga0466959_0317331 3300045049 Bacteria 1066
544 Ga0466967_0006466 3300045976 Bacteria 8296
545 Ga0466967_0259799 3300045976 Bacteria 1661
546 Ga0495592_0013035 3300046454 Bacteria 6326
547 Ga0495592_0261505 3300046454 Bacteria 1140
548 Ga0495603_0001390 3300046455 Bacteria 14060
549 Ga0495603_0009344 3300046455 Bacteria 5927
550 Ga0495603_0056638 3300046455 Bacteria 2320
551 Ga0495603_0114465 3300046455 Bacteria 1573
552 Ga0495629_0000915 3300046459 Bacteria 23696
553 Ga0495629_0011323 3300046459 Bacteria 6479
554 Ga0495629_0191547 3300046459 Bacteria 1415
555 Ga0495629_0200420 3300046459 Bacteria 1380
556 Ga0495629_0468573 3300046459 Bacteria 852
557 Ga0495638_0000880 3300046460 Bacteria 30953
558 Ga0495638_0053467 3300046460 Bacteria 2513
559 Ga0495651_0043528 3300046462 Bacteria 3483
560 Ga0495651_0060267 3300046462 Bacteria 2907
561 Ga0495651_0154845 3300046462 Bacteria 1648
562 Ga0495653_0009157 3300046463 Bacteria 8096
563 Ga0495653_0118678 3300046463 Bacteria 1889
564 Ga0495580_0001523 3300046472 Bacteria 20383
565 Ga0495582_0000302 3300046473 Bacteria 27218
566 Ga0495582_0111898 3300046473 Bacteria 1534
567 Ga0495605_0175610 3300046474 Bacteria 944
568 Ga0495605_0219528 3300046474 Bacteria 822
569 Ga0495639_0001076 3300046475 Bacteria 12289
570 Ga0495639_0116494 3300046475 Bacteria 1272
571 Ga0495639_0161660 3300046475 Bacteria 1084
572 Ga0495639_0223844 3300046475 Bacteria 925
573 Ga0495662_0001265 3300046476 Bacteria 12489
574 Ga0495662_0109893 3300046476 Bacteria 1351
575 Ga0495664_0002747 3300046477 Bacteria 9463
576 Ga0495664_0107226 3300046477 Bacteria 1685
577 Ga0495584_0089326 3300046491 Bacteria 1553
578 Ga0495584_0133506 3300046491 Bacteria 1260
579 Ga0495585_0032041 3300046492 Bacteria 2980
580 Ga0495585_0194995 3300046492 Bacteria 1034
581 Ga0495585_0242057 3300046492 Bacteria 903
582 Ga0495594_0000046 3300046499 Bacteria 53822
583 Ga0495594_0142731 3300046499 Bacteria 1358
584 Ga0495596_0059215 3300046500 Bacteria 1493
585 Ga0495596_0163646 3300046500 Bacteria 865
586 Ga0495607_0041012 3300046501 Bacteria 2752
587 Ga0495606_0149603 3300046507 Bacteria 1371
588 Ga0495608_0023287 3300046511 Bacteria 4246
589 Ga0495610_0056579 3300046512 Bacteria 1885
590 Ga0495616_0185930 3300046513 Bacteria 921
591 Ga0495618_0034111 3300046514 Bacteria 3190
592 Ga0495618_0470320 3300046514 Bacteria 761
593 Ga0495628_0016164 3300046516 Bacteria 6226
594 Ga0495628_0056134 3300046516 Bacteria 3101
595 Ga0495628_0066292 3300046516 Bacteria 2822
596 Ga0495630_0010764 3300046517 Bacteria 6605
597 Ga0495631_0110500 3300046518 Bacteria 1182
598 Ga0495631_0191522 3300046518 Bacteria 875
599 Ga0495631_0242572 3300046518 Bacteria 768
600 Ga0495632_0138315 3300046519 Bacteria 1131
601 Ga0495637_0065561 3300046520 Bacteria 1478
602 Ga0495637_0138050 3300046520 Bacteria 927
603 Ga0495637_0140372 3300046520 Bacteria 917
604 Ga0495644_0032974 3300046523 Bacteria 1957
605 Ga0495644_0090753 3300046523 Bacteria 1153
606 Ga0495648_0174313 3300046524 Bacteria 1099
607 Ga0495648_0252318 3300046524 Bacteria 851
608 Ga0495663_0142196 3300046525 Bacteria 815
609 Ga0495666_0251170 3300046526 Bacteria 806
610 Ga0495652_0045047 3300046529 Bacteria 3796
611 Ga0495652_0052089 3300046529 Bacteria 3492
612 Ga0495652_0125031 3300046529 Bacteria 2045
613 Ga0495665_0005462 3300046531 Bacteria 6846
614 Ga0495665_0155252 3300046531 Bacteria 1194
615 Ga0495640_0014808 3300046533 Bacteria 5889
616 Ga0495640_0022664 3300046533 Bacteria 4586
617 Ga0495640_0041763 3300046533 Bacteria 3203
618 Ga0495640_0120391 3300046533 Bacteria 1707
619 Ga0495586_0159932 3300046535 Bacteria 1270
620 Ga0495587_0008424 3300046536 Bacteria 6630
621 Ga0495587_0028223 3300046536 Bacteria 3413
622 Ga0495598_0039336 3300046537 Bacteria 1374
623 Ga0495598_0068940 3300046537 Bacteria 1109
624 Ga0495598_0125482 3300046537 Bacteria 874
625 Ga0495609_0161563 3300046538 Bacteria 949
626 Ga0495621_0018725 3300046539 Bacteria 2252
627 Ga0495645_0031433 3300046543 Bacteria 3869
628 Ga0495645_0038894 3300046543 Bacteria 3469
629 Ga0495622_0001947 3300046557 Bacteria 10142
630 Ga0495622_0016887 3300046557 Bacteria 3397
631 Ga0495622_0022475 3300046557 Bacteria 2939
632 Ga0495622_0116846 3300046557 Bacteria 1219
633 Ga0495622_0164627 3300046557 Bacteria 999
634 Ga0495633_0023444 3300046558 Bacteria 3059
635 Ga0495633_0103038 3300046558 Bacteria 1324
636 Ga0495633_0236163 3300046558 Bacteria 835
637 Ga0495667_0012267 3300046559 Bacteria 5808
638 Ga0495667_0049672 3300046559 Bacteria 2769
639 Ga0495656_0007484 3300046615 Bacteria 3858
640 Ga0495656_0092460 3300046615 Bacteria 1385
641 Ga0495656_0382859 3300046615 Bacteria 733
642 Ga0495668_0063539 3300046616 Bacteria 2033
643 Ga0495668_0377495 3300046616 Bacteria 778
644 Ga0495634_0001329 3300046642 Bacteria 22513
645 Ga0495634_0114644 3300046642 Bacteria 1730
646 Ga0495611_0120632 3300046648 Bacteria 1222
647 Ga0495625_0111727 3300046660 Bacteria 1867
648 Ga0495625_0118440 3300046660 Bacteria 1804
649 Ga0495635_0004154 3300046663 Bacteria 10044
650 Ga0495635_0004822 3300046663 Bacteria 9377
651 Ga0495635_0080087 3300046663 Bacteria 2235
652 Ga0495659_0009582 3300046664 Bacteria 3095
653 Ga0495659_0053327 3300046664 Bacteria 1477
654 Ga0495661_0186151 3300046665 Bacteria 1097
655 Ga0495588_0001920 3300046674 Bacteria 8877
656 Ga0495657_0020270 3300046675 Bacteria 4783
657 Ga0495657_0022368 3300046675 Bacteria 4529
658 Ga0495657_0062078 3300046675 Bacteria 2470
659 Ga0495657_0277491 3300046675 Bacteria 1004
660 Ga0495599_0004544 3300046678 Bacteria 8230
661 Ga0495623_0088438 3300046679 Bacteria 1907
662 Ga0495647_0002160 3300046681 Bacteria 6146
663 Ga0495658_0000201 3300046683 Bacteria 34784
664 Ga0495669_0093505 3300046684 Bacteria 1390
665 Ga0495613_0004521 3300046689 Bacteria 10429
666 Ga0495613_0023990 3300046689 Bacteria 4544
667 Ga0495613_0354347 3300046689 Bacteria 1007
668 Ga0495624_0001903 3300046690 Bacteria 15891
669 Ga0495624_0038534 3300046690 Bacteria 3070
670 Ga0495624_0080169 3300046690 Bacteria 2023
671 Ga0495624_0184126 3300046690 Bacteria 1272
672 Ga0495624_0408186 3300046690 Bacteria 815
673 Ga0495670_0062870 3300046691 Bacteria 1868
674 Ga0495671_0266772 3300046692 Bacteria 825
675 Ga0495589_0194388 3300046794 Bacteria 959
676 Ga0495589_0200469 3300046794 Bacteria 942
677 Ga0495600_0007343 3300046809 Bacteria 6735
678 Ga0495600_0019156 3300046809 Bacteria 4366
679 Ga0495600_0261955 3300046809 Bacteria 1098
680 Ga0495581_0020918 3300047315 Bacteria 3796
681 Ga0495581_0066978 3300047315 Bacteria 2076
682 Ga0495581_0136213 3300047315 Bacteria 1431
683 Ga0495604_0003808 3300047317 Bacteria 12011
684 Ga0495604_0006226 3300047317 Bacteria 9469
685 Ga0495604_0653718 3300047317 Bacteria 670
686 Ga0495636_0019953 3300047318 Bacteria 2698
687 Ga0495636_0169243 3300047318 Bacteria 987
688 Ga0495674_0002494 3300047319 Bacteria 17944
689 Ga0495674_0016347 3300047319 Bacteria 6919
690 Ga0495672_0035732 3300047320 Bacteria 3058
691 Ga0495672_0125167 3300047320 Bacteria 1360
692 Ga0495672_0214234 3300047320 Bacteria 955
693 Ga0495676_0021845 3300047321 Bacteria 5579
694 Ga0495676_0083168 3300047321 Bacteria 2420
695 Ga0495680_0177655 3300047322 Bacteria 1538
696 Ga0495680_0215289 3300047322 Bacteria 1373
697 Ga0495680_0341864 3300047322 Bacteria 1044
698 Ga0495687_021924 3300047443 Bacteria 3077
699 Ga0495675_0143259 3300047444 Bacteria 1480
700 Ga0495677_0069234 3300047445 Bacteria 1314
701 Ga0495677_0220675 3300047445 Bacteria 738
702 Ga0495679_045734 3300047446 Bacteria 1336
703 Ga0495685_035692 3300047447 Bacteria 1708
704 Ga0495685_116384 3300047447 Bacteria 878
705 Ga0495673_0022825 3300047469 Bacteria 3059
706 Ga0495673_0054536 3300047469 Bacteria 1738
707 Ga0495673_0203275 3300047469 Bacteria 740
708 Ga0495684_0212105 3300047471 Bacteria 1423
709 Ga0495686_0050099 3300047472 Bacteria 2625
710 Ga0495686_0127757 3300047472 Bacteria 1510
711 Ga0495686_0234882 3300047472 Bacteria 1037
712 Ga0495686_0257824 3300047472 Bacteria 977
713 Ga0495593_0000100 3300047673 Bacteria 39337
714 Ga0495593_0039768 3300047673 Bacteria 2534
715 Ga0495602_0031546 3300048088 Bacteria 5008
716 Ga0495602_0040379 3300048088 Bacteria 4280
717 Ga0495602_0074008 3300048088 Bacteria 2897
718 Ga0495615_0119086 3300048090 Bacteria 762
719 Ga0496100_0298392 3300048903 Bacteria 1205
720 Ga0496100_0377035 3300048903 Bacteria 1077
721 Ga0496101_0022763 3300048904 Bacteria 4318
722 Ga0496101_0085366 3300048904 Bacteria 2339
723 Ga0496101_0141721 3300048904 Bacteria 1832
724 Ga0496101_0149908 3300048904 Bacteria 1783
725 Ga0496101_0201161 3300048904 Bacteria 1540
726 Ga0496101_0234098 3300048904 Bacteria 1428
727 Ga0496101_0286600 3300048904 Bacteria 1288
728 Ga0496101_0558465 3300048904 Bacteria 905
729 Ga0496102_0076683 3300048905 Bacteria 3075
730 Ga0496102_0079587 3300048905 Bacteria 3018
731 Ga0496102_0097650 3300048905 Bacteria 2725
732 Ga0496102_0235912 3300048905 Bacteria 1725
733 Ga0496102_0304465 3300048905 Bacteria 1502
734 Ga0496102_0400093 3300048905 Bacteria 1291
735 Ga0496102_0402980 3300048905 Bacteria 1286
736 Ga0496102_0459300 3300048905 Bacteria 1194
737 Ga0496102_0505779 3300048905 Bacteria 1130
738 Ga0496102_0612993 3300048905 Bacteria 1011
739 Ga0496102_0789037 3300048905 Bacteria 872
740 Ga0496103_0049170 3300048906 Bacteria 2607
741 Ga0496103_0174853 3300048906 Bacteria 1379
742 Ga0496103_0248391 3300048906 Bacteria 1145
743 Ga0496104_0002017 3300048907 Bacteria 17626
744 Ga0496104_0013397 3300048907 Bacteria 7388
745 Ga0496104_0178357 3300048907 Bacteria 2034
746 Ga0496105_0014164 3300048908 Bacteria 6345
747 Ga0496105_0158786 3300048908 Bacteria 1856
748 Ga0496105_0211572 3300048908 Bacteria 1580
749 Ga0496105_0451779 3300048908 Bacteria 1014
750 Ga0496106_0110392 3300048909 Bacteria 2141
751 Ga0496106_0243799 3300048909 Bacteria 1436
752 Ga0496106_0306063 3300048909 Bacteria 1275
753 Ga0496106_0412024 3300048909 Bacteria 1086
754 Ga0496107_0029068 3300048910 Bacteria 3930
755 Ga0496107_0352377 3300048910 Bacteria 1095
756 Ga0496107_0385605 3300048910 Bacteria 1042
757 Ga0496107_0401019 3300048910 Bacteria 1020
758 Ga0496107_0769059 3300048910 Bacteria 706
759 Ga0496108_0059860 3300048911 Bacteria 3203
760 Ga0496108_0067424 3300048911 Bacteria 3018
761 Ga0496108_0134973 3300048911 Bacteria 2122
762 Ga0496108_0476619 3300048911 Bacteria 1090
763 Ga0496108_0749374 3300048911 Bacteria 845
764 Ga0496109_0168973 3300048912 Bacteria 2051
765 Ga0496109_0273274 3300048912 Bacteria 1592
766 Ga0496109_0354752 3300048912 Bacteria 1385
767 Ga0496109_0480950 3300048912 Bacteria 1172
768 Ga0496109_0657988 3300048912 Bacteria 985
769 Ga0496109_0810174 3300048912 Bacteria 874
770 Ga0496110_0005974 3300048913 Bacteria 9585
771 Ga0496110_0159198 3300048913 Bacteria 2046
772 Ga0496110_0336989 3300048913 Bacteria 1374
773 Ga0496110_0632832 3300048913 Bacteria 969
774 Ga0496111_0046141 3300048914 Bacteria 3137
775 Ga0496111_0090187 3300048914 Bacteria 2245
776 Ga0496111_0165877 3300048914 Bacteria 1640
777 Ga0496111_0268738 3300048914 Bacteria 1265
778 Ga0496111_0472391 3300048914 Bacteria 924
779 Ga0496112_0073684 3300048915 Bacteria 3375
780 Ga0496112_0082564 3300048915 Bacteria 3178
781 Ga0496112_0186977 3300048915 Bacteria 2034
782 Ga0496112_0351266 3300048915 Bacteria 1417
783 Ga0496113_0014545 3300048916 Bacteria 5372
784 Ga0496113_0112818 3300048916 Bacteria 2118
785 Ga0496113_0155196 3300048916 Bacteria 1807
786 Ga0496113_0238292 3300048916 Bacteria 1451
787 Ga0496113_0320899 3300048916 Bacteria 1241
788 Ga0496113_0392864 3300048916 Bacteria 1113
789 Ga0496113_0421495 3300048916 Bacteria 1072
790 Ga0496114_0086672 3300048917 Bacteria 2654
791 Ga0496114_0118976 3300048917 Bacteria 2270
792 Ga0496114_0144087 3300048917 Bacteria 2064
793 Ga0496114_0197224 3300048917 Bacteria 1762
794 Ga0496114_0329999 3300048917 Bacteria 1349
795 Ga0496115_0013622 3300048918 Bacteria 6153
796 Ga0496116_0043611 3300048919 Bacteria 3054
797 Ga0496116_0116134 3300048919 Bacteria 1560
798 Ga0496116_0215041 3300048919 Bacteria 992
799 Ga0496116_0260054 3300048919 Bacteria 857
800 Ga0496117_0108922 3300048920 Bacteria 1731
801 Ga0496118_0023553 3300048921 Bacteria 5344
802 Ga0496118_0041055 3300048921 Bacteria 3669
803 Ga0496118_0138648 3300048921 Bacteria 1547
804 Ga0496118_0225317 3300048921 Bacteria 1087
805 Ga0496119_0009198 3300048922 Bacteria 8528
806 Ga0496119_0050219 3300048922 Bacteria 2572
807 Ga0496119_0134725 3300048922 Bacteria 1341
808 Ga0496120_0084242 3300048923 Bacteria 1714
809 Ga0496121_0000278 3300048924 Bacteria 106838
810 Ga0496121_0014972 3300048924 Bacteria 8168
811 Ga0496121_0051540 3300048924 Bacteria 3465
812 Ga0496121_0093467 3300048924 Bacteria 2341
813 Ga0496121_0108562 3300048924 Bacteria 2122
814 Ga0496121_0149826 3300048924 Bacteria 1718
815 Ga0496121_0232637 3300048924 Bacteria 1289
816 Ga0496121_0360565 3300048924 Bacteria 965
817 Ga0496121_0395786 3300048924 Bacteria 906
818 Ga0496122_0043096 3300048925 Bacteria 3540
819 Ga0496122_0144868 3300048925 Bacteria 1478
820 Ga0496123_0171852 3300048926 Bacteria 1142
821 Ga0496124_0090250 3300048927 Bacteria 2500
822 Ga0496124_0091231 3300048927 Bacteria 2483
823 Ga0496124_0133286 3300048927 Bacteria 1971
824 Ga0496124_0589564 3300048927 Bacteria 725
825 Ga0496125_0045202 3300048928 Bacteria 3710
826 Ga0496125_0057511 3300048928 Bacteria 3149
827 Ga0496125_0114688 3300048928 Bacteria 1940
828 Ga0496125_0120412 3300048928 Bacteria 1874
829 Ga0496125_0142097 3300048928 Bacteria 1667
830 Ga0496125_0158875 3300048928 Bacteria 1539
831 Ga0496125_0283110 3300048928 Bacteria 1026
832 Ga0496125_0370739 3300048928 Bacteria 847
833 Ga0496126_0011733 3300048929 Bacteria 9026
834 Ga0496126_0066932 3300048929 Bacteria 3211
835 Ga0496126_0080549 3300048929 Bacteria 2881
836 Ga0496126_0116623 3300048929 Bacteria 2320
837 Ga0496126_0136354 3300048929 Bacteria 2117
838 Ga0496126_0169065 3300048929 Bacteria 1864
839 Ga0496126_0201356 3300048929 Bacteria 1681
840 Ga0496126_0211854 3300048929 Bacteria 1631
841 Ga0496126_0377561 3300048929 Bacteria 1154
842 Ga0496126_0403285 3300048929 Bacteria 1108
843 Ga0496126_0444539 3300048929 Bacteria 1044
844 Ga0496126_0452777 3300048929 Bacteria 1033
845 Ga0496126_0638625 3300048929 Bacteria 834
846 Ga0501034_0047500 3300049571 Bacteria 4334
847 Ga0501036_0134500 3300049572 Bacteria 2087
848 Ga0501037_0250093 3300049573 Bacteria 1241
849 Ga0501038_0082192 3300049574 Bacteria 2712
850 Ga0501041_0063098 3300049577 Bacteria 2269
851 Ga0501042_0285099 3300049578 Bacteria 1193
852 Ga0501043_0027498 3300049579 Bacteria 4464
853 Ga0501046_0005445 3300049580 Bacteria 11378
854 Ga0501046_0342668 3300049580 Bacteria 1086
855 Ga0501047_0023204 3300049581 Bacteria 5957
856 Ga0501047_0179362 3300049581 Bacteria 1984
857 Ga0501047_0348788 3300049581 Bacteria 1317
858 Ga0501048_0080390 3300049582 Bacteria 2300
859 Ga0501067_0453636 3300049583 Bacteria 716
860 Ga0501068_0359019 3300049584 Bacteria 937
861 Ga0501070_0019284 3300049586 Bacteria 5720
862 Ga0501070_0732693 3300049586 Bacteria 780
863 Ga0501074_0098293 3300049590 Bacteria 2095
864 Ga0501077_0159734 3300049593 Bacteria 1431
865 Ga0501080_0030696 3300049742 Bacteria 5007
866 Ga0501080_0418865 3300049742 Bacteria 1203
867 Ga0501081_0378528 3300049743 Bacteria 1046
868 Ga0501035_0015880 3300049822 Bacteria 6948
869 Ga0501035_0177012 3300049822 Bacteria 1839
870 Ga0501044_0022135 3300049823 Bacteria 6777
871 nmdc:mga03n38_254487_c1 3300050490 Bacteria 929
872 nmdc:mga03n38_2806_c1 3300050490 Bacteria 5474
873 nmdc:mga03n38_31131_c1 3300050490 Bacteria 2249
874 nmdc:mga03n38_473151_c1 3300050490 Bacteria 700
875 nmdc:mga00v17_139434_c1 3300050491 Bacteria 1554
876 nmdc:mga00v17_70950_c1 3300050491 Bacteria 2159
877 nmdc:mga00v17_85010_c1 3300050491 Bacteria 1981
878 nmdc:mga0yw44_111959_c1 3300050492 Bacteria 1750
879 nmdc:mga0yw44_122028_c1 3300050492 Bacteria 1679
880 nmdc:mga0yw44_62839_c1 3300050492 Bacteria 2282
881 nmdc:mga0yw44_75349_c1 3300050492 Bacteria 2104
882 nmdc:mga0yw44_86056_c1 3300050492 Bacteria 1979
883 nmdc:mga0k408_146577_c1 3300050493 Bacteria 1405
884 nmdc:mga0k408_37421_c1 3300050493 Bacteria 2026
885 nmdc:mga0k408_44479_c1 3300050493 Bacteria 2561
886 nmdc:mga0k408_56176_c1 3300050493 Bacteria 2284
887 nmdc:mga06z11_165622_c1 3300050494 Bacteria 1266
888 nmdc:mga06z11_69619_c1 3300050494 Bacteria 1858
889 nmdc:mga07m45_121951_c1 3300050496 Bacteria 1506
890 nmdc:mga07m45_134725_c1 3300050496 Bacteria 1430
891 nmdc:mga07m45_247737_c1 3300050496 Bacteria 1037
892 nmdc:mga07m45_344647_c1 3300050496 Bacteria 866
893 nmdc:mga07m45_40313_c1 3300050496 Bacteria 1917
894 nmdc:mga05p37_690309_c1 3300050507 Bacteria 1136
895 nmdc:mga0qj67_540059_c1 3300050509 Bacteria 935
896 nmdc:mga08y16_272165_c1 3300050511 Bacteria 1748
897 nmdc:mga08y16_47004_c1 3300050511 Bacteria 4518
898 nmdc:mga0sz30_113233_c1 3300050516 Bacteria 1190
899 nmdc:mga0sz30_165944_c1 3300050516 Bacteria 979
900 nmdc:mga0sz30_22699_c2 3300050516 Bacteria 1389
901 nmdc:mga0sz30_23280_c1 3300050516 Bacteria 2519
902 nmdc:mga0sz30_9134_c1 3300050516 Bacteria 3762
903 Ga0495601_0054935 3300053077 Bacteria 2520
904 Ga0495601_0116784 3300053077 Bacteria 1731
905 Ga0495612_0004894 3300053078 Bacteria 5541
906 Ga0500635_0009760 3300053080 Bacteria 2674
907 Ga0495655_0040839 3300053083 Bacteria 1183
908 Ga0495655_0106885 3300053083 Bacteria 836
909 Ga0495595_0026720 3300053084 Bacteria 2566
910 Ga0495619_0073994 3300053085 Bacteria 2284
911 Ga0495619_0086732 3300053085 Bacteria 2116
912 Ga0495619_0215566 3300053085 Bacteria 1329
913 Ga0500643_000112 3300053087 Bacteria 84793
914 Ga0500646_0023576 3300053090 Bacteria 1651
915 Ga0500646_0052009 3300053090 Bacteria 1184
916 Ga0500566_0004025 3300053094 Bacteria 8766
917 Ga0500566_0008103 3300053094 Bacteria 6218
918 Ga0500566_0115556 3300053094 Bacteria 1453
919 Ga0500641_0014043 3300053096 Bacteria 2949
920 Ga0500641_0094828 3300053096 Bacteria 1276
921 Ga0500641_0156095 3300053096 Bacteria 984
922 Ga0500555_001746 3300053103 Bacteria 6507
923 Ga0500557_000021 3300053105 Bacteria 89662
924 Ga0500569_002081 3300053109 Bacteria 3896
925 Ga0500572_000229 3300053111 Bacteria 19843
926 Ga0500572_003273 3300053111 Bacteria 3731
927 Ga0500572_008536 3300053111 Bacteria 2399
928 Ga0500594_0013322 3300053118 Bacteria 1953
929 Ga0500595_001023 3300053119 Bacteria 15679
930 Ga0500595_006104 3300053119 Bacteria 5165
931 Ga0500595_006755 3300053119 Bacteria 4837
932 Ga0500595_090448 3300053119 Bacteria 886
933 Ga0500595_096598 3300053119 Bacteria 850
934 Ga0500597_164821 3300053120 Bacteria 947
935 Ga0500614_016618 3300053123 Bacteria 1653
936 Ga0500618_022118 3300053125 Bacteria 1547
937 Ga0500642_0000583 3300053130 Bacteria 10905
938 Ga0500642_0032521 3300053130 Bacteria 2189
939 Ga0500652_151432 3300053131 Bacteria 962
940 Ga0500559_0000186 3300053136 Bacteria 49470
941 Ga0500559_0126183 3300053136 Bacteria 1193
942 Ga0500568_0002888 3300053139 Bacteria 9874
943 Ga0500568_0076134 3300053139 Bacteria 1278
944 Ga0500577_0065965 3300053142 Bacteria 1406
945 Ga0500588_0071073 3300053146 Bacteria 1141
946 Ga0500589_015685 3300053147 Bacteria 3384
947 Ga0500604_0027468 3300053151 Bacteria 1646
948 Ga0500604_0101196 3300053151 Bacteria 950
949 Ga0500616_0006228 3300053153 Bacteria 7873
950 Ga0500622_0026195 3300053156 Bacteria 3079
951 Ga0500624_005276 3300053157 Bacteria 1716
952 Ga0500627_0038300 3300053158 Bacteria 2049
953 Ga0500633_0003710 3300053160 Bacteria 3381
954 Ga0500634_0059643 3300053161 Bacteria 2028
955 Ga0500638_002757 3300053162 Bacteria 6258
956 Ga0500638_089970 3300053162 Bacteria 1446
957 Ga0500639_049971 3300053163 Bacteria 2180
958 Ga0500636_0004022 3300053177 Bacteria 8292
959 Ga0500636_0028340 3300053177 Bacteria 3308
960 Ga0500637_0022159 3300053178 Bacteria 3458
961 Ga0500576_021939 3300053725 Bacteria 2915
962 Ga0500657_042091 3300053728 Bacteria 2118
963 Ga0500625_025664 3300053729 Bacteria 2787
964 Ga0500645_025711 3300053730 Bacteria 1795
965 Ga0500609_016525 3300053731 Bacteria 1001
966 Ga0500596_003902 3300053735 Bacteria 2788
967 Ga0500599_000328 3300053736 Bacteria 4677
968 Ga0500661_001755 3300055283 Bacteria 4086
969 Ga0500661_026424 3300055283 Bacteria 1025
970 2507505473 2507262055 Bacteria 8048963
971 2508539358 2508501009 Bacteria 7784016
972 2508695688 2508501042 Bacteria 8719808
973 2511397796 2511231028 Bacteria 8046582
974 2513623902 2513237092 Bacteria 8341956
975 2513642216 2513237094 Bacteria 8789602
976 2513651310 2513237095 Bacteria 8976980
977 2513703484 2513237102 Bacteria 7703324
978 2513873323 2513237139 Bacteria 8737671
979 2513888556 2513237141 Bacteria 8496279
980 2514014653 2513237161 Bacteria 8871253
981 2515627670 2515154112 Bacteria 8294334
982 2517106255 2517093001 Bacteria 9002274
983 2524441465 2524023205 Bacteria 8918781
984 2524467202 2524023210 Bacteria 9029266
985 2528852707 2528768022 Bacteria 10457665
986 2617352036 2617270735 Bacteria 9163226
987 2617373506 2617270741 Bacteria 8201522
988 2745077599 2744054633 Bacteria 8678936
989 2793062261 2791355196 Bacteria 7323613
990 2805920671 2802429603 Bacteria 8777136
991 2818237880 2816332527 Bacteria 8933356
992 2824604399 2824600985 Bacteria 8488197
993 2824614871 2824609381 Bacteria 8672835
994 2824624187 2824617872 Bacteria 8814715
995 2824632867 2824626560 Bacteria 8813858
996 2824641394 2824635225 Bacteria 8785348
997 2824652574 2824644064 Bacteria 8743947
998 2824656317 2824653114 Bacteria 8493680
999 2824667270 2824661429 Bacteria 9877870
1000 2824671773 2824671348 Bacteria 8369588
1001 2824684715 2824679649 Bacteria 8248951
1002 2824688545 2824687955 Bacteria 8360029
1003 2824701683 2824696289 Bacteria 8335049
1004 2824718456 2824714736 Bacteria 8717648
1005 2824728837 2824723954 Bacteria 8758240
1006 2824737641 2824732956 Bacteria 7810675
1007 2824751163 2824746037 Bacteria 7911610
1008 2824779969 2824773399 Bacteria 8360218
1009 2838124723 2838122688 Bacteria 8803140
1010 2841945414 2841941048 Bacteria 8688029
1011 2841952200 2841949485 Bacteria 8680857
1012 2841965322 2841957949 Bacteria 8652217
1013 2841970410 2841966195 Bacteria 8673214
1014 2841981661 2841974524 Bacteria 8931498
1015 2841984941 2841983080 Bacteria 8395090
1016 2842043296 2842038055 Bacteria 8002051
1017 2842052714 2842045827 Bacteria 8006841
1018 2844315569 2844315083 Bacteria 8138177
1019 2847942365 2847939898 Bacteria 8606328
1020 2849083237 2849076700 Bacteria 7039503
1021 2857516329 2857509624 Bacteria 7472071
1022 2874592524 2874590934 Bacteria 8299676
1023 2874618666 2874612657 Bacteria 8252029
1024 2874621178 2874620515 Bacteria 8290088
1025 2874628578 2874628541 Bacteria 8630250
1026 2874647143 2874645413 Bacteria 8214782
1027 2876769667 2876761206 Bacteria 10111113
1028 2876772527 2876771140 Bacteria 8287509
1029 2876819788 2876818435 Bacteria 8274608
1030 2879076294 2879074833 Bacteria 8279565
1031 2879083794 2879083081 Bacteria 8587928
1032 2879101968 2879099564 Bacteria 10442239
1033 2879128778 2879127579 Bacteria 8294491
1034 2879142906 2879142872 Bacteria 8267021
1035 2881368951 2881364244 Bacteria 7710352
1036 2885369312 2885366525 Bacteria 8326213
1037 2885417979 2885409591 Bacteria 9235467
1038 2888379377 2888378607 Bacteria 9652610
1039 2888390477 2888388044 Bacteria 7304136
1040 2888420098 2888419890 Bacteria 7857137
1041 2903733522 2903727486 Bacteria 8281579
1042 2903770572 2903768456 Bacteria 9749579
1043 2904667723 2904666416 Bacteria 8226587
1044 2904690981 2904690495 Bacteria 9412302
1045 2904708376
1046 2906608876 2906602504 Bacteria 8295279
1047 2906631697 2906626472 Bacteria 8826946
1048 2908757039 2908756301 Bacteria 8864324
1049 2908775977 2908775508 Bacteria 8092255
1050 2922369357
1051 2922396557 2922393267 Bacteria 8285685
1052 2929618811 2929615660 Bacteria 9193770
1053 2929628504 2929624759 Bacteria 9339455
1054 2932790989 2932784394 Bacteria 9704911
1055 2932794118 2932794094 Bacteria 7915132
1056 2932809193 2932801729 Bacteria 7987968
1057 2932816233 2932809354 Bacteria 9135765
1058 2932827640 2932818245 Bacteria 9955613
1059 2932833705 2932828146 Bacteria 9745859
1060 2933580479 2933577622 Bacteria 9116884
1061 2935615496 2935608549 Bacteria 8203142
1062 2935623231 2935616580 Bacteria 9032984
1063 2935644306 2935638405 Bacteria 10015038
1064 2935654425 2935648319 Bacteria 8801166
1065 2935663305 2935656913 Bacteria 8965014
1066 2935672112 2935665750 Bacteria 9571747
1067 2935679368 2935675223 Bacteria 9928132
1068 2935686610 2935684952 Bacteria 9590419
1069 2935700391 2935694250 Bacteria 9291695
1070 2935710339 2935703347 Bacteria 10242284
1071 2935716298 2935713505 Bacteria 9608509
1072 2935723578 2935722832 Bacteria 9608746
1073 2935735133 2935732158 Bacteria 9706831
1074 2935744076 2935741537 Bacteria 9707219
1075 2935752576 2935750917 Bacteria 9590372
1076 2935763291 2935760218 Bacteria 9817913
1077 2935774263 2935769743 Bacteria 7878163
1078 2935785127 2935777560 Bacteria 8077691
1079 2935789022 2935785616 Bacteria 7962367
1080 2935796772 2935793552 Bacteria 8012592
1081 2935808330 2935801545 Bacteria 9301974
1082 2935816055 2935810662 Bacteria 9401221
1083 2935825703 2935819856 Bacteria 8261050
1084 2935833450 2935827899 Bacteria 10038562
1085 2935845992 2935837841 Bacteria 9454360
1086 2935853467 2935847175 Bacteria 8228321
1087 2935861479 2935855204 Bacteria 9035059
1088 2935869598 2935864058 Bacteria 9784707
1089 2935879927 2935873716 Bacteria 9632195
1090 2935889145 2935883170 Bacteria 7964738
1091 2935915068 2935908558 Bacteria 8568796
1092 2935918916 2935916978 Bacteria 9113783
1093 2935931367 2935926038 Bacteria 8601059
1094 2935939964 2935934488 Bacteria 8602579
1095 2935947689 2935942939 Bacteria 8599779
1096 2935956460 2935951376 Bacteria 8602333
1097 2935966693 2935959822 Bacteria 7869783
1098 2935973254 2935967501 Bacteria 8603075
1099 2935980501 2935975950 Bacteria 8347125
1100 2935990148 2935984226 Bacteria 8302647
1101 2935997850 2935992306 Bacteria 9802711
1102 2936008885 2936002035 Bacteria 9362176
1103 2936017536 2936011229 Bacteria 8801034
1104 2936025963 2936019824 Bacteria 8804134
1105 2936034805 2936028420 Bacteria 8965941
1106 2936041061 2936037263 Bacteria 9446081
1107 2936052937 2936046547 Bacteria 8903709
1108 2936060204 2936055302 Bacteria 8785755
1109 2940558489 2940556831 Bacteria 9590747
1110 2941535319 2941531003 Bacteria 7653939
1111 2941547161 2941538514 Bacteria 9402094
1112 3005486650 3005483717 Bacteria 7877331
1113 3005508954 3005506211 Bacteria 6943378
1114 3005593269 3005587118 Bacteria 7794411
1115 3005595259 3005594810 Bacteria 8716512
1116 3005711205 3005710791 Bacteria 7622528
1117 3005718506 3005718088 Bacteria 8283608
1118 8006927272 8006926726 Bacteria 6749210
1119 8006935978 8006933436 Bacteria 10410654
1120 8016526354 8016522445 Bacteria 8156687
1121 8016557445 8016548790 Bacteria 8155074
1122 8016565800 8016557553 Bacteria 8154380
1123 8016569687 8016566248 Bacteria 8158151
1124 8016582293 8016575299 Bacteria 8154085
1125 8016586119 8016583857 Bacteria 10421953
1126 8016603403 8016595262 Bacteria 8149947
1127 8016606335 8016603502 Bacteria 8731218
1128 8016618243 8016613128 Bacteria 8794220
1129 8016635399 8016630954 Bacteria 9217207
1130 8017058673 8017057580 Bacteria 10023680
1131 8019531251 8019530166 Bacteria 8155624
1132 8019540301 8019538911 Bacteria 7872763
1133 8019549892 8019547302 Bacteria 7996444
1134 8019576985 8019576017 Bacteria 10049540
1135 8019595049 8019586578 Bacteria 10212056
1136 8019611816 8019608314 Bacteria 10042931
1137 8019623189 8019619141 Bacteria 9218857
1138 8019629908 8019629233 Bacteria 8687553
1139 8019652257 8019648815 Bacteria 10014479
1140 8019676506 8019668869 Bacteria 8791617
1141 8019679488 8019678201 Bacteria 8863603
1142 8019696024 8019687851 Bacteria 8712826
1143 8055742660 8055742211 Bacteria 9226248
1144 8056682967 8056681323 Bacteria 8472857
1145 Ga0373923_0035595
1146 JGI25406J46586_10000364
1147 JGI25153J46596_10008527
1148 JGI25153J46596_10023803
1149 JGI25160J50197_1005464
1150 JGI25160J50197_1013128
1151 JGI25160J50197_1017285
1152 JGI25404J52841_10044352
1153 Ga0055529_1012617
1154 Ga0055543_1002453
1155 Ga0065165_1018348
1156 Ga0065165_1030140
1157 Ga0070683_100504803
1158 Ga0070690_100459413
1159 Ga0070670_100949250
1160 Ga0068869_100431957
1161 Ga0070666_10142591
1162 Ga0070666_10179745
1163 Ga0070682_100115845
1164 Ga0070682_100225491
1165 Ga0068868_100271192
1166 Ga0070660_100453970
1167 Ga0070660_100759423
1168 Ga0070689_100101308
1169 Ga0070687_100155833
1170 Ga0070661_100223677
1171 Ga0070668_100179797
1172 Ga0070669_100408239
1173 Ga0070675_100209414
1174 Ga0070675_100211310
1175 Ga0070671_100319260
1176 Ga0070671_100727714
1177 Ga0070674_100057289
1178 Ga0070674_100231012
1179 Ga0070674_100352941
1180 Ga0070674_100385310
1181 Ga0070688_100494379
1182 Ga0070659_100091579
1183 Ga0070659_100164937
1184 Ga0070659_100258130
1185 Ga0070659_100449700
1186 Ga0070667_100146017
1187 Ga0070667_100241603
1188 Ga0070714_100001570
1189 Ga0070714_100015683
1190 Ga0070714_100020448
1191 Ga0070714_100725284
1192 Ga0070713_100008285
1193 Ga0070713_100081550
1194 Ga0070713_100179686
1195 Ga0070713_100213771
1196 Ga0070710_10001859
1197 Ga0070710_10085827
1198 Ga0070711_100013892
1199 Ga0070711_100121742
1200 Ga0070711_100206529
1201 Ga0070705_100148406
1202 Ga0070663_100089391
1203 Ga0070663_100093853
1204 Ga0070663_100323687
1205 Ga0070663_100376385
1206 Ga0070663_100669300
1207 Ga0070678_100333205
1208 Ga0070681_10012682
1209 Ga0070681_10014900
1210 Ga0070681_10059272
1211 Ga0068867_100667780
1212 Ga0070685_10161771
1213 Ga0070707_100026862
1214 Ga0070698_100305874
1215 Ga0070699_100160173
1216 Ga0070679_100103628
1217 Ga0070679_100174271
1218 Ga0070684_100347298
1219 Ga0068853_100010595
1220 Ga0068853_100013156
1221 Ga0068853_100113574
1222 Ga0068853_100297217
1223 Ga0070672_100092290
1224 Ga0070672_100508765
1225 Ga0070686_100123856
1226 Ga0070686_100561180
1227 Ga0070665_100092776
1228 Ga0070665_100400513
1229 Ga0070665_100414613
1230 Ga0070665_101151804
1231 Ga0068855_100023359
1232 Ga0068855_100058220
1233 Ga0068855_100101537
1234 Ga0068855_100249162
1235 Ga0068855_100495448
1236 Ga0070664_100424039
1237 Ga0070664_100792560
1238 Ga0068857_100012785
1239 Ga0068857_100062694
1240 Ga0068857_100593569
1241 Ga0068854_100280803
1242 Ga0068856_100026080
1243 Ga0068856_100256563
1244 Ga0068856_100349331
1245 Ga0070702_100150153
1246 Ga0068852_100025281
1247 Ga0068852_100247267
1248 Ga0068852_100410545
1249 Ga0068852_100579835
1250 Ga0068859_100235253
1251 Ga0068864_100067650
1252 Ga0068864_100068559
1253 Ga0068866_10096225
1254 Ga0068861_100086139
1255 Ga0068861_100262018
1256 Ga0068861_100478497
1257 Ga0068851_10041453
1258 Ga0068870_10222774
1259 Ga0068863_100047085
1260 Ga0068863_100269322
1261 Ga0068858_100169723
1262 Ga0068858_100180795
1263 Ga0068858_100218274
1264 Ga0068860_100225901
1265 Ga0068860_100359355
1266 Ga0068860_100365935
1267 Ga0068860_100482574
1268 Ga0068860_100569843
1269 Ga0068860_100617494
1270 Ga0068862_100118329
1271 Ga0068862_100521364
1272 Ga0068862_100793073
1273 Ga0081455_10027393
1274 Ga0081455_10107291
1275 Ga0081455_10109972
1276 Ga0081455_10244865
1277 Ga0081538_10040708
1278 Ga0081540_1008955
1279 Ga0081540_1023424
1280 Ga0081540_1033253
1281 Ga0081540_1038528
1282 Ga0081540_1074886
1283 Ga0081540_1084152
1284 Ga0081539_10000048
1285 Ga0081539_10036075
1286 Ga0070717_10011435
1287 Ga0070717_10012018
1288 Ga0070717_10732534
1289 Ga0075365_10196779
1290 Ga0075365_10280147
1291 Ga0075363_100002635
1292 Ga0075363_100071771
1293 Ga0075363_100142227
1294 Ga0075363_100159479
1295 Ga0075364_10043997
1296 Ga0075364_10144848
1297 Ga0070716_100001724
1298 Ga0070716_100005301
1299 Ga0070712_100002575
1300 Ga0070712_100008167
1301 Ga0070712_100018957
1302 Ga0070712_100022704
1303 Ga0070712_100048715
1304 Ga0070712_100569961
1305 Ga0075362_10048007
1306 Ga0075362_10099154
1307 Ga0075367_10076702
1308 Ga0075367_10178837
1309 Ga0075367_10278412
1310 Ga0075369_10009532
1311 Ga0075369_10069537
1312 Ga0075369_10105043
1313 Ga0075366_10040639
1314 Ga0075366_10090039
1315 Ga0075366_10259752
1316 Ga0097621_100187595
1317 Ga0075370_10053268
1318 Ga0075370_10078556
1319 Ga0075370_10221854
1320 Ga0068871_100132076
1321 Ga0068871_100196138
1322 Ga0068871_100411789
1323 Ga0075428_100778165
1324 Ga0075434_100080096
1325 Ga0075434_100572900
1326 Ga0068865_100080664
1327 Ga0068865_100209227
1328 Ga0068865_100329938
1329 Ga0068865_100621010
1330 Ga0075436_100192108
1331 Ga0097620_100235271
1332 Ga0097620_100671719
1333 Ga0099795_10006522
1334 Ga0105240_10006144
1335 Ga0105240_10026751
1336 Ga0105240_10031683
1337 Ga0105240_10204399
1338 Ga0105240_10280515
1339 Ga0111539_10685995
1340 Ga0105245_10109815
1341 Ga0114129_10225048
1342 Ga0105243_10229080
1343 Ga0105243_10253946
1344 Ga0105241_10148686
1345 Ga0105241_10374259
1346 Ga0105242_10649739
1347 Ga0105242_10777263
1348 Ga0105248_10123069
1349 Ga0105248_10869908
1350 Ga0105237_10031550
1351 Ga0105237_10283060
1352 Ga0105237_10328722
1353 Ga0105237_10645400
1354 Ga0105237_10921115
1355 Ga0105237_10926396
1356 Ga0105238_10040832
1357 Ga0105238_10198728
1358 Ga0105238_10219633
1359 Ga0105238_10351617
1360 Ga0105238_10477278
1361 Ga0105238_10546089
1362 Ga0105249_10198830
1363 Ga0105249_10312530
1364 Ga0099796_10039157
1365 Ga0105239_10022471
1366 Ga0105239_10084117
1367 Ga0105239_10090895
1368 Ga0105239_10238920
1369 Ga0105239_10252813
1370 Ga0105239_10533040
1371 Ga0105239_10602347
1372 Ga0157370_10113104
1373 Ga0157370_10557354
1374 Ga0157369_10026404
1375 Ga0157369_10046781
1376 Ga0157374_10089923
1377 Ga0157378_10002715
1378 Ga0157378_10608512
1379 Ga0163162_10127470
1380 Ga0163162_10265281
1381 Ga0163162_11530500
1382 Ga0157372_10031372
1383 Ga0157372_10545492
1384 Ga0157375_10130145
1385 Ga0157375_10231195
1386 Ga0157375_10314222
1387 Ga0157375_10632810
1388 Ga0163163_10262185
1389 Ga0163163_10329184
1390 Ga0163163_10406084
1391 Ga0163163_10430380
1392 Ga0163163_10791603
1393 Ga0163163_10839309
1394 Ga0157380_11078668
1395 Ga0157377_10250121
1396 Ga0157379_10285083
1397 Ga0157379_10439921
1398 Ga0157379_10534279
1399 Ga0157376_10604550
1400 Ga0163161_10779974
1401 Ga0213875_10056365
1402 Ga0209563_105488
1403 Ga0209677_101407
1404 Ga0209148_1000418
1405 Ga0209233_1006320
1406 Ga0209233_1018369
1407 Ga0209455_1002667
1408 Ga0209130_1039697
1409 Ga0209564_1004051
1410 Ga0209564_1004930
1411 Ga0209758_1000992
1412 Ga0209758_1003988
1413 Ga0209758_1006211
1414 Ga0209758_1016088
1415 Ga0209256_1014609
1416 Ga0207426_1002389
1417 Ga0207426_1002931
1418 Ga0207426_1024113
1419 Ga0209257_1010825
1420 Ga0207697_10011788
1421 Ga0207697_10110796
1422 Ga0207656_10007112
1423 Ga0207682_10071672
1424 Ga0207692_10001084
1425 Ga0207692_10020867
1426 Ga0207692_10023041
1427 Ga0207642_10137028
1428 Ga0207710_10033533
1429 Ga0207710_10144449
1430 Ga0207688_10016201
1431 Ga0207688_10215987
1432 Ga0207680_10477429
1433 Ga0207647_10012688
1434 Ga0207685_10088793
1435 Ga0207699_10000184
1436 Ga0207643_10188074
1437 Ga0207705_10031180
1438 Ga0207654_10054988
1439 Ga0207654_10089494
1440 Ga0207654_10501923
1441 Ga0207707_10001217
1442 Ga0207707_10004329
1443 Ga0207707_10012573
1444 Ga0207707_10029874
1445 Ga0207707_10275996
1446 Ga0207695_10000148
1447 Ga0207695_10010844
1448 Ga0207695_10064739
1449 Ga0207695_10100215
1450 Ga0207695_10141903
1451 Ga0207695_10256594
1452 Ga0207671_10009621
1453 Ga0207671_10069645
1454 Ga0207693_10004934
1455 Ga0207693_10006712
1456 Ga0207693_10044439
1457 Ga0207693_10318068
1458 Ga0207693_10337130
1459 Ga0207663_10000585
1460 Ga0207663_10000680
1461 Ga0207663_10009659
1462 Ga0207663_10024585
1463 Ga0207663_10051159
1464 Ga0207660_10014328
1465 Ga0207662_10269986
1466 Ga0207657_10000700
1467 Ga0207657_10305575
1468 Ga0207649_10284126
1469 Ga0207649_10389782
1470 Ga0207652_10002661
1471 Ga0207652_10007721
1472 Ga0207652_10013904
1473 Ga0207681_10147193
1474 Ga0207694_10055995
1475 Ga0207694_10102197
1476 Ga0207694_10109141
1477 Ga0207694_10396572
1478 Ga0207650_10091363
1479 Ga0207650_10812283
1480 Ga0207687_10709527
1481 Ga0207700_10015244
1482 Ga0207700_10134873
1483 Ga0207700_10146977
1484 Ga0207700_10165427
1485 Ga0207664_10003622
1486 Ga0207664_10012251
1487 Ga0207664_10068749
1488 Ga0207664_10094211
1489 Ga0207664_10532916
1490 Ga0207644_10155611
1491 Ga0207690_10046755
1492 Ga0207706_10053577
1493 Ga0207706_10161302
1494 Ga0207706_10550892
1495 Ga0207686_10564059
1496 Ga0207686_10755804
1497 Ga0207709_10017861
1498 Ga0207709_10159778
1499 Ga0207709_10341866
1500 Ga0207669_10285598
1501 Ga0207669_10365577
1502 Ga0207704_10280309
1503 Ga0207704_10445090
1504 Ga0207704_10580008
1505 Ga0207704_10582708
1506 Ga0207665_10002484
1507 Ga0207665_10007064
1508 Ga0207665_10163728
1509 Ga0207691_10479073
1510 Ga0207711_10045483
1511 Ga0207711_10913739
1512 Ga0207689_10136965
1513 Ga0207661_10001291
1514 Ga0207661_10397557
1515 Ga0207667_10001909
1516 Ga0207667_10030060
1517 Ga0207667_10237390
1518 Ga0207667_10326029
1519 Ga0207667_10407962
1520 Ga0207667_10420887
1521 Ga0207667_10448463
1522 Ga0207712_10199502
1523 Ga0207668_10051032
1524 Ga0207668_10245744
1525 Ga0207668_10506330
1526 Ga0207640_10266437
1527 Ga0207640_10308400
1528 Ga0207640_10405229
1529 Ga0207677_10100007
1530 Ga0207703_10032875
1531 Ga0207703_10164381
1532 Ga0207703_10418455
1533 Ga0207703_10447648
1534 Ga0207639_10002676
1535 Ga0207639_10042968
1536 Ga0207639_10081860
1537 Ga0207639_10274325
1538 Ga0207678_10018564
1539 Ga0207678_10044801
1540 Ga0207708_10170608
1541 Ga0207702_10000546
1542 Ga0207702_10148445
1543 Ga0207702_10185504
1544 Ga0207702_10741297
1545 Ga0207702_10885931
1546 Ga0207641_10285304
1547 Ga0207641_10333260
1548 Ga0207648_10075157
1549 Ga0207648_10120862
1550 Ga0207648_10317421
1551 Ga0207676_10352687
1552 Ga0207676_10482211
1553 Ga0207674_10028047
1554 Ga0207674_10048764
1555 Ga0207674_10530378
1556 Ga0207675_100209834
1557 Ga0207675_100622266
1558 Ga0207683_10164315
1559 Ga0207683_10168846
1560 Ga0207698_10254092
1561 Ga0209389_1000142
1562 Ga0209589_1000331
1563 Ga0209489_100818
1564 Ga0209813_10010674
1565 Ga0207428_10485609
1566 Ga0268266_10001335
1567 Ga0268266_10438309
1568 Ga0268265_10512415
1569 Ga0268265_10580303
1570 Ga0268265_10807968
1571 Ga0268265_11075820
1572 Ga0268264_10191625
1573 Ga0268264_10366852
1574 Ga0268264_10579964
1575 Ga0268264_10727049
1576 Ga0307517_10000232
1577 Ga0307517_10223864
1578 Ga0307515_10157960
1579 Ga0307511_10045310
1580 Ga0265330_10105977
1581 Ga0265325_10026243
1582 Ga0265316_10048928
1583 Ga0307513_10183023
1584 Ga0307509_10038863
1585 Ga0307509_10170593
1586 Ga0307509_10372470
1587 Ga0307508_10085301
1588 Ga0265314_10021118
1589 Ga0265314_10081447
1590 Ga0265342_10017967
1591 Ga0265342_10122093
1592 Ga0307516_10011325
1593 Ga0307516_10255965
1594 Ga0307516_10365399
1595 Ga0307405_10108057
1596 Ga0307413_10026553
1597 Ga0307406_10184148
1598 Ga0307406_10260630
1599 Ga0307406_10363163
1600 Ga0307407_10266860
1601 Ga0307412_10041444
1602 Ga0307412_10281166
1603 Ga0307409_100808243
1604 Ga0307416_100542984
1605 Ga0307414_10617857
1606 Ga0307411_10052199
1607 Ga0307411_10129259
1608 Ga0307415_100258015
1609 Ga0307415_100318916
1610 Ga0307510_10010850
1611 Ga0307510_10019009
1612 Ga0307510_10101854
1613 Ga0373926_0162609
1614 Ga0373928_0069102
1615 Ga0373928_0111700
1616 Ga0373940_0108324
1617 Ga0373936_0002293
1618 Ga0373953_0008406
1619 Ga0373954_0006447
1620 Ga0373954_0074360
1621 Ga0373956_0015957
1622 Ga0373943_0229359
1623 Ga0373943_0281041
1624 Ga0373946_0012943
1625 Ga0373946_0333097
1626 Ga0373955_0008311
1627 Ga0373955_0136081
1628 Ga0373955_0192633
1629 Ga0373955_0381978
1630 Ga0373942_0025500
1631 Ga0373961_0023631
1632 Ga0373924_0003894
1633 Ga0373924_0103433
1634 Ga0373931_0015989
1635 Ga0373931_0395554
1636 Ga0373935_0000595
1637 Ga0373935_0012443
1638 Ga0373935_0053467
1639 Ga0373927_0001021
1640 Ga0373927_0036138
1641 Ga0373927_0217715
1642 Ga0373927_0267405
1643 Ga0373933_0001113
1644 Ga0373933_0010410
1645 Ga0373933_0339803
1646 Ga0373947_0000970
1647 Ga0373937_0095132
1648 Ga0373925_0006983
1649 Ga0373925_0027554
1650 Ga0373925_0253367
1651 Ga0395900_0055668
1652 Ga0395900_0650153
1653 Ga0395898_0010317
1654 Ga0395898_0251530
1655 Ga0395905_0019136
1656 Ga0395905_0109230
1657 Ga0436364_0738152
1658 Ga0436364_0984470
1659 Ga0395901_0035089
1660 Ga0395901_0039676
1661 Ga0436365_0265605
1662 Ga0436365_0303379
1663 Ga0436365_0411209
1664 Ga0436361_0532765
1665 Ga0436363_1287774
1666 Ga0436362_1005505
1667 Ga0466969_0141349
1668 Ga0466969_0162377
1669 Ga0466972_0000306
1670 Ga0466972_0000804
1671 Ga0466972_0102091
1672 Ga0466972_0199137
1673 Ga0466965_0161057
1674 Ga0466966_0007733
1675 Ga0466966_0043550
1676 Ga0466961_0000770
1677 Ga0466961_0391074
1678 Ga0466964_0102741
1679 Ga0466964_0279370
1680 Ga0466968_0028571
1681 Ga0466970_0117082
1682 Ga0466970_0218130
1683 Ga0466970_0222244
1684 Ga0466957_0228418
1685 Ga0466959_0003303
1686 Ga0466959_0047779
1687 Ga0466959_0317331
1688 Ga0466967_0006466
1689 Ga0466967_0259799
1690 Ga0495592_0013035
1691 Ga0495592_0261505
1692 Ga0495603_0001390
1693 Ga0495603_0009344
1694 Ga0495603_0056638
1695 Ga0495603_0114465
1696 Ga0495629_0000915
1697 Ga0495629_0011323
1698 Ga0495629_0191547
1699 Ga0495629_0200420
1700 Ga0495629_0468573
1701 Ga0495638_0000880
1702 Ga0495638_0053467
1703 Ga0495651_0043528
1704 Ga0495651_0060267
1705 Ga0495651_0154845
1706 Ga0495653_0009157
1707 Ga0495653_0118678
1708 Ga0495580_0001523
1709 Ga0495582_0000302
1710 Ga0495582_0111898
1711 Ga0495605_0175610
1712 Ga0495605_0219528
1713 Ga0495639_0001076
1714 Ga0495639_0116494
1715 Ga0495639_0161660
1716 Ga0495639_0223844
1717 Ga0495662_0001265
1718 Ga0495662_0109893
1719 Ga0495664_0002747
1720 Ga0495664_0107226
1721 Ga0495584_0089326
1722 Ga0495584_0133506
1723 Ga0495585_0032041
1724 Ga0495585_0194995
1725 Ga0495585_0242057
1726 Ga0495594_0000046
1727 Ga0495594_0142731
1728 Ga0495596_0059215
1729 Ga0495596_0163646
1730 Ga0495607_0041012
1731 Ga0495606_0149603
1732 Ga0495608_0023287
1733 Ga0495610_0056579
1734 Ga0495616_0185930
1735 Ga0495618_0034111
1736 Ga0495618_0470320
1737 Ga0495628_0016164
1738 Ga0495628_0056134
1739 Ga0495628_0066292
1740 Ga0495630_0010764
1741 Ga0495631_0110500
1742 Ga0495631_0191522
1743 Ga0495631_0242572
1744 Ga0495632_0138315
1745 Ga0495637_0065561
1746 Ga0495637_0138050
1747 Ga0495637_0140372
1748 Ga0495644_0032974
1749 Ga0495644_0090753
1750 Ga0495648_0174313
1751 Ga0495648_0252318
1752 Ga0495663_0142196
1753 Ga0495666_0251170
1754 Ga0495652_0045047
1755 Ga0495652_0052089
1756 Ga0495652_0125031
1757 Ga0495665_0005462
1758 Ga0495665_0155252
1759 Ga0495640_0014808
1760 Ga0495640_0022664
1761 Ga0495640_0041763
1762 Ga0495640_0120391
1763 Ga0495586_0159932
1764 Ga0495587_0008424
1765 Ga0495587_0028223
1766 Ga0495598_0039336
1767 Ga0495598_0068940
1768 Ga0495598_0125482
1769 Ga0495609_0161563
1770 Ga0495621_0018725
1771 Ga0495645_0031433
1772 Ga0495645_0038894
1773 Ga0495622_0001947
1774 Ga0495622_0016887
1775 Ga0495622_0022475
1776 Ga0495622_0116846
1777 Ga0495622_0164627
1778 Ga0495633_0023444
1779 Ga0495633_0103038
1780 Ga0495633_0236163
1781 Ga0495667_0012267
1782 Ga0495667_0049672
1783 Ga0495656_0007484
1784 Ga0495656_0092460
1785 Ga0495656_0382859
1786 Ga0495668_0063539
1787 Ga0495668_0377495
1788 Ga0495634_0001329
1789 Ga0495634_0114644
1790 Ga0495611_0120632
1791 Ga0495625_0111727
1792 Ga0495625_0118440
1793 Ga0495635_0004154
1794 Ga0495635_0004822
1795 Ga0495635_0080087
1796 Ga0495659_0009582
1797 Ga0495659_0053327
1798 Ga0495661_0186151
1799 Ga0495588_0001920
1800 Ga0495657_0020270
1801 Ga0495657_0022368
1802 Ga0495657_0062078
1803 Ga0495657_0277491
1804 Ga0495599_0004544
1805 Ga0495623_0088438
1806 Ga0495647_0002160
1807 Ga0495658_0000201
1808 Ga0495669_0093505
1809 Ga0495613_0004521
1810 Ga0495613_0023990
1811 Ga0495613_0354347
1812 Ga0495624_0001903
1813 Ga0495624_0038534
1814 Ga0495624_0080169
1815 Ga0495624_0184126
1816 Ga0495624_0408186
1817 Ga0495670_0062870
1818 Ga0495671_0266772
1819 Ga0495589_0194388
1820 Ga0495589_0200469
1821 Ga0495600_0007343
1822 Ga0495600_0019156
1823 Ga0495600_0261955
1824 Ga0495581_0020918
1825 Ga0495581_0066978
1826 Ga0495581_0136213
1827 Ga0495604_0003808
1828 Ga0495604_0006226
1829 Ga0495604_0653718
1830 Ga0495636_0019953
1831 Ga0495636_0169243
1832 Ga0495674_0002494
1833 Ga0495674_0016347
1834 Ga0495672_0035732
1835 Ga0495672_0125167
1836 Ga0495672_0214234
1837 Ga0495676_0021845
1838 Ga0495676_0083168
1839 Ga0495680_0177655
1840 Ga0495680_0215289
1841 Ga0495680_0341864
1842 Ga0495687_021924
1843 Ga0495675_0143259
1844 Ga0495677_0069234
1845 Ga0495677_0220675
1846 Ga0495679_045734
1847 Ga0495685_035692
1848 Ga0495685_116384
1849 Ga0495673_0022825
1850 Ga0495673_0054536
1851 Ga0495673_0203275
1852 Ga0495684_0212105
1853 Ga0495686_0050099
1854 Ga0495686_0127757
1855 Ga0495686_0234882
1856 Ga0495686_0257824
1857 Ga0495593_0000100
1858 Ga0495593_0039768
1859 Ga0495602_0031546
1860 Ga0495602_0040379
1861 Ga0495602_0074008
1862 Ga0495615_0119086
1863 Ga0496100_0298392
1864 Ga0496100_0377035
1865 Ga0496101_0022763
1866 Ga0496101_0085366
1867 Ga0496101_0141721
1868 Ga0496101_0149908
1869 Ga0496101_0201161
1870 Ga0496101_0234098
1871 Ga0496101_0286600
1872 Ga0496101_0558465
1873 Ga0496102_0076683
1874 Ga0496102_0079587
1875 Ga0496102_0097650
1876 Ga0496102_0235912
1877 Ga0496102_0304465
1878 Ga0496102_0400093
1879 Ga0496102_0402980
1880 Ga0496102_0459300
1881 Ga0496102_0505779
1882 Ga0496102_0612993
1883 Ga0496102_0789037
1884 Ga0496103_0049170
1885 Ga0496103_0174853
1886 Ga0496103_0248391
1887 Ga0496104_0002017
1888 Ga0496104_0013397
1889 Ga0496104_0178357
1890 Ga0496105_0014164
1891 Ga0496105_0158786
1892 Ga0496105_0211572
1893 Ga0496105_0451779
1894 Ga0496106_0110392
1895 Ga0496106_0243799
1896 Ga0496106_0306063
1897 Ga0496106_0412024
1898 Ga0496107_0029068
1899 Ga0496107_0352377
1900 Ga0496107_0385605
1901 Ga0496107_0401019
1902 Ga0496107_0769059
1903 Ga0496108_0059860
1904 Ga0496108_0067424
1905 Ga0496108_0134973
1906 Ga0496108_0476619
1907 Ga0496108_0749374
1908 Ga0496109_0168973
1909 Ga0496109_0273274
1910 Ga0496109_0354752
1911 Ga0496109_0480950
1912 Ga0496109_0657988
1913 Ga0496109_0810174
1914 Ga0496110_0005974
1915 Ga0496110_0159198
1916 Ga0496110_0336989
1917 Ga0496110_0632832
1918 Ga0496111_0046141
1919 Ga0496111_0090187
1920 Ga0496111_0165877
1921 Ga0496111_0268738
1922 Ga0496111_0472391
1923 Ga0496112_0073684
1924 Ga0496112_0082564
1925 Ga0496112_0186977
1926 Ga0496112_0351266
1927 Ga0496113_0014545
1928 Ga0496113_0112818
1929 Ga0496113_0155196
1930 Ga0496113_0238292
1931 Ga0496113_0320899
1932 Ga0496113_0392864
1933 Ga0496113_0421495
1934 Ga0496114_0086672
1935 Ga0496114_0118976
1936 Ga0496114_0144087
1937 Ga0496114_0197224
1938 Ga0496114_0329999
1939 Ga0496115_0013622
1940 Ga0496116_0043611
1941 Ga0496116_0116134
1942 Ga0496116_0215041
1943 Ga0496116_0260054
1944 Ga0496117_0108922
1945 Ga0496118_0023553
1946 Ga0496118_0041055
1947 Ga0496118_0138648
1948 Ga0496118_0225317
1949 Ga0496119_0009198
1950 Ga0496119_0050219
1951 Ga0496119_0134725
1952 Ga0496120_0084242
1953 Ga0496121_0000278
1954 Ga0496121_0014972
1955 Ga0496121_0051540
1956 Ga0496121_0093467
1957 Ga0496121_0108562
1958 Ga0496121_0149826
1959 Ga0496121_0232637
1960 Ga0496121_0360565
1961 Ga0496121_0395786
1962 Ga0496122_0043096
1963 Ga0496122_0144868
1964 Ga0496123_0171852
1965 Ga0496124_0090250
1966 Ga0496124_0091231
1967 Ga0496124_0133286
1968 Ga0496124_0589564
1969 Ga0496125_0045202
1970 Ga0496125_0057511
1971 Ga0496125_0114688
1972 Ga0496125_0120412
1973 Ga0496125_0142097
1974 Ga0496125_0158875
1975 Ga0496125_0283110
1976 Ga0496125_0370739
1977 Ga0496126_0011733
1978 Ga0496126_0066932
1979 Ga0496126_0080549
1980 Ga0496126_0116623
1981 Ga0496126_0136354
1982 Ga0496126_0169065
1983 Ga0496126_0201356
1984 Ga0496126_0211854
1985 Ga0496126_0377561
1986 Ga0496126_0403285
1987 Ga0496126_0444539
1988 Ga0496126_0452777
1989 Ga0496126_0638625
1990 Ga0501034_0047500
1991 Ga0501036_0134500
1992 Ga0501037_0250093
1993 Ga0501038_0082192
1994 Ga0501041_0063098
1995 Ga0501042_0285099
1996 Ga0501043_0027498
1997 Ga0501046_0005445
1998 Ga0501046_0342668
1999 Ga0501047_0023204
2000 Ga0501047_0179362
2001 Ga0501047_0348788
2002 Ga0501048_0080390
2003 Ga0501067_0453636
2004 Ga0501068_0359019
2005 Ga0501070_0019284
2006 Ga0501070_0732693
2007 Ga0501074_0098293
2008 Ga0501077_0159734
2009 Ga0501080_0030696
2010 Ga0501080_0418865
2011 Ga0501081_0378528
2012 Ga0501035_0015880
2013 Ga0501035_0177012
2014 Ga0501044_0022135
2015 nmdc:mga03n38_254487_c1
2016 nmdc:mga03n38_2806_c1
2017 nmdc:mga03n38_31131_c1
2018 nmdc:mga03n38_473151_c1
2019 nmdc:mga00v17_139434_c1
2020 nmdc:mga00v17_70950_c1
2021 nmdc:mga00v17_85010_c1
2022 nmdc:mga0yw44_111959_c1
2023 nmdc:mga0yw44_122028_c1
2024 nmdc:mga0yw44_62839_c1
2025 nmdc:mga0yw44_75349_c1
2026 nmdc:mga0yw44_86056_c1
2027 nmdc:mga0k408_146577_c1
2028 nmdc:mga0k408_37421_c1
2029 nmdc:mga0k408_44479_c1
2030 nmdc:mga0k408_56176_c1
2031 nmdc:mga06z11_165622_c1
2032 nmdc:mga06z11_69619_c1
2033 nmdc:mga07m45_121951_c1
2034 nmdc:mga07m45_134725_c1
2035 nmdc:mga07m45_247737_c1
2036 nmdc:mga07m45_344647_c1
2037 nmdc:mga07m45_40313_c1
2038 nmdc:mga05p37_690309_c1
2039 nmdc:mga0qj67_540059_c1
2040 nmdc:mga08y16_272165_c1
2041 nmdc:mga08y16_47004_c1
2042 nmdc:mga0sz30_113233_c1
2043 nmdc:mga0sz30_165944_c1
2044 nmdc:mga0sz30_22699_c2
2045 nmdc:mga0sz30_23280_c1
2046 nmdc:mga0sz30_9134_c1
2047 Ga0495601_0054935
2048 Ga0495601_0116784
2049 Ga0495612_0004894
2050 Ga0500635_0009760
2051 Ga0495655_0040839
2052 Ga0495655_0106885
2053 Ga0495595_0026720
2054 Ga0495619_0073994
2055 Ga0495619_0086732
2056 Ga0495619_0215566
2057 Ga0500643_000112
2058 Ga0500646_0023576
2059 Ga0500646_0052009
2060 Ga0500566_0004025
2061 Ga0500566_0008103
2062 Ga0500566_0115556
2063 Ga0500641_0014043
2064 Ga0500641_0094828
2065 Ga0500641_0156095
2066 Ga0500555_001746
2067 Ga0500557_000021
2068 Ga0500569_002081
2069 Ga0500572_000229
2070 Ga0500572_003273
2071 Ga0500572_008536
2072 Ga0500594_0013322
2073 Ga0500595_001023
2074 Ga0500595_006104
2075 Ga0500595_006755
2076 Ga0500595_090448
2077 Ga0500595_096598
2078 Ga0500597_164821
2079 Ga0500614_016618
2080 Ga0500618_022118
2081 Ga0500642_0000583
2082 Ga0500642_0032521
2083 Ga0500652_151432
2084 Ga0500559_0000186
2085 Ga0500559_0126183
2086 Ga0500568_0002888
2087 Ga0500568_0076134
2088 Ga0500577_0065965
2089 Ga0500588_0071073
2090 Ga0500589_015685
2091 Ga0500604_0027468
2092 Ga0500604_0101196
2093 Ga0500616_0006228
2094 Ga0500622_0026195
2095 Ga0500624_005276
2096 Ga0500627_0038300
2097 Ga0500633_0003710
2098 Ga0500634_0059643
2099 Ga0500638_002757
2100 Ga0500638_089970
2101 Ga0500639_049971
2102 Ga0500636_0004022
2103 Ga0500636_0028340
2104 Ga0500637_0022159
2105 Ga0500576_021939
2106 Ga0500657_042091
2107 Ga0500625_025664
2108 Ga0500645_025711
2109 Ga0500609_016525
2110 Ga0500596_003902
2111 Ga0500599_000328
2112 Ga0500661_001755
2113 Ga0500661_026424
2114 2507505473
2115 2508539358
2116 2508695688
2117 2511397796
2118 2513623902
2119 2513642216
2120 2513651310
2121 2513703484
2122 2513873323
2123 2513888556
2124 2514014653
2125 2515627670
2126 2517106255
2127 2524441465
2128 2524467202
2129 2528852707
2130 2617352036
2131 2617373506
2132 2745077599
2133 2793062261
2134 2805920671
2135 2818237880
2136 2824604399
2137 2824614871
2138 2824624187
2139 2824632867
2140 2824641394
2141 2824652574
2142 2824656317
2143 2824667270
2144 2824671773
2145 2824684715
2146 2824688545
2147 2824701683
2148 2824718456
2149 2824728837
2150 2824737641
2151 2824751163
2152 2824779969
2153 2838124723
2154 2841945414
2155 2841952200
2156 2841965322
2157 2841970410
2158 2841981661
2159 2841984941
2160 2842043296
2161 2842052714
2162 2844315569
2163 2847942365
2164 2849083237
2165 2857516329
2166 2874592524
2167 2874618666
2168 2874621178
2169 2874628578
2170 2874647143
2171 2876769667
2172 2876772527
2173 2876819788
2174 2879076294
2175 2879083794
2176 2879101968
2177 2879128778
2178 2879142906
2179 2881368951
2180 2885369312
2181 2885417979
2182 2888379377
2183 2888390477
2184 2888420098
2185 2903733522
2186 2903770572
2187 2904667723
2188 2904690981
2189 2904708376
2190 2906608876
2191 2906631697
2192 2908757039
2193 2908775977
2194 2922369357
2195 2922396557
2196 2929618811
2197 2929628504
2198 2932790989
2199 2932794118
2200 2932809193
2201 2932816233
2202 2932827640
2203 2932833705
2204 2933580479
2205 2935615496
2206 2935623231
2207 2935644306
2208 2935654425
2209 2935663305
2210 2935672112
2211 2935679368
2212 2935686610
2213 2935700391
2214 2935710339
2215 2935716298
2216 2935723578
2217 2935735133
2218 2935744076
2219 2935752576
2220 2935763291
2221 2935774263
2222 2935785127
2223 2935789022
2224 2935796772
2225 2935808330
2226 2935816055
2227 2935825703
2228 2935833450
2229 2935845992
2230 2935853467
2231 2935861479
2232 2935869598
2233 2935879927
2234 2935889145
2235 2935915068
2236 2935918916
2237 2935931367
2238 2935939964
2239 2935947689
2240 2935956460
2241 2935966693
2242 2935973254
2243 2935980501
2244 2935990148
2245 2935997850
2246 2936008885
2247 2936017536
2248 2936025963
2249 2936034805
2250 2936041061
2251 2936052937
2252 2936060204
2253 2940558489
2254 2941535319
2255 2941547161
2256 3005486650
2257 3005508954
2258 3005593269
2259 3005595259
2260 3005711205
2261 3005718506
2262 8006927272
2263 8006935978
2264 8016526354
2265 8016557445
2266 8016565800
2267 8016569687
2268 8016582293
2269 8016586119
2270 8016603403
2271 8016606335
2272 8016618243
2273 8016635399
2274 8017058673
2275 8019531251
2276 8019540301
2277 8019549892
2278 8019576985
2279 8019595049
2280 8019611816
2281 8019623189
2282 8019629908
2283 8019652257
2284 8019676506
2285 8019679488
2286 8019696024
2287 8055742660
2288 8056682967

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

72

251

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h29-assembly1.cif.gz_B crystal structure of nicotinic acid mononucleotide adenylyltransferase from staphylococcus aureus: product bound form 1 0.8548 21 152
1kaq-assembly1.cif.gz_D structure of bacillus subtilis nicotinic acid mononucleotide adenylyl transferase 0.8456 23 203
1kaq-assembly3.cif.gz_F structure of bacillus subtilis nicotinic acid mononucleotide adenylyl transferase 0.8423 22 152
1kaq-assembly3.cif.gz_E structure of bacillus subtilis nicotinic acid mononucleotide adenylyl transferase 0.8401 23 203
5vir-assembly1.cif.gz_A-2 crystal structure of probable nicotinate-nucleotide adenylyltransferase from mycobacterium abscessus in complex with nadp and compound fol0091 0.8386 21 151
ID Description Score Start End Superfamily
2h2aB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8542 21 152 3.40.50.620
5virA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8386 21 151 3.40.50.620
af_A0A1D6QAZ7_25_240_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8281 22 171 3.40.50.620
3h05A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8139 21 147 3.40.50.620
4wsoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8084 16 202 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A833G943-F1-model_v4 nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) 0.9558 12 187 GO:0009435
GO:0070566
AF-A0A2H0ETY4-F1-model_v4 nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) 0.9521 87 202 GO:0009435
GO:0070566
AF-A0A836SVQ4-F1-model_v4 deleted 0.95 40 202
AF-A0A356V7P4-F1-model_v4 nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) 0.9498 13 171 GO:0004515
GO:0009435
AF-A0A840ZVF3-F1-model_v4 deleted 0.9496 77 202

Map