F490754
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1144 | 612 | 2288 | 214 |
Family's Representative Sequence
| Representative Sequence | 3300035111|Ga0373923_0035595|Ga0373923_0035595_775_1554 |
| Length | 259 |
| Sequence | VISRVLSGKNAAGKNEPAELPASPLFPKFASGDAAKNSELRKRGHSLKPASVASQSAASAIPLYTNGMRIGLLGGSFNPPHVAHRAISLFAIKRLKLDRVWWLITPGNPLKDGGALHDLDERAEAARRMAGDPRIDISCLESVIGTRYTVDTVRYLRRRASGLRFVWIMGADNLAQFHRWQDWRRIASEVPIAVIDRPPQSFRALASPAAQALARYRMPENQAGRLADEKAPAWVFLTGMKLSLSSTGLRNLDGSWRTK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 114 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 185 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 186 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 187 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 193 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 194 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 195 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 197 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 198 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 199 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 200 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 201 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 212 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 213 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 214 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 215 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 216 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 238 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 239 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 240 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 243 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 244 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 245 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 246 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 247 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 248 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 249 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 250 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 251 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 252 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 253 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 254 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 255 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 341 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 342 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 343 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 344 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 345 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 348 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 349 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 350 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 351 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 352 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 353 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 354 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 355 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 356 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 357 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 358 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 359 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 360 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 361 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 362 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 363 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 364 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 384 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 385 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 387 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 388 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 393 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 396 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 400 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 401 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 402 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 403 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 404 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 405 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 406 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 407 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 408 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 409 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 410 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 411 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 413 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 414 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 415 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 416 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 417 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 418 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 419 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 420 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 421 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 422 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 423 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 424 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 425 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 426 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 427 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 428 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 429 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 430 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 431 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 432 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 433 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 434 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 435 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 436 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 437 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 438 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 439 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 440 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 441 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 442 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 443 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 444 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 445 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 446 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 447 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 448 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 449 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 450 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 451 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 452 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 453 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 454 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 455 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 456 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 457 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 458 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 459 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 460 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 461 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 462 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 463 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 464 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 465 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 466 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 467 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 468 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 469 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 470 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 471 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 472 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 473 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 474 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 475 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 476 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 477 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 478 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 479 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 480 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 481 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 482 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 483 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 484 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 485 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 486 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 487 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 488 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 489 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 490 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 491 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 492 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 493 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 494 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 495 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 496 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 497 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 498 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 499 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 500 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 501 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 502 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 503 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 504 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 505 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 506 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 507 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 508 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 509 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 510 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 511 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 512 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 513 | 2904699407 | |||
| 514 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 515 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 516 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 517 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 518 | 2922368715 | |||
| 519 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 520 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 521 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 522 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 523 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 524 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 525 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 526 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 527 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 528 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 529 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 530 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 531 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 532 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 533 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 534 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 535 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 536 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 537 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 538 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 539 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 540 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 541 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 542 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 543 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 544 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 545 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 546 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 547 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 548 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 549 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 550 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 551 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 552 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 553 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 554 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 555 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 556 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 557 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 558 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 559 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 560 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 561 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 562 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 563 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 564 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 565 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 566 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 567 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 568 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 569 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 570 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 571 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 572 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 573 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 574 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 575 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 576 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 577 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 578 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 579 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 580 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 581 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 582 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 583 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 584 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 585 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 586 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 587 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 588 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 589 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 590 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 591 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 592 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 593 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 594 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 595 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 596 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 597 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 598 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 599 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 600 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 601 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 602 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 603 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 604 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 605 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 606 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 607 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 608 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 609 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 610 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 611 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 612 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.85 |
| Metatranscriptomes | 0 |
| Isolates | 15.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.89 |
| Nodule | 11.63 |
| Rhizoplane | 6.73 |
| Rhizosphere | 59.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373923_0035595 | 3300035111 | Bacteria | 2028 |
| 2 | JGI25406J46586_10000364 | 3300003203 | Bacteria | 20635 |
| 3 | JGI25153J46596_10008527 | 3300003215 | Bacteria | 4885 |
| 4 | JGI25153J46596_10023803 | 3300003215 | Bacteria | 2223 |
| 5 | JGI25160J50197_1005464 | 3300003354 | Bacteria | 5285 |
| 6 | JGI25160J50197_1013128 | 3300003354 | Bacteria | 2838 |
| 7 | JGI25160J50197_1017285 | 3300003354 | Bacteria | 2291 |
| 8 | JGI25404J52841_10044352 | 3300003659 | Bacteria | 938 |
| 9 | Ga0055529_1012617 | 3300003763 | Bacteria | 1080 |
| 10 | Ga0055543_1002453 | 3300004625 | Bacteria | 6121 |
| 11 | Ga0065165_1018348 | 3300005262 | Bacteria | 2535 |
| 12 | Ga0065165_1030140 | 3300005262 | Bacteria | 1729 |
| 13 | Ga0070683_100504803 | 3300005329 | Bacteria | 1155 |
| 14 | Ga0070690_100459413 | 3300005330 | Bacteria | 946 |
| 15 | Ga0070670_100949250 | 3300005331 | Bacteria | 781 |
| 16 | Ga0068869_100431957 | 3300005334 | Bacteria | 1088 |
| 17 | Ga0070666_10142591 | 3300005335 | Bacteria | 1669 |
| 18 | Ga0070666_10179745 | 3300005335 | Bacteria | 1483 |
| 19 | Ga0070682_100115845 | 3300005337 | Bacteria | 1792 |
| 20 | Ga0070682_100225491 | 3300005337 | Bacteria | 1337 |
| 21 | Ga0068868_100271192 | 3300005338 | Bacteria | 1433 |
| 22 | Ga0070660_100453970 | 3300005339 | Bacteria | 1063 |
| 23 | Ga0070660_100759423 | 3300005339 | Bacteria | 814 |
| 24 | Ga0070689_100101308 | 3300005340 | Bacteria | 2279 |
| 25 | Ga0070687_100155833 | 3300005343 | Bacteria | 1345 |
| 26 | Ga0070661_100223677 | 3300005344 | Bacteria | 1444 |
| 27 | Ga0070668_100179797 | 3300005347 | Bacteria | 1727 |
| 28 | Ga0070669_100408239 | 3300005353 | Bacteria | 1113 |
| 29 | Ga0070675_100209414 | 3300005354 | Bacteria | 1694 |
| 30 | Ga0070675_100211310 | 3300005354 | Bacteria | 1686 |
| 31 | Ga0070671_100319260 | 3300005355 | Bacteria | 1323 |
| 32 | Ga0070671_100727714 | 3300005355 | Bacteria | 862 |
| 33 | Ga0070674_100057289 | 3300005356 | Bacteria | 2705 |
| 34 | Ga0070674_100231012 | 3300005356 | Bacteria | 1444 |
| 35 | Ga0070674_100352941 | 3300005356 | Bacteria | 1188 |
| 36 | Ga0070674_100385310 | 3300005356 | Bacteria | 1141 |
| 37 | Ga0070688_100494379 | 3300005365 | Bacteria | 922 |
| 38 | Ga0070659_100091579 | 3300005366 | Bacteria | 2437 |
| 39 | Ga0070659_100164937 | 3300005366 | Bacteria | 1812 |
| 40 | Ga0070659_100258130 | 3300005366 | Bacteria | 1446 |
| 41 | Ga0070659_100449700 | 3300005366 | Bacteria | 1093 |
| 42 | Ga0070667_100146017 | 3300005367 | Bacteria | 2075 |
| 43 | Ga0070667_100241603 | 3300005367 | Bacteria | 1613 |
| 44 | Ga0070714_100001570 | 3300005435 | Bacteria | 16615 |
| 45 | Ga0070714_100015683 | 3300005435 | Bacteria | 6100 |
| 46 | Ga0070714_100020448 | 3300005435 | Bacteria | 5405 |
| 47 | Ga0070714_100725284 | 3300005435 | Bacteria | 960 |
| 48 | Ga0070713_100008285 | 3300005436 | Bacteria | 7370 |
| 49 | Ga0070713_100081550 | 3300005436 | Bacteria | 2760 |
| 50 | Ga0070713_100179686 | 3300005436 | Bacteria | 1900 |
| 51 | Ga0070713_100213771 | 3300005436 | Bacteria | 1747 |
| 52 | Ga0070710_10001859 | 3300005437 | Bacteria | 9943 |
| 53 | Ga0070710_10085827 | 3300005437 | Bacteria | 1847 |
| 54 | Ga0070711_100013892 | 3300005439 | Bacteria | 5066 |
| 55 | Ga0070711_100121742 | 3300005439 | Bacteria | 1931 |
| 56 | Ga0070711_100206529 | 3300005439 | Bacteria | 1519 |
| 57 | Ga0070705_100148406 | 3300005440 | Bacteria | 1552 |
| 58 | Ga0070663_100089391 | 3300005455 | Bacteria | 2279 |
| 59 | Ga0070663_100093853 | 3300005455 | Bacteria | 2227 |
| 60 | Ga0070663_100323687 | 3300005455 | Bacteria | 1240 |
| 61 | Ga0070663_100376385 | 3300005455 | Bacteria | 1155 |
| 62 | Ga0070663_100669300 | 3300005455 | Bacteria | 880 |
| 63 | Ga0070678_100333205 | 3300005456 | Bacteria | 1299 |
| 64 | Ga0070681_10012682 | 3300005458 | Bacteria | 8361 |
| 65 | Ga0070681_10014900 | 3300005458 | Bacteria | 7730 |
| 66 | Ga0070681_10059272 | 3300005458 | Bacteria | 3808 |
| 67 | Ga0068867_100667780 | 3300005459 | Bacteria | 914 |
| 68 | Ga0070685_10161771 | 3300005466 | Bacteria | 1427 |
| 69 | Ga0070707_100026862 | 3300005468 | Bacteria | 5470 |
| 70 | Ga0070698_100305874 | 3300005471 | Bacteria | 1520 |
| 71 | Ga0070699_100160173 | 3300005518 | Bacteria | 1991 |
| 72 | Ga0070679_100103628 | 3300005530 | Bacteria | 2831 |
| 73 | Ga0070679_100174271 | 3300005530 | Bacteria | 2123 |
| 74 | Ga0070684_100347298 | 3300005535 | Bacteria | 1364 |
| 75 | Ga0068853_100010595 | 3300005539 | Bacteria | 7456 |
| 76 | Ga0068853_100013156 | 3300005539 | Bacteria | 6753 |
| 77 | Ga0068853_100113574 | 3300005539 | Bacteria | 2408 |
| 78 | Ga0068853_100297217 | 3300005539 | Bacteria | 1492 |
| 79 | Ga0070672_100092290 | 3300005543 | Bacteria | 2444 |
| 80 | Ga0070672_100508765 | 3300005543 | Bacteria | 1042 |
| 81 | Ga0070686_100123856 | 3300005544 | Bacteria | 1778 |
| 82 | Ga0070686_100561180 | 3300005544 | Bacteria | 895 |
| 83 | Ga0070665_100092776 | 3300005548 | Bacteria | 3024 |
| 84 | Ga0070665_100400513 | 3300005548 | Bacteria | 1380 |
| 85 | Ga0070665_100414613 | 3300005548 | Bacteria | 1355 |
| 86 | Ga0070665_101151804 | 3300005548 | Bacteria | 787 |
| 87 | Ga0068855_100023359 | 3300005563 | Bacteria | 7405 |
| 88 | Ga0068855_100058220 | 3300005563 | Bacteria | 4526 |
| 89 | Ga0068855_100101537 | 3300005563 | Bacteria | 3311 |
| 90 | Ga0068855_100249162 | 3300005563 | Bacteria | 1981 |
| 91 | Ga0068855_100495448 | 3300005563 | Bacteria | 1328 |
| 92 | Ga0070664_100424039 | 3300005564 | Bacteria | 1219 |
| 93 | Ga0070664_100792560 | 3300005564 | Bacteria | 886 |
| 94 | Ga0068857_100012785 | 3300005577 | Bacteria | 7317 |
| 95 | Ga0068857_100062694 | 3300005577 | Bacteria | 3305 |
| 96 | Ga0068857_100593569 | 3300005577 | Bacteria | 1046 |
| 97 | Ga0068854_100280803 | 3300005578 | Bacteria | 1341 |
| 98 | Ga0068856_100026080 | 3300005614 | Bacteria | 5698 |
| 99 | Ga0068856_100256563 | 3300005614 | Bacteria | 1763 |
| 100 | Ga0068856_100349331 | 3300005614 | Bacteria | 1497 |
| 101 | Ga0070702_100150153 | 3300005615 | Bacteria | 1495 |
| 102 | Ga0068852_100025281 | 3300005616 | Bacteria | 4809 |
| 103 | Ga0068852_100247267 | 3300005616 | Bacteria | 1707 |
| 104 | Ga0068852_100410545 | 3300005616 | Bacteria | 1334 |
| 105 | Ga0068852_100579835 | 3300005616 | Bacteria | 1124 |
| 106 | Ga0068859_100235253 | 3300005617 | Bacteria | 1920 |
| 107 | Ga0068864_100067650 | 3300005618 | Bacteria | 3102 |
| 108 | Ga0068864_100068559 | 3300005618 | Bacteria | 3082 |
| 109 | Ga0068866_10096225 | 3300005718 | Bacteria | 1623 |
| 110 | Ga0068861_100086139 | 3300005719 | Bacteria | 2469 |
| 111 | Ga0068861_100262018 | 3300005719 | Bacteria | 1480 |
| 112 | Ga0068861_100478497 | 3300005719 | Bacteria | 1121 |
| 113 | Ga0068851_10041453 | 3300005834 | Bacteria | 2314 |
| 114 | Ga0068870_10222774 | 3300005840 | Bacteria | 1155 |
| 115 | Ga0068863_100047085 | 3300005841 | Bacteria | 4092 |
| 116 | Ga0068863_100269322 | 3300005841 | Bacteria | 1648 |
| 117 | Ga0068858_100169723 | 3300005842 | Bacteria | 2057 |
| 118 | Ga0068858_100180795 | 3300005842 | Bacteria | 1991 |
| 119 | Ga0068858_100218274 | 3300005842 | Bacteria | 1805 |
| 120 | Ga0068860_100225901 | 3300005843 | Bacteria | 1818 |
| 121 | Ga0068860_100359355 | 3300005843 | Bacteria | 1434 |
| 122 | Ga0068860_100365935 | 3300005843 | Bacteria | 1421 |
| 123 | Ga0068860_100482574 | 3300005843 | Bacteria | 1236 |
| 124 | Ga0068860_100569843 | 3300005843 | Bacteria | 1136 |
| 125 | Ga0068860_100617494 | 3300005843 | Bacteria | 1090 |
| 126 | Ga0068862_100118329 | 3300005844 | Bacteria | 2332 |
| 127 | Ga0068862_100521364 | 3300005844 | Bacteria | 1131 |
| 128 | Ga0068862_100793073 | 3300005844 | Bacteria | 924 |
| 129 | Ga0081455_10027393 | 3300005937 | Bacteria | 5223 |
| 130 | Ga0081455_10107291 | 3300005937 | Bacteria | 2227 |
| 131 | Ga0081455_10109972 | 3300005937 | Bacteria | 2192 |
| 132 | Ga0081455_10244865 | 3300005937 | Bacteria | 1315 |
| 133 | Ga0081538_10040708 | 3300005981 | Bacteria | 2959 |
| 134 | Ga0081540_1008955 | 3300005983 | Bacteria | 6929 |
| 135 | Ga0081540_1023424 | 3300005983 | Bacteria | 3612 |
| 136 | Ga0081540_1033253 | 3300005983 | Bacteria | 2803 |
| 137 | Ga0081540_1038528 | 3300005983 | Bacteria | 2518 |
| 138 | Ga0081540_1074886 | 3300005983 | Bacteria | 1549 |
| 139 | Ga0081540_1084152 | 3300005983 | Bacteria | 1421 |
| 140 | Ga0081539_10000048 | 3300005985 | Bacteria | 272906 |
| 141 | Ga0081539_10036075 | 3300005985 | Bacteria | 2964 |
| 142 | Ga0070717_10011435 | 3300006028 | Bacteria | 6741 |
| 143 | Ga0070717_10012018 | 3300006028 | Bacteria | 6593 |
| 144 | Ga0070717_10732534 | 3300006028 | Bacteria | 899 |
| 145 | Ga0075365_10196779 | 3300006038 | Bacteria | 1411 |
| 146 | Ga0075365_10280147 | 3300006038 | Bacteria | 1173 |
| 147 | Ga0075363_100002635 | 3300006048 | Bacteria | 7396 |
| 148 | Ga0075363_100071771 | 3300006048 | Bacteria | 1882 |
| 149 | Ga0075363_100142227 | 3300006048 | Bacteria | 1351 |
| 150 | Ga0075363_100159479 | 3300006048 | Bacteria | 1277 |
| 151 | Ga0075364_10043997 | 3300006051 | Bacteria | 2903 |
| 152 | Ga0075364_10144848 | 3300006051 | Bacteria | 1599 |
| 153 | Ga0070716_100001724 | 3300006173 | Bacteria | 9859 |
| 154 | Ga0070716_100005301 | 3300006173 | Bacteria | 6233 |
| 155 | Ga0070712_100002575 | 3300006175 | Bacteria | 11202 |
| 156 | Ga0070712_100008167 | 3300006175 | Bacteria | 6571 |
| 157 | Ga0070712_100018957 | 3300006175 | Bacteria | 4478 |
| 158 | Ga0070712_100022704 | 3300006175 | Bacteria | 4136 |
| 159 | Ga0070712_100048715 | 3300006175 | Bacteria | 2939 |
| 160 | Ga0070712_100569961 | 3300006175 | Bacteria | 956 |
| 161 | Ga0075362_10048007 | 3300006177 | Bacteria | 1903 |
| 162 | Ga0075362_10099154 | 3300006177 | Bacteria | 1360 |
| 163 | Ga0075367_10076702 | 3300006178 | Bacteria | 2017 |
| 164 | Ga0075367_10178837 | 3300006178 | Bacteria | 1322 |
| 165 | Ga0075367_10278412 | 3300006178 | Bacteria | 1051 |
| 166 | Ga0075369_10009532 | 3300006186 | Bacteria | 3776 |
| 167 | Ga0075369_10069537 | 3300006186 | Bacteria | 1548 |
| 168 | Ga0075369_10105043 | 3300006186 | Bacteria | 1269 |
| 169 | Ga0075366_10040639 | 3300006195 | Bacteria | 2751 |
| 170 | Ga0075366_10090039 | 3300006195 | Bacteria | 1837 |
| 171 | Ga0075366_10259752 | 3300006195 | Bacteria | 1060 |
| 172 | Ga0097621_100187595 | 3300006237 | Bacteria | 1789 |
| 173 | Ga0075370_10053268 | 3300006353 | Bacteria | 2296 |
| 174 | Ga0075370_10078556 | 3300006353 | Bacteria | 1895 |
| 175 | Ga0075370_10221854 | 3300006353 | Bacteria | 1117 |
| 176 | Ga0068871_100132076 | 3300006358 | Bacteria | 2118 |
| 177 | Ga0068871_100196138 | 3300006358 | Bacteria | 1741 |
| 178 | Ga0068871_100411789 | 3300006358 | Bacteria | 1206 |
| 179 | Ga0075428_100778165 | 3300006844 | Bacteria | 1018 |
| 180 | Ga0075434_100080096 | 3300006871 | Bacteria | 3262 |
| 181 | Ga0075434_100572900 | 3300006871 | Bacteria | 1148 |
| 182 | Ga0068865_100080664 | 3300006881 | Bacteria | 2334 |
| 183 | Ga0068865_100209227 | 3300006881 | Bacteria | 1519 |
| 184 | Ga0068865_100329938 | 3300006881 | Bacteria | 1230 |
| 185 | Ga0068865_100621010 | 3300006881 | Bacteria | 916 |
| 186 | Ga0075436_100192108 | 3300006914 | Bacteria | 1445 |
| 187 | Ga0097620_100235271 | 3300006931 | Bacteria | 1920 |
| 188 | Ga0097620_100671719 | 3300006931 | Bacteria | 1127 |
| 189 | Ga0099795_10006522 | 3300007788 | Bacteria | 3190 |
| 190 | Ga0105240_10006144 | 3300009093 | Bacteria | 17713 |
| 191 | Ga0105240_10026751 | 3300009093 | Bacteria | 7566 |
| 192 | Ga0105240_10031683 | 3300009093 | Bacteria | 6851 |
| 193 | Ga0105240_10204399 | 3300009093 | Bacteria | 2313 |
| 194 | Ga0105240_10280515 | 3300009093 | Bacteria | 1914 |
| 195 | Ga0111539_10685995 | 3300009094 | Bacteria | 1192 |
| 196 | Ga0105245_10109815 | 3300009098 | Bacteria | 2563 |
| 197 | Ga0114129_10225048 | 3300009147 | Bacteria | 2529 |
| 198 | Ga0105243_10229080 | 3300009148 | Bacteria | 1647 |
| 199 | Ga0105243_10253946 | 3300009148 | Bacteria | 1571 |
| 200 | Ga0105241_10148686 | 3300009174 | Bacteria | 1914 |
| 201 | Ga0105241_10374259 | 3300009174 | Bacteria | 1243 |
| 202 | Ga0105242_10649739 | 3300009176 | Bacteria | 1025 |
| 203 | Ga0105242_10777263 | 3300009176 | Bacteria | 945 |
| 204 | Ga0105248_10123069 | 3300009177 | Bacteria | 2926 |
| 205 | Ga0105248_10869908 | 3300009177 | Bacteria | 1017 |
| 206 | Ga0105237_10031550 | 3300009545 | Bacteria | 5369 |
| 207 | Ga0105237_10283060 | 3300009545 | Bacteria | 1661 |
| 208 | Ga0105237_10328722 | 3300009545 | Bacteria | 1533 |
| 209 | Ga0105237_10645400 | 3300009545 | Bacteria | 1065 |
| 210 | Ga0105237_10921115 | 3300009545 | Bacteria | 881 |
| 211 | Ga0105237_10926396 | 3300009545 | Bacteria | 878 |
| 212 | Ga0105238_10040832 | 3300009551 | Bacteria | 4700 |
| 213 | Ga0105238_10198728 | 3300009551 | Bacteria | 1980 |
| 214 | Ga0105238_10219633 | 3300009551 | Bacteria | 1877 |
| 215 | Ga0105238_10351617 | 3300009551 | Bacteria | 1463 |
| 216 | Ga0105238_10477278 | 3300009551 | Bacteria | 1246 |
| 217 | Ga0105238_10546089 | 3300009551 | Bacteria | 1163 |
| 218 | Ga0105249_10198830 | 3300009553 | Bacteria | 1961 |
| 219 | Ga0105249_10312530 | 3300009553 | Bacteria | 1580 |
| 220 | Ga0099796_10039157 | 3300010159 | Bacteria | 1594 |
| 221 | Ga0105239_10022471 | 3300010375 | Bacteria | 6953 |
| 222 | Ga0105239_10084117 | 3300010375 | Bacteria | 3504 |
| 223 | Ga0105239_10090895 | 3300010375 | Bacteria | 3368 |
| 224 | Ga0105239_10238920 | 3300010375 | Bacteria | 2039 |
| 225 | Ga0105239_10252813 | 3300010375 | Bacteria | 1979 |
| 226 | Ga0105239_10533040 | 3300010375 | Bacteria | 1336 |
| 227 | Ga0105239_10602347 | 3300010375 | Bacteria | 1253 |
| 228 | Ga0157370_10113104 | 3300013104 | Bacteria | 2537 |
| 229 | Ga0157370_10557354 | 3300013104 | Bacteria | 1050 |
| 230 | Ga0157369_10026404 | 3300013105 | Bacteria | 6442 |
| 231 | Ga0157369_10046781 | 3300013105 | Bacteria | 4701 |
| 232 | Ga0157374_10089923 | 3300013296 | Bacteria | 2926 |
| 233 | Ga0157378_10002715 | 3300013297 | Bacteria | 15762 |
| 234 | Ga0157378_10608512 | 3300013297 | Bacteria | 1105 |
| 235 | Ga0163162_10127470 | 3300013306 | Bacteria | 2652 |
| 236 | Ga0163162_10265281 | 3300013306 | Bacteria | 1849 |
| 237 | Ga0163162_11530500 | 3300013306 | Bacteria | 760 |
| 238 | Ga0157372_10031372 | 3300013307 | Bacteria | 5819 |
| 239 | Ga0157372_10545492 | 3300013307 | Bacteria | 1352 |
| 240 | Ga0157375_10130145 | 3300013308 | Bacteria | 2635 |
| 241 | Ga0157375_10231195 | 3300013308 | Bacteria | 2008 |
| 242 | Ga0157375_10314222 | 3300013308 | Bacteria | 1731 |
| 243 | Ga0157375_10632810 | 3300013308 | Bacteria | 1227 |
| 244 | Ga0163163_10262185 | 3300014325 | Bacteria | 1779 |
| 245 | Ga0163163_10329184 | 3300014325 | Bacteria | 1582 |
| 246 | Ga0163163_10406084 | 3300014325 | Bacteria | 1421 |
| 247 | Ga0163163_10430380 | 3300014325 | Bacteria | 1379 |
| 248 | Ga0163163_10791603 | 3300014325 | Bacteria | 1011 |
| 249 | Ga0163163_10839309 | 3300014325 | Bacteria | 982 |
| 250 | Ga0157380_11078668 | 3300014326 | Bacteria | 841 |
| 251 | Ga0157377_10250121 | 3300014745 | Bacteria | 1148 |
| 252 | Ga0157379_10285083 | 3300014968 | Bacteria | 1503 |
| 253 | Ga0157379_10439921 | 3300014968 | Bacteria | 1202 |
| 254 | Ga0157379_10534279 | 3300014968 | Bacteria | 1090 |
| 255 | Ga0157376_10604550 | 3300014969 | Bacteria | 1092 |
| 256 | Ga0163161_10779974 | 3300017792 | Bacteria | 802 |
| 257 | Ga0213875_10056365 | 3300021388 | Bacteria | 1841 |
| 258 | Ga0209563_105488 | 3300025230 | Bacteria | 2293 |
| 259 | Ga0209677_101407 | 3300025253 | Bacteria | 10444 |
| 260 | Ga0209148_1000418 | 3300025254 | Bacteria | 47611 |
| 261 | Ga0209233_1006320 | 3300025261 | Bacteria | 3829 |
| 262 | Ga0209233_1018369 | 3300025261 | Bacteria | 1883 |
| 263 | Ga0209455_1002667 | 3300025272 | Bacteria | 6723 |
| 264 | Ga0209130_1039697 | 3300025284 | Bacteria | 915 |
| 265 | Ga0209564_1004051 | 3300025295 | Bacteria | 9245 |
| 266 | Ga0209564_1004930 | 3300025295 | Bacteria | 7891 |
| 267 | Ga0209758_1000992 | 3300025297 | Bacteria | 37900 |
| 268 | Ga0209758_1003988 | 3300025297 | Bacteria | 12774 |
| 269 | Ga0209758_1006211 | 3300025297 | Bacteria | 8724 |
| 270 | Ga0209758_1016088 | 3300025297 | Bacteria | 3821 |
| 271 | Ga0209256_1014609 | 3300025299 | Bacteria | 2811 |
| 272 | Ga0207426_1002389 | 3300025302 | Bacteria | 12105 |
| 273 | Ga0207426_1002931 | 3300025302 | Bacteria | 10046 |
| 274 | Ga0207426_1024113 | 3300025302 | Bacteria | 2067 |
| 275 | Ga0209257_1010825 | 3300025304 | Bacteria | 4521 |
| 276 | Ga0207697_10011788 | 3300025315 | Bacteria | 3688 |
| 277 | Ga0207697_10110796 | 3300025315 | Bacteria | 1175 |
| 278 | Ga0207656_10007112 | 3300025321 | Bacteria | 4066 |
| 279 | Ga0207682_10071672 | 3300025893 | Bacteria | 1469 |
| 280 | Ga0207692_10001084 | 3300025898 | Bacteria | 9986 |
| 281 | Ga0207692_10020867 | 3300025898 | Bacteria | 2988 |
| 282 | Ga0207692_10023041 | 3300025898 | Bacteria | 2875 |
| 283 | Ga0207642_10137028 | 3300025899 | Bacteria | 1285 |
| 284 | Ga0207710_10033533 | 3300025900 | Bacteria | 2253 |
| 285 | Ga0207710_10144449 | 3300025900 | Bacteria | 1151 |
| 286 | Ga0207688_10016201 | 3300025901 | Bacteria | 4042 |
| 287 | Ga0207688_10215987 | 3300025901 | Bacteria | 1154 |
| 288 | Ga0207680_10477429 | 3300025903 | Bacteria | 887 |
| 289 | Ga0207647_10012688 | 3300025904 | Bacteria | 5856 |
| 290 | Ga0207685_10088793 | 3300025905 | Bacteria | 1296 |
| 291 | Ga0207699_10000184 | 3300025906 | Bacteria | 37990 |
| 292 | Ga0207643_10188074 | 3300025908 | Bacteria | 1252 |
| 293 | Ga0207705_10031180 | 3300025909 | Bacteria | 3803 |
| 294 | Ga0207654_10054988 | 3300025911 | Bacteria | 2303 |
| 295 | Ga0207654_10089494 | 3300025911 | Bacteria | 1873 |
| 296 | Ga0207654_10501923 | 3300025911 | Bacteria | 857 |
| 297 | Ga0207707_10001217 | 3300025912 | Bacteria | 24173 |
| 298 | Ga0207707_10004329 | 3300025912 | Bacteria | 12571 |
| 299 | Ga0207707_10012573 | 3300025912 | Bacteria | 7357 |
| 300 | Ga0207707_10029874 | 3300025912 | Bacteria | 4766 |
| 301 | Ga0207707_10275996 | 3300025912 | Bacteria | 1456 |
| 302 | Ga0207695_10000148 | 3300025913 | Bacteria | 208344 |
| 303 | Ga0207695_10010844 | 3300025913 | Bacteria | 11100 |
| 304 | Ga0207695_10064739 | 3300025913 | Bacteria | 3762 |
| 305 | Ga0207695_10100215 | 3300025913 | Bacteria | 2893 |
| 306 | Ga0207695_10141903 | 3300025913 | Bacteria | 2350 |
| 307 | Ga0207695_10256594 | 3300025913 | Bacteria | 1647 |
| 308 | Ga0207671_10009621 | 3300025914 | Bacteria | 8057 |
| 309 | Ga0207671_10069645 | 3300025914 | Bacteria | 2622 |
| 310 | Ga0207693_10004934 | 3300025915 | Bacteria | 11209 |
| 311 | Ga0207693_10006712 | 3300025915 | Bacteria | 9502 |
| 312 | Ga0207693_10044439 | 3300025915 | Bacteria | 3492 |
| 313 | Ga0207693_10318068 | 3300025915 | Bacteria | 1218 |
| 314 | Ga0207693_10337130 | 3300025915 | Bacteria | 1180 |
| 315 | Ga0207663_10000585 | 3300025916 | Bacteria | 16125 |
| 316 | Ga0207663_10000680 | 3300025916 | Bacteria | 15063 |
| 317 | Ga0207663_10009659 | 3300025916 | Bacteria | 5106 |
| 318 | Ga0207663_10024585 | 3300025916 | Bacteria | 3470 |
| 319 | Ga0207663_10051159 | 3300025916 | Bacteria | 2571 |
| 320 | Ga0207660_10014328 | 3300025917 | Bacteria | 5211 |
| 321 | Ga0207662_10269986 | 3300025918 | Bacteria | 1122 |
| 322 | Ga0207657_10000700 | 3300025919 | Bacteria | 35601 |
| 323 | Ga0207657_10305575 | 3300025919 | Bacteria | 1259 |
| 324 | Ga0207649_10284126 | 3300025920 | Bacteria | 1204 |
| 325 | Ga0207649_10389782 | 3300025920 | Bacteria | 1040 |
| 326 | Ga0207652_10002661 | 3300025921 | Bacteria | 14988 |
| 327 | Ga0207652_10007721 | 3300025921 | Bacteria | 8642 |
| 328 | Ga0207652_10013904 | 3300025921 | Bacteria | 6515 |
| 329 | Ga0207681_10147193 | 3300025923 | Bacteria | 1761 |
| 330 | Ga0207694_10055995 | 3300025924 | Bacteria | 3062 |
| 331 | Ga0207694_10102197 | 3300025924 | Bacteria | 2272 |
| 332 | Ga0207694_10109141 | 3300025924 | Bacteria | 2200 |
| 333 | Ga0207694_10396572 | 3300025924 | Bacteria | 1147 |
| 334 | Ga0207650_10091363 | 3300025925 | Bacteria | 2327 |
| 335 | Ga0207650_10812283 | 3300025925 | Bacteria | 793 |
| 336 | Ga0207687_10709527 | 3300025927 | Bacteria | 854 |
| 337 | Ga0207700_10015244 | 3300025928 | Bacteria | 5061 |
| 338 | Ga0207700_10134873 | 3300025928 | Bacteria | 2021 |
| 339 | Ga0207700_10146977 | 3300025928 | Bacteria | 1944 |
| 340 | Ga0207700_10165427 | 3300025928 | Bacteria | 1840 |
| 341 | Ga0207664_10003622 | 3300025929 | Bacteria | 10338 |
| 342 | Ga0207664_10012251 | 3300025929 | Bacteria | 6129 |
| 343 | Ga0207664_10068749 | 3300025929 | Bacteria | 2846 |
| 344 | Ga0207664_10094211 | 3300025929 | Bacteria | 2461 |
| 345 | Ga0207664_10532916 | 3300025929 | Bacteria | 1053 |
| 346 | Ga0207644_10155611 | 3300025931 | Bacteria | 1772 |
| 347 | Ga0207690_10046755 | 3300025932 | Bacteria | 2868 |
| 348 | Ga0207706_10053577 | 3300025933 | Bacteria | 3561 |
| 349 | Ga0207706_10161302 | 3300025933 | Bacteria | 1971 |
| 350 | Ga0207706_10550892 | 3300025933 | Bacteria | 993 |
| 351 | Ga0207686_10564059 | 3300025934 | Bacteria | 892 |
| 352 | Ga0207686_10755804 | 3300025934 | Bacteria | 776 |
| 353 | Ga0207709_10017861 | 3300025935 | Bacteria | 3966 |
| 354 | Ga0207709_10159778 | 3300025935 | Bacteria | 1570 |
| 355 | Ga0207709_10341866 | 3300025935 | Bacteria | 1127 |
| 356 | Ga0207669_10285598 | 3300025937 | Bacteria | 1247 |
| 357 | Ga0207669_10365577 | 3300025937 | Bacteria | 1119 |
| 358 | Ga0207704_10280309 | 3300025938 | Bacteria | 1267 |
| 359 | Ga0207704_10445090 | 3300025938 | Bacteria | 1033 |
| 360 | Ga0207704_10580008 | 3300025938 | Bacteria | 915 |
| 361 | Ga0207704_10582708 | 3300025938 | Bacteria | 913 |
| 362 | Ga0207665_10002484 | 3300025939 | Bacteria | 12418 |
| 363 | Ga0207665_10007064 | 3300025939 | Bacteria | 7434 |
| 364 | Ga0207665_10163728 | 3300025939 | Bacteria | 1602 |
| 365 | Ga0207691_10479073 | 3300025940 | Bacteria | 1058 |
| 366 | Ga0207711_10045483 | 3300025941 | Bacteria | 3751 |
| 367 | Ga0207711_10913739 | 3300025941 | Bacteria | 816 |
| 368 | Ga0207689_10136965 | 3300025942 | Bacteria | 2016 |
| 369 | Ga0207661_10001291 | 3300025944 | Bacteria | 16759 |
| 370 | Ga0207661_10397557 | 3300025944 | Bacteria | 1249 |
| 371 | Ga0207667_10001909 | 3300025949 | Bacteria | 26170 |
| 372 | Ga0207667_10030060 | 3300025949 | Bacteria | 5881 |
| 373 | Ga0207667_10237390 | 3300025949 | Bacteria | 1866 |
| 374 | Ga0207667_10326029 | 3300025949 | Bacteria | 1568 |
| 375 | Ga0207667_10407962 | 3300025949 | Bacteria | 1383 |
| 376 | Ga0207667_10420887 | 3300025949 | Bacteria | 1359 |
| 377 | Ga0207667_10448463 | 3300025949 | Bacteria | 1311 |
| 378 | Ga0207712_10199502 | 3300025961 | Bacteria | 1586 |
| 379 | Ga0207668_10051032 | 3300025972 | Bacteria | 2854 |
| 380 | Ga0207668_10245744 | 3300025972 | Bacteria | 1450 |
| 381 | Ga0207668_10506330 | 3300025972 | Bacteria | 1039 |
| 382 | Ga0207640_10266437 | 3300025981 | Bacteria | 1338 |
| 383 | Ga0207640_10308400 | 3300025981 | Bacteria | 1255 |
| 384 | Ga0207640_10405229 | 3300025981 | Bacteria | 1112 |
| 385 | Ga0207677_10100007 | 3300026023 | Bacteria | 2131 |
| 386 | Ga0207703_10032875 | 3300026035 | Bacteria | 4109 |
| 387 | Ga0207703_10164381 | 3300026035 | Bacteria | 1946 |
| 388 | Ga0207703_10418455 | 3300026035 | Bacteria | 1246 |
| 389 | Ga0207703_10447648 | 3300026035 | Bacteria | 1206 |
| 390 | Ga0207639_10002676 | 3300026041 | Bacteria | 11963 |
| 391 | Ga0207639_10042968 | 3300026041 | Bacteria | 3390 |
| 392 | Ga0207639_10081860 | 3300026041 | Bacteria | 2558 |
| 393 | Ga0207639_10274325 | 3300026041 | Bacteria | 1480 |
| 394 | Ga0207678_10018564 | 3300026067 | Bacteria | 6107 |
| 395 | Ga0207678_10044801 | 3300026067 | Bacteria | 3825 |
| 396 | Ga0207708_10170608 | 3300026075 | Bacteria | 1723 |
| 397 | Ga0207702_10000546 | 3300026078 | Bacteria | 42023 |
| 398 | Ga0207702_10148445 | 3300026078 | Bacteria | 2130 |
| 399 | Ga0207702_10185504 | 3300026078 | Bacteria | 1918 |
| 400 | Ga0207702_10741297 | 3300026078 | Bacteria | 969 |
| 401 | Ga0207702_10885931 | 3300026078 | Bacteria | 884 |
| 402 | Ga0207641_10285304 | 3300026088 | Bacteria | 1554 |
| 403 | Ga0207641_10333260 | 3300026088 | Bacteria | 1442 |
| 404 | Ga0207648_10075157 | 3300026089 | Bacteria | 2946 |
| 405 | Ga0207648_10120862 | 3300026089 | Bacteria | 2303 |
| 406 | Ga0207648_10317421 | 3300026089 | Bacteria | 1400 |
| 407 | Ga0207676_10352687 | 3300026095 | Bacteria | 1361 |
| 408 | Ga0207676_10482211 | 3300026095 | Bacteria | 1174 |
| 409 | Ga0207674_10028047 | 3300026116 | Bacteria | 5948 |
| 410 | Ga0207674_10048764 | 3300026116 | Bacteria | 4333 |
| 411 | Ga0207674_10530378 | 3300026116 | Bacteria | 1137 |
| 412 | Ga0207675_100209834 | 3300026118 | Bacteria | 1873 |
| 413 | Ga0207675_100622266 | 3300026118 | Bacteria | 1084 |
| 414 | Ga0207683_10164315 | 3300026121 | Bacteria | 2008 |
| 415 | Ga0207683_10168846 | 3300026121 | Bacteria | 1981 |
| 416 | Ga0207698_10254092 | 3300026142 | Bacteria | 1610 |
| 417 | Ga0209389_1000142 | 3300027296 | Bacteria | 62072 |
| 418 | Ga0209589_1000331 | 3300027357 | Bacteria | 62072 |
| 419 | Ga0209489_100818 | 3300027361 | Bacteria | 62070 |
| 420 | Ga0209813_10010674 | 3300027866 | Bacteria | 2383 |
| 421 | Ga0207428_10485609 | 3300027907 | Bacteria | 898 |
| 422 | Ga0268266_10001335 | 3300028379 | Bacteria | 29884 |
| 423 | Ga0268266_10438309 | 3300028379 | Bacteria | 1240 |
| 424 | Ga0268265_10512415 | 3300028380 | Bacteria | 1132 |
| 425 | Ga0268265_10580303 | 3300028380 | Bacteria | 1068 |
| 426 | Ga0268265_10807968 | 3300028380 | Bacteria | 914 |
| 427 | Ga0268265_11075820 | 3300028380 | Bacteria | 797 |
| 428 | Ga0268264_10191625 | 3300028381 | Bacteria | 1864 |
| 429 | Ga0268264_10366852 | 3300028381 | Bacteria | 1375 |
| 430 | Ga0268264_10579964 | 3300028381 | Bacteria | 1103 |
| 431 | Ga0268264_10727049 | 3300028381 | Bacteria | 987 |
| 432 | Ga0307517_10000232 | 3300028786 | Bacteria | 94332 |
| 433 | Ga0307517_10223864 | 3300028786 | Bacteria | 1139 |
| 434 | Ga0307515_10157960 | 3300028794 | Bacteria | 2329 |
| 435 | Ga0307511_10045310 | 3300030521 | Bacteria | 3636 |
| 436 | Ga0265330_10105977 | 3300031235 | Bacteria | 1202 |
| 437 | Ga0265325_10026243 | 3300031241 | Bacteria | 3158 |
| 438 | Ga0265316_10048928 | 3300031344 | Bacteria | 3333 |
| 439 | Ga0307513_10183023 | 3300031456 | Bacteria | 1956 |
| 440 | Ga0307509_10038863 | 3300031507 | Bacteria | 5187 |
| 441 | Ga0307509_10170593 | 3300031507 | Bacteria | 2056 |
| 442 | Ga0307509_10372470 | 3300031507 | Bacteria | 1144 |
| 443 | Ga0307508_10085301 | 3300031616 | Bacteria | 2741 |
| 444 | Ga0265314_10021118 | 3300031711 | Bacteria | 5015 |
| 445 | Ga0265314_10081447 | 3300031711 | Bacteria | 2133 |
| 446 | Ga0265342_10017967 | 3300031712 | Bacteria | 4592 |
| 447 | Ga0265342_10122093 | 3300031712 | Bacteria | 1466 |
| 448 | Ga0307516_10011325 | 3300031730 | Bacteria | 9707 |
| 449 | Ga0307516_10255965 | 3300031730 | Bacteria | 1443 |
| 450 | Ga0307516_10365399 | 3300031730 | Bacteria | 1107 |
| 451 | Ga0307405_10108057 | 3300031731 | Bacteria | 1879 |
| 452 | Ga0307413_10026553 | 3300031824 | Bacteria | 3193 |
| 453 | Ga0307406_10184148 | 3300031901 | Bacteria | 1523 |
| 454 | Ga0307406_10260630 | 3300031901 | Bacteria | 1311 |
| 455 | Ga0307406_10363163 | 3300031901 | Bacteria | 1136 |
| 456 | Ga0307407_10266860 | 3300031903 | Bacteria | 1180 |
| 457 | Ga0307412_10041444 | 3300031911 | Bacteria | 2984 |
| 458 | Ga0307412_10281166 | 3300031911 | Bacteria | 1307 |
| 459 | Ga0307409_100808243 | 3300031995 | Bacteria | 946 |
| 460 | Ga0307416_100542984 | 3300032002 | Bacteria | 1234 |
| 461 | Ga0307414_10617857 | 3300032004 | Bacteria | 974 |
| 462 | Ga0307411_10052199 | 3300032005 | Bacteria | 2672 |
| 463 | Ga0307411_10129259 | 3300032005 | Bacteria | 1843 |
| 464 | Ga0307415_100258015 | 3300032126 | Bacteria | 1420 |
| 465 | Ga0307415_100318916 | 3300032126 | Bacteria | 1295 |
| 466 | Ga0307510_10010850 | 3300033180 | Bacteria | 10828 |
| 467 | Ga0307510_10019009 | 3300033180 | Bacteria | 8062 |
| 468 | Ga0307510_10101854 | 3300033180 | Bacteria | 2657 |
| 469 | Ga0373926_0162609 | 3300035083 | Bacteria | 853 |
| 470 | Ga0373928_0069102 | 3300035084 | Bacteria | 869 |
| 471 | Ga0373928_0111700 | 3300035084 | Bacteria | 724 |
| 472 | Ga0373940_0108324 | 3300035088 | Bacteria | 850 |
| 473 | Ga0373936_0002293 | 3300035113 | Bacteria | 7163 |
| 474 | Ga0373953_0008406 | 3300035117 | Bacteria | 3505 |
| 475 | Ga0373954_0006447 | 3300035118 | Bacteria | 5117 |
| 476 | Ga0373954_0074360 | 3300035118 | Bacteria | 1617 |
| 477 | Ga0373956_0015957 | 3300035119 | Bacteria | 3151 |
| 478 | Ga0373943_0229359 | 3300035170 | Bacteria | 1037 |
| 479 | Ga0373943_0281041 | 3300035170 | Bacteria | 941 |
| 480 | Ga0373946_0012943 | 3300035171 | Bacteria | 3130 |
| 481 | Ga0373946_0333097 | 3300035171 | Bacteria | 756 |
| 482 | Ga0373955_0008311 | 3300035172 | Bacteria | 4815 |
| 483 | Ga0373955_0136081 | 3300035172 | Bacteria | 1437 |
| 484 | Ga0373955_0192633 | 3300035172 | Bacteria | 1212 |
| 485 | Ga0373955_0381978 | 3300035172 | Bacteria | 855 |
| 486 | Ga0373942_0025500 | 3300035207 | Bacteria | 1525 |
| 487 | Ga0373961_0023631 | 3300035241 | Bacteria | 1656 |
| 488 | Ga0373924_0003894 | 3300035410 | Bacteria | 5175 |
| 489 | Ga0373924_0103433 | 3300035410 | Bacteria | 1227 |
| 490 | Ga0373931_0015989 | 3300035691 | Bacteria | 3687 |
| 491 | Ga0373931_0395554 | 3300035691 | Bacteria | 874 |
| 492 | Ga0373935_0000595 | 3300035692 | Bacteria | 18877 |
| 493 | Ga0373935_0012443 | 3300035692 | Bacteria | 5118 |
| 494 | Ga0373935_0053467 | 3300035692 | Bacteria | 2569 |
| 495 | Ga0373927_0001021 | 3300035695 | Bacteria | 21303 |
| 496 | Ga0373927_0036138 | 3300035695 | Bacteria | 3213 |
| 497 | Ga0373927_0217715 | 3300035695 | Bacteria | 1254 |
| 498 | Ga0373927_0267405 | 3300035695 | Bacteria | 1124 |
| 499 | Ga0373933_0001113 | 3300035724 | Bacteria | 16004 |
| 500 | Ga0373933_0010410 | 3300035724 | Bacteria | 5098 |
| 501 | Ga0373933_0339803 | 3300035724 | Bacteria | 975 |
| 502 | Ga0373947_0000970 | 3300035725 | Bacteria | 17506 |
| 503 | Ga0373937_0095132 | 3300036401 | Bacteria | 2762 |
| 504 | Ga0373925_0006983 | 3300037068 | Bacteria | 8255 |
| 505 | Ga0373925_0027554 | 3300037068 | Bacteria | 4158 |
| 506 | Ga0373925_0253367 | 3300037068 | Bacteria | 1412 |
| 507 | Ga0395900_0055668 | 3300037418 | Bacteria | 4073 |
| 508 | Ga0395900_0650153 | 3300037418 | Bacteria | 991 |
| 509 | Ga0395898_0010317 | 3300037466 | Bacteria | 9773 |
| 510 | Ga0395898_0251530 | 3300037466 | Bacteria | 1685 |
| 511 | Ga0395905_0019136 | 3300037471 | Bacteria | 6495 |
| 512 | Ga0395905_0109230 | 3300037471 | Bacteria | 2597 |
| 513 | Ga0436364_0738152 | 3300037853 | Bacteria | 2964 |
| 514 | Ga0436364_0984470 | 3300037853 | Bacteria | 2585 |
| 515 | Ga0395901_0035089 | 3300038443 | Bacteria | 5183 |
| 516 | Ga0395901_0039676 | 3300038443 | Bacteria | 4874 |
| 517 | Ga0436365_0265605 | 3300039437 | Bacteria | 1126 |
| 518 | Ga0436365_0303379 | 3300039437 | Bacteria | 847 |
| 519 | Ga0436365_0411209 | 3300039437 | Bacteria | 10910 |
| 520 | Ga0436361_0532765 | 3300039447 | Bacteria | 985 |
| 521 | Ga0436363_1287774 | 3300039450 | Bacteria | 1847 |
| 522 | Ga0436362_1005505 | 3300039453 | Bacteria | 3174 |
| 523 | Ga0466969_0141349 | 3300044656 | Bacteria | 1112 |
| 524 | Ga0466969_0162377 | 3300044656 | Bacteria | 1026 |
| 525 | Ga0466972_0000306 | 3300044658 | Bacteria | 28921 |
| 526 | Ga0466972_0000804 | 3300044658 | Bacteria | 14929 |
| 527 | Ga0466972_0102091 | 3300044658 | Bacteria | 1357 |
| 528 | Ga0466972_0199137 | 3300044658 | Bacteria | 938 |
| 529 | Ga0466965_0161057 | 3300044683 | Bacteria | 1177 |
| 530 | Ga0466966_0007733 | 3300044684 | Bacteria | 7118 |
| 531 | Ga0466966_0043550 | 3300044684 | Bacteria | 2877 |
| 532 | Ga0466961_0000770 | 3300044693 | Bacteria | 20096 |
| 533 | Ga0466961_0391074 | 3300044693 | Bacteria | 844 |
| 534 | Ga0466964_0102741 | 3300044706 | Bacteria | 1262 |
| 535 | Ga0466964_0279370 | 3300044706 | Bacteria | 834 |
| 536 | Ga0466968_0028571 | 3300044735 | Bacteria | 2300 |
| 537 | Ga0466970_0117082 | 3300044765 | Bacteria | 1457 |
| 538 | Ga0466970_0218130 | 3300044765 | Bacteria | 1064 |
| 539 | Ga0466970_0222244 | 3300044765 | Bacteria | 1054 |
| 540 | Ga0466957_0228418 | 3300044842 | Bacteria | 1231 |
| 541 | Ga0466959_0003303 | 3300045049 | Bacteria | 10524 |
| 542 | Ga0466959_0047779 | 3300045049 | Bacteria | 3147 |
| 543 | Ga0466959_0317331 | 3300045049 | Bacteria | 1066 |
| 544 | Ga0466967_0006466 | 3300045976 | Bacteria | 8296 |
| 545 | Ga0466967_0259799 | 3300045976 | Bacteria | 1661 |
| 546 | Ga0495592_0013035 | 3300046454 | Bacteria | 6326 |
| 547 | Ga0495592_0261505 | 3300046454 | Bacteria | 1140 |
| 548 | Ga0495603_0001390 | 3300046455 | Bacteria | 14060 |
| 549 | Ga0495603_0009344 | 3300046455 | Bacteria | 5927 |
| 550 | Ga0495603_0056638 | 3300046455 | Bacteria | 2320 |
| 551 | Ga0495603_0114465 | 3300046455 | Bacteria | 1573 |
| 552 | Ga0495629_0000915 | 3300046459 | Bacteria | 23696 |
| 553 | Ga0495629_0011323 | 3300046459 | Bacteria | 6479 |
| 554 | Ga0495629_0191547 | 3300046459 | Bacteria | 1415 |
| 555 | Ga0495629_0200420 | 3300046459 | Bacteria | 1380 |
| 556 | Ga0495629_0468573 | 3300046459 | Bacteria | 852 |
| 557 | Ga0495638_0000880 | 3300046460 | Bacteria | 30953 |
| 558 | Ga0495638_0053467 | 3300046460 | Bacteria | 2513 |
| 559 | Ga0495651_0043528 | 3300046462 | Bacteria | 3483 |
| 560 | Ga0495651_0060267 | 3300046462 | Bacteria | 2907 |
| 561 | Ga0495651_0154845 | 3300046462 | Bacteria | 1648 |
| 562 | Ga0495653_0009157 | 3300046463 | Bacteria | 8096 |
| 563 | Ga0495653_0118678 | 3300046463 | Bacteria | 1889 |
| 564 | Ga0495580_0001523 | 3300046472 | Bacteria | 20383 |
| 565 | Ga0495582_0000302 | 3300046473 | Bacteria | 27218 |
| 566 | Ga0495582_0111898 | 3300046473 | Bacteria | 1534 |
| 567 | Ga0495605_0175610 | 3300046474 | Bacteria | 944 |
| 568 | Ga0495605_0219528 | 3300046474 | Bacteria | 822 |
| 569 | Ga0495639_0001076 | 3300046475 | Bacteria | 12289 |
| 570 | Ga0495639_0116494 | 3300046475 | Bacteria | 1272 |
| 571 | Ga0495639_0161660 | 3300046475 | Bacteria | 1084 |
| 572 | Ga0495639_0223844 | 3300046475 | Bacteria | 925 |
| 573 | Ga0495662_0001265 | 3300046476 | Bacteria | 12489 |
| 574 | Ga0495662_0109893 | 3300046476 | Bacteria | 1351 |
| 575 | Ga0495664_0002747 | 3300046477 | Bacteria | 9463 |
| 576 | Ga0495664_0107226 | 3300046477 | Bacteria | 1685 |
| 577 | Ga0495584_0089326 | 3300046491 | Bacteria | 1553 |
| 578 | Ga0495584_0133506 | 3300046491 | Bacteria | 1260 |
| 579 | Ga0495585_0032041 | 3300046492 | Bacteria | 2980 |
| 580 | Ga0495585_0194995 | 3300046492 | Bacteria | 1034 |
| 581 | Ga0495585_0242057 | 3300046492 | Bacteria | 903 |
| 582 | Ga0495594_0000046 | 3300046499 | Bacteria | 53822 |
| 583 | Ga0495594_0142731 | 3300046499 | Bacteria | 1358 |
| 584 | Ga0495596_0059215 | 3300046500 | Bacteria | 1493 |
| 585 | Ga0495596_0163646 | 3300046500 | Bacteria | 865 |
| 586 | Ga0495607_0041012 | 3300046501 | Bacteria | 2752 |
| 587 | Ga0495606_0149603 | 3300046507 | Bacteria | 1371 |
| 588 | Ga0495608_0023287 | 3300046511 | Bacteria | 4246 |
| 589 | Ga0495610_0056579 | 3300046512 | Bacteria | 1885 |
| 590 | Ga0495616_0185930 | 3300046513 | Bacteria | 921 |
| 591 | Ga0495618_0034111 | 3300046514 | Bacteria | 3190 |
| 592 | Ga0495618_0470320 | 3300046514 | Bacteria | 761 |
| 593 | Ga0495628_0016164 | 3300046516 | Bacteria | 6226 |
| 594 | Ga0495628_0056134 | 3300046516 | Bacteria | 3101 |
| 595 | Ga0495628_0066292 | 3300046516 | Bacteria | 2822 |
| 596 | Ga0495630_0010764 | 3300046517 | Bacteria | 6605 |
| 597 | Ga0495631_0110500 | 3300046518 | Bacteria | 1182 |
| 598 | Ga0495631_0191522 | 3300046518 | Bacteria | 875 |
| 599 | Ga0495631_0242572 | 3300046518 | Bacteria | 768 |
| 600 | Ga0495632_0138315 | 3300046519 | Bacteria | 1131 |
| 601 | Ga0495637_0065561 | 3300046520 | Bacteria | 1478 |
| 602 | Ga0495637_0138050 | 3300046520 | Bacteria | 927 |
| 603 | Ga0495637_0140372 | 3300046520 | Bacteria | 917 |
| 604 | Ga0495644_0032974 | 3300046523 | Bacteria | 1957 |
| 605 | Ga0495644_0090753 | 3300046523 | Bacteria | 1153 |
| 606 | Ga0495648_0174313 | 3300046524 | Bacteria | 1099 |
| 607 | Ga0495648_0252318 | 3300046524 | Bacteria | 851 |
| 608 | Ga0495663_0142196 | 3300046525 | Bacteria | 815 |
| 609 | Ga0495666_0251170 | 3300046526 | Bacteria | 806 |
| 610 | Ga0495652_0045047 | 3300046529 | Bacteria | 3796 |
| 611 | Ga0495652_0052089 | 3300046529 | Bacteria | 3492 |
| 612 | Ga0495652_0125031 | 3300046529 | Bacteria | 2045 |
| 613 | Ga0495665_0005462 | 3300046531 | Bacteria | 6846 |
| 614 | Ga0495665_0155252 | 3300046531 | Bacteria | 1194 |
| 615 | Ga0495640_0014808 | 3300046533 | Bacteria | 5889 |
| 616 | Ga0495640_0022664 | 3300046533 | Bacteria | 4586 |
| 617 | Ga0495640_0041763 | 3300046533 | Bacteria | 3203 |
| 618 | Ga0495640_0120391 | 3300046533 | Bacteria | 1707 |
| 619 | Ga0495586_0159932 | 3300046535 | Bacteria | 1270 |
| 620 | Ga0495587_0008424 | 3300046536 | Bacteria | 6630 |
| 621 | Ga0495587_0028223 | 3300046536 | Bacteria | 3413 |
| 622 | Ga0495598_0039336 | 3300046537 | Bacteria | 1374 |
| 623 | Ga0495598_0068940 | 3300046537 | Bacteria | 1109 |
| 624 | Ga0495598_0125482 | 3300046537 | Bacteria | 874 |
| 625 | Ga0495609_0161563 | 3300046538 | Bacteria | 949 |
| 626 | Ga0495621_0018725 | 3300046539 | Bacteria | 2252 |
| 627 | Ga0495645_0031433 | 3300046543 | Bacteria | 3869 |
| 628 | Ga0495645_0038894 | 3300046543 | Bacteria | 3469 |
| 629 | Ga0495622_0001947 | 3300046557 | Bacteria | 10142 |
| 630 | Ga0495622_0016887 | 3300046557 | Bacteria | 3397 |
| 631 | Ga0495622_0022475 | 3300046557 | Bacteria | 2939 |
| 632 | Ga0495622_0116846 | 3300046557 | Bacteria | 1219 |
| 633 | Ga0495622_0164627 | 3300046557 | Bacteria | 999 |
| 634 | Ga0495633_0023444 | 3300046558 | Bacteria | 3059 |
| 635 | Ga0495633_0103038 | 3300046558 | Bacteria | 1324 |
| 636 | Ga0495633_0236163 | 3300046558 | Bacteria | 835 |
| 637 | Ga0495667_0012267 | 3300046559 | Bacteria | 5808 |
| 638 | Ga0495667_0049672 | 3300046559 | Bacteria | 2769 |
| 639 | Ga0495656_0007484 | 3300046615 | Bacteria | 3858 |
| 640 | Ga0495656_0092460 | 3300046615 | Bacteria | 1385 |
| 641 | Ga0495656_0382859 | 3300046615 | Bacteria | 733 |
| 642 | Ga0495668_0063539 | 3300046616 | Bacteria | 2033 |
| 643 | Ga0495668_0377495 | 3300046616 | Bacteria | 778 |
| 644 | Ga0495634_0001329 | 3300046642 | Bacteria | 22513 |
| 645 | Ga0495634_0114644 | 3300046642 | Bacteria | 1730 |
| 646 | Ga0495611_0120632 | 3300046648 | Bacteria | 1222 |
| 647 | Ga0495625_0111727 | 3300046660 | Bacteria | 1867 |
| 648 | Ga0495625_0118440 | 3300046660 | Bacteria | 1804 |
| 649 | Ga0495635_0004154 | 3300046663 | Bacteria | 10044 |
| 650 | Ga0495635_0004822 | 3300046663 | Bacteria | 9377 |
| 651 | Ga0495635_0080087 | 3300046663 | Bacteria | 2235 |
| 652 | Ga0495659_0009582 | 3300046664 | Bacteria | 3095 |
| 653 | Ga0495659_0053327 | 3300046664 | Bacteria | 1477 |
| 654 | Ga0495661_0186151 | 3300046665 | Bacteria | 1097 |
| 655 | Ga0495588_0001920 | 3300046674 | Bacteria | 8877 |
| 656 | Ga0495657_0020270 | 3300046675 | Bacteria | 4783 |
| 657 | Ga0495657_0022368 | 3300046675 | Bacteria | 4529 |
| 658 | Ga0495657_0062078 | 3300046675 | Bacteria | 2470 |
| 659 | Ga0495657_0277491 | 3300046675 | Bacteria | 1004 |
| 660 | Ga0495599_0004544 | 3300046678 | Bacteria | 8230 |
| 661 | Ga0495623_0088438 | 3300046679 | Bacteria | 1907 |
| 662 | Ga0495647_0002160 | 3300046681 | Bacteria | 6146 |
| 663 | Ga0495658_0000201 | 3300046683 | Bacteria | 34784 |
| 664 | Ga0495669_0093505 | 3300046684 | Bacteria | 1390 |
| 665 | Ga0495613_0004521 | 3300046689 | Bacteria | 10429 |
| 666 | Ga0495613_0023990 | 3300046689 | Bacteria | 4544 |
| 667 | Ga0495613_0354347 | 3300046689 | Bacteria | 1007 |
| 668 | Ga0495624_0001903 | 3300046690 | Bacteria | 15891 |
| 669 | Ga0495624_0038534 | 3300046690 | Bacteria | 3070 |
| 670 | Ga0495624_0080169 | 3300046690 | Bacteria | 2023 |
| 671 | Ga0495624_0184126 | 3300046690 | Bacteria | 1272 |
| 672 | Ga0495624_0408186 | 3300046690 | Bacteria | 815 |
| 673 | Ga0495670_0062870 | 3300046691 | Bacteria | 1868 |
| 674 | Ga0495671_0266772 | 3300046692 | Bacteria | 825 |
| 675 | Ga0495589_0194388 | 3300046794 | Bacteria | 959 |
| 676 | Ga0495589_0200469 | 3300046794 | Bacteria | 942 |
| 677 | Ga0495600_0007343 | 3300046809 | Bacteria | 6735 |
| 678 | Ga0495600_0019156 | 3300046809 | Bacteria | 4366 |
| 679 | Ga0495600_0261955 | 3300046809 | Bacteria | 1098 |
| 680 | Ga0495581_0020918 | 3300047315 | Bacteria | 3796 |
| 681 | Ga0495581_0066978 | 3300047315 | Bacteria | 2076 |
| 682 | Ga0495581_0136213 | 3300047315 | Bacteria | 1431 |
| 683 | Ga0495604_0003808 | 3300047317 | Bacteria | 12011 |
| 684 | Ga0495604_0006226 | 3300047317 | Bacteria | 9469 |
| 685 | Ga0495604_0653718 | 3300047317 | Bacteria | 670 |
| 686 | Ga0495636_0019953 | 3300047318 | Bacteria | 2698 |
| 687 | Ga0495636_0169243 | 3300047318 | Bacteria | 987 |
| 688 | Ga0495674_0002494 | 3300047319 | Bacteria | 17944 |
| 689 | Ga0495674_0016347 | 3300047319 | Bacteria | 6919 |
| 690 | Ga0495672_0035732 | 3300047320 | Bacteria | 3058 |
| 691 | Ga0495672_0125167 | 3300047320 | Bacteria | 1360 |
| 692 | Ga0495672_0214234 | 3300047320 | Bacteria | 955 |
| 693 | Ga0495676_0021845 | 3300047321 | Bacteria | 5579 |
| 694 | Ga0495676_0083168 | 3300047321 | Bacteria | 2420 |
| 695 | Ga0495680_0177655 | 3300047322 | Bacteria | 1538 |
| 696 | Ga0495680_0215289 | 3300047322 | Bacteria | 1373 |
| 697 | Ga0495680_0341864 | 3300047322 | Bacteria | 1044 |
| 698 | Ga0495687_021924 | 3300047443 | Bacteria | 3077 |
| 699 | Ga0495675_0143259 | 3300047444 | Bacteria | 1480 |
| 700 | Ga0495677_0069234 | 3300047445 | Bacteria | 1314 |
| 701 | Ga0495677_0220675 | 3300047445 | Bacteria | 738 |
| 702 | Ga0495679_045734 | 3300047446 | Bacteria | 1336 |
| 703 | Ga0495685_035692 | 3300047447 | Bacteria | 1708 |
| 704 | Ga0495685_116384 | 3300047447 | Bacteria | 878 |
| 705 | Ga0495673_0022825 | 3300047469 | Bacteria | 3059 |
| 706 | Ga0495673_0054536 | 3300047469 | Bacteria | 1738 |
| 707 | Ga0495673_0203275 | 3300047469 | Bacteria | 740 |
| 708 | Ga0495684_0212105 | 3300047471 | Bacteria | 1423 |
| 709 | Ga0495686_0050099 | 3300047472 | Bacteria | 2625 |
| 710 | Ga0495686_0127757 | 3300047472 | Bacteria | 1510 |
| 711 | Ga0495686_0234882 | 3300047472 | Bacteria | 1037 |
| 712 | Ga0495686_0257824 | 3300047472 | Bacteria | 977 |
| 713 | Ga0495593_0000100 | 3300047673 | Bacteria | 39337 |
| 714 | Ga0495593_0039768 | 3300047673 | Bacteria | 2534 |
| 715 | Ga0495602_0031546 | 3300048088 | Bacteria | 5008 |
| 716 | Ga0495602_0040379 | 3300048088 | Bacteria | 4280 |
| 717 | Ga0495602_0074008 | 3300048088 | Bacteria | 2897 |
| 718 | Ga0495615_0119086 | 3300048090 | Bacteria | 762 |
| 719 | Ga0496100_0298392 | 3300048903 | Bacteria | 1205 |
| 720 | Ga0496100_0377035 | 3300048903 | Bacteria | 1077 |
| 721 | Ga0496101_0022763 | 3300048904 | Bacteria | 4318 |
| 722 | Ga0496101_0085366 | 3300048904 | Bacteria | 2339 |
| 723 | Ga0496101_0141721 | 3300048904 | Bacteria | 1832 |
| 724 | Ga0496101_0149908 | 3300048904 | Bacteria | 1783 |
| 725 | Ga0496101_0201161 | 3300048904 | Bacteria | 1540 |
| 726 | Ga0496101_0234098 | 3300048904 | Bacteria | 1428 |
| 727 | Ga0496101_0286600 | 3300048904 | Bacteria | 1288 |
| 728 | Ga0496101_0558465 | 3300048904 | Bacteria | 905 |
| 729 | Ga0496102_0076683 | 3300048905 | Bacteria | 3075 |
| 730 | Ga0496102_0079587 | 3300048905 | Bacteria | 3018 |
| 731 | Ga0496102_0097650 | 3300048905 | Bacteria | 2725 |
| 732 | Ga0496102_0235912 | 3300048905 | Bacteria | 1725 |
| 733 | Ga0496102_0304465 | 3300048905 | Bacteria | 1502 |
| 734 | Ga0496102_0400093 | 3300048905 | Bacteria | 1291 |
| 735 | Ga0496102_0402980 | 3300048905 | Bacteria | 1286 |
| 736 | Ga0496102_0459300 | 3300048905 | Bacteria | 1194 |
| 737 | Ga0496102_0505779 | 3300048905 | Bacteria | 1130 |
| 738 | Ga0496102_0612993 | 3300048905 | Bacteria | 1011 |
| 739 | Ga0496102_0789037 | 3300048905 | Bacteria | 872 |
| 740 | Ga0496103_0049170 | 3300048906 | Bacteria | 2607 |
| 741 | Ga0496103_0174853 | 3300048906 | Bacteria | 1379 |
| 742 | Ga0496103_0248391 | 3300048906 | Bacteria | 1145 |
| 743 | Ga0496104_0002017 | 3300048907 | Bacteria | 17626 |
| 744 | Ga0496104_0013397 | 3300048907 | Bacteria | 7388 |
| 745 | Ga0496104_0178357 | 3300048907 | Bacteria | 2034 |
| 746 | Ga0496105_0014164 | 3300048908 | Bacteria | 6345 |
| 747 | Ga0496105_0158786 | 3300048908 | Bacteria | 1856 |
| 748 | Ga0496105_0211572 | 3300048908 | Bacteria | 1580 |
| 749 | Ga0496105_0451779 | 3300048908 | Bacteria | 1014 |
| 750 | Ga0496106_0110392 | 3300048909 | Bacteria | 2141 |
| 751 | Ga0496106_0243799 | 3300048909 | Bacteria | 1436 |
| 752 | Ga0496106_0306063 | 3300048909 | Bacteria | 1275 |
| 753 | Ga0496106_0412024 | 3300048909 | Bacteria | 1086 |
| 754 | Ga0496107_0029068 | 3300048910 | Bacteria | 3930 |
| 755 | Ga0496107_0352377 | 3300048910 | Bacteria | 1095 |
| 756 | Ga0496107_0385605 | 3300048910 | Bacteria | 1042 |
| 757 | Ga0496107_0401019 | 3300048910 | Bacteria | 1020 |
| 758 | Ga0496107_0769059 | 3300048910 | Bacteria | 706 |
| 759 | Ga0496108_0059860 | 3300048911 | Bacteria | 3203 |
| 760 | Ga0496108_0067424 | 3300048911 | Bacteria | 3018 |
| 761 | Ga0496108_0134973 | 3300048911 | Bacteria | 2122 |
| 762 | Ga0496108_0476619 | 3300048911 | Bacteria | 1090 |
| 763 | Ga0496108_0749374 | 3300048911 | Bacteria | 845 |
| 764 | Ga0496109_0168973 | 3300048912 | Bacteria | 2051 |
| 765 | Ga0496109_0273274 | 3300048912 | Bacteria | 1592 |
| 766 | Ga0496109_0354752 | 3300048912 | Bacteria | 1385 |
| 767 | Ga0496109_0480950 | 3300048912 | Bacteria | 1172 |
| 768 | Ga0496109_0657988 | 3300048912 | Bacteria | 985 |
| 769 | Ga0496109_0810174 | 3300048912 | Bacteria | 874 |
| 770 | Ga0496110_0005974 | 3300048913 | Bacteria | 9585 |
| 771 | Ga0496110_0159198 | 3300048913 | Bacteria | 2046 |
| 772 | Ga0496110_0336989 | 3300048913 | Bacteria | 1374 |
| 773 | Ga0496110_0632832 | 3300048913 | Bacteria | 969 |
| 774 | Ga0496111_0046141 | 3300048914 | Bacteria | 3137 |
| 775 | Ga0496111_0090187 | 3300048914 | Bacteria | 2245 |
| 776 | Ga0496111_0165877 | 3300048914 | Bacteria | 1640 |
| 777 | Ga0496111_0268738 | 3300048914 | Bacteria | 1265 |
| 778 | Ga0496111_0472391 | 3300048914 | Bacteria | 924 |
| 779 | Ga0496112_0073684 | 3300048915 | Bacteria | 3375 |
| 780 | Ga0496112_0082564 | 3300048915 | Bacteria | 3178 |
| 781 | Ga0496112_0186977 | 3300048915 | Bacteria | 2034 |
| 782 | Ga0496112_0351266 | 3300048915 | Bacteria | 1417 |
| 783 | Ga0496113_0014545 | 3300048916 | Bacteria | 5372 |
| 784 | Ga0496113_0112818 | 3300048916 | Bacteria | 2118 |
| 785 | Ga0496113_0155196 | 3300048916 | Bacteria | 1807 |
| 786 | Ga0496113_0238292 | 3300048916 | Bacteria | 1451 |
| 787 | Ga0496113_0320899 | 3300048916 | Bacteria | 1241 |
| 788 | Ga0496113_0392864 | 3300048916 | Bacteria | 1113 |
| 789 | Ga0496113_0421495 | 3300048916 | Bacteria | 1072 |
| 790 | Ga0496114_0086672 | 3300048917 | Bacteria | 2654 |
| 791 | Ga0496114_0118976 | 3300048917 | Bacteria | 2270 |
| 792 | Ga0496114_0144087 | 3300048917 | Bacteria | 2064 |
| 793 | Ga0496114_0197224 | 3300048917 | Bacteria | 1762 |
| 794 | Ga0496114_0329999 | 3300048917 | Bacteria | 1349 |
| 795 | Ga0496115_0013622 | 3300048918 | Bacteria | 6153 |
| 796 | Ga0496116_0043611 | 3300048919 | Bacteria | 3054 |
| 797 | Ga0496116_0116134 | 3300048919 | Bacteria | 1560 |
| 798 | Ga0496116_0215041 | 3300048919 | Bacteria | 992 |
| 799 | Ga0496116_0260054 | 3300048919 | Bacteria | 857 |
| 800 | Ga0496117_0108922 | 3300048920 | Bacteria | 1731 |
| 801 | Ga0496118_0023553 | 3300048921 | Bacteria | 5344 |
| 802 | Ga0496118_0041055 | 3300048921 | Bacteria | 3669 |
| 803 | Ga0496118_0138648 | 3300048921 | Bacteria | 1547 |
| 804 | Ga0496118_0225317 | 3300048921 | Bacteria | 1087 |
| 805 | Ga0496119_0009198 | 3300048922 | Bacteria | 8528 |
| 806 | Ga0496119_0050219 | 3300048922 | Bacteria | 2572 |
| 807 | Ga0496119_0134725 | 3300048922 | Bacteria | 1341 |
| 808 | Ga0496120_0084242 | 3300048923 | Bacteria | 1714 |
| 809 | Ga0496121_0000278 | 3300048924 | Bacteria | 106838 |
| 810 | Ga0496121_0014972 | 3300048924 | Bacteria | 8168 |
| 811 | Ga0496121_0051540 | 3300048924 | Bacteria | 3465 |
| 812 | Ga0496121_0093467 | 3300048924 | Bacteria | 2341 |
| 813 | Ga0496121_0108562 | 3300048924 | Bacteria | 2122 |
| 814 | Ga0496121_0149826 | 3300048924 | Bacteria | 1718 |
| 815 | Ga0496121_0232637 | 3300048924 | Bacteria | 1289 |
| 816 | Ga0496121_0360565 | 3300048924 | Bacteria | 965 |
| 817 | Ga0496121_0395786 | 3300048924 | Bacteria | 906 |
| 818 | Ga0496122_0043096 | 3300048925 | Bacteria | 3540 |
| 819 | Ga0496122_0144868 | 3300048925 | Bacteria | 1478 |
| 820 | Ga0496123_0171852 | 3300048926 | Bacteria | 1142 |
| 821 | Ga0496124_0090250 | 3300048927 | Bacteria | 2500 |
| 822 | Ga0496124_0091231 | 3300048927 | Bacteria | 2483 |
| 823 | Ga0496124_0133286 | 3300048927 | Bacteria | 1971 |
| 824 | Ga0496124_0589564 | 3300048927 | Bacteria | 725 |
| 825 | Ga0496125_0045202 | 3300048928 | Bacteria | 3710 |
| 826 | Ga0496125_0057511 | 3300048928 | Bacteria | 3149 |
| 827 | Ga0496125_0114688 | 3300048928 | Bacteria | 1940 |
| 828 | Ga0496125_0120412 | 3300048928 | Bacteria | 1874 |
| 829 | Ga0496125_0142097 | 3300048928 | Bacteria | 1667 |
| 830 | Ga0496125_0158875 | 3300048928 | Bacteria | 1539 |
| 831 | Ga0496125_0283110 | 3300048928 | Bacteria | 1026 |
| 832 | Ga0496125_0370739 | 3300048928 | Bacteria | 847 |
| 833 | Ga0496126_0011733 | 3300048929 | Bacteria | 9026 |
| 834 | Ga0496126_0066932 | 3300048929 | Bacteria | 3211 |
| 835 | Ga0496126_0080549 | 3300048929 | Bacteria | 2881 |
| 836 | Ga0496126_0116623 | 3300048929 | Bacteria | 2320 |
| 837 | Ga0496126_0136354 | 3300048929 | Bacteria | 2117 |
| 838 | Ga0496126_0169065 | 3300048929 | Bacteria | 1864 |
| 839 | Ga0496126_0201356 | 3300048929 | Bacteria | 1681 |
| 840 | Ga0496126_0211854 | 3300048929 | Bacteria | 1631 |
| 841 | Ga0496126_0377561 | 3300048929 | Bacteria | 1154 |
| 842 | Ga0496126_0403285 | 3300048929 | Bacteria | 1108 |
| 843 | Ga0496126_0444539 | 3300048929 | Bacteria | 1044 |
| 844 | Ga0496126_0452777 | 3300048929 | Bacteria | 1033 |
| 845 | Ga0496126_0638625 | 3300048929 | Bacteria | 834 |
| 846 | Ga0501034_0047500 | 3300049571 | Bacteria | 4334 |
| 847 | Ga0501036_0134500 | 3300049572 | Bacteria | 2087 |
| 848 | Ga0501037_0250093 | 3300049573 | Bacteria | 1241 |
| 849 | Ga0501038_0082192 | 3300049574 | Bacteria | 2712 |
| 850 | Ga0501041_0063098 | 3300049577 | Bacteria | 2269 |
| 851 | Ga0501042_0285099 | 3300049578 | Bacteria | 1193 |
| 852 | Ga0501043_0027498 | 3300049579 | Bacteria | 4464 |
| 853 | Ga0501046_0005445 | 3300049580 | Bacteria | 11378 |
| 854 | Ga0501046_0342668 | 3300049580 | Bacteria | 1086 |
| 855 | Ga0501047_0023204 | 3300049581 | Bacteria | 5957 |
| 856 | Ga0501047_0179362 | 3300049581 | Bacteria | 1984 |
| 857 | Ga0501047_0348788 | 3300049581 | Bacteria | 1317 |
| 858 | Ga0501048_0080390 | 3300049582 | Bacteria | 2300 |
| 859 | Ga0501067_0453636 | 3300049583 | Bacteria | 716 |
| 860 | Ga0501068_0359019 | 3300049584 | Bacteria | 937 |
| 861 | Ga0501070_0019284 | 3300049586 | Bacteria | 5720 |
| 862 | Ga0501070_0732693 | 3300049586 | Bacteria | 780 |
| 863 | Ga0501074_0098293 | 3300049590 | Bacteria | 2095 |
| 864 | Ga0501077_0159734 | 3300049593 | Bacteria | 1431 |
| 865 | Ga0501080_0030696 | 3300049742 | Bacteria | 5007 |
| 866 | Ga0501080_0418865 | 3300049742 | Bacteria | 1203 |
| 867 | Ga0501081_0378528 | 3300049743 | Bacteria | 1046 |
| 868 | Ga0501035_0015880 | 3300049822 | Bacteria | 6948 |
| 869 | Ga0501035_0177012 | 3300049822 | Bacteria | 1839 |
| 870 | Ga0501044_0022135 | 3300049823 | Bacteria | 6777 |
| 871 | nmdc:mga03n38_254487_c1 | 3300050490 | Bacteria | 929 |
| 872 | nmdc:mga03n38_2806_c1 | 3300050490 | Bacteria | 5474 |
| 873 | nmdc:mga03n38_31131_c1 | 3300050490 | Bacteria | 2249 |
| 874 | nmdc:mga03n38_473151_c1 | 3300050490 | Bacteria | 700 |
| 875 | nmdc:mga00v17_139434_c1 | 3300050491 | Bacteria | 1554 |
| 876 | nmdc:mga00v17_70950_c1 | 3300050491 | Bacteria | 2159 |
| 877 | nmdc:mga00v17_85010_c1 | 3300050491 | Bacteria | 1981 |
| 878 | nmdc:mga0yw44_111959_c1 | 3300050492 | Bacteria | 1750 |
| 879 | nmdc:mga0yw44_122028_c1 | 3300050492 | Bacteria | 1679 |
| 880 | nmdc:mga0yw44_62839_c1 | 3300050492 | Bacteria | 2282 |
| 881 | nmdc:mga0yw44_75349_c1 | 3300050492 | Bacteria | 2104 |
| 882 | nmdc:mga0yw44_86056_c1 | 3300050492 | Bacteria | 1979 |
| 883 | nmdc:mga0k408_146577_c1 | 3300050493 | Bacteria | 1405 |
| 884 | nmdc:mga0k408_37421_c1 | 3300050493 | Bacteria | 2026 |
| 885 | nmdc:mga0k408_44479_c1 | 3300050493 | Bacteria | 2561 |
| 886 | nmdc:mga0k408_56176_c1 | 3300050493 | Bacteria | 2284 |
| 887 | nmdc:mga06z11_165622_c1 | 3300050494 | Bacteria | 1266 |
| 888 | nmdc:mga06z11_69619_c1 | 3300050494 | Bacteria | 1858 |
| 889 | nmdc:mga07m45_121951_c1 | 3300050496 | Bacteria | 1506 |
| 890 | nmdc:mga07m45_134725_c1 | 3300050496 | Bacteria | 1430 |
| 891 | nmdc:mga07m45_247737_c1 | 3300050496 | Bacteria | 1037 |
| 892 | nmdc:mga07m45_344647_c1 | 3300050496 | Bacteria | 866 |
| 893 | nmdc:mga07m45_40313_c1 | 3300050496 | Bacteria | 1917 |
| 894 | nmdc:mga05p37_690309_c1 | 3300050507 | Bacteria | 1136 |
| 895 | nmdc:mga0qj67_540059_c1 | 3300050509 | Bacteria | 935 |
| 896 | nmdc:mga08y16_272165_c1 | 3300050511 | Bacteria | 1748 |
| 897 | nmdc:mga08y16_47004_c1 | 3300050511 | Bacteria | 4518 |
| 898 | nmdc:mga0sz30_113233_c1 | 3300050516 | Bacteria | 1190 |
| 899 | nmdc:mga0sz30_165944_c1 | 3300050516 | Bacteria | 979 |
| 900 | nmdc:mga0sz30_22699_c2 | 3300050516 | Bacteria | 1389 |
| 901 | nmdc:mga0sz30_23280_c1 | 3300050516 | Bacteria | 2519 |
| 902 | nmdc:mga0sz30_9134_c1 | 3300050516 | Bacteria | 3762 |
| 903 | Ga0495601_0054935 | 3300053077 | Bacteria | 2520 |
| 904 | Ga0495601_0116784 | 3300053077 | Bacteria | 1731 |
| 905 | Ga0495612_0004894 | 3300053078 | Bacteria | 5541 |
| 906 | Ga0500635_0009760 | 3300053080 | Bacteria | 2674 |
| 907 | Ga0495655_0040839 | 3300053083 | Bacteria | 1183 |
| 908 | Ga0495655_0106885 | 3300053083 | Bacteria | 836 |
| 909 | Ga0495595_0026720 | 3300053084 | Bacteria | 2566 |
| 910 | Ga0495619_0073994 | 3300053085 | Bacteria | 2284 |
| 911 | Ga0495619_0086732 | 3300053085 | Bacteria | 2116 |
| 912 | Ga0495619_0215566 | 3300053085 | Bacteria | 1329 |
| 913 | Ga0500643_000112 | 3300053087 | Bacteria | 84793 |
| 914 | Ga0500646_0023576 | 3300053090 | Bacteria | 1651 |
| 915 | Ga0500646_0052009 | 3300053090 | Bacteria | 1184 |
| 916 | Ga0500566_0004025 | 3300053094 | Bacteria | 8766 |
| 917 | Ga0500566_0008103 | 3300053094 | Bacteria | 6218 |
| 918 | Ga0500566_0115556 | 3300053094 | Bacteria | 1453 |
| 919 | Ga0500641_0014043 | 3300053096 | Bacteria | 2949 |
| 920 | Ga0500641_0094828 | 3300053096 | Bacteria | 1276 |
| 921 | Ga0500641_0156095 | 3300053096 | Bacteria | 984 |
| 922 | Ga0500555_001746 | 3300053103 | Bacteria | 6507 |
| 923 | Ga0500557_000021 | 3300053105 | Bacteria | 89662 |
| 924 | Ga0500569_002081 | 3300053109 | Bacteria | 3896 |
| 925 | Ga0500572_000229 | 3300053111 | Bacteria | 19843 |
| 926 | Ga0500572_003273 | 3300053111 | Bacteria | 3731 |
| 927 | Ga0500572_008536 | 3300053111 | Bacteria | 2399 |
| 928 | Ga0500594_0013322 | 3300053118 | Bacteria | 1953 |
| 929 | Ga0500595_001023 | 3300053119 | Bacteria | 15679 |
| 930 | Ga0500595_006104 | 3300053119 | Bacteria | 5165 |
| 931 | Ga0500595_006755 | 3300053119 | Bacteria | 4837 |
| 932 | Ga0500595_090448 | 3300053119 | Bacteria | 886 |
| 933 | Ga0500595_096598 | 3300053119 | Bacteria | 850 |
| 934 | Ga0500597_164821 | 3300053120 | Bacteria | 947 |
| 935 | Ga0500614_016618 | 3300053123 | Bacteria | 1653 |
| 936 | Ga0500618_022118 | 3300053125 | Bacteria | 1547 |
| 937 | Ga0500642_0000583 | 3300053130 | Bacteria | 10905 |
| 938 | Ga0500642_0032521 | 3300053130 | Bacteria | 2189 |
| 939 | Ga0500652_151432 | 3300053131 | Bacteria | 962 |
| 940 | Ga0500559_0000186 | 3300053136 | Bacteria | 49470 |
| 941 | Ga0500559_0126183 | 3300053136 | Bacteria | 1193 |
| 942 | Ga0500568_0002888 | 3300053139 | Bacteria | 9874 |
| 943 | Ga0500568_0076134 | 3300053139 | Bacteria | 1278 |
| 944 | Ga0500577_0065965 | 3300053142 | Bacteria | 1406 |
| 945 | Ga0500588_0071073 | 3300053146 | Bacteria | 1141 |
| 946 | Ga0500589_015685 | 3300053147 | Bacteria | 3384 |
| 947 | Ga0500604_0027468 | 3300053151 | Bacteria | 1646 |
| 948 | Ga0500604_0101196 | 3300053151 | Bacteria | 950 |
| 949 | Ga0500616_0006228 | 3300053153 | Bacteria | 7873 |
| 950 | Ga0500622_0026195 | 3300053156 | Bacteria | 3079 |
| 951 | Ga0500624_005276 | 3300053157 | Bacteria | 1716 |
| 952 | Ga0500627_0038300 | 3300053158 | Bacteria | 2049 |
| 953 | Ga0500633_0003710 | 3300053160 | Bacteria | 3381 |
| 954 | Ga0500634_0059643 | 3300053161 | Bacteria | 2028 |
| 955 | Ga0500638_002757 | 3300053162 | Bacteria | 6258 |
| 956 | Ga0500638_089970 | 3300053162 | Bacteria | 1446 |
| 957 | Ga0500639_049971 | 3300053163 | Bacteria | 2180 |
| 958 | Ga0500636_0004022 | 3300053177 | Bacteria | 8292 |
| 959 | Ga0500636_0028340 | 3300053177 | Bacteria | 3308 |
| 960 | Ga0500637_0022159 | 3300053178 | Bacteria | 3458 |
| 961 | Ga0500576_021939 | 3300053725 | Bacteria | 2915 |
| 962 | Ga0500657_042091 | 3300053728 | Bacteria | 2118 |
| 963 | Ga0500625_025664 | 3300053729 | Bacteria | 2787 |
| 964 | Ga0500645_025711 | 3300053730 | Bacteria | 1795 |
| 965 | Ga0500609_016525 | 3300053731 | Bacteria | 1001 |
| 966 | Ga0500596_003902 | 3300053735 | Bacteria | 2788 |
| 967 | Ga0500599_000328 | 3300053736 | Bacteria | 4677 |
| 968 | Ga0500661_001755 | 3300055283 | Bacteria | 4086 |
| 969 | Ga0500661_026424 | 3300055283 | Bacteria | 1025 |
| 970 | 2507505473 | 2507262055 | Bacteria | 8048963 |
| 971 | 2508539358 | 2508501009 | Bacteria | 7784016 |
| 972 | 2508695688 | 2508501042 | Bacteria | 8719808 |
| 973 | 2511397796 | 2511231028 | Bacteria | 8046582 |
| 974 | 2513623902 | 2513237092 | Bacteria | 8341956 |
| 975 | 2513642216 | 2513237094 | Bacteria | 8789602 |
| 976 | 2513651310 | 2513237095 | Bacteria | 8976980 |
| 977 | 2513703484 | 2513237102 | Bacteria | 7703324 |
| 978 | 2513873323 | 2513237139 | Bacteria | 8737671 |
| 979 | 2513888556 | 2513237141 | Bacteria | 8496279 |
| 980 | 2514014653 | 2513237161 | Bacteria | 8871253 |
| 981 | 2515627670 | 2515154112 | Bacteria | 8294334 |
| 982 | 2517106255 | 2517093001 | Bacteria | 9002274 |
| 983 | 2524441465 | 2524023205 | Bacteria | 8918781 |
| 984 | 2524467202 | 2524023210 | Bacteria | 9029266 |
| 985 | 2528852707 | 2528768022 | Bacteria | 10457665 |
| 986 | 2617352036 | 2617270735 | Bacteria | 9163226 |
| 987 | 2617373506 | 2617270741 | Bacteria | 8201522 |
| 988 | 2745077599 | 2744054633 | Bacteria | 8678936 |
| 989 | 2793062261 | 2791355196 | Bacteria | 7323613 |
| 990 | 2805920671 | 2802429603 | Bacteria | 8777136 |
| 991 | 2818237880 | 2816332527 | Bacteria | 8933356 |
| 992 | 2824604399 | 2824600985 | Bacteria | 8488197 |
| 993 | 2824614871 | 2824609381 | Bacteria | 8672835 |
| 994 | 2824624187 | 2824617872 | Bacteria | 8814715 |
| 995 | 2824632867 | 2824626560 | Bacteria | 8813858 |
| 996 | 2824641394 | 2824635225 | Bacteria | 8785348 |
| 997 | 2824652574 | 2824644064 | Bacteria | 8743947 |
| 998 | 2824656317 | 2824653114 | Bacteria | 8493680 |
| 999 | 2824667270 | 2824661429 | Bacteria | 9877870 |
| 1000 | 2824671773 | 2824671348 | Bacteria | 8369588 |
| 1001 | 2824684715 | 2824679649 | Bacteria | 8248951 |
| 1002 | 2824688545 | 2824687955 | Bacteria | 8360029 |
| 1003 | 2824701683 | 2824696289 | Bacteria | 8335049 |
| 1004 | 2824718456 | 2824714736 | Bacteria | 8717648 |
| 1005 | 2824728837 | 2824723954 | Bacteria | 8758240 |
| 1006 | 2824737641 | 2824732956 | Bacteria | 7810675 |
| 1007 | 2824751163 | 2824746037 | Bacteria | 7911610 |
| 1008 | 2824779969 | 2824773399 | Bacteria | 8360218 |
| 1009 | 2838124723 | 2838122688 | Bacteria | 8803140 |
| 1010 | 2841945414 | 2841941048 | Bacteria | 8688029 |
| 1011 | 2841952200 | 2841949485 | Bacteria | 8680857 |
| 1012 | 2841965322 | 2841957949 | Bacteria | 8652217 |
| 1013 | 2841970410 | 2841966195 | Bacteria | 8673214 |
| 1014 | 2841981661 | 2841974524 | Bacteria | 8931498 |
| 1015 | 2841984941 | 2841983080 | Bacteria | 8395090 |
| 1016 | 2842043296 | 2842038055 | Bacteria | 8002051 |
| 1017 | 2842052714 | 2842045827 | Bacteria | 8006841 |
| 1018 | 2844315569 | 2844315083 | Bacteria | 8138177 |
| 1019 | 2847942365 | 2847939898 | Bacteria | 8606328 |
| 1020 | 2849083237 | 2849076700 | Bacteria | 7039503 |
| 1021 | 2857516329 | 2857509624 | Bacteria | 7472071 |
| 1022 | 2874592524 | 2874590934 | Bacteria | 8299676 |
| 1023 | 2874618666 | 2874612657 | Bacteria | 8252029 |
| 1024 | 2874621178 | 2874620515 | Bacteria | 8290088 |
| 1025 | 2874628578 | 2874628541 | Bacteria | 8630250 |
| 1026 | 2874647143 | 2874645413 | Bacteria | 8214782 |
| 1027 | 2876769667 | 2876761206 | Bacteria | 10111113 |
| 1028 | 2876772527 | 2876771140 | Bacteria | 8287509 |
| 1029 | 2876819788 | 2876818435 | Bacteria | 8274608 |
| 1030 | 2879076294 | 2879074833 | Bacteria | 8279565 |
| 1031 | 2879083794 | 2879083081 | Bacteria | 8587928 |
| 1032 | 2879101968 | 2879099564 | Bacteria | 10442239 |
| 1033 | 2879128778 | 2879127579 | Bacteria | 8294491 |
| 1034 | 2879142906 | 2879142872 | Bacteria | 8267021 |
| 1035 | 2881368951 | 2881364244 | Bacteria | 7710352 |
| 1036 | 2885369312 | 2885366525 | Bacteria | 8326213 |
| 1037 | 2885417979 | 2885409591 | Bacteria | 9235467 |
| 1038 | 2888379377 | 2888378607 | Bacteria | 9652610 |
| 1039 | 2888390477 | 2888388044 | Bacteria | 7304136 |
| 1040 | 2888420098 | 2888419890 | Bacteria | 7857137 |
| 1041 | 2903733522 | 2903727486 | Bacteria | 8281579 |
| 1042 | 2903770572 | 2903768456 | Bacteria | 9749579 |
| 1043 | 2904667723 | 2904666416 | Bacteria | 8226587 |
| 1044 | 2904690981 | 2904690495 | Bacteria | 9412302 |
| 1045 | 2904708376 | |||
| 1046 | 2906608876 | 2906602504 | Bacteria | 8295279 |
| 1047 | 2906631697 | 2906626472 | Bacteria | 8826946 |
| 1048 | 2908757039 | 2908756301 | Bacteria | 8864324 |
| 1049 | 2908775977 | 2908775508 | Bacteria | 8092255 |
| 1050 | 2922369357 | |||
| 1051 | 2922396557 | 2922393267 | Bacteria | 8285685 |
| 1052 | 2929618811 | 2929615660 | Bacteria | 9193770 |
| 1053 | 2929628504 | 2929624759 | Bacteria | 9339455 |
| 1054 | 2932790989 | 2932784394 | Bacteria | 9704911 |
| 1055 | 2932794118 | 2932794094 | Bacteria | 7915132 |
| 1056 | 2932809193 | 2932801729 | Bacteria | 7987968 |
| 1057 | 2932816233 | 2932809354 | Bacteria | 9135765 |
| 1058 | 2932827640 | 2932818245 | Bacteria | 9955613 |
| 1059 | 2932833705 | 2932828146 | Bacteria | 9745859 |
| 1060 | 2933580479 | 2933577622 | Bacteria | 9116884 |
| 1061 | 2935615496 | 2935608549 | Bacteria | 8203142 |
| 1062 | 2935623231 | 2935616580 | Bacteria | 9032984 |
| 1063 | 2935644306 | 2935638405 | Bacteria | 10015038 |
| 1064 | 2935654425 | 2935648319 | Bacteria | 8801166 |
| 1065 | 2935663305 | 2935656913 | Bacteria | 8965014 |
| 1066 | 2935672112 | 2935665750 | Bacteria | 9571747 |
| 1067 | 2935679368 | 2935675223 | Bacteria | 9928132 |
| 1068 | 2935686610 | 2935684952 | Bacteria | 9590419 |
| 1069 | 2935700391 | 2935694250 | Bacteria | 9291695 |
| 1070 | 2935710339 | 2935703347 | Bacteria | 10242284 |
| 1071 | 2935716298 | 2935713505 | Bacteria | 9608509 |
| 1072 | 2935723578 | 2935722832 | Bacteria | 9608746 |
| 1073 | 2935735133 | 2935732158 | Bacteria | 9706831 |
| 1074 | 2935744076 | 2935741537 | Bacteria | 9707219 |
| 1075 | 2935752576 | 2935750917 | Bacteria | 9590372 |
| 1076 | 2935763291 | 2935760218 | Bacteria | 9817913 |
| 1077 | 2935774263 | 2935769743 | Bacteria | 7878163 |
| 1078 | 2935785127 | 2935777560 | Bacteria | 8077691 |
| 1079 | 2935789022 | 2935785616 | Bacteria | 7962367 |
| 1080 | 2935796772 | 2935793552 | Bacteria | 8012592 |
| 1081 | 2935808330 | 2935801545 | Bacteria | 9301974 |
| 1082 | 2935816055 | 2935810662 | Bacteria | 9401221 |
| 1083 | 2935825703 | 2935819856 | Bacteria | 8261050 |
| 1084 | 2935833450 | 2935827899 | Bacteria | 10038562 |
| 1085 | 2935845992 | 2935837841 | Bacteria | 9454360 |
| 1086 | 2935853467 | 2935847175 | Bacteria | 8228321 |
| 1087 | 2935861479 | 2935855204 | Bacteria | 9035059 |
| 1088 | 2935869598 | 2935864058 | Bacteria | 9784707 |
| 1089 | 2935879927 | 2935873716 | Bacteria | 9632195 |
| 1090 | 2935889145 | 2935883170 | Bacteria | 7964738 |
| 1091 | 2935915068 | 2935908558 | Bacteria | 8568796 |
| 1092 | 2935918916 | 2935916978 | Bacteria | 9113783 |
| 1093 | 2935931367 | 2935926038 | Bacteria | 8601059 |
| 1094 | 2935939964 | 2935934488 | Bacteria | 8602579 |
| 1095 | 2935947689 | 2935942939 | Bacteria | 8599779 |
| 1096 | 2935956460 | 2935951376 | Bacteria | 8602333 |
| 1097 | 2935966693 | 2935959822 | Bacteria | 7869783 |
| 1098 | 2935973254 | 2935967501 | Bacteria | 8603075 |
| 1099 | 2935980501 | 2935975950 | Bacteria | 8347125 |
| 1100 | 2935990148 | 2935984226 | Bacteria | 8302647 |
| 1101 | 2935997850 | 2935992306 | Bacteria | 9802711 |
| 1102 | 2936008885 | 2936002035 | Bacteria | 9362176 |
| 1103 | 2936017536 | 2936011229 | Bacteria | 8801034 |
| 1104 | 2936025963 | 2936019824 | Bacteria | 8804134 |
| 1105 | 2936034805 | 2936028420 | Bacteria | 8965941 |
| 1106 | 2936041061 | 2936037263 | Bacteria | 9446081 |
| 1107 | 2936052937 | 2936046547 | Bacteria | 8903709 |
| 1108 | 2936060204 | 2936055302 | Bacteria | 8785755 |
| 1109 | 2940558489 | 2940556831 | Bacteria | 9590747 |
| 1110 | 2941535319 | 2941531003 | Bacteria | 7653939 |
| 1111 | 2941547161 | 2941538514 | Bacteria | 9402094 |
| 1112 | 3005486650 | 3005483717 | Bacteria | 7877331 |
| 1113 | 3005508954 | 3005506211 | Bacteria | 6943378 |
| 1114 | 3005593269 | 3005587118 | Bacteria | 7794411 |
| 1115 | 3005595259 | 3005594810 | Bacteria | 8716512 |
| 1116 | 3005711205 | 3005710791 | Bacteria | 7622528 |
| 1117 | 3005718506 | 3005718088 | Bacteria | 8283608 |
| 1118 | 8006927272 | 8006926726 | Bacteria | 6749210 |
| 1119 | 8006935978 | 8006933436 | Bacteria | 10410654 |
| 1120 | 8016526354 | 8016522445 | Bacteria | 8156687 |
| 1121 | 8016557445 | 8016548790 | Bacteria | 8155074 |
| 1122 | 8016565800 | 8016557553 | Bacteria | 8154380 |
| 1123 | 8016569687 | 8016566248 | Bacteria | 8158151 |
| 1124 | 8016582293 | 8016575299 | Bacteria | 8154085 |
| 1125 | 8016586119 | 8016583857 | Bacteria | 10421953 |
| 1126 | 8016603403 | 8016595262 | Bacteria | 8149947 |
| 1127 | 8016606335 | 8016603502 | Bacteria | 8731218 |
| 1128 | 8016618243 | 8016613128 | Bacteria | 8794220 |
| 1129 | 8016635399 | 8016630954 | Bacteria | 9217207 |
| 1130 | 8017058673 | 8017057580 | Bacteria | 10023680 |
| 1131 | 8019531251 | 8019530166 | Bacteria | 8155624 |
| 1132 | 8019540301 | 8019538911 | Bacteria | 7872763 |
| 1133 | 8019549892 | 8019547302 | Bacteria | 7996444 |
| 1134 | 8019576985 | 8019576017 | Bacteria | 10049540 |
| 1135 | 8019595049 | 8019586578 | Bacteria | 10212056 |
| 1136 | 8019611816 | 8019608314 | Bacteria | 10042931 |
| 1137 | 8019623189 | 8019619141 | Bacteria | 9218857 |
| 1138 | 8019629908 | 8019629233 | Bacteria | 8687553 |
| 1139 | 8019652257 | 8019648815 | Bacteria | 10014479 |
| 1140 | 8019676506 | 8019668869 | Bacteria | 8791617 |
| 1141 | 8019679488 | 8019678201 | Bacteria | 8863603 |
| 1142 | 8019696024 | 8019687851 | Bacteria | 8712826 |
| 1143 | 8055742660 | 8055742211 | Bacteria | 9226248 |
| 1144 | 8056682967 | 8056681323 | Bacteria | 8472857 |
| 1145 | Ga0373923_0035595 | |||
| 1146 | JGI25406J46586_10000364 | |||
| 1147 | JGI25153J46596_10008527 | |||
| 1148 | JGI25153J46596_10023803 | |||
| 1149 | JGI25160J50197_1005464 | |||
| 1150 | JGI25160J50197_1013128 | |||
| 1151 | JGI25160J50197_1017285 | |||
| 1152 | JGI25404J52841_10044352 | |||
| 1153 | Ga0055529_1012617 | |||
| 1154 | Ga0055543_1002453 | |||
| 1155 | Ga0065165_1018348 | |||
| 1156 | Ga0065165_1030140 | |||
| 1157 | Ga0070683_100504803 | |||
| 1158 | Ga0070690_100459413 | |||
| 1159 | Ga0070670_100949250 | |||
| 1160 | Ga0068869_100431957 | |||
| 1161 | Ga0070666_10142591 | |||
| 1162 | Ga0070666_10179745 | |||
| 1163 | Ga0070682_100115845 | |||
| 1164 | Ga0070682_100225491 | |||
| 1165 | Ga0068868_100271192 | |||
| 1166 | Ga0070660_100453970 | |||
| 1167 | Ga0070660_100759423 | |||
| 1168 | Ga0070689_100101308 | |||
| 1169 | Ga0070687_100155833 | |||
| 1170 | Ga0070661_100223677 | |||
| 1171 | Ga0070668_100179797 | |||
| 1172 | Ga0070669_100408239 | |||
| 1173 | Ga0070675_100209414 | |||
| 1174 | Ga0070675_100211310 | |||
| 1175 | Ga0070671_100319260 | |||
| 1176 | Ga0070671_100727714 | |||
| 1177 | Ga0070674_100057289 | |||
| 1178 | Ga0070674_100231012 | |||
| 1179 | Ga0070674_100352941 | |||
| 1180 | Ga0070674_100385310 | |||
| 1181 | Ga0070688_100494379 | |||
| 1182 | Ga0070659_100091579 | |||
| 1183 | Ga0070659_100164937 | |||
| 1184 | Ga0070659_100258130 | |||
| 1185 | Ga0070659_100449700 | |||
| 1186 | Ga0070667_100146017 | |||
| 1187 | Ga0070667_100241603 | |||
| 1188 | Ga0070714_100001570 | |||
| 1189 | Ga0070714_100015683 | |||
| 1190 | Ga0070714_100020448 | |||
| 1191 | Ga0070714_100725284 | |||
| 1192 | Ga0070713_100008285 | |||
| 1193 | Ga0070713_100081550 | |||
| 1194 | Ga0070713_100179686 | |||
| 1195 | Ga0070713_100213771 | |||
| 1196 | Ga0070710_10001859 | |||
| 1197 | Ga0070710_10085827 | |||
| 1198 | Ga0070711_100013892 | |||
| 1199 | Ga0070711_100121742 | |||
| 1200 | Ga0070711_100206529 | |||
| 1201 | Ga0070705_100148406 | |||
| 1202 | Ga0070663_100089391 | |||
| 1203 | Ga0070663_100093853 | |||
| 1204 | Ga0070663_100323687 | |||
| 1205 | Ga0070663_100376385 | |||
| 1206 | Ga0070663_100669300 | |||
| 1207 | Ga0070678_100333205 | |||
| 1208 | Ga0070681_10012682 | |||
| 1209 | Ga0070681_10014900 | |||
| 1210 | Ga0070681_10059272 | |||
| 1211 | Ga0068867_100667780 | |||
| 1212 | Ga0070685_10161771 | |||
| 1213 | Ga0070707_100026862 | |||
| 1214 | Ga0070698_100305874 | |||
| 1215 | Ga0070699_100160173 | |||
| 1216 | Ga0070679_100103628 | |||
| 1217 | Ga0070679_100174271 | |||
| 1218 | Ga0070684_100347298 | |||
| 1219 | Ga0068853_100010595 | |||
| 1220 | Ga0068853_100013156 | |||
| 1221 | Ga0068853_100113574 | |||
| 1222 | Ga0068853_100297217 | |||
| 1223 | Ga0070672_100092290 | |||
| 1224 | Ga0070672_100508765 | |||
| 1225 | Ga0070686_100123856 | |||
| 1226 | Ga0070686_100561180 | |||
| 1227 | Ga0070665_100092776 | |||
| 1228 | Ga0070665_100400513 | |||
| 1229 | Ga0070665_100414613 | |||
| 1230 | Ga0070665_101151804 | |||
| 1231 | Ga0068855_100023359 | |||
| 1232 | Ga0068855_100058220 | |||
| 1233 | Ga0068855_100101537 | |||
| 1234 | Ga0068855_100249162 | |||
| 1235 | Ga0068855_100495448 | |||
| 1236 | Ga0070664_100424039 | |||
| 1237 | Ga0070664_100792560 | |||
| 1238 | Ga0068857_100012785 | |||
| 1239 | Ga0068857_100062694 | |||
| 1240 | Ga0068857_100593569 | |||
| 1241 | Ga0068854_100280803 | |||
| 1242 | Ga0068856_100026080 | |||
| 1243 | Ga0068856_100256563 | |||
| 1244 | Ga0068856_100349331 | |||
| 1245 | Ga0070702_100150153 | |||
| 1246 | Ga0068852_100025281 | |||
| 1247 | Ga0068852_100247267 | |||
| 1248 | Ga0068852_100410545 | |||
| 1249 | Ga0068852_100579835 | |||
| 1250 | Ga0068859_100235253 | |||
| 1251 | Ga0068864_100067650 | |||
| 1252 | Ga0068864_100068559 | |||
| 1253 | Ga0068866_10096225 | |||
| 1254 | Ga0068861_100086139 | |||
| 1255 | Ga0068861_100262018 | |||
| 1256 | Ga0068861_100478497 | |||
| 1257 | Ga0068851_10041453 | |||
| 1258 | Ga0068870_10222774 | |||
| 1259 | Ga0068863_100047085 | |||
| 1260 | Ga0068863_100269322 | |||
| 1261 | Ga0068858_100169723 | |||
| 1262 | Ga0068858_100180795 | |||
| 1263 | Ga0068858_100218274 | |||
| 1264 | Ga0068860_100225901 | |||
| 1265 | Ga0068860_100359355 | |||
| 1266 | Ga0068860_100365935 | |||
| 1267 | Ga0068860_100482574 | |||
| 1268 | Ga0068860_100569843 | |||
| 1269 | Ga0068860_100617494 | |||
| 1270 | Ga0068862_100118329 | |||
| 1271 | Ga0068862_100521364 | |||
| 1272 | Ga0068862_100793073 | |||
| 1273 | Ga0081455_10027393 | |||
| 1274 | Ga0081455_10107291 | |||
| 1275 | Ga0081455_10109972 | |||
| 1276 | Ga0081455_10244865 | |||
| 1277 | Ga0081538_10040708 | |||
| 1278 | Ga0081540_1008955 | |||
| 1279 | Ga0081540_1023424 | |||
| 1280 | Ga0081540_1033253 | |||
| 1281 | Ga0081540_1038528 | |||
| 1282 | Ga0081540_1074886 | |||
| 1283 | Ga0081540_1084152 | |||
| 1284 | Ga0081539_10000048 | |||
| 1285 | Ga0081539_10036075 | |||
| 1286 | Ga0070717_10011435 | |||
| 1287 | Ga0070717_10012018 | |||
| 1288 | Ga0070717_10732534 | |||
| 1289 | Ga0075365_10196779 | |||
| 1290 | Ga0075365_10280147 | |||
| 1291 | Ga0075363_100002635 | |||
| 1292 | Ga0075363_100071771 | |||
| 1293 | Ga0075363_100142227 | |||
| 1294 | Ga0075363_100159479 | |||
| 1295 | Ga0075364_10043997 | |||
| 1296 | Ga0075364_10144848 | |||
| 1297 | Ga0070716_100001724 | |||
| 1298 | Ga0070716_100005301 | |||
| 1299 | Ga0070712_100002575 | |||
| 1300 | Ga0070712_100008167 | |||
| 1301 | Ga0070712_100018957 | |||
| 1302 | Ga0070712_100022704 | |||
| 1303 | Ga0070712_100048715 | |||
| 1304 | Ga0070712_100569961 | |||
| 1305 | Ga0075362_10048007 | |||
| 1306 | Ga0075362_10099154 | |||
| 1307 | Ga0075367_10076702 | |||
| 1308 | Ga0075367_10178837 | |||
| 1309 | Ga0075367_10278412 | |||
| 1310 | Ga0075369_10009532 | |||
| 1311 | Ga0075369_10069537 | |||
| 1312 | Ga0075369_10105043 | |||
| 1313 | Ga0075366_10040639 | |||
| 1314 | Ga0075366_10090039 | |||
| 1315 | Ga0075366_10259752 | |||
| 1316 | Ga0097621_100187595 | |||
| 1317 | Ga0075370_10053268 | |||
| 1318 | Ga0075370_10078556 | |||
| 1319 | Ga0075370_10221854 | |||
| 1320 | Ga0068871_100132076 | |||
| 1321 | Ga0068871_100196138 | |||
| 1322 | Ga0068871_100411789 | |||
| 1323 | Ga0075428_100778165 | |||
| 1324 | Ga0075434_100080096 | |||
| 1325 | Ga0075434_100572900 | |||
| 1326 | Ga0068865_100080664 | |||
| 1327 | Ga0068865_100209227 | |||
| 1328 | Ga0068865_100329938 | |||
| 1329 | Ga0068865_100621010 | |||
| 1330 | Ga0075436_100192108 | |||
| 1331 | Ga0097620_100235271 | |||
| 1332 | Ga0097620_100671719 | |||
| 1333 | Ga0099795_10006522 | |||
| 1334 | Ga0105240_10006144 | |||
| 1335 | Ga0105240_10026751 | |||
| 1336 | Ga0105240_10031683 | |||
| 1337 | Ga0105240_10204399 | |||
| 1338 | Ga0105240_10280515 | |||
| 1339 | Ga0111539_10685995 | |||
| 1340 | Ga0105245_10109815 | |||
| 1341 | Ga0114129_10225048 | |||
| 1342 | Ga0105243_10229080 | |||
| 1343 | Ga0105243_10253946 | |||
| 1344 | Ga0105241_10148686 | |||
| 1345 | Ga0105241_10374259 | |||
| 1346 | Ga0105242_10649739 | |||
| 1347 | Ga0105242_10777263 | |||
| 1348 | Ga0105248_10123069 | |||
| 1349 | Ga0105248_10869908 | |||
| 1350 | Ga0105237_10031550 | |||
| 1351 | Ga0105237_10283060 | |||
| 1352 | Ga0105237_10328722 | |||
| 1353 | Ga0105237_10645400 | |||
| 1354 | Ga0105237_10921115 | |||
| 1355 | Ga0105237_10926396 | |||
| 1356 | Ga0105238_10040832 | |||
| 1357 | Ga0105238_10198728 | |||
| 1358 | Ga0105238_10219633 | |||
| 1359 | Ga0105238_10351617 | |||
| 1360 | Ga0105238_10477278 | |||
| 1361 | Ga0105238_10546089 | |||
| 1362 | Ga0105249_10198830 | |||
| 1363 | Ga0105249_10312530 | |||
| 1364 | Ga0099796_10039157 | |||
| 1365 | Ga0105239_10022471 | |||
| 1366 | Ga0105239_10084117 | |||
| 1367 | Ga0105239_10090895 | |||
| 1368 | Ga0105239_10238920 | |||
| 1369 | Ga0105239_10252813 | |||
| 1370 | Ga0105239_10533040 | |||
| 1371 | Ga0105239_10602347 | |||
| 1372 | Ga0157370_10113104 | |||
| 1373 | Ga0157370_10557354 | |||
| 1374 | Ga0157369_10026404 | |||
| 1375 | Ga0157369_10046781 | |||
| 1376 | Ga0157374_10089923 | |||
| 1377 | Ga0157378_10002715 | |||
| 1378 | Ga0157378_10608512 | |||
| 1379 | Ga0163162_10127470 | |||
| 1380 | Ga0163162_10265281 | |||
| 1381 | Ga0163162_11530500 | |||
| 1382 | Ga0157372_10031372 | |||
| 1383 | Ga0157372_10545492 | |||
| 1384 | Ga0157375_10130145 | |||
| 1385 | Ga0157375_10231195 | |||
| 1386 | Ga0157375_10314222 | |||
| 1387 | Ga0157375_10632810 | |||
| 1388 | Ga0163163_10262185 | |||
| 1389 | Ga0163163_10329184 | |||
| 1390 | Ga0163163_10406084 | |||
| 1391 | Ga0163163_10430380 | |||
| 1392 | Ga0163163_10791603 | |||
| 1393 | Ga0163163_10839309 | |||
| 1394 | Ga0157380_11078668 | |||
| 1395 | Ga0157377_10250121 | |||
| 1396 | Ga0157379_10285083 | |||
| 1397 | Ga0157379_10439921 | |||
| 1398 | Ga0157379_10534279 | |||
| 1399 | Ga0157376_10604550 | |||
| 1400 | Ga0163161_10779974 | |||
| 1401 | Ga0213875_10056365 | |||
| 1402 | Ga0209563_105488 | |||
| 1403 | Ga0209677_101407 | |||
| 1404 | Ga0209148_1000418 | |||
| 1405 | Ga0209233_1006320 | |||
| 1406 | Ga0209233_1018369 | |||
| 1407 | Ga0209455_1002667 | |||
| 1408 | Ga0209130_1039697 | |||
| 1409 | Ga0209564_1004051 | |||
| 1410 | Ga0209564_1004930 | |||
| 1411 | Ga0209758_1000992 | |||
| 1412 | Ga0209758_1003988 | |||
| 1413 | Ga0209758_1006211 | |||
| 1414 | Ga0209758_1016088 | |||
| 1415 | Ga0209256_1014609 | |||
| 1416 | Ga0207426_1002389 | |||
| 1417 | Ga0207426_1002931 | |||
| 1418 | Ga0207426_1024113 | |||
| 1419 | Ga0209257_1010825 | |||
| 1420 | Ga0207697_10011788 | |||
| 1421 | Ga0207697_10110796 | |||
| 1422 | Ga0207656_10007112 | |||
| 1423 | Ga0207682_10071672 | |||
| 1424 | Ga0207692_10001084 | |||
| 1425 | Ga0207692_10020867 | |||
| 1426 | Ga0207692_10023041 | |||
| 1427 | Ga0207642_10137028 | |||
| 1428 | Ga0207710_10033533 | |||
| 1429 | Ga0207710_10144449 | |||
| 1430 | Ga0207688_10016201 | |||
| 1431 | Ga0207688_10215987 | |||
| 1432 | Ga0207680_10477429 | |||
| 1433 | Ga0207647_10012688 | |||
| 1434 | Ga0207685_10088793 | |||
| 1435 | Ga0207699_10000184 | |||
| 1436 | Ga0207643_10188074 | |||
| 1437 | Ga0207705_10031180 | |||
| 1438 | Ga0207654_10054988 | |||
| 1439 | Ga0207654_10089494 | |||
| 1440 | Ga0207654_10501923 | |||
| 1441 | Ga0207707_10001217 | |||
| 1442 | Ga0207707_10004329 | |||
| 1443 | Ga0207707_10012573 | |||
| 1444 | Ga0207707_10029874 | |||
| 1445 | Ga0207707_10275996 | |||
| 1446 | Ga0207695_10000148 | |||
| 1447 | Ga0207695_10010844 | |||
| 1448 | Ga0207695_10064739 | |||
| 1449 | Ga0207695_10100215 | |||
| 1450 | Ga0207695_10141903 | |||
| 1451 | Ga0207695_10256594 | |||
| 1452 | Ga0207671_10009621 | |||
| 1453 | Ga0207671_10069645 | |||
| 1454 | Ga0207693_10004934 | |||
| 1455 | Ga0207693_10006712 | |||
| 1456 | Ga0207693_10044439 | |||
| 1457 | Ga0207693_10318068 | |||
| 1458 | Ga0207693_10337130 | |||
| 1459 | Ga0207663_10000585 | |||
| 1460 | Ga0207663_10000680 | |||
| 1461 | Ga0207663_10009659 | |||
| 1462 | Ga0207663_10024585 | |||
| 1463 | Ga0207663_10051159 | |||
| 1464 | Ga0207660_10014328 | |||
| 1465 | Ga0207662_10269986 | |||
| 1466 | Ga0207657_10000700 | |||
| 1467 | Ga0207657_10305575 | |||
| 1468 | Ga0207649_10284126 | |||
| 1469 | Ga0207649_10389782 | |||
| 1470 | Ga0207652_10002661 | |||
| 1471 | Ga0207652_10007721 | |||
| 1472 | Ga0207652_10013904 | |||
| 1473 | Ga0207681_10147193 | |||
| 1474 | Ga0207694_10055995 | |||
| 1475 | Ga0207694_10102197 | |||
| 1476 | Ga0207694_10109141 | |||
| 1477 | Ga0207694_10396572 | |||
| 1478 | Ga0207650_10091363 | |||
| 1479 | Ga0207650_10812283 | |||
| 1480 | Ga0207687_10709527 | |||
| 1481 | Ga0207700_10015244 | |||
| 1482 | Ga0207700_10134873 | |||
| 1483 | Ga0207700_10146977 | |||
| 1484 | Ga0207700_10165427 | |||
| 1485 | Ga0207664_10003622 | |||
| 1486 | Ga0207664_10012251 | |||
| 1487 | Ga0207664_10068749 | |||
| 1488 | Ga0207664_10094211 | |||
| 1489 | Ga0207664_10532916 | |||
| 1490 | Ga0207644_10155611 | |||
| 1491 | Ga0207690_10046755 | |||
| 1492 | Ga0207706_10053577 | |||
| 1493 | Ga0207706_10161302 | |||
| 1494 | Ga0207706_10550892 | |||
| 1495 | Ga0207686_10564059 | |||
| 1496 | Ga0207686_10755804 | |||
| 1497 | Ga0207709_10017861 | |||
| 1498 | Ga0207709_10159778 | |||
| 1499 | Ga0207709_10341866 | |||
| 1500 | Ga0207669_10285598 | |||
| 1501 | Ga0207669_10365577 | |||
| 1502 | Ga0207704_10280309 | |||
| 1503 | Ga0207704_10445090 | |||
| 1504 | Ga0207704_10580008 | |||
| 1505 | Ga0207704_10582708 | |||
| 1506 | Ga0207665_10002484 | |||
| 1507 | Ga0207665_10007064 | |||
| 1508 | Ga0207665_10163728 | |||
| 1509 | Ga0207691_10479073 | |||
| 1510 | Ga0207711_10045483 | |||
| 1511 | Ga0207711_10913739 | |||
| 1512 | Ga0207689_10136965 | |||
| 1513 | Ga0207661_10001291 | |||
| 1514 | Ga0207661_10397557 | |||
| 1515 | Ga0207667_10001909 | |||
| 1516 | Ga0207667_10030060 | |||
| 1517 | Ga0207667_10237390 | |||
| 1518 | Ga0207667_10326029 | |||
| 1519 | Ga0207667_10407962 | |||
| 1520 | Ga0207667_10420887 | |||
| 1521 | Ga0207667_10448463 | |||
| 1522 | Ga0207712_10199502 | |||
| 1523 | Ga0207668_10051032 | |||
| 1524 | Ga0207668_10245744 | |||
| 1525 | Ga0207668_10506330 | |||
| 1526 | Ga0207640_10266437 | |||
| 1527 | Ga0207640_10308400 | |||
| 1528 | Ga0207640_10405229 | |||
| 1529 | Ga0207677_10100007 | |||
| 1530 | Ga0207703_10032875 | |||
| 1531 | Ga0207703_10164381 | |||
| 1532 | Ga0207703_10418455 | |||
| 1533 | Ga0207703_10447648 | |||
| 1534 | Ga0207639_10002676 | |||
| 1535 | Ga0207639_10042968 | |||
| 1536 | Ga0207639_10081860 | |||
| 1537 | Ga0207639_10274325 | |||
| 1538 | Ga0207678_10018564 | |||
| 1539 | Ga0207678_10044801 | |||
| 1540 | Ga0207708_10170608 | |||
| 1541 | Ga0207702_10000546 | |||
| 1542 | Ga0207702_10148445 | |||
| 1543 | Ga0207702_10185504 | |||
| 1544 | Ga0207702_10741297 | |||
| 1545 | Ga0207702_10885931 | |||
| 1546 | Ga0207641_10285304 | |||
| 1547 | Ga0207641_10333260 | |||
| 1548 | Ga0207648_10075157 | |||
| 1549 | Ga0207648_10120862 | |||
| 1550 | Ga0207648_10317421 | |||
| 1551 | Ga0207676_10352687 | |||
| 1552 | Ga0207676_10482211 | |||
| 1553 | Ga0207674_10028047 | |||
| 1554 | Ga0207674_10048764 | |||
| 1555 | Ga0207674_10530378 | |||
| 1556 | Ga0207675_100209834 | |||
| 1557 | Ga0207675_100622266 | |||
| 1558 | Ga0207683_10164315 | |||
| 1559 | Ga0207683_10168846 | |||
| 1560 | Ga0207698_10254092 | |||
| 1561 | Ga0209389_1000142 | |||
| 1562 | Ga0209589_1000331 | |||
| 1563 | Ga0209489_100818 | |||
| 1564 | Ga0209813_10010674 | |||
| 1565 | Ga0207428_10485609 | |||
| 1566 | Ga0268266_10001335 | |||
| 1567 | Ga0268266_10438309 | |||
| 1568 | Ga0268265_10512415 | |||
| 1569 | Ga0268265_10580303 | |||
| 1570 | Ga0268265_10807968 | |||
| 1571 | Ga0268265_11075820 | |||
| 1572 | Ga0268264_10191625 | |||
| 1573 | Ga0268264_10366852 | |||
| 1574 | Ga0268264_10579964 | |||
| 1575 | Ga0268264_10727049 | |||
| 1576 | Ga0307517_10000232 | |||
| 1577 | Ga0307517_10223864 | |||
| 1578 | Ga0307515_10157960 | |||
| 1579 | Ga0307511_10045310 | |||
| 1580 | Ga0265330_10105977 | |||
| 1581 | Ga0265325_10026243 | |||
| 1582 | Ga0265316_10048928 | |||
| 1583 | Ga0307513_10183023 | |||
| 1584 | Ga0307509_10038863 | |||
| 1585 | Ga0307509_10170593 | |||
| 1586 | Ga0307509_10372470 | |||
| 1587 | Ga0307508_10085301 | |||
| 1588 | Ga0265314_10021118 | |||
| 1589 | Ga0265314_10081447 | |||
| 1590 | Ga0265342_10017967 | |||
| 1591 | Ga0265342_10122093 | |||
| 1592 | Ga0307516_10011325 | |||
| 1593 | Ga0307516_10255965 | |||
| 1594 | Ga0307516_10365399 | |||
| 1595 | Ga0307405_10108057 | |||
| 1596 | Ga0307413_10026553 | |||
| 1597 | Ga0307406_10184148 | |||
| 1598 | Ga0307406_10260630 | |||
| 1599 | Ga0307406_10363163 | |||
| 1600 | Ga0307407_10266860 | |||
| 1601 | Ga0307412_10041444 | |||
| 1602 | Ga0307412_10281166 | |||
| 1603 | Ga0307409_100808243 | |||
| 1604 | Ga0307416_100542984 | |||
| 1605 | Ga0307414_10617857 | |||
| 1606 | Ga0307411_10052199 | |||
| 1607 | Ga0307411_10129259 | |||
| 1608 | Ga0307415_100258015 | |||
| 1609 | Ga0307415_100318916 | |||
| 1610 | Ga0307510_10010850 | |||
| 1611 | Ga0307510_10019009 | |||
| 1612 | Ga0307510_10101854 | |||
| 1613 | Ga0373926_0162609 | |||
| 1614 | Ga0373928_0069102 | |||
| 1615 | Ga0373928_0111700 | |||
| 1616 | Ga0373940_0108324 | |||
| 1617 | Ga0373936_0002293 | |||
| 1618 | Ga0373953_0008406 | |||
| 1619 | Ga0373954_0006447 | |||
| 1620 | Ga0373954_0074360 | |||
| 1621 | Ga0373956_0015957 | |||
| 1622 | Ga0373943_0229359 | |||
| 1623 | Ga0373943_0281041 | |||
| 1624 | Ga0373946_0012943 | |||
| 1625 | Ga0373946_0333097 | |||
| 1626 | Ga0373955_0008311 | |||
| 1627 | Ga0373955_0136081 | |||
| 1628 | Ga0373955_0192633 | |||
| 1629 | Ga0373955_0381978 | |||
| 1630 | Ga0373942_0025500 | |||
| 1631 | Ga0373961_0023631 | |||
| 1632 | Ga0373924_0003894 | |||
| 1633 | Ga0373924_0103433 | |||
| 1634 | Ga0373931_0015989 | |||
| 1635 | Ga0373931_0395554 | |||
| 1636 | Ga0373935_0000595 | |||
| 1637 | Ga0373935_0012443 | |||
| 1638 | Ga0373935_0053467 | |||
| 1639 | Ga0373927_0001021 | |||
| 1640 | Ga0373927_0036138 | |||
| 1641 | Ga0373927_0217715 | |||
| 1642 | Ga0373927_0267405 | |||
| 1643 | Ga0373933_0001113 | |||
| 1644 | Ga0373933_0010410 | |||
| 1645 | Ga0373933_0339803 | |||
| 1646 | Ga0373947_0000970 | |||
| 1647 | Ga0373937_0095132 | |||
| 1648 | Ga0373925_0006983 | |||
| 1649 | Ga0373925_0027554 | |||
| 1650 | Ga0373925_0253367 | |||
| 1651 | Ga0395900_0055668 | |||
| 1652 | Ga0395900_0650153 | |||
| 1653 | Ga0395898_0010317 | |||
| 1654 | Ga0395898_0251530 | |||
| 1655 | Ga0395905_0019136 | |||
| 1656 | Ga0395905_0109230 | |||
| 1657 | Ga0436364_0738152 | |||
| 1658 | Ga0436364_0984470 | |||
| 1659 | Ga0395901_0035089 | |||
| 1660 | Ga0395901_0039676 | |||
| 1661 | Ga0436365_0265605 | |||
| 1662 | Ga0436365_0303379 | |||
| 1663 | Ga0436365_0411209 | |||
| 1664 | Ga0436361_0532765 | |||
| 1665 | Ga0436363_1287774 | |||
| 1666 | Ga0436362_1005505 | |||
| 1667 | Ga0466969_0141349 | |||
| 1668 | Ga0466969_0162377 | |||
| 1669 | Ga0466972_0000306 | |||
| 1670 | Ga0466972_0000804 | |||
| 1671 | Ga0466972_0102091 | |||
| 1672 | Ga0466972_0199137 | |||
| 1673 | Ga0466965_0161057 | |||
| 1674 | Ga0466966_0007733 | |||
| 1675 | Ga0466966_0043550 | |||
| 1676 | Ga0466961_0000770 | |||
| 1677 | Ga0466961_0391074 | |||
| 1678 | Ga0466964_0102741 | |||
| 1679 | Ga0466964_0279370 | |||
| 1680 | Ga0466968_0028571 | |||
| 1681 | Ga0466970_0117082 | |||
| 1682 | Ga0466970_0218130 | |||
| 1683 | Ga0466970_0222244 | |||
| 1684 | Ga0466957_0228418 | |||
| 1685 | Ga0466959_0003303 | |||
| 1686 | Ga0466959_0047779 | |||
| 1687 | Ga0466959_0317331 | |||
| 1688 | Ga0466967_0006466 | |||
| 1689 | Ga0466967_0259799 | |||
| 1690 | Ga0495592_0013035 | |||
| 1691 | Ga0495592_0261505 | |||
| 1692 | Ga0495603_0001390 | |||
| 1693 | Ga0495603_0009344 | |||
| 1694 | Ga0495603_0056638 | |||
| 1695 | Ga0495603_0114465 | |||
| 1696 | Ga0495629_0000915 | |||
| 1697 | Ga0495629_0011323 | |||
| 1698 | Ga0495629_0191547 | |||
| 1699 | Ga0495629_0200420 | |||
| 1700 | Ga0495629_0468573 | |||
| 1701 | Ga0495638_0000880 | |||
| 1702 | Ga0495638_0053467 | |||
| 1703 | Ga0495651_0043528 | |||
| 1704 | Ga0495651_0060267 | |||
| 1705 | Ga0495651_0154845 | |||
| 1706 | Ga0495653_0009157 | |||
| 1707 | Ga0495653_0118678 | |||
| 1708 | Ga0495580_0001523 | |||
| 1709 | Ga0495582_0000302 | |||
| 1710 | Ga0495582_0111898 | |||
| 1711 | Ga0495605_0175610 | |||
| 1712 | Ga0495605_0219528 | |||
| 1713 | Ga0495639_0001076 | |||
| 1714 | Ga0495639_0116494 | |||
| 1715 | Ga0495639_0161660 | |||
| 1716 | Ga0495639_0223844 | |||
| 1717 | Ga0495662_0001265 | |||
| 1718 | Ga0495662_0109893 | |||
| 1719 | Ga0495664_0002747 | |||
| 1720 | Ga0495664_0107226 | |||
| 1721 | Ga0495584_0089326 | |||
| 1722 | Ga0495584_0133506 | |||
| 1723 | Ga0495585_0032041 | |||
| 1724 | Ga0495585_0194995 | |||
| 1725 | Ga0495585_0242057 | |||
| 1726 | Ga0495594_0000046 | |||
| 1727 | Ga0495594_0142731 | |||
| 1728 | Ga0495596_0059215 | |||
| 1729 | Ga0495596_0163646 | |||
| 1730 | Ga0495607_0041012 | |||
| 1731 | Ga0495606_0149603 | |||
| 1732 | Ga0495608_0023287 | |||
| 1733 | Ga0495610_0056579 | |||
| 1734 | Ga0495616_0185930 | |||
| 1735 | Ga0495618_0034111 | |||
| 1736 | Ga0495618_0470320 | |||
| 1737 | Ga0495628_0016164 | |||
| 1738 | Ga0495628_0056134 | |||
| 1739 | Ga0495628_0066292 | |||
| 1740 | Ga0495630_0010764 | |||
| 1741 | Ga0495631_0110500 | |||
| 1742 | Ga0495631_0191522 | |||
| 1743 | Ga0495631_0242572 | |||
| 1744 | Ga0495632_0138315 | |||
| 1745 | Ga0495637_0065561 | |||
| 1746 | Ga0495637_0138050 | |||
| 1747 | Ga0495637_0140372 | |||
| 1748 | Ga0495644_0032974 | |||
| 1749 | Ga0495644_0090753 | |||
| 1750 | Ga0495648_0174313 | |||
| 1751 | Ga0495648_0252318 | |||
| 1752 | Ga0495663_0142196 | |||
| 1753 | Ga0495666_0251170 | |||
| 1754 | Ga0495652_0045047 | |||
| 1755 | Ga0495652_0052089 | |||
| 1756 | Ga0495652_0125031 | |||
| 1757 | Ga0495665_0005462 | |||
| 1758 | Ga0495665_0155252 | |||
| 1759 | Ga0495640_0014808 | |||
| 1760 | Ga0495640_0022664 | |||
| 1761 | Ga0495640_0041763 | |||
| 1762 | Ga0495640_0120391 | |||
| 1763 | Ga0495586_0159932 | |||
| 1764 | Ga0495587_0008424 | |||
| 1765 | Ga0495587_0028223 | |||
| 1766 | Ga0495598_0039336 | |||
| 1767 | Ga0495598_0068940 | |||
| 1768 | Ga0495598_0125482 | |||
| 1769 | Ga0495609_0161563 | |||
| 1770 | Ga0495621_0018725 | |||
| 1771 | Ga0495645_0031433 | |||
| 1772 | Ga0495645_0038894 | |||
| 1773 | Ga0495622_0001947 | |||
| 1774 | Ga0495622_0016887 | |||
| 1775 | Ga0495622_0022475 | |||
| 1776 | Ga0495622_0116846 | |||
| 1777 | Ga0495622_0164627 | |||
| 1778 | Ga0495633_0023444 | |||
| 1779 | Ga0495633_0103038 | |||
| 1780 | Ga0495633_0236163 | |||
| 1781 | Ga0495667_0012267 | |||
| 1782 | Ga0495667_0049672 | |||
| 1783 | Ga0495656_0007484 | |||
| 1784 | Ga0495656_0092460 | |||
| 1785 | Ga0495656_0382859 | |||
| 1786 | Ga0495668_0063539 | |||
| 1787 | Ga0495668_0377495 | |||
| 1788 | Ga0495634_0001329 | |||
| 1789 | Ga0495634_0114644 | |||
| 1790 | Ga0495611_0120632 | |||
| 1791 | Ga0495625_0111727 | |||
| 1792 | Ga0495625_0118440 | |||
| 1793 | Ga0495635_0004154 | |||
| 1794 | Ga0495635_0004822 | |||
| 1795 | Ga0495635_0080087 | |||
| 1796 | Ga0495659_0009582 | |||
| 1797 | Ga0495659_0053327 | |||
| 1798 | Ga0495661_0186151 | |||
| 1799 | Ga0495588_0001920 | |||
| 1800 | Ga0495657_0020270 | |||
| 1801 | Ga0495657_0022368 | |||
| 1802 | Ga0495657_0062078 | |||
| 1803 | Ga0495657_0277491 | |||
| 1804 | Ga0495599_0004544 | |||
| 1805 | Ga0495623_0088438 | |||
| 1806 | Ga0495647_0002160 | |||
| 1807 | Ga0495658_0000201 | |||
| 1808 | Ga0495669_0093505 | |||
| 1809 | Ga0495613_0004521 | |||
| 1810 | Ga0495613_0023990 | |||
| 1811 | Ga0495613_0354347 | |||
| 1812 | Ga0495624_0001903 | |||
| 1813 | Ga0495624_0038534 | |||
| 1814 | Ga0495624_0080169 | |||
| 1815 | Ga0495624_0184126 | |||
| 1816 | Ga0495624_0408186 | |||
| 1817 | Ga0495670_0062870 | |||
| 1818 | Ga0495671_0266772 | |||
| 1819 | Ga0495589_0194388 | |||
| 1820 | Ga0495589_0200469 | |||
| 1821 | Ga0495600_0007343 | |||
| 1822 | Ga0495600_0019156 | |||
| 1823 | Ga0495600_0261955 | |||
| 1824 | Ga0495581_0020918 | |||
| 1825 | Ga0495581_0066978 | |||
| 1826 | Ga0495581_0136213 | |||
| 1827 | Ga0495604_0003808 | |||
| 1828 | Ga0495604_0006226 | |||
| 1829 | Ga0495604_0653718 | |||
| 1830 | Ga0495636_0019953 | |||
| 1831 | Ga0495636_0169243 | |||
| 1832 | Ga0495674_0002494 | |||
| 1833 | Ga0495674_0016347 | |||
| 1834 | Ga0495672_0035732 | |||
| 1835 | Ga0495672_0125167 | |||
| 1836 | Ga0495672_0214234 | |||
| 1837 | Ga0495676_0021845 | |||
| 1838 | Ga0495676_0083168 | |||
| 1839 | Ga0495680_0177655 | |||
| 1840 | Ga0495680_0215289 | |||
| 1841 | Ga0495680_0341864 | |||
| 1842 | Ga0495687_021924 | |||
| 1843 | Ga0495675_0143259 | |||
| 1844 | Ga0495677_0069234 | |||
| 1845 | Ga0495677_0220675 | |||
| 1846 | Ga0495679_045734 | |||
| 1847 | Ga0495685_035692 | |||
| 1848 | Ga0495685_116384 | |||
| 1849 | Ga0495673_0022825 | |||
| 1850 | Ga0495673_0054536 | |||
| 1851 | Ga0495673_0203275 | |||
| 1852 | Ga0495684_0212105 | |||
| 1853 | Ga0495686_0050099 | |||
| 1854 | Ga0495686_0127757 | |||
| 1855 | Ga0495686_0234882 | |||
| 1856 | Ga0495686_0257824 | |||
| 1857 | Ga0495593_0000100 | |||
| 1858 | Ga0495593_0039768 | |||
| 1859 | Ga0495602_0031546 | |||
| 1860 | Ga0495602_0040379 | |||
| 1861 | Ga0495602_0074008 | |||
| 1862 | Ga0495615_0119086 | |||
| 1863 | Ga0496100_0298392 | |||
| 1864 | Ga0496100_0377035 | |||
| 1865 | Ga0496101_0022763 | |||
| 1866 | Ga0496101_0085366 | |||
| 1867 | Ga0496101_0141721 | |||
| 1868 | Ga0496101_0149908 | |||
| 1869 | Ga0496101_0201161 | |||
| 1870 | Ga0496101_0234098 | |||
| 1871 | Ga0496101_0286600 | |||
| 1872 | Ga0496101_0558465 | |||
| 1873 | Ga0496102_0076683 | |||
| 1874 | Ga0496102_0079587 | |||
| 1875 | Ga0496102_0097650 | |||
| 1876 | Ga0496102_0235912 | |||
| 1877 | Ga0496102_0304465 | |||
| 1878 | Ga0496102_0400093 | |||
| 1879 | Ga0496102_0402980 | |||
| 1880 | Ga0496102_0459300 | |||
| 1881 | Ga0496102_0505779 | |||
| 1882 | Ga0496102_0612993 | |||
| 1883 | Ga0496102_0789037 | |||
| 1884 | Ga0496103_0049170 | |||
| 1885 | Ga0496103_0174853 | |||
| 1886 | Ga0496103_0248391 | |||
| 1887 | Ga0496104_0002017 | |||
| 1888 | Ga0496104_0013397 | |||
| 1889 | Ga0496104_0178357 | |||
| 1890 | Ga0496105_0014164 | |||
| 1891 | Ga0496105_0158786 | |||
| 1892 | Ga0496105_0211572 | |||
| 1893 | Ga0496105_0451779 | |||
| 1894 | Ga0496106_0110392 | |||
| 1895 | Ga0496106_0243799 | |||
| 1896 | Ga0496106_0306063 | |||
| 1897 | Ga0496106_0412024 | |||
| 1898 | Ga0496107_0029068 | |||
| 1899 | Ga0496107_0352377 | |||
| 1900 | Ga0496107_0385605 | |||
| 1901 | Ga0496107_0401019 | |||
| 1902 | Ga0496107_0769059 | |||
| 1903 | Ga0496108_0059860 | |||
| 1904 | Ga0496108_0067424 | |||
| 1905 | Ga0496108_0134973 | |||
| 1906 | Ga0496108_0476619 | |||
| 1907 | Ga0496108_0749374 | |||
| 1908 | Ga0496109_0168973 | |||
| 1909 | Ga0496109_0273274 | |||
| 1910 | Ga0496109_0354752 | |||
| 1911 | Ga0496109_0480950 | |||
| 1912 | Ga0496109_0657988 | |||
| 1913 | Ga0496109_0810174 | |||
| 1914 | Ga0496110_0005974 | |||
| 1915 | Ga0496110_0159198 | |||
| 1916 | Ga0496110_0336989 | |||
| 1917 | Ga0496110_0632832 | |||
| 1918 | Ga0496111_0046141 | |||
| 1919 | Ga0496111_0090187 | |||
| 1920 | Ga0496111_0165877 | |||
| 1921 | Ga0496111_0268738 | |||
| 1922 | Ga0496111_0472391 | |||
| 1923 | Ga0496112_0073684 | |||
| 1924 | Ga0496112_0082564 | |||
| 1925 | Ga0496112_0186977 | |||
| 1926 | Ga0496112_0351266 | |||
| 1927 | Ga0496113_0014545 | |||
| 1928 | Ga0496113_0112818 | |||
| 1929 | Ga0496113_0155196 | |||
| 1930 | Ga0496113_0238292 | |||
| 1931 | Ga0496113_0320899 | |||
| 1932 | Ga0496113_0392864 | |||
| 1933 | Ga0496113_0421495 | |||
| 1934 | Ga0496114_0086672 | |||
| 1935 | Ga0496114_0118976 | |||
| 1936 | Ga0496114_0144087 | |||
| 1937 | Ga0496114_0197224 | |||
| 1938 | Ga0496114_0329999 | |||
| 1939 | Ga0496115_0013622 | |||
| 1940 | Ga0496116_0043611 | |||
| 1941 | Ga0496116_0116134 | |||
| 1942 | Ga0496116_0215041 | |||
| 1943 | Ga0496116_0260054 | |||
| 1944 | Ga0496117_0108922 | |||
| 1945 | Ga0496118_0023553 | |||
| 1946 | Ga0496118_0041055 | |||
| 1947 | Ga0496118_0138648 | |||
| 1948 | Ga0496118_0225317 | |||
| 1949 | Ga0496119_0009198 | |||
| 1950 | Ga0496119_0050219 | |||
| 1951 | Ga0496119_0134725 | |||
| 1952 | Ga0496120_0084242 | |||
| 1953 | Ga0496121_0000278 | |||
| 1954 | Ga0496121_0014972 | |||
| 1955 | Ga0496121_0051540 | |||
| 1956 | Ga0496121_0093467 | |||
| 1957 | Ga0496121_0108562 | |||
| 1958 | Ga0496121_0149826 | |||
| 1959 | Ga0496121_0232637 | |||
| 1960 | Ga0496121_0360565 | |||
| 1961 | Ga0496121_0395786 | |||
| 1962 | Ga0496122_0043096 | |||
| 1963 | Ga0496122_0144868 | |||
| 1964 | Ga0496123_0171852 | |||
| 1965 | Ga0496124_0090250 | |||
| 1966 | Ga0496124_0091231 | |||
| 1967 | Ga0496124_0133286 | |||
| 1968 | Ga0496124_0589564 | |||
| 1969 | Ga0496125_0045202 | |||
| 1970 | Ga0496125_0057511 | |||
| 1971 | Ga0496125_0114688 | |||
| 1972 | Ga0496125_0120412 | |||
| 1973 | Ga0496125_0142097 | |||
| 1974 | Ga0496125_0158875 | |||
| 1975 | Ga0496125_0283110 | |||
| 1976 | Ga0496125_0370739 | |||
| 1977 | Ga0496126_0011733 | |||
| 1978 | Ga0496126_0066932 | |||
| 1979 | Ga0496126_0080549 | |||
| 1980 | Ga0496126_0116623 | |||
| 1981 | Ga0496126_0136354 | |||
| 1982 | Ga0496126_0169065 | |||
| 1983 | Ga0496126_0201356 | |||
| 1984 | Ga0496126_0211854 | |||
| 1985 | Ga0496126_0377561 | |||
| 1986 | Ga0496126_0403285 | |||
| 1987 | Ga0496126_0444539 | |||
| 1988 | Ga0496126_0452777 | |||
| 1989 | Ga0496126_0638625 | |||
| 1990 | Ga0501034_0047500 | |||
| 1991 | Ga0501036_0134500 | |||
| 1992 | Ga0501037_0250093 | |||
| 1993 | Ga0501038_0082192 | |||
| 1994 | Ga0501041_0063098 | |||
| 1995 | Ga0501042_0285099 | |||
| 1996 | Ga0501043_0027498 | |||
| 1997 | Ga0501046_0005445 | |||
| 1998 | Ga0501046_0342668 | |||
| 1999 | Ga0501047_0023204 | |||
| 2000 | Ga0501047_0179362 | |||
| 2001 | Ga0501047_0348788 | |||
| 2002 | Ga0501048_0080390 | |||
| 2003 | Ga0501067_0453636 | |||
| 2004 | Ga0501068_0359019 | |||
| 2005 | Ga0501070_0019284 | |||
| 2006 | Ga0501070_0732693 | |||
| 2007 | Ga0501074_0098293 | |||
| 2008 | Ga0501077_0159734 | |||
| 2009 | Ga0501080_0030696 | |||
| 2010 | Ga0501080_0418865 | |||
| 2011 | Ga0501081_0378528 | |||
| 2012 | Ga0501035_0015880 | |||
| 2013 | Ga0501035_0177012 | |||
| 2014 | Ga0501044_0022135 | |||
| 2015 | nmdc:mga03n38_254487_c1 | |||
| 2016 | nmdc:mga03n38_2806_c1 | |||
| 2017 | nmdc:mga03n38_31131_c1 | |||
| 2018 | nmdc:mga03n38_473151_c1 | |||
| 2019 | nmdc:mga00v17_139434_c1 | |||
| 2020 | nmdc:mga00v17_70950_c1 | |||
| 2021 | nmdc:mga00v17_85010_c1 | |||
| 2022 | nmdc:mga0yw44_111959_c1 | |||
| 2023 | nmdc:mga0yw44_122028_c1 | |||
| 2024 | nmdc:mga0yw44_62839_c1 | |||
| 2025 | nmdc:mga0yw44_75349_c1 | |||
| 2026 | nmdc:mga0yw44_86056_c1 | |||
| 2027 | nmdc:mga0k408_146577_c1 | |||
| 2028 | nmdc:mga0k408_37421_c1 | |||
| 2029 | nmdc:mga0k408_44479_c1 | |||
| 2030 | nmdc:mga0k408_56176_c1 | |||
| 2031 | nmdc:mga06z11_165622_c1 | |||
| 2032 | nmdc:mga06z11_69619_c1 | |||
| 2033 | nmdc:mga07m45_121951_c1 | |||
| 2034 | nmdc:mga07m45_134725_c1 | |||
| 2035 | nmdc:mga07m45_247737_c1 | |||
| 2036 | nmdc:mga07m45_344647_c1 | |||
| 2037 | nmdc:mga07m45_40313_c1 | |||
| 2038 | nmdc:mga05p37_690309_c1 | |||
| 2039 | nmdc:mga0qj67_540059_c1 | |||
| 2040 | nmdc:mga08y16_272165_c1 | |||
| 2041 | nmdc:mga08y16_47004_c1 | |||
| 2042 | nmdc:mga0sz30_113233_c1 | |||
| 2043 | nmdc:mga0sz30_165944_c1 | |||
| 2044 | nmdc:mga0sz30_22699_c2 | |||
| 2045 | nmdc:mga0sz30_23280_c1 | |||
| 2046 | nmdc:mga0sz30_9134_c1 | |||
| 2047 | Ga0495601_0054935 | |||
| 2048 | Ga0495601_0116784 | |||
| 2049 | Ga0495612_0004894 | |||
| 2050 | Ga0500635_0009760 | |||
| 2051 | Ga0495655_0040839 | |||
| 2052 | Ga0495655_0106885 | |||
| 2053 | Ga0495595_0026720 | |||
| 2054 | Ga0495619_0073994 | |||
| 2055 | Ga0495619_0086732 | |||
| 2056 | Ga0495619_0215566 | |||
| 2057 | Ga0500643_000112 | |||
| 2058 | Ga0500646_0023576 | |||
| 2059 | Ga0500646_0052009 | |||
| 2060 | Ga0500566_0004025 | |||
| 2061 | Ga0500566_0008103 | |||
| 2062 | Ga0500566_0115556 | |||
| 2063 | Ga0500641_0014043 | |||
| 2064 | Ga0500641_0094828 | |||
| 2065 | Ga0500641_0156095 | |||
| 2066 | Ga0500555_001746 | |||
| 2067 | Ga0500557_000021 | |||
| 2068 | Ga0500569_002081 | |||
| 2069 | Ga0500572_000229 | |||
| 2070 | Ga0500572_003273 | |||
| 2071 | Ga0500572_008536 | |||
| 2072 | Ga0500594_0013322 | |||
| 2073 | Ga0500595_001023 | |||
| 2074 | Ga0500595_006104 | |||
| 2075 | Ga0500595_006755 | |||
| 2076 | Ga0500595_090448 | |||
| 2077 | Ga0500595_096598 | |||
| 2078 | Ga0500597_164821 | |||
| 2079 | Ga0500614_016618 | |||
| 2080 | Ga0500618_022118 | |||
| 2081 | Ga0500642_0000583 | |||
| 2082 | Ga0500642_0032521 | |||
| 2083 | Ga0500652_151432 | |||
| 2084 | Ga0500559_0000186 | |||
| 2085 | Ga0500559_0126183 | |||
| 2086 | Ga0500568_0002888 | |||
| 2087 | Ga0500568_0076134 | |||
| 2088 | Ga0500577_0065965 | |||
| 2089 | Ga0500588_0071073 | |||
| 2090 | Ga0500589_015685 | |||
| 2091 | Ga0500604_0027468 | |||
| 2092 | Ga0500604_0101196 | |||
| 2093 | Ga0500616_0006228 | |||
| 2094 | Ga0500622_0026195 | |||
| 2095 | Ga0500624_005276 | |||
| 2096 | Ga0500627_0038300 | |||
| 2097 | Ga0500633_0003710 | |||
| 2098 | Ga0500634_0059643 | |||
| 2099 | Ga0500638_002757 | |||
| 2100 | Ga0500638_089970 | |||
| 2101 | Ga0500639_049971 | |||
| 2102 | Ga0500636_0004022 | |||
| 2103 | Ga0500636_0028340 | |||
| 2104 | Ga0500637_0022159 | |||
| 2105 | Ga0500576_021939 | |||
| 2106 | Ga0500657_042091 | |||
| 2107 | Ga0500625_025664 | |||
| 2108 | Ga0500645_025711 | |||
| 2109 | Ga0500609_016525 | |||
| 2110 | Ga0500596_003902 | |||
| 2111 | Ga0500599_000328 | |||
| 2112 | Ga0500661_001755 | |||
| 2113 | Ga0500661_026424 | |||
| 2114 | 2507505473 | |||
| 2115 | 2508539358 | |||
| 2116 | 2508695688 | |||
| 2117 | 2511397796 | |||
| 2118 | 2513623902 | |||
| 2119 | 2513642216 | |||
| 2120 | 2513651310 | |||
| 2121 | 2513703484 | |||
| 2122 | 2513873323 | |||
| 2123 | 2513888556 | |||
| 2124 | 2514014653 | |||
| 2125 | 2515627670 | |||
| 2126 | 2517106255 | |||
| 2127 | 2524441465 | |||
| 2128 | 2524467202 | |||
| 2129 | 2528852707 | |||
| 2130 | 2617352036 | |||
| 2131 | 2617373506 | |||
| 2132 | 2745077599 | |||
| 2133 | 2793062261 | |||
| 2134 | 2805920671 | |||
| 2135 | 2818237880 | |||
| 2136 | 2824604399 | |||
| 2137 | 2824614871 | |||
| 2138 | 2824624187 | |||
| 2139 | 2824632867 | |||
| 2140 | 2824641394 | |||
| 2141 | 2824652574 | |||
| 2142 | 2824656317 | |||
| 2143 | 2824667270 | |||
| 2144 | 2824671773 | |||
| 2145 | 2824684715 | |||
| 2146 | 2824688545 | |||
| 2147 | 2824701683 | |||
| 2148 | 2824718456 | |||
| 2149 | 2824728837 | |||
| 2150 | 2824737641 | |||
| 2151 | 2824751163 | |||
| 2152 | 2824779969 | |||
| 2153 | 2838124723 | |||
| 2154 | 2841945414 | |||
| 2155 | 2841952200 | |||
| 2156 | 2841965322 | |||
| 2157 | 2841970410 | |||
| 2158 | 2841981661 | |||
| 2159 | 2841984941 | |||
| 2160 | 2842043296 | |||
| 2161 | 2842052714 | |||
| 2162 | 2844315569 | |||
| 2163 | 2847942365 | |||
| 2164 | 2849083237 | |||
| 2165 | 2857516329 | |||
| 2166 | 2874592524 | |||
| 2167 | 2874618666 | |||
| 2168 | 2874621178 | |||
| 2169 | 2874628578 | |||
| 2170 | 2874647143 | |||
| 2171 | 2876769667 | |||
| 2172 | 2876772527 | |||
| 2173 | 2876819788 | |||
| 2174 | 2879076294 | |||
| 2175 | 2879083794 | |||
| 2176 | 2879101968 | |||
| 2177 | 2879128778 | |||
| 2178 | 2879142906 | |||
| 2179 | 2881368951 | |||
| 2180 | 2885369312 | |||
| 2181 | 2885417979 | |||
| 2182 | 2888379377 | |||
| 2183 | 2888390477 | |||
| 2184 | 2888420098 | |||
| 2185 | 2903733522 | |||
| 2186 | 2903770572 | |||
| 2187 | 2904667723 | |||
| 2188 | 2904690981 | |||
| 2189 | 2904708376 | |||
| 2190 | 2906608876 | |||
| 2191 | 2906631697 | |||
| 2192 | 2908757039 | |||
| 2193 | 2908775977 | |||
| 2194 | 2922369357 | |||
| 2195 | 2922396557 | |||
| 2196 | 2929618811 | |||
| 2197 | 2929628504 | |||
| 2198 | 2932790989 | |||
| 2199 | 2932794118 | |||
| 2200 | 2932809193 | |||
| 2201 | 2932816233 | |||
| 2202 | 2932827640 | |||
| 2203 | 2932833705 | |||
| 2204 | 2933580479 | |||
| 2205 | 2935615496 | |||
| 2206 | 2935623231 | |||
| 2207 | 2935644306 | |||
| 2208 | 2935654425 | |||
| 2209 | 2935663305 | |||
| 2210 | 2935672112 | |||
| 2211 | 2935679368 | |||
| 2212 | 2935686610 | |||
| 2213 | 2935700391 | |||
| 2214 | 2935710339 | |||
| 2215 | 2935716298 | |||
| 2216 | 2935723578 | |||
| 2217 | 2935735133 | |||
| 2218 | 2935744076 | |||
| 2219 | 2935752576 | |||
| 2220 | 2935763291 | |||
| 2221 | 2935774263 | |||
| 2222 | 2935785127 | |||
| 2223 | 2935789022 | |||
| 2224 | 2935796772 | |||
| 2225 | 2935808330 | |||
| 2226 | 2935816055 | |||
| 2227 | 2935825703 | |||
| 2228 | 2935833450 | |||
| 2229 | 2935845992 | |||
| 2230 | 2935853467 | |||
| 2231 | 2935861479 | |||
| 2232 | 2935869598 | |||
| 2233 | 2935879927 | |||
| 2234 | 2935889145 | |||
| 2235 | 2935915068 | |||
| 2236 | 2935918916 | |||
| 2237 | 2935931367 | |||
| 2238 | 2935939964 | |||
| 2239 | 2935947689 | |||
| 2240 | 2935956460 | |||
| 2241 | 2935966693 | |||
| 2242 | 2935973254 | |||
| 2243 | 2935980501 | |||
| 2244 | 2935990148 | |||
| 2245 | 2935997850 | |||
| 2246 | 2936008885 | |||
| 2247 | 2936017536 | |||
| 2248 | 2936025963 | |||
| 2249 | 2936034805 | |||
| 2250 | 2936041061 | |||
| 2251 | 2936052937 | |||
| 2252 | 2936060204 | |||
| 2253 | 2940558489 | |||
| 2254 | 2941535319 | |||
| 2255 | 2941547161 | |||
| 2256 | 3005486650 | |||
| 2257 | 3005508954 | |||
| 2258 | 3005593269 | |||
| 2259 | 3005595259 | |||
| 2260 | 3005711205 | |||
| 2261 | 3005718506 | |||
| 2262 | 8006927272 | |||
| 2263 | 8006935978 | |||
| 2264 | 8016526354 | |||
| 2265 | 8016557445 | |||
| 2266 | 8016565800 | |||
| 2267 | 8016569687 | |||
| 2268 | 8016582293 | |||
| 2269 | 8016586119 | |||
| 2270 | 8016603403 | |||
| 2271 | 8016606335 | |||
| 2272 | 8016618243 | |||
| 2273 | 8016635399 | |||
| 2274 | 8017058673 | |||
| 2275 | 8019531251 | |||
| 2276 | 8019540301 | |||
| 2277 | 8019549892 | |||
| 2278 | 8019576985 | |||
| 2279 | 8019595049 | |||
| 2280 | 8019611816 | |||
| 2281 | 8019623189 | |||
| 2282 | 8019629908 | |||
| 2283 | 8019652257 | |||
| 2284 | 8019676506 | |||
| 2285 | 8019679488 | |||
| 2286 | 8019696024 | |||
| 2287 | 8055742660 | |||
| 2288 | 8056682967 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2h29-assembly1.cif.gz_B | crystal structure of nicotinic acid mononucleotide adenylyltransferase from staphylococcus aureus: product bound form 1 | 0.8548 | 21 | 152 |
| 1kaq-assembly1.cif.gz_D | structure of bacillus subtilis nicotinic acid mononucleotide adenylyl transferase | 0.8456 | 23 | 203 |
| 1kaq-assembly3.cif.gz_F | structure of bacillus subtilis nicotinic acid mononucleotide adenylyl transferase | 0.8423 | 22 | 152 |
| 1kaq-assembly3.cif.gz_E | structure of bacillus subtilis nicotinic acid mononucleotide adenylyl transferase | 0.8401 | 23 | 203 |
| 5vir-assembly1.cif.gz_A-2 | crystal structure of probable nicotinate-nucleotide adenylyltransferase from mycobacterium abscessus in complex with nadp and compound fol0091 | 0.8386 | 21 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2h2aB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8542 | 21 | 152 | 3.40.50.620 |
| 5virA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8386 | 21 | 151 | 3.40.50.620 |
| af_A0A1D6QAZ7_25_240_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8281 | 22 | 171 | 3.40.50.620 |
| 3h05A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8139 | 21 | 147 | 3.40.50.620 |
| 4wsoB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8084 | 16 | 202 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A833G943-F1-model_v4 | nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) | 0.9558 | 12 | 187 |
GO:0009435
GO:0070566 |
| AF-A0A2H0ETY4-F1-model_v4 | nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) | 0.9521 | 87 | 202 |
GO:0009435
GO:0070566 |
| AF-A0A836SVQ4-F1-model_v4 | deleted | 0.95 | 40 | 202 |
|
| AF-A0A356V7P4-F1-model_v4 | nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) | 0.9498 | 13 | 171 |
GO:0004515
GO:0009435 |
| AF-A0A840ZVF3-F1-model_v4 | deleted | 0.9496 | 77 | 202 |
|