F490751

General Info

Members Datasets Scaffolds Average Seq Length
1144 635 2288 236

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10047903|Ga0081455_100479032
Length 264
Sequence LTALRRCTNVLVHLWQALPAHTGIRMDQPVIAQRRVAPRSGGRLDRDRQAAPQVFERLRGMIIALELPPGSPLSRAALAEQFGVSSTPIRDALMRLEEEGLVEVFPQYATVVSRIDVHRAQQAHFLRQALELEIVRVLALKPDEALVTELNATIARQLQFAKAGAFEKFMAADNEFHAKLYEAADKQDIWTLVKSRSGHIDRLRRLHLPSPGKAQDIVRHHKLITKAIAGGEPEEAQKHLRTHLSGTLSELAKIRAQHPQYLND

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
99 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
100 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
124 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
126 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
127 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
187 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
188 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
193 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
194 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
195 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
196 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
197 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
198 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
199 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
200 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
201 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
206 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
209 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
215 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
218 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
223 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
234 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
235 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
236 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
237 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
238 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
246 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
247 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
255 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
256 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
257 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
258 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
259 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
262 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
263 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
264 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
265 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
266 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
267 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
268 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
269 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
270 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
271 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
272 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
273 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
274 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
275 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
276 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
277 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
278 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
279 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
280 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
281 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
282 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
283 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
284 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
285 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
286 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
287 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
288 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
289 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
290 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
291 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
292 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
293 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
294 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
295 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
298 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
299 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
300 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
301 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
302 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
305 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
306 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
307 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
310 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
311 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
312 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
313 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
314 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
315 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
316 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
317 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
318 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
319 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
320 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
321 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
322 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
323 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
324 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
325 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
326 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
327 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
330 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
331 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
332 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
333 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
334 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
335 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
336 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
337 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
338 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
339 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
340 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
341 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
342 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
343 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
344 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
345 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
346 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
347 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
348 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
349 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
355 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
356 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
357 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
361 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
362 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
363 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
364 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
365 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
366 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
367 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
368 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
369 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
370 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
371 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
372 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
373 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
374 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
375 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
376 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
377 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
378 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
379 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
380 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
381 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
382 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
383 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
384 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
385 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
386 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
387 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
388 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
389 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
390 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
391 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
392 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
393 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
394 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
395 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
396 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
397 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
398 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
399 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
400 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
401 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
402 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
403 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
404 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
405 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
406 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
407 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
408 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
409 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
410 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
411 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
412 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
413 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
414 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
415 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
416 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
417 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
418 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
419 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
420 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
421 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
422 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
423 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
424 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
425 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
426 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
427 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
428 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
429 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
430 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
431 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
432 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
433 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
434 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
435 2643221558 Rhizobium sp. Root149 Isolate Unclassified
436 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
437 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
438 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
439 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
440 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
441 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
442 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
443 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
444 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
445 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
446 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
447 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
448 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
449 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
450 2773857925 Microvirga vignae BR3299 Isolate Unclassified
451 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
452 2791355199
453 2791355256 Rhizobium sp. M10 Isolate Nodule
454 2791355261 Rhizobium sp. J15 Isolate Nodule
455 2791355262 Rhizobium sp. M1 Isolate Nodule
456 2791355264 Rhizobium sp. S9 Isolate Nodule
457 2791355265 Rhizobium sp. H4 Isolate Nodule
458 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
459 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
460 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
461 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
462 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
463 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
464 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
465 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
466 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
467 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
468 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
469 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
470 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
471 2838061910 Rhizobium phaseoli L15 Isolate Nodule
472 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
473 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
474 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
475 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
476 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
477 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
478 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
479 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
480 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
481 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
482 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
483 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
484 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
485 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
486 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
487 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
488 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
489 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
490 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
491 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
492 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
493 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
494 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
495 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
496 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
497 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
498 2855730933 Achromobacter sp. HZ28 Isolate Nodule
499 2855767633 Achromobacter sp. HZ34 Isolate Nodule
500 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
501 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
502 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
503 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
504 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
505 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
506 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
507 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
508 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
509 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
510 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
511 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
512 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
513 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
514 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
515 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
516 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
517 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
518 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
519 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
520 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
521 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
522 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
523 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
524 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
525 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
526 2922368715
527 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
528 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
529 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
530 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
531 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
532 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
533 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
534 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
535 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
536 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
537 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
538 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
539 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
540 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
541 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
542 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
543 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
544 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
545 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
546 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
547 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
548 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
549 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
550 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
551 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
552 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
553 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
554 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
555 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
556 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
557 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
558 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
559 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
560 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
561 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
562 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
563 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
564 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
565 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
566 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
567 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
568 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
569 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
570 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
571 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
572 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
573 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
574 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
575 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
576 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
577 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
578 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
579 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
580 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
581 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
582 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
583 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
584 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
585 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
586 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
587 2996887358 Rhizobium sp. R711 Isolate Nodule
588 2996893221 Rhizobium sp. R635 Isolate Nodule
589 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
590 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
591 8005258706 Rhizobium sp. R693 Isolate Nodule
592 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
593 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
594 8005321885 Rhizobium sp. R72 Isolate Nodule
595 8005382845 Rhizobium sp. R634 Isolate Nodule
596 8005395548 Rhizobium sp. R339 Isolate Nodule
597 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
598 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
599 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
600 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
601 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
602 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
603 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
604 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
605 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
606 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
607 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
608 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
609 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
610 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
611 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
612 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
613 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
614 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
615 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
616 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
617 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
618 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
619 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
620 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
621 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
622 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
623 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
624 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
625 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
626 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
627 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
628 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
629 8024501048 Rhizobium sp. H4 Isolate Nodule
630 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
631 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
632 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
633 8056382006 Rhizobium croatiense 13T Isolate Nodule
634 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
635 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81
Metatranscriptomes 0.18
Isolates 18.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.51
Nodule 16.35
Rhizoplane 4.55
Rhizosphere 54.9
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10047903 3300005937 Bacteria 3697
2 JGI24735J21928_10041752 3300002067 Bacteria 1336
3 JGI25152J39213_1001108 3300002773 Bacteria 12593
4 JGI25151J46595_10000451 3300003187 Bacteria 39770
5 JGI25151J46595_10012763 3300003187 Bacteria 3808
6 JGI25165J46597_1012936 3300003214 Bacteria 1158
7 JGI25153J46596_10001849 3300003215 Bacteria 12551
8 JGI25153J46596_10003596 3300003215 Bacteria 8611
9 JGI25153J46596_10003675 3300003215 Bacteria 8492
10 JGI25153J46596_10007159 3300003215 Bacteria 5534
11 JGI25153J46596_10012613 3300003215 Bacteria 3629
12 rootH1_10084142 3300003316 Bacteria 1774
13 rootL2_10239686 3300003322 Bacteria 1200
14 rootH1_10058417 3300003323 Bacteria 1887
15 JGI25160J50197_1003782 3300003354 Bacteria 6662
16 JGI25160J50197_1005043 3300003354 Bacteria 5580
17 JGI25160J50197_1025211 3300003354 Bacteria 1669
18 JGI25404J52841_10024642 3300003659 Bacteria 1296
19 Ga0055539_1003001 3300003752 Bacteria 2434
20 Ga0055531_10005144 3300003794 Bacteria 7716
21 Ga0055543_1001103 3300004625 Bacteria 11670
22 Ga0065165_1001646 3300005262 Bacteria 22707
23 Ga0065165_1003743 3300005262 Bacteria 10239
24 Ga0065165_1022241 3300005262 Bacteria 2180
25 Ga0070658_10064511 3300005327 Bacteria 2987
26 Ga0070658_10110967 3300005327 Bacteria 2272
27 Ga0070658_10243097 3300005327 Bacteria 1526
28 Ga0070690_100090747 3300005330 Bacteria 2012
29 Ga0070670_100182032 3300005331 Bacteria 1825
30 Ga0070670_100403626 3300005331 Bacteria 1207
31 Ga0068869_100018682 3300005334 Bacteria 4723
32 Ga0068869_100229158 3300005334 Bacteria 1475
33 Ga0070666_10198145 3300005335 Bacteria 1412
34 Ga0070680_100005214 3300005336 Bacteria 9831
35 Ga0070680_100011561 3300005336 Bacteria 6834
36 Ga0070680_100471625 3300005336 Bacteria 1073
37 Ga0070682_100024236 3300005337 Bacteria 3609
38 Ga0070682_100074067 3300005337 Bacteria 2186
39 Ga0070682_100278192 3300005337 Bacteria 1219
40 Ga0070682_100349336 3300005337 Bacteria 1102
41 Ga0068868_100004833 3300005338 Bacteria 9459
42 Ga0068868_100086679 3300005338 Bacteria 2517
43 Ga0068868_100529731 3300005338 Bacteria 1035
44 Ga0070660_100014405 3300005339 Bacteria 5694
45 Ga0070660_100021819 3300005339 Bacteria 4727
46 Ga0070660_100034372 3300005339 Bacteria 3830
47 Ga0070660_100068342 3300005339 Bacteria 2769
48 Ga0070660_100193274 3300005339 Bacteria 1649
49 Ga0070660_100399953 3300005339 Bacteria 1136
50 Ga0070689_100238269 3300005340 Bacteria 1498
51 Ga0070687_100157363 3300005343 Bacteria 1340
52 Ga0070661_100002881 3300005344 Bacteria 11836
53 Ga0070661_100122108 3300005344 Bacteria 1952
54 Ga0070668_100013201 3300005347 Bacteria 6160
55 Ga0070668_100015674 3300005347 Bacteria 5668
56 Ga0070668_100025268 3300005347 Bacteria 4502
57 Ga0070668_100066527 3300005347 Bacteria 2797
58 Ga0070668_100547921 3300005347 Bacteria 1006
59 Ga0070675_100259455 3300005354 Bacteria 1522
60 Ga0070675_100311874 3300005354 Bacteria 1388
61 Ga0070675_100697504 3300005354 Bacteria 924
62 Ga0070671_100015188 3300005355 Bacteria 6220
63 Ga0070671_100063445 3300005355 Bacteria 3077
64 Ga0070671_100171645 3300005355 Bacteria 1834
65 Ga0070674_100199625 3300005356 Bacteria 1544
66 Ga0070673_100125190 3300005364 Bacteria 2149
67 Ga0070673_100213175 3300005364 Bacteria 1669
68 Ga0070659_100050519 3300005366 Bacteria 3269
69 Ga0070667_100149367 3300005367 Bacteria 2052
70 Ga0070667_100200492 3300005367 Bacteria 1771
71 Ga0070714_100231515 3300005435 Bacteria 1702
72 Ga0070701_10143799 3300005438 Bacteria 1367
73 Ga0070700_100070726 3300005441 Bacteria 2226
74 Ga0070700_100223878 3300005441 Bacteria 1335
75 Ga0070663_100000598 3300005455 Bacteria 19225
76 Ga0070663_100017095 3300005455 Bacteria 4726
77 Ga0070663_100019221 3300005455 Bacteria 4497
78 Ga0070663_100083818 3300005455 Bacteria 2348
79 Ga0070678_100024855 3300005456 Bacteria 4018
80 Ga0070678_100078094 3300005456 Bacteria 2500
81 Ga0070678_100134028 3300005456 Bacteria 1973
82 Ga0070678_100142321 3300005456 Bacteria 1921
83 Ga0070678_100158056 3300005456 Bacteria 1833
84 Ga0070678_100278143 3300005456 Bacteria 1414
85 Ga0070662_100007191 3300005457 Bacteria 7210
86 Ga0070662_100015533 3300005457 Bacteria 5103
87 Ga0070662_100073350 3300005457 Bacteria 2528
88 Ga0070681_10104996 3300005458 Bacteria 2767
89 Ga0070681_10139645 3300005458 Bacteria 2353
90 Ga0070681_10141265 3300005458 Bacteria 2338
91 Ga0068867_100164012 3300005459 Bacteria 1754
92 Ga0068867_100387304 3300005459 Bacteria 1176
93 Ga0070706_100159540 3300005467 Bacteria 2106
94 Ga0070679_100240604 3300005530 Bacteria 1767
95 Ga0070679_100262422 3300005530 Bacteria 1682
96 Ga0070679_100354758 3300005530 Bacteria 1414
97 Ga0070684_100122197 3300005535 Bacteria 2343
98 Ga0070684_100408283 3300005535 Bacteria 1253
99 Ga0070684_100588559 3300005535 Bacteria 1034
100 Ga0068853_100051162 3300005539 Bacteria 3555
101 Ga0068853_100068809 3300005539 Bacteria 3078
102 Ga0068853_100175878 3300005539 Bacteria 1939
103 Ga0068853_100201553 3300005539 Bacteria 1811
104 Ga0068853_100257283 3300005539 Bacteria 1604
105 Ga0070672_100104298 3300005543 Bacteria 2304
106 Ga0070672_100127479 3300005543 Bacteria 2089
107 Ga0070686_100042506 3300005544 Bacteria 2847
108 Ga0070693_100040702 3300005547 Bacteria 2610
109 Ga0070665_100010827 3300005548 Bacteria 9225
110 Ga0070665_100015557 3300005548 Bacteria 7642
111 Ga0070665_100015812 3300005548 Bacteria 7578
112 Ga0070665_100123562 3300005548 Bacteria 2590
113 Ga0070665_100134738 3300005548 Bacteria 2472
114 Ga0070665_100368750 3300005548 Bacteria 1443
115 Ga0070665_100370198 3300005548 Bacteria 1439
116 Ga0070665_100370216 3300005548 Bacteria 1439
117 Ga0068855_100019755 3300005563 Bacteria 8090
118 Ga0068855_100110183 3300005563 Bacteria 3161
119 Ga0068855_100134239 3300005563 Bacteria 2824
120 Ga0068855_100355831 3300005563 Bacteria 1612
121 Ga0068855_100454851 3300005563 Bacteria 1396
122 Ga0068855_100565992 3300005563 Bacteria 1229
123 Ga0070664_100003791 3300005564 Bacteria 12197
124 Ga0070664_100082048 3300005564 Bacteria 2780
125 Ga0070664_100089380 3300005564 Bacteria 2665
126 Ga0068857_100085354 3300005577 Bacteria 2822
127 Ga0068854_100805751 3300005578 Bacteria 819
128 Ga0068856_100002355 3300005614 Bacteria 19438
129 Ga0068856_100083923 3300005614 Bacteria 3164
130 Ga0068856_100368275 3300005614 Bacteria 1456
131 Ga0068856_100649046 3300005614 Bacteria 1076
132 Ga0070702_100249769 3300005615 Bacteria 1202
133 Ga0070702_100281751 3300005615 Bacteria 1142
134 Ga0068852_100008549 3300005616 Bacteria 7551
135 Ga0068852_100018956 3300005616 Bacteria 5435
136 Ga0068852_100082923 3300005616 Bacteria 2850
137 Ga0068852_100229094 3300005616 Bacteria 1770
138 Ga0068852_100280195 3300005616 Bacteria 1607
139 Ga0068852_100360141 3300005616 Bacteria 1422
140 Ga0068852_100579129 3300005616 Bacteria 1125
141 Ga0068852_100714906 3300005616 Bacteria 1012
142 Ga0068859_100016877 3300005617 Bacteria 7328
143 Ga0068859_100166317 3300005617 Bacteria 2285
144 Ga0068859_100584304 3300005617 Bacteria 1211
145 Ga0068864_100027680 3300005618 Bacteria 4789
146 Ga0068864_100821211 3300005618 Bacteria 915
147 Ga0068861_100064658 3300005719 Bacteria 2815
148 Ga0068861_100092252 3300005719 Bacteria 2392
149 Ga0068861_100096747 3300005719 Bacteria 2340
150 Ga0068851_10129435 3300005834 Bacteria 1364
151 Ga0068851_10324908 3300005834 Bacteria 890
152 Ga0068870_10139812 3300005840 Bacteria 1416
153 Ga0068870_10175109 3300005840 Bacteria 1283
154 Ga0068863_100086085 3300005841 Bacteria 2978
155 Ga0068858_100151471 3300005842 Bacteria 2181
156 Ga0068858_100153798 3300005842 Bacteria 2164
157 Ga0068858_100365844 3300005842 Bacteria 1382
158 Ga0068858_100404129 3300005842 Bacteria 1312
159 Ga0068858_101072092 3300005842 Bacteria 791
160 Ga0068860_100000577 3300005843 Bacteria 44036
161 Ga0068860_100177029 3300005843 Bacteria 2061
162 Ga0068860_100222173 3300005843 Bacteria 1834
163 Ga0068860_100296370 3300005843 Bacteria 1583
164 Ga0068860_100337864 3300005843 Bacteria 1480
165 Ga0068862_100012465 3300005844 Bacteria 7035
166 Ga0068862_100036297 3300005844 Bacteria 4178
167 Ga0068862_100052418 3300005844 Bacteria 3490
168 Ga0068862_100253887 3300005844 Bacteria 1603
169 Ga0068862_100489020 3300005844 Bacteria 1166
170 Ga0081455_10004895 3300005937 Bacteria 14842
171 Ga0081455_10013363 3300005937 Bacteria 8121
172 Ga0081455_10065600 3300005937 Bacteria 3036
173 Ga0081540_1004561 3300005983 Bacteria 10498
174 Ga0081540_1005048 3300005983 Bacteria 9905
175 Ga0081540_1010591 3300005983 Bacteria 6230
176 Ga0081540_1011487 3300005983 Bacteria 5917
177 Ga0081540_1011797 3300005983 Bacteria 5809
178 Ga0081540_1013781 3300005983 Bacteria 5235
179 Ga0081540_1031452 3300005983 Bacteria 2917
180 Ga0081540_1036693 3300005983 Bacteria 2609
181 Ga0081540_1051966 3300005983 Bacteria 2022
182 Ga0081539_10019046 3300005985 Bacteria 4722
183 Ga0075365_10004812 3300006038 Bacteria 7201
184 Ga0075365_10011993 3300006038 Bacteria 5122
185 Ga0075365_10093839 3300006038 Bacteria 2048
186 Ga0075365_10116414 3300006038 Bacteria 1841
187 Ga0075365_10199218 3300006038 Bacteria 1402
188 Ga0075365_10311713 3300006038 Unclassified 1108
189 Ga0075368_10035929 3300006042 Bacteria 1935
190 Ga0075368_10141535 3300006042 Bacteria 1002
191 Ga0075363_100003163 3300006048 Bacteria 6930
192 Ga0075363_100070001 3300006048 Bacteria 1904
193 Ga0075364_10011381 3300006051 Bacteria 5405
194 Ga0075364_10020053 3300006051 Bacteria 4204
195 Ga0075364_10044928 3300006051 Bacteria 2874
196 Ga0075364_10223317 3300006051 Unclassified 1279
197 Ga0075364_10287374 3300006051 Bacteria 1119
198 Ga0075362_10177018 3300006177 Bacteria 1032
199 Ga0075367_10018509 3300006178 Bacteria 3845
200 Ga0075367_10159273 3300006178 Bacteria 1403
201 Ga0075367_10186630 3300006178 Bacteria 1293
202 Ga0075369_10063085 3300006186 Bacteria 1620
203 Ga0075366_10138885 3300006195 Bacteria 1468
204 Ga0075366_10205646 3300006195 Bacteria 1198
205 Ga0097621_100079086 3300006237 Bacteria 2733
206 Ga0075370_10012846 3300006353 Bacteria 4437
207 Ga0075370_10058931 3300006353 Bacteria 2184
208 Ga0068871_100221194 3300006358 Bacteria 1640
209 Ga0068871_100302702 3300006358 Bacteria 1404
210 Ga0068871_100508328 3300006358 Bacteria 1087
211 Ga0075428_100014565 3300006844 Bacteria 8735
212 Ga0075434_100669941 3300006871 Bacteria 1055
213 Ga0068865_100077817 3300006881 Bacteria 2371
214 Ga0068865_100425324 3300006881 Bacteria 1093
215 Ga0097620_100016876 3300006931 Bacteria 7328
216 Ga0097620_100166318 3300006931 Bacteria 2285
217 Ga0097620_100584282 3300006931 Bacteria 1211
218 Ga0075435_100222013 3300007076 Bacteria 1605
219 Ga0075435_100416675 3300007076 Bacteria 1156
220 Ga0105250_10069082 3300009092 Bacteria 1426
221 Ga0105240_10015922 3300009093 Bacteria 10199
222 Ga0105240_10199785 3300009093 Bacteria 2344
223 Ga0105240_10575624 3300009093 Bacteria 1243
224 Ga0111539_10042663 3300009094 Bacteria 5445
225 Ga0105245_10009744 3300009098 Bacteria 8373
226 Ga0105245_10041488 3300009098 Bacteria 4102
227 Ga0105245_10044825 3300009098 Bacteria 3948
228 Ga0105245_10183066 3300009098 Bacteria 2003
229 Ga0105245_10262667 3300009098 Bacteria 1681
230 Ga0105247_10009734 3300009101 Bacteria 5829
231 Ga0105247_10187484 3300009101 Bacteria 1383
232 Ga0105247_10348157 3300009101 Bacteria 1041
233 Ga0114129_10209945 3300009147 Bacteria 2633
234 Ga0114129_10364713 3300009147 Bacteria 1911
235 Ga0105243_10138872 3300009148 Bacteria 2071
236 Ga0105243_10249007 3300009148 Bacteria 1585
237 Ga0105243_10504984 3300009148 Bacteria 1146
238 Ga0105241_10174490 3300009174 Bacteria 1778
239 Ga0105241_10412078 3300009174 Bacteria 1187
240 Ga0105242_10018681 3300009176 Bacteria 5424
241 Ga0105242_10087044 3300009176 Bacteria 2622
242 Ga0105242_10632323 3300009176 Bacteria 1038
243 Ga0105242_10928944 3300009176 Bacteria 872
244 Ga0105248_10037824 3300009177 Bacteria 5400
245 Ga0105248_10303341 3300009177 Bacteria 1798
246 Ga0105248_10315684 3300009177 Bacteria 1760
247 Ga0105248_10372403 3300009177 Bacteria 1608
248 Ga0105248_10942923 3300009177 Bacteria 975
249 Ga0105248_11196719 3300009177 Bacteria 859
250 Ga0105237_10009776 3300009545 Bacteria 10257
251 Ga0105237_10016276 3300009545 Bacteria 7729
252 Ga0105237_10061924 3300009545 Bacteria 3740
253 Ga0105237_10065294 3300009545 Bacteria 3636
254 Ga0105237_10834968 3300009545 Bacteria 928
255 Ga0105238_10116422 3300009551 Bacteria 2652
256 Ga0105238_10351489 3300009551 Bacteria 1463
257 Ga0105238_10685202 3300009551 Bacteria 1037
258 Ga0105249_10369478 3300009553 Bacteria 1458
259 Ga0123340_1000167 3300009763 Bacteria 33533
260 Ga0123341_1010909 3300009765 Bacteria 8280
261 Ga0123341_1063720 3300009765 Bacteria 1748
262 Ga0123342_1018186 3300009766 Bacteria 5658
263 Ga0099796_10011789 3300010159 Bacteria 2450
264 Ga0105239_10032831 3300010375 Bacteria 5704
265 Ga0105239_10040749 3300010375 Bacteria 5089
266 Ga0105239_10046379 3300010375 Bacteria 4762
267 Ga0105239_10060369 3300010375 Bacteria 4162
268 Ga0105239_10094671 3300010375 Bacteria 3299
269 Ga0105239_10120138 3300010375 Bacteria 2917
270 Ga0105239_10371891 3300010375 Bacteria 1615
271 Ga0105239_10620053 3300010375 Bacteria 1234
272 Ga0105246_10022753 3300011119 Bacteria 4048
273 Ga0105246_10081357 3300011119 Bacteria 2308
274 Ga0105246_10203546 3300011119 Bacteria 1540
275 Ga0105246_10386997 3300011119 Bacteria 1157
276 Ga0157373_10000647 3300013100 Bacteria 27419
277 Ga0157373_10049148 3300013100 Bacteria 3006
278 Ga0157371_10028934 3300013102 Bacteria 4011
279 Ga0157371_10173482 3300013102 Bacteria 1541
280 Ga0157371_10436736 3300013102 Bacteria 961
281 Ga0157370_10022331 3300013104 Bacteria 6296
282 Ga0157370_10029317 3300013104 Bacteria 5403
283 Ga0157370_10031768 3300013104 Bacteria 5161
284 Ga0157370_10194746 3300013104 Bacteria 1881
285 Ga0157369_10011194 3300013105 Bacteria 10195
286 Ga0157369_10159097 3300013105 Bacteria 2385
287 Ga0157369_10215276 3300013105 Bacteria 2012
288 Ga0157374_10016521 3300013296 Bacteria 6489
289 Ga0157374_10164035 3300013296 Bacteria 2165
290 Ga0157378_10014932 3300013297 Bacteria 6797
291 Ga0157378_10225469 3300013297 Bacteria 1783
292 Ga0157378_10302560 3300013297 Bacteria 1548
293 Ga0163162_10274922 3300013306 Bacteria 1816
294 Ga0163162_10323237 3300013306 Bacteria 1675
295 Ga0157372_10000593 3300013307 Bacteria 39451
296 Ga0157372_10027954 3300013307 Bacteria 6149
297 Ga0157375_10283930 3300013308 Bacteria 1818
298 Ga0163163_10042519 3300014325 Bacteria 4451
299 Ga0163163_10845215 3300014325 Bacteria 979
300 Ga0157380_10152327 3300014326 Bacteria 2000
301 Ga0157380_10534424 3300014326 Bacteria 1147
302 Ga0157377_10027973 3300014745 Bacteria 3031
303 Ga0157377_10214457 3300014745 Bacteria 1229
304 Ga0157379_10053440 3300014968 Bacteria 3608
305 Ga0157379_10112157 3300014968 Bacteria 2450
306 Ga0157376_10009078 3300014969 Bacteria 7203
307 Ga0157376_10023064 3300014969 Bacteria 4864
308 Ga0157376_10032010 3300014969 Bacteria 4218
309 Ga0157376_10160662 3300014969 Bacteria 2036
310 Ga0157376_10713806 3300014969 Bacteria 1009
311 Ga0163161_10079952 3300017792 Bacteria 2405
312 Ga0163161_10145217 3300017792 Bacteria 1799
313 Ga0206356_10161480 3300020070 Bacteria 2377
314 Ga0206354_10602836 3300020081 Bacteria 882
315 Ga0213876_10077997 3300021384 Bacteria 1750
316 Ga0209563_100670 3300025230 Bacteria 10845
317 Ga0207425_1010250 3300025245 Bacteria 2289
318 Ga0207425_1017347 3300025245 Bacteria 1583
319 Ga0209677_100221 3300025253 Bacteria 40837
320 Ga0209677_101711 3300025253 Bacteria 9125
321 Ga0209129_1000489 3300025258 Bacteria 28872
322 Ga0209233_1002119 3300025261 Bacteria 7478
323 Ga0209455_1022391 3300025272 Bacteria 1205
324 Ga0209455_1031154 3300025272 Bacteria 900
325 Ga0209025_1000003 3300025294 Bacteria 1366495
326 Ga0209025_1002657 3300025294 Bacteria 18286
327 Ga0209564_1006843 3300025295 Bacteria 6021
328 Ga0209758_1000030 3300025297 Bacteria 509217
329 Ga0209758_1001470 3300025297 Bacteria 27657
330 Ga0209758_1002448 3300025297 Bacteria 18947
331 Ga0209758_1003221 3300025297 Bacteria 15206
332 Ga0209758_1003848 3300025297 Bacteria 13172
333 Ga0209758_1004001 3300025297 Bacteria 12754
334 Ga0209758_1007239 3300025297 Bacteria 7632
335 Ga0209758_1031807 3300025297 Bacteria 2156
336 Ga0209758_1036140 3300025297 Bacteria 1934
337 Ga0209758_1041277 3300025297 Bacteria 1727
338 Ga0209758_1051646 3300025297 Bacteria 1429
339 Ga0209256_1004427 3300025299 Bacteria 8829
340 Ga0207426_1001583 3300025302 Bacteria 18291
341 Ga0207426_1010110 3300025302 Bacteria 3686
342 Ga0209257_1003693 3300025304 Bacteria 12738
343 Ga0209257_1007061 3300025304 Bacteria 6941
344 Ga0207697_10108442 3300025315 Bacteria 1188
345 Ga0207710_10077684 3300025900 Bacteria 1534
346 Ga0207710_10133009 3300025900 Bacteria 1196
347 Ga0207688_10026849 3300025901 Bacteria 3168
348 Ga0207688_10083585 3300025901 Bacteria 1826
349 Ga0207688_10256468 3300025901 Bacteria 1060
350 Ga0207647_10002968 3300025904 Bacteria 12759
351 Ga0207645_10112693 3300025907 Bacteria 1762
352 Ga0207645_10256861 3300025907 Bacteria 1157
353 Ga0207643_10107871 3300025908 Bacteria 1638
354 Ga0207705_10034198 3300025909 Bacteria 3634
355 Ga0207705_10318544 3300025909 Bacteria 1195
356 Ga0207705_10348081 3300025909 Bacteria 1141
357 Ga0207654_10042739 3300025911 Bacteria 2566
358 Ga0207707_10159207 3300025912 Bacteria 1974
359 Ga0207707_10190557 3300025912 Bacteria 1789
360 Ga0207695_10001156 3300025913 Bacteria 45753
361 Ga0207695_10195650 3300025913 Bacteria 1938
362 Ga0207695_10483740 3300025913 Bacteria 1120
363 Ga0207671_10009815 3300025914 Bacteria 7966
364 Ga0207671_10084741 3300025914 Bacteria 2380
365 Ga0207671_10208480 3300025914 Bacteria 1528
366 Ga0207671_10215184 3300025914 Bacteria 1504
367 Ga0207671_10218399 3300025914 Bacteria 1493
368 Ga0207660_10012643 3300025917 Bacteria 5527
369 Ga0207660_10085154 3300025917 Bacteria 2331
370 Ga0207660_10329673 3300025917 Bacteria 1220
371 Ga0207657_10000510 3300025919 Bacteria 41051
372 Ga0207657_10030292 3300025919 Bacteria 4912
373 Ga0207657_10032543 3300025919 Bacteria 4710
374 Ga0207657_10053216 3300025919 Bacteria 3507
375 Ga0207657_10187229 3300025919 Bacteria 1671
376 Ga0207657_10212004 3300025919 Bacteria 1554
377 Ga0207657_10350377 3300025919 Bacteria 1164
378 Ga0207649_10018858 3300025920 Bacteria 3934
379 Ga0207649_10139777 3300025920 Bacteria 1655
380 Ga0207652_10023363 3300025921 Bacteria 5121
381 Ga0207652_10042542 3300025921 Bacteria 3867
382 Ga0207652_10180515 3300025921 Bacteria 1897
383 Ga0207652_10632312 3300025921 Bacteria 958
384 Ga0207646_10639630 3300025922 Bacteria 953
385 Ga0207681_10047401 3300025923 Bacteria 2895
386 Ga0207681_10383193 3300025923 Bacteria 1132
387 Ga0207694_10120369 3300025924 Bacteria 2095
388 Ga0207694_10223641 3300025924 Bacteria 1536
389 Ga0207650_10728091 3300025925 Bacteria 839
390 Ga0207659_10500644 3300025926 Bacteria 1028
391 Ga0207664_10270537 3300025929 Bacteria 1488
392 Ga0207644_10003534 3300025931 Bacteria 10123
393 Ga0207690_10000725 3300025932 Bacteria 21280
394 Ga0207690_10079258 3300025932 Bacteria 2288
395 Ga0207690_10566500 3300025932 Bacteria 925
396 Ga0207706_10000093 3300025933 Bacteria 93173
397 Ga0207706_10039680 3300025933 Bacteria 4174
398 Ga0207706_10107804 3300025933 Bacteria 2451
399 Ga0207686_10257785 3300025934 Bacteria 1277
400 Ga0207709_10258685 3300025935 Bacteria 1275
401 Ga0207709_10356389 3300025935 Bacteria 1106
402 Ga0207709_10529046 3300025935 Bacteria 924
403 Ga0207670_10344009 3300025936 Bacteria 1179
404 Ga0207669_10042091 3300025937 Bacteria 2663
405 Ga0207704_10087655 3300025938 Bacteria 2033
406 Ga0207704_10455356 3300025938 Bacteria 1022
407 Ga0207691_10056371 3300025940 Bacteria 3579
408 Ga0207691_10419708 3300025940 Bacteria 1140
409 Ga0207711_10023938 3300025941 Bacteria 5111
410 Ga0207711_10056621 3300025941 Bacteria 3369
411 Ga0207711_10310148 3300025941 Bacteria 1457
412 Ga0207689_10009995 3300025942 Bacteria 8179
413 Ga0207679_10068588 3300025945 Bacteria 2665
414 Ga0207679_10139755 3300025945 Bacteria 1956
415 Ga0207679_10352563 3300025945 Bacteria 1283
416 Ga0207667_10003071 3300025949 Bacteria 20698
417 Ga0207667_10076640 3300025949 Bacteria 3469
418 Ga0207667_10091474 3300025949 Bacteria 3143
419 Ga0207667_10375327 3300025949 Bacteria 1449
420 Ga0207667_11023390 3300025949 Bacteria 812
421 Ga0207651_10226524 3300025960 Bacteria 1515
422 Ga0207651_10433481 3300025960 Bacteria 1124
423 Ga0207712_10032642 3300025961 Bacteria 3515
424 Ga0207668_10239790 3300025972 Bacteria 1466
425 Ga0207640_10062308 3300025981 Bacteria 2474
426 Ga0207658_10046691 3300025986 Bacteria 3165
427 Ga0207658_10110777 3300025986 Bacteria 2170
428 Ga0207658_10845704 3300025986 Bacteria 832
429 Ga0207677_10068509 3300026023 Bacteria 2491
430 Ga0207703_10036511 3300026035 Bacteria 3912
431 Ga0207703_10075570 3300026035 Bacteria 2793
432 Ga0207703_10307582 3300026035 Bacteria 1448
433 Ga0207703_10599310 3300026035 Bacteria 1042
434 Ga0207639_10051447 3300026041 Bacteria 3133
435 Ga0207639_10123494 3300026041 Bacteria 2131
436 Ga0207639_10139648 3300026041 Bacteria 2017
437 Ga0207639_10182571 3300026041 Bacteria 1786
438 Ga0207639_10303926 3300026041 Bacteria 1411
439 Ga0207678_10019543 3300026067 Bacteria 5952
440 Ga0207678_10030242 3300026067 Bacteria 4728
441 Ga0207678_10320935 3300026067 Bacteria 1333
442 Ga0207708_10011392 3300026075 Bacteria 6623
443 Ga0207708_10072081 3300026075 Bacteria 2647
444 Ga0207702_10004987 3300026078 Bacteria 11661
445 Ga0207702_10052978 3300026078 Bacteria 3435
446 Ga0207702_10263990 3300026078 Bacteria 1622
447 Ga0207702_10452340 3300026078 Bacteria 1246
448 Ga0207702_11196976 3300026078 Bacteria 754
449 Ga0207641_10358026 3300026088 Bacteria 1392
450 Ga0207641_10404061 3300026088 Bacteria 1312
451 Ga0207648_10193731 3300026089 Bacteria 1802
452 Ga0207648_10250267 3300026089 Bacteria 1580
453 Ga0207648_10782948 3300026089 Bacteria 887
454 Ga0207676_10098407 3300026095 Bacteria 2418
455 Ga0207676_10680803 3300026095 Bacteria 995
456 Ga0207674_10097268 3300026116 Bacteria 2927
457 Ga0207675_100025561 3300026118 Bacteria 5495
458 Ga0207675_100030002 3300026118 Bacteria 5062
459 Ga0207683_10011692 3300026121 Bacteria 7493
460 Ga0207683_10049887 3300026121 Bacteria 3664
461 Ga0207683_10078177 3300026121 Bacteria 2932
462 Ga0207683_10166455 3300026121 Bacteria 1995
463 Ga0207683_10170942 3300026121 Bacteria 1968
464 Ga0207683_10237400 3300026121 Bacteria 1663
465 Ga0207698_10054572 3300026142 Bacteria 3075
466 Ga0207698_10114172 3300026142 Bacteria 2271
467 Ga0209389_1000163 3300027296 Bacteria 55041
468 Ga0209489_101100 3300027361 Bacteria 55041
469 Ga0209700_100014 3300027363 Bacteria 299349
470 Ga0268266_10004510 3300028379 Bacteria 13310
471 Ga0268266_10014493 3300028379 Bacteria 6775
472 Ga0268266_10250808 3300028379 Bacteria 1637
473 Ga0268266_10263322 3300028379 Bacteria 1598
474 Ga0268266_10688045 3300028379 Bacteria 985
475 Ga0268265_10002012 3300028380 Bacteria 16001
476 Ga0268265_10557746 3300028380 Bacteria 1088
477 Ga0268264_10000107 3300028381 Bacteria 209105
478 Ga0268264_10101045 3300028381 Bacteria 2506
479 Ga0268264_10745597 3300028381 Bacteria 975
480 Ga0265334_10017875 3300028573 Bacteria 2924
481 Ga0265318_10009533 3300028577 Bacteria 4263
482 Ga0265323_10000706 3300028653 Bacteria 18167
483 Ga0265336_10000683 3300028666 Bacteria 18322
484 Ga0307517_10001121 3300028786 Bacteria 45217
485 Ga0307515_10048703 3300028794 Bacteria 6400
486 Ga0265338_10001041 3300028800 Bacteria 46363
487 Ga0265324_10004820 3300029957 Bacteria 5958
488 Ga0316177_1142486 3300030731 Bacteria 4082
489 Ga0316178_1062662 3300030735 Bacteria 1086
490 Ga0307513_10170936 3300031456 Bacteria 2051
491 Ga0307513_10238570 3300031456 Bacteria 1625
492 Ga0307513_10326987 3300031456 Bacteria 1289
493 Ga0307509_10032140 3300031507 Bacteria 5786
494 Ga0307509_10306562 3300031507 Bacteria 1332
495 Ga0307509_10355137 3300031507 Bacteria 1187
496 Ga0307408_100000252 3300031548 Bacteria 54975
497 Ga0265313_10085917 3300031595 Bacteria 1420
498 Ga0307508_10000154 3300031616 Bacteria 82824
499 Ga0307508_10144852 3300031616 Bacteria 1980
500 Ga0307508_10199788 3300031616 Bacteria 1600
501 Ga0307508_10284103 3300031616 Bacteria 1248
502 Ga0265314_10084709 3300031711 Bacteria 2080
503 Ga0265342_10000687 3300031712 Bacteria 35389
504 Ga0307516_10009658 3300031730 Bacteria 10725
505 Ga0307516_10046891 3300031730 Bacteria 4261
506 Ga0307516_10048561 3300031730 Bacteria 4176
507 Ga0307516_10058550 3300031730 Bacteria 3750
508 Ga0307405_10166428 3300031731 Bacteria 1568
509 Ga0307405_10239103 3300031731 Bacteria 1344
510 Ga0307416_100250974 3300032002 Bacteria 1722
511 Ga0307416_100369373 3300032002 Bacteria 1460
512 Ga0307411_10079962 3300032005 Bacteria 2246
513 Ga0307415_100195771 3300032126 Bacteria 1599
514 Ga0307510_10020868 3300033180 Bacteria 7646
515 Ga0307510_10035200 3300033180 Bacteria 5596
516 Ga0307510_10210970 3300033180 Bacteria 1464
517 Ga0307510_10229271 3300033180 Bacteria 1361
518 Ga0373930_0038620 3300034816 Bacteria 1009
519 Ga0373936_0034200 3300035113 Bacteria 2018
520 Ga0373936_0050697 3300035113 Bacteria 1679
521 Ga0373941_0018909 3300035115 Bacteria 1910
522 Ga0373945_0023969 3300035116 Bacteria 2111
523 Ga0373954_0049206 3300035118 Bacteria 1976
524 Ga0373956_0016462 3300035119 Bacteria 3106
525 Ga0373943_0019761 3300035170 Bacteria 3101
526 Ga0373946_0077904 3300035171 Bacteria 1445
527 Ga0373946_0156936 3300035171 Bacteria 1066
528 Ga0373924_0105697 3300035410 Bacteria 1213
529 Ga0373931_0000922 3300035691 Bacteria 12362
530 Ga0373931_0069916 3300035691 Bacteria 1914
531 Ga0373931_0401473 3300035691 Bacteria 868
532 Ga0373935_0007139 3300035692 Bacteria 6669
533 Ga0373935_0061490 3300035692 Bacteria 2404
534 Ga0373927_0003207 3300035695 Bacteria 11783
535 Ga0373927_0027031 3300035695 Bacteria 3750
536 Ga0373927_0130679 3300035695 Bacteria 1640
537 Ga0373927_0304999 3300035695 Bacteria 1048
538 Ga0373927_0310865 3300035695 Bacteria 1037
539 Ga0373927_0369211 3300035695 Bacteria 946
540 Ga0373947_0016126 3300035725 Bacteria 4293
541 Ga0373925_0051695 3300037068 Bacteria 3068
542 Ga0373925_0386573 3300037068 Bacteria 1140
543 Ga0373925_0448791 3300037068 Bacteria 1056
544 Ga0395898_0333998 3300037466 Bacteria 1445
545 Ga0395905_0003426 3300037471 Bacteria 16972
546 Ga0395905_0072293 3300037471 Bacteria 3234
547 Ga0395905_0177334 3300037471 Bacteria 2000
548 Ga0395905_0213892 3300037471 Bacteria 1806
549 Ga0436364_1376044 3300037853 Bacteria 1231
550 Ga0436365_1627177 3300039437 Bacteria 3436
551 Ga0436363_0270101 3300039450 Bacteria 4354
552 Ga0439465_0010459 3300041413 Bacteria 2914
553 Ga0451791_0655594 3300041451 Bacteria 961
554 Ga0451849_1322946 3300041505 Bacteria 951
555 Ga0439459_0008892 3300042438 Bacteria 1727
556 Ga0466972_0078620 3300044658 Bacteria 1571
557 Ga0466963_0274646 3300044694 Unclassified 1184
558 Ga0466957_0195755 3300044842 Bacteria 1326
559 Ga0466957_0380207 3300044842 Bacteria 963
560 Ga0466960_0235099 3300044901 Bacteria 1013
561 Ga0466959_0221764 3300045049 Bacteria 1311
562 Ga0466958_0104327 3300045836 Bacteria 1766
563 Ga0466967_0001133 3300045976 Bacteria 14847
564 Ga0495617_058050 3300046452 Bacteria 1282
565 Ga0495592_0037169 3300046454 Bacteria 3666
566 Ga0495603_0000182 3300046455 Bacteria 32426
567 Ga0495603_0004488 3300046455 Bacteria 8327
568 Ga0495603_0030757 3300046455 Bacteria 3233
569 Ga0495603_0148374 3300046455 Bacteria 1363
570 Ga0495603_0363663 3300046455 Bacteria 830
571 Ga0495629_0000314 3300046459 Bacteria 41394
572 Ga0495641_0001508 3300046461 Bacteria 19835
573 Ga0495641_0041135 3300046461 Bacteria 2148
574 Ga0495651_0012151 3300046462 Bacteria 6629
575 Ga0495651_0180065 3300046462 Bacteria 1497
576 Ga0495653_0101966 3300046463 Bacteria 2078
577 Ga0495653_0109029 3300046463 Bacteria 1993
578 Ga0495580_0036094 3300046472 Bacteria 3550
579 Ga0495582_0000597 3300046473 Bacteria 19925
580 Ga0495582_0016511 3300046473 Bacteria 4044
581 Ga0495605_0120213 3300046474 Bacteria 1191
582 Ga0495639_0000235 3300046475 Bacteria 27682
583 Ga0495639_0089101 3300046475 Bacteria 1445
584 Ga0495662_0001470 3300046476 Bacteria 11662
585 Ga0495664_0005693 3300046477 Bacteria 6856
586 Ga0495664_0315894 3300046477 Bacteria 942
587 Ga0495584_0015964 3300046491 Bacteria 3832
588 Ga0495585_0048788 3300046492 Bacteria 2353
589 Ga0495594_0000302 3300046499 Bacteria 24227
590 Ga0495607_0142450 3300046501 Bacteria 1235
591 Ga0495606_0047029 3300046507 Bacteria 2848
592 Ga0495606_0106966 3300046507 Bacteria 1693
593 Ga0495606_0116102 3300046507 Bacteria 1608
594 Ga0495606_0159498 3300046507 Bacteria 1317
595 Ga0495610_0099204 3300046512 Bacteria 1307
596 Ga0495610_0136409 3300046512 Bacteria 1060
597 Ga0495616_0020136 3300046513 Bacteria 3634
598 Ga0495616_0032705 3300046513 Bacteria 2715
599 Ga0495628_0029830 3300046516 Bacteria 4420
600 Ga0495628_0274453 3300046516 Bacteria 1253
601 Ga0495628_0294238 3300046516 Bacteria 1203
602 Ga0495628_0376855 3300046516 Bacteria 1040
603 Ga0495630_0002415 3300046517 Bacteria 12968
604 Ga0495632_0067614 3300046519 Bacteria 1723
605 Ga0495637_0087103 3300046520 Bacteria 1237
606 Ga0495643_0208714 3300046522 Bacteria 933
607 Ga0495644_0072945 3300046523 Bacteria 1291
608 Ga0495648_0000619 3300046524 Bacteria 38032
609 Ga0495648_0006267 3300046524 Bacteria 9733
610 Ga0495666_0035782 3300046526 Bacteria 2419
611 Ga0495652_0006258 3300046529 Bacteria 11097
612 Ga0495652_0041525 3300046529 Bacteria 3970
613 Ga0495652_0232304 3300046529 Bacteria 1378
614 Ga0495665_0000619 3300046531 Bacteria 18044
615 Ga0495640_0000308 3300046533 Bacteria 33750
616 Ga0495640_0124019 3300046533 Bacteria 1676
617 Ga0495640_0229529 3300046533 Bacteria 1168
618 Ga0495587_0032889 3300046536 Bacteria 3132
619 Ga0495609_0102427 3300046538 Bacteria 1240
620 Ga0495609_0155626 3300046538 Bacteria 971
621 Ga0495621_0064946 3300046539 Bacteria 1332
622 Ga0495645_0002277 3300046543 Bacteria 13061
623 Ga0495622_0033182 3300046557 Bacteria 2410
624 Ga0495622_0056752 3300046557 Bacteria 1816
625 Ga0495622_0072635 3300046557 Bacteria 1587
626 Ga0495633_0012187 3300046558 Bacteria 4588
627 Ga0495633_0063792 3300046558 Bacteria 1723
628 Ga0495667_0008896 3300046559 Bacteria 6827
629 Ga0495656_0042782 3300046615 Bacteria 1898
630 Ga0495668_0017158 3300046616 Bacteria 4205
631 Ga0495668_0052268 3300046616 Bacteria 2261
632 Ga0495668_0069062 3300046616 Bacteria 1943
633 Ga0495668_0131199 3300046616 Bacteria 1371
634 Ga0495634_0001483 3300046642 Bacteria 20763
635 Ga0495634_0047054 3300046642 Bacteria 2908
636 Ga0495611_0113091 3300046648 Bacteria 1264
637 Ga0495625_0123597 3300046660 Bacteria 1759
638 Ga0495625_0134632 3300046660 Bacteria 1671
639 Ga0495625_0164807 3300046660 Bacteria 1483
640 Ga0495625_0195089 3300046660 Bacteria 1339
641 Ga0495635_0003423 3300046663 Bacteria 10975
642 Ga0495635_0045072 3300046663 Bacteria 3042
643 Ga0495661_0102372 3300046665 Bacteria 1610
644 Ga0495661_0137567 3300046665 Bacteria 1332
645 Ga0495588_0004152 3300046674 Bacteria 6381
646 Ga0495588_0006111 3300046674 Bacteria 5405
647 Ga0495588_0081788 3300046674 Bacteria 1686
648 Ga0495657_0021179 3300046675 Bacteria 4666
649 Ga0495657_0060848 3300046675 Bacteria 2500
650 Ga0495657_0135004 3300046675 Bacteria 1542
651 Ga0495599_0032491 3300046678 Bacteria 3276
652 Ga0495623_0124232 3300046679 Bacteria 1551
653 Ga0495646_0077067 3300046680 Bacteria 1951
654 Ga0495647_0000405 3300046681 Bacteria 12350
655 Ga0495647_0047624 3300046681 Bacteria 1655
656 Ga0495647_0119342 3300046681 Bacteria 1108
657 Ga0495658_0000936 3300046683 Bacteria 15569
658 Ga0495658_0259591 3300046683 Bacteria 1094
659 Ga0495669_0035983 3300046684 Bacteria 2187
660 Ga0495669_0096619 3300046684 Bacteria 1369
661 Ga0495613_0004828 3300046689 Bacteria 10114
662 Ga0495613_0082107 3300046689 Bacteria 2341
663 Ga0495624_0000810 3300046690 Bacteria 24701
664 Ga0495624_0116093 3300046690 Bacteria 1645
665 Ga0495670_0076587 3300046691 Bacteria 1700
666 Ga0495670_0276454 3300046691 Bacteria 898
667 Ga0495671_0106338 3300046692 Bacteria 1370
668 Ga0495589_0092108 3300046794 Bacteria 1472
669 Ga0495600_0004756 3300046809 Bacteria 8148
670 Ga0495600_0049276 3300046809 Bacteria 2748
671 Ga0495600_0211607 3300046809 Bacteria 1242
672 Ga0495660_0165806 3300046810 Bacteria 1080
673 Ga0495581_0000683 3300047315 Bacteria 17799
674 Ga0495581_0037772 3300047315 Bacteria 2795
675 Ga0495604_0005707 3300047317 Bacteria 9871
676 Ga0495604_0321556 3300047317 Bacteria 1034
677 Ga0495604_0347989 3300047317 Bacteria 985
678 Ga0495636_0027019 3300047318 Bacteria 2337
679 Ga0495674_0033870 3300047319 Bacteria 4623
680 Ga0495672_0018381 3300047320 Bacteria 4642
681 Ga0495672_0091395 3300047320 Bacteria 1671
682 Ga0495676_0005624 3300047321 Bacteria 11492
683 Ga0495676_0146325 3300047321 Bacteria 1687
684 Ga0495676_0165304 3300047321 Bacteria 1562
685 Ga0495680_0181214 3300047322 Bacteria 1520
686 Ga0495680_0201624 3300047322 Bacteria 1427
687 Ga0495683_0026647 3300047323 Bacteria 2958
688 Ga0495683_0048443 3300047323 Bacteria 2131
689 Ga0495683_0068885 3300047323 Bacteria 1739
690 Ga0495683_0203252 3300047323 Bacteria 892
691 Ga0495687_003554 3300047443 Bacteria 11205
692 Ga0495687_029783 3300047443 Bacteria 2521
693 Ga0495675_0022183 3300047444 Bacteria 4046
694 Ga0495677_0019823 3300047445 Bacteria 2439
695 Ga0495673_0024196 3300047469 Bacteria 2940
696 Ga0495684_0014657 3300047471 Bacteria 6032
697 Ga0495686_0139174 3300047472 Bacteria 1433
698 Ga0495686_0174065 3300047472 Bacteria 1251
699 Ga0495686_0329425 3300047472 Bacteria 835
700 Ga0495593_0000370 3300047673 Bacteria 24754
701 Ga0495602_0055398 3300048088 Bacteria 3492
702 Ga0495614_0067848 3300048089 Bacteria 1535
703 Ga0496100_0057050 3300048903 Bacteria 2557
704 Ga0496100_0059644 3300048903 Bacteria 2508
705 Ga0496101_0011788 3300048904 Bacteria 5814
706 Ga0496101_0079991 3300048904 Bacteria 2414
707 Ga0496102_0035160 3300048905 Bacteria 4508
708 Ga0496102_0039885 3300048905 Bacteria 4245
709 Ga0496102_0182086 3300048905 Bacteria 1980
710 Ga0496102_0296367 3300048905 Bacteria 1524
711 Ga0496102_0650350 3300048905 Bacteria 977
712 Ga0496103_0050386 3300048906 Bacteria 2576
713 Ga0496103_0199871 3300048906 Bacteria 1285
714 Ga0496104_0027452 3300048907 Bacteria 5267
715 Ga0496104_0046793 3300048907 Bacteria 4075
716 Ga0496104_0145388 3300048907 Bacteria 2277
717 Ga0496104_0156640 3300048907 Bacteria 2186
718 Ga0496104_0259136 3300048907 Bacteria 1652
719 Ga0496105_0248534 3300048908 Bacteria 1441
720 Ga0496105_0492742 3300048908 Bacteria 963
721 Ga0496105_0636787 3300048908 Bacteria 824
722 Ga0496106_0000788 3300048909 Bacteria 22899
723 Ga0496106_0006629 3300048909 Bacteria 8572
724 Ga0496106_0010327 3300048909 Bacteria 6902
725 Ga0496106_0071909 3300048909 Bacteria 2644
726 Ga0496106_0085959 3300048909 Bacteria 2422
727 Ga0496106_0399575 3300048909 Bacteria 1104
728 Ga0496107_0010427 3300048910 Bacteria 6455
729 Ga0496107_0073394 3300048910 Bacteria 2488
730 Ga0496108_0029240 3300048911 Bacteria 4562
731 Ga0496108_0041613 3300048911 Bacteria 3836
732 Ga0496108_0138390 3300048911 Bacteria 2097
733 Ga0496108_0378606 3300048911 Bacteria 1236
734 Ga0496108_0874853 3300048911 Bacteria 772
735 Ga0496109_0074114 3300048912 Bacteria 3128
736 Ga0496109_0216868 3300048912 Bacteria 1799
737 Ga0496110_0009815 3300048913 Bacteria 7754
738 Ga0496110_0035698 3300048913 Bacteria 4314
739 Ga0496111_0002060 3300048914 Bacteria 11981
740 Ga0496111_0021035 3300048914 Bacteria 4550
741 Ga0496112_0074644 3300048915 Bacteria 3353
742 Ga0496112_0150982 3300048915 Bacteria 2290
743 Ga0496112_0168267 3300048915 Bacteria 2157
744 Ga0496112_0242858 3300048915 Bacteria 1753
745 Ga0496113_0005020 3300048916 Bacteria 8207
746 Ga0496113_0048688 3300048916 Bacteria 3154
747 Ga0496113_0049431 3300048916 Bacteria 3131
748 Ga0496114_0002069 3300048917 Bacteria 15273
749 Ga0496114_0117355 3300048917 Bacteria 2286
750 Ga0496114_0519902 3300048917 Bacteria 1053
751 Ga0496115_0005035 3300048918 Bacteria 9600
752 Ga0496115_0051684 3300048918 Bacteria 3295
753 Ga0496115_0081154 3300048918 Bacteria 2641
754 Ga0496116_0026977 3300048919 Bacteria 4188
755 Ga0496116_0135082 3300048919 Bacteria 1398
756 Ga0496117_0008719 3300048920 Bacteria 9584
757 Ga0496117_0105573 3300048920 Bacteria 1770
758 Ga0496117_0139628 3300048920 Bacteria 1453
759 Ga0496117_0148990 3300048920 Bacteria 1388
760 Ga0496118_0004035 3300048921 Bacteria 17843
761 Ga0496118_0067376 3300048921 Bacteria 2607
762 Ga0496118_0104340 3300048921 Bacteria 1903
763 Ga0496118_0243986 3300048921 Bacteria 1026
764 Ga0496119_0022541 3300048922 Bacteria 4502
765 Ga0496119_0140231 3300048922 Bacteria 1306
766 Ga0496120_0111142 3300048923 Bacteria 1432
767 Ga0496120_0223240 3300048923 Bacteria 899
768 Ga0496121_0000640 3300048924 Bacteria 65295
769 Ga0496121_0006350 3300048924 Bacteria 14731
770 Ga0496121_0014968 3300048924 Bacteria 8170
771 Ga0496121_0018042 3300048924 Bacteria 7147
772 Ga0496121_0027740 3300048924 Bacteria 5292
773 Ga0496121_0042560 3300048924 Bacteria 3947
774 Ga0496121_0097728 3300048924 Bacteria 2274
775 Ga0496121_0117532 3300048924 Bacteria 2014
776 Ga0496121_0176268 3300048924 Bacteria 1547
777 Ga0496121_0355383 3300048924 Bacteria 974
778 Ga0496122_0000072 3300048925 Bacteria 222436
779 Ga0496122_0096390 3300048925 Bacteria 1995
780 Ga0496123_0000035 3300048926 Bacteria 267288
781 Ga0496124_0000004 3300048927 Bacteria 976131
782 Ga0496124_0007008 3300048927 Bacteria 12079
783 Ga0496124_0049279 3300048927 Bacteria 3594
784 Ga0496124_0051307 3300048927 Bacteria 3511
785 Ga0496124_0068381 3300048927 Bacteria 2952
786 Ga0496124_0340935 3300048927 Unclassified 1064
787 Ga0496125_0000136 3300048928 Bacteria 160544
788 Ga0496125_0049499 3300048928 Bacteria 3492
789 Ga0496125_0052528 3300048928 Bacteria 3351
790 Ga0496125_0063712 3300048928 Bacteria 2937
791 Ga0496125_0071712 3300048928 Bacteria 2704
792 Ga0496125_0124627 3300048928 Bacteria 1829
793 Ga0496125_0379349 3300048928 Unclassified 834
794 Ga0496126_0013134 3300048929 Bacteria 8447
795 Ga0496126_0030491 3300048929 Bacteria 5108
796 Ga0496126_0064381 3300048929 Bacteria 3284
797 Ga0496126_0067186 3300048929 Bacteria 3204
798 Ga0496126_0108383 3300048929 Bacteria 2422
799 Ga0496126_0185856 3300048929 Bacteria 1762
800 Ga0496126_0360985 3300048929 Bacteria 1186
801 Ga0496126_0462019 3300048929 Bacteria 1020
802 Ga0501036_0080390 3300049572 Bacteria 2756
803 Ga0501036_0478362 3300049572 Bacteria 1037
804 Ga0501038_0280696 3300049574 Bacteria 1311
805 Ga0501039_0272995 3300049575 Bacteria 1329
806 Ga0501042_0159742 3300049578 Bacteria 1626
807 Ga0501047_0009703 3300049581 Bacteria 9102
808 Ga0501047_0191466 3300049581 Bacteria 1908
809 Ga0501069_0197914 3300049585 Bacteria 1164
810 Ga0501076_0021084 3300049592 Bacteria 4994
811 Ga0501222_019810 3300049662 Unclassified 899
812 Ga0501227_002739 3300049665 Bacteria 3874
813 Ga0501079_0125280 3300049741 Bacteria 1999
814 Ga0501080_0452554 3300049742 Bacteria 1151
815 Ga0501279_002614 3300049775 Bacteria 2353
816 Ga0501279_005909 3300049775 Unclassified 1611
817 Ga0501044_0214807 3300049823 Bacteria 1876
818 nmdc:mga03683_144337_c1 3300050489 Bacteria 1071
819 nmdc:mga03683_147991_c1 3300050489 Unclassified 1058
820 nmdc:mga03683_82892_c1 3300050489 Bacteria 1387
821 nmdc:mga03n38_989_c1 3300050490 Bacteria 7760
822 nmdc:mga00v17_11205_c1 3300050491 Bacteria 4923
823 nmdc:mga00v17_171917_c1 3300050491 Bacteria 1397
824 nmdc:mga00v17_407537_c1 3300050491 Bacteria 883
825 nmdc:mga00v17_51920_c1 3300050491 Bacteria 2493
826 nmdc:mga0yw44_143278_c1 3300050492 Bacteria 1554
827 nmdc:mga0yw44_15824_c1 3300050492 Bacteria 3350
828 nmdc:mga0yw44_20383_c1 3300050492 Bacteria 3679
829 nmdc:mga0yw44_24975_c1 3300050492 Bacteria 3390
830 nmdc:mga0yw44_311142_c1 3300050492 Bacteria 1057
831 nmdc:mga0yw44_331579_c1 3300050492 Bacteria 1023
832 nmdc:mga0yw44_71313_c1 3300050492 Bacteria 2157
833 nmdc:mga0k408_100771_c1 3300050493 Bacteria 1703
834 nmdc:mga0k408_1944_c1 3300050493 Bacteria 11068
835 nmdc:mga0k408_247264_c1 3300050493 Bacteria 1065
836 nmdc:mga0k408_341162_c1 3300050493 Bacteria 893
837 nmdc:mga06z11_3558_c1 3300050494 Bacteria 6033
838 nmdc:mga06z11_47899_c1 3300050494 Bacteria 2173
839 nmdc:mga06z11_94031_c1 3300050494 Bacteria 1633
840 nmdc:mga07m45_115683_c1 3300050496 Bacteria 1546
841 nmdc:mga07m45_130042_c1 3300050496 Bacteria 1457
842 nmdc:mga07m45_269500_c1 3300050496 Bacteria 990
843 nmdc:mga07m45_6373_c1 3300050496 Bacteria 4073
844 nmdc:mga09592_656276_c1 3300050508 Bacteria 895
845 nmdc:mga0qj67_354668_c1 3300050509 Bacteria 1185
846 nmdc:mga0n895_196917_c1 3300050512 Bacteria 2046
847 nmdc:mga0n895_243665_c1 3300050512 Bacteria 1824
848 nmdc:mga0n895_80087_c1 3300050512 Bacteria 3253
849 nmdc:mga0rr50_32574_c1 3300050513 Bacteria 3714
850 nmdc:mga0a205_393136_c1 3300050515 Bacteria 1250
851 nmdc:mga0sz30_102954_c1 3300050516 Bacteria 1248
852 nmdc:mga0sz30_2977_c1 3300050516 Bacteria 6074
853 nmdc:mga0sz30_37766_c1 3300050516 Bacteria 2022
854 nmdc:mga0sz30_98394_c1 3300050516 Bacteria 1277
855 Ga0495601_0170003 3300053077 Bacteria 1425
856 Ga0495612_0037009 3300053078 Bacteria 1981
857 Ga0500635_0001720 3300053080 Bacteria 5313
858 Ga0500635_0019869 3300053080 Bacteria 2049
859 Ga0500635_0141489 3300053080 Bacteria 913
860 Ga0495595_0046772 3300053084 Bacteria 1994
861 Ga0495619_0238218 3300053085 Bacteria 1261
862 Ga0495619_0295850 3300053085 Bacteria 1121
863 Ga0500578_0154790 3300053086 Bacteria 1426
864 Ga0500578_0187342 3300053086 Bacteria 1272
865 Ga0500578_0271687 3300053086 Bacteria 1014
866 Ga0500643_000160 3300053087 Bacteria 66845
867 Ga0500643_018379 3300053087 Bacteria 2320
868 Ga0500581_145907 3300053089 Bacteria 1116
869 Ga0500583_0171510 3300053092 Bacteria 1080
870 Ga0500651_0010771 3300053093 Bacteria 5494
871 Ga0500651_0272163 3300053093 Bacteria 979
872 Ga0500566_0001345 3300053094 Bacteria 14355
873 Ga0500566_0003268 3300053094 Bacteria 9688
874 Ga0500566_0025753 3300053094 Bacteria 3446
875 Ga0500566_0194611 3300053094 Bacteria 1029
876 Ga0500640_027308 3300053095 Bacteria 2490
877 Ga0500641_0004044 3300053096 Bacteria 5179
878 Ga0500641_0028998 3300053096 Bacteria 2165
879 Ga0500554_010606 3300053102 Bacteria 2253
880 Ga0500555_049236 3300053103 Bacteria 1156
881 Ga0500556_0008987 3300053104 Bacteria 2895
882 Ga0500557_000128 3300053105 Bacteria 20005
883 Ga0500562_021788 3300053108 Bacteria 1669
884 Ga0500569_008127 3300053109 Bacteria 2388
885 Ga0500572_003155 3300053111 Bacteria 3817
886 Ga0500572_004302 3300053111 Bacteria 3235
887 Ga0500572_022921 3300053111 Bacteria 1671
888 Ga0500593_118304 3300053117 Unclassified 1078
889 Ga0500595_000095 3300053119 Bacteria 61248
890 Ga0500595_003348 3300053119 Bacteria 7528
891 Ga0500595_003752 3300053119 Bacteria 6999
892 Ga0500595_012265 3300053119 Bacteria 3320
893 Ga0500595_012487 3300053119 Bacteria 3284
894 Ga0500595_037246 3300053119 Bacteria 1588
895 Ga0500595_046973 3300053119 Bacteria 1355
896 Ga0500607_059315 3300053121 Bacteria 2011
897 Ga0500642_0000477 3300053130 Bacteria 12415
898 Ga0500642_0045664 3300053130 Bacteria 1912
899 Ga0500642_0061116 3300053130 Bacteria 1692
900 Ga0500559_0059280 3300053136 Bacteria 1704
901 Ga0500564_172143 3300053138 Bacteria 909
902 Ga0500568_0027931 3300053139 Bacteria 2356
903 Ga0500573_0027650 3300053140 Bacteria 3262
904 Ga0500586_000452 3300053145 Bacteria 8178
905 Ga0500590_000992 3300053148 Bacteria 10984
906 Ga0500590_037623 3300053148 Bacteria 2499
907 Ga0500603_000280 3300053150 Bacteria 13469
908 Ga0500603_001503 3300053150 Bacteria 5312
909 Ga0500616_0022308 3300053153 Bacteria 3537
910 Ga0500619_105282 3300053154 Bacteria 958
911 Ga0500638_007811 3300053162 Bacteria 4512
912 Ga0500638_139429 3300053162 Bacteria 1091
913 Ga0500639_013828 3300053163 Bacteria 4243
914 Ga0500639_062419 3300053163 Bacteria 1918
915 Ga0500639_073945 3300053163 Bacteria 1730
916 Ga0500636_0001993 3300053177 Bacteria 11232
917 Ga0500636_0005628 3300053177 Bacteria 7160
918 Ga0500637_0000653 3300053178 Bacteria 13761
919 Ga0500637_0032662 3300053178 Bacteria 2902
920 Ga0500637_0144347 3300053178 Bacteria 1377
921 Ga0500609_015376 3300053731 Bacteria 1036
922 Ga0500596_005506 3300053735 Bacteria 2218
923 Ga0500599_007382 3300053736 Bacteria 1413
924 Ga0500601_000310 3300053737 Bacteria 9139
925 Ga0500661_000198 3300055283 Bacteria 10649
926 Ga0466962_0088477 3300061719 Bacteria 1483
927 Ga0530510_0531238 3300061734 Bacteria 893
928 2507505509 2507262055 Bacteria 8048963
929 2508539394 2508501009 Bacteria 7784016
930 2508695725 2508501042 Bacteria 8719808
931 2511397412 2511231028 Bacteria 8046582
932 2513642384 2513237094 Bacteria 8789602
933 2513652611 2513237095 Bacteria 8976980
934 2513698872 2513237101 Bacteria 7952346
935 2513721907 2513237104 Bacteria 10034502
936 2513879266 2513237139 Bacteria 8737671
937 2514016903 2513237161 Bacteria 8871253
938 2515630195 2515154112 Bacteria 8294334
939 2517107618 2517093001 Bacteria 9002274
940 2524441949 2524023205 Bacteria 8918781
941 2524468123 2524023210 Bacteria 9029266
942 2528851899 2528768022 Bacteria 10457665
943 2617354363 2617270735 Bacteria 9163226
944 2643814134 2643221558 Bacteria 5460675
945 2719669412 2718217997 Bacteria 6740740
946 2720494428 2718218199 Bacteria 6740745
947 2720610765 2718218232 Bacteria 6720332
948 2720616643 2718218233 Bacteria 6662049
949 2720628000 2718218235 Bacteria 6630699
950 2720771580 2718218269 Bacteria 6906114
951 2723563343 2721755684 Bacteria 6859907
952 2723571334 2721755685 Bacteria 6704835
953 2723841887 2721755755 Bacteria 8322773
954 2724087129 2721755819 Bacteria 6906405
955 2724100840 2721755822 Bacteria 6726041
956 2724108081 2721755823 Bacteria 6752556
957 2745082749 2744054633 Bacteria 8678936
958 2757571902 2757320392 Bacteria 3737298
959 2774869488 2773857925 Bacteria 6472445
960 2793065716 2791355196 Bacteria 7323613
961 2793079183
962 2793296096 2791355256 Bacteria 6798008
963 2793328629 2791355261 Bacteria 6661293
964 2793334728 2791355262 Bacteria 6774204
965 2793348682 2791355264 Bacteria 6429314
966 2793357190 2791355265 Bacteria 6539969
967 2805921586 2802429603 Bacteria 8777136
968 2805929688 2802429605 Bacteria 6875453
969 2805933036 2802429606 Bacteria 6346811
970 2818239028 2816332527 Bacteria 8933356
971 2824660248 2824653114 Bacteria 8493680
972 2824678909 2824671348 Bacteria 8369588
973 2824695431 2824687955 Bacteria 8360029
974 2824703809 2824696289 Bacteria 8335049
975 2824714418 2824704595 Bacteria 9667483
976 2824761398 2824753945 Bacteria 9787441
977 2824768529 2824763712 Bacteria 9792355
978 2824781310 2824773399 Bacteria 8360218
979 2838019532 2838016132 Bacteria 6577831
980 2838066316 2838061910 Bacteria 6794874
981 2838072696 2838068647 Bacteria 6208656
982 2838130159 2838122688 Bacteria 8803140
983 2841949206 2841941048 Bacteria 8688029
984 2841956988 2841949485 Bacteria 8680857
985 2841964872 2841957949 Bacteria 8652217
986 2841974462 2841966195 Bacteria 8673214
987 2841977394 2841974524 Bacteria 8931498
988 2841990707 2841983080 Bacteria 8395090
989 2842041240 2842038055 Bacteria 8002051
990 2842049282 2842045827 Bacteria 8006841
991 2842208620 2842205361 Bacteria 6340321
992 2842282034 2842278818 Bacteria 6340002
993 2842289080 2842285085 Bacteria 6011953
994 2842313122 2842311132 Bacteria 6616990
995 2842407286 2842402390 Bacteria 6681310
996 2842413465 2842409023 Bacteria 6687331
997 2842420108 2842415677 Bacteria 6596907
998 2842426206 2842422224 Bacteria 6239196
999 2842430009 2842428310 Bacteria 6767288
1000 2842442750 2842441272 Bacteria 6769273
1001 2842453813 2842447887 Bacteria 6754142
1002 2842464626 2842462802 Bacteria 6588055
1003 2842471006 2842469257 Bacteria 6752936
1004 2842490798 2842489311 Bacteria 6620893
1005 2847931313 2847930680 Bacteria 9342022
1006 2847942404 2847939898 Bacteria 8606328
1007 2855734093 2855730933 Bacteria 7047938
1008 2855769683 2855767633 Bacteria 7049357
1009 2857516435 2857509624 Bacteria 7472071
1010 2857547434 2857542790 Bacteria 5326616
1011 2874592584 2874590934 Bacteria 8299676
1012 2874610517 2874604998 Bacteria 7834745
1013 2874619948 2874612657 Bacteria 8252029
1014 2874622988 2874620515 Bacteria 8290088
1015 2874647408 2874645413 Bacteria 8214782
1016 2876763769 2876761206 Bacteria 10111113
1017 2876772708 2876771140 Bacteria 8287509
1018 2876818214 2876808645 Bacteria 8824342
1019 2876820041 2876818435 Bacteria 8274608
1020 2879076546 2879074833 Bacteria 8279565
1021 2879087646 2879083081 Bacteria 8587928
1022 2879106863 2879099564 Bacteria 10442239
1023 2879115161 2879110137 Bacteria 8907982
1024 2879129180 2879127579 Bacteria 8294491
1025 2879144819 2879142872 Bacteria 8267021
1026 2881414021 2881412998 Bacteria 6492157
1027 2882458745 2882456835 Bacteria 6863978
1028 2885388425 2885383462 Bacteria 9473874
1029 2888379326 2888378607 Bacteria 9652610
1030 2888420018 2888419890 Bacteria 7857137
1031 2889035199 2889033259 Bacteria 9099371
1032 2904668950 2904666416 Bacteria 8226587
1033 2904714030 2904711408 Bacteria 9771557
1034 2922363274 2922361189 Bacteria 7436256
1035 2922369231
1036 2922388801 2922386360 Bacteria 7017218
1037 2929618869 2929615660 Bacteria 9193770
1038 2929630946 2929624759 Bacteria 9339455
1039 2932791058 2932784394 Bacteria 9704911
1040 2932800044 2932794094 Bacteria 7915132
1041 2932809053 2932801729 Bacteria 7987968
1042 2932817942 2932809354 Bacteria 9135765
1043 2932820573 2932818245 Bacteria 9955613
1044 2932837136 2932828146 Bacteria 9745859
1045 2933580421 2933577622 Bacteria 9116884
1046 2935614565 2935608549 Bacteria 8203142
1047 2935624367 2935616580 Bacteria 9032984
1048 2935644358 2935638405 Bacteria 10015038
1049 2935654728 2935648319 Bacteria 8801166
1050 2935663608 2935656913 Bacteria 8965014
1051 2935674727 2935665750 Bacteria 9571747
1052 2935684713 2935675223 Bacteria 9928132
1053 2935686659 2935684952 Bacteria 9590419
1054 2935701663 2935694250 Bacteria 9291695
1055 2935710391 2935703347 Bacteria 10242284
1056 2935716347 2935713505 Bacteria 9608509
1057 2935723528 2935722832 Bacteria 9608746
1058 2935735084 2935732158 Bacteria 9706831
1059 2935744125 2935741537 Bacteria 9707219
1060 2935752625 2935750917 Bacteria 9590372
1061 2935764945 2935760218 Bacteria 9817913
1062 2935778272 2935777560 Bacteria 8077691
1063 2935789056 2935785616 Bacteria 7962367
1064 2935796806 2935793552 Bacteria 8012592
1065 2935810511 2935801545 Bacteria 9301974
1066 2935816823 2935810662 Bacteria 9401221
1067 2935826403 2935819856 Bacteria 8261050
1068 2935833398 2935827899 Bacteria 10038562
1069 2935846046 2935837841 Bacteria 9454360
1070 2935853890 2935847175 Bacteria 8228321
1071 2935863086 2935855204 Bacteria 9035059
1072 2935873458 2935864058 Bacteria 9784707
1073 2935879980 2935873716 Bacteria 9632195
1074 2935888260 2935883170 Bacteria 7964738
1075 2935915432 2935908558 Bacteria 8568796
1076 2935925092 2935916978 Bacteria 9113783
1077 2935933327 2935926038 Bacteria 8601059
1078 2935941419 2935934488 Bacteria 8602579
1079 2935949522 2935942939 Bacteria 8599779
1080 2935958303 2935951376 Bacteria 8602333
1081 2935966552 2935959822 Bacteria 7869783
1082 2935974891 2935967501 Bacteria 8603075
1083 2935983154 2935975950 Bacteria 8347125
1084 2935985219 2935984226 Bacteria 8302647
1085 2935997798 2935992306 Bacteria 9802711
1086 2936010994 2936002035 Bacteria 9362176
1087 2936017764 2936011229 Bacteria 8801034
1088 2936026267 2936019824 Bacteria 8804134
1089 2936035014 2936028420 Bacteria 8965941
1090 2936043814 2936037263 Bacteria 9446081
1091 2936053229 2936046547 Bacteria 8903709
1092 2936057020 2936055302 Bacteria 8785755
1093 2940558538 2940556831 Bacteria 9590747
1094 2941537946 2941531003 Bacteria 7653939
1095 2941547073 2941538514 Bacteria 9402094
1096 2996887414 2996887358 Bacteria 5795980
1097 2996895469 2996893221 Bacteria 5823108
1098 3005511457 3005506211 Bacteria 6943378
1099 3005595304 3005594810 Bacteria 8716512
1100 8005261976 8005258706 Bacteria 6184835
1101 8005287517 8005282627 Bacteria 6675747
1102 8005292323 8005289223 Bacteria 6634003
1103 8005321941 8005321885 Bacteria 5795980
1104 8005384299 8005382845 Bacteria 6732062
1105 8005401504 8005395548 Bacteria 6806915
1106 8005435996 8005430974 Bacteria 6689030
1107 8005503668 8005497431 Bacteria 6477605
1108 8005625669 8005619151 Bacteria 7030230
1109 8005632215 8005626139 Bacteria 6534237
1110 8005675546 8005668836 Bacteria 6953162
1111 8006930251 8006926726 Bacteria 6749210
1112 8006969418 8006964411 Bacteria 8966052
1113 8006988467 8006984368 Bacteria 9651211
1114 8007000710 8006994254 Bacteria 8309700
1115 8016517909 8016511872 Bacteria 9921665
1116 8016531464 8016530956 Bacteria 8155261
1117 8016544674 8016539877 Bacteria 8155419
1118 8016557405 8016548790 Bacteria 8155074
1119 8016565759 8016557553 Bacteria 8154380
1120 8016569732 8016566248 Bacteria 8158151
1121 8016582335 8016575299 Bacteria 8154085
1122 8016603363 8016595262 Bacteria 8149947
1123 8016606295 8016603502 Bacteria 8731218
1124 8016618202 8016613128 Bacteria 8794220
1125 8016635363 8016630954 Bacteria 9217207
1126 8017058727 8017057580 Bacteria 10023680
1127 8019540262 8019538911 Bacteria 7872763
1128 8019576926 8019576017 Bacteria 10049540
1129 8019594988 8019586578 Bacteria 10212056
1130 8019606752 8019597564 Bacteria 10041141
1131 8019611756 8019608314 Bacteria 10042931
1132 8019623231 8019619141 Bacteria 9218857
1133 8019629866 8019629233 Bacteria 8687553
1134 8019640744 8019638758 Bacteria 9062356
1135 8019666704 8019659431 Bacteria 8577854
1136 8019679526 8019678201 Bacteria 8863603
1137 8019695985 8019687851 Bacteria 8712826
1138 8024507098 8024501048 Bacteria 6427847
1139 8055227679 8055225921 Bacteria 3341787
1140 8055436055 8055431914 Bacteria 4551896
1141 8055742718 8055742211 Bacteria 9226248
1142 8056383013 8056382006 Bacteria 6408074
1143 8056678600 8056673599 Bacteria 7871253
1144 8056975788 8056967851 Bacteria 9038162
1145 Ga0081455_10047903
1146 JGI24735J21928_10041752
1147 JGI25152J39213_1001108
1148 JGI25151J46595_10000451
1149 JGI25151J46595_10012763
1150 JGI25165J46597_1012936
1151 JGI25153J46596_10001849
1152 JGI25153J46596_10003596
1153 JGI25153J46596_10003675
1154 JGI25153J46596_10007159
1155 JGI25153J46596_10012613
1156 rootH1_10084142
1157 rootL2_10239686
1158 rootH1_10058417
1159 JGI25160J50197_1003782
1160 JGI25160J50197_1005043
1161 JGI25160J50197_1025211
1162 JGI25404J52841_10024642
1163 Ga0055539_1003001
1164 Ga0055531_10005144
1165 Ga0055543_1001103
1166 Ga0065165_1001646
1167 Ga0065165_1003743
1168 Ga0065165_1022241
1169 Ga0070658_10064511
1170 Ga0070658_10110967
1171 Ga0070658_10243097
1172 Ga0070690_100090747
1173 Ga0070670_100182032
1174 Ga0070670_100403626
1175 Ga0068869_100018682
1176 Ga0068869_100229158
1177 Ga0070666_10198145
1178 Ga0070680_100005214
1179 Ga0070680_100011561
1180 Ga0070680_100471625
1181 Ga0070682_100024236
1182 Ga0070682_100074067
1183 Ga0070682_100278192
1184 Ga0070682_100349336
1185 Ga0068868_100004833
1186 Ga0068868_100086679
1187 Ga0068868_100529731
1188 Ga0070660_100014405
1189 Ga0070660_100021819
1190 Ga0070660_100034372
1191 Ga0070660_100068342
1192 Ga0070660_100193274
1193 Ga0070660_100399953
1194 Ga0070689_100238269
1195 Ga0070687_100157363
1196 Ga0070661_100002881
1197 Ga0070661_100122108
1198 Ga0070668_100013201
1199 Ga0070668_100015674
1200 Ga0070668_100025268
1201 Ga0070668_100066527
1202 Ga0070668_100547921
1203 Ga0070675_100259455
1204 Ga0070675_100311874
1205 Ga0070675_100697504
1206 Ga0070671_100015188
1207 Ga0070671_100063445
1208 Ga0070671_100171645
1209 Ga0070674_100199625
1210 Ga0070673_100125190
1211 Ga0070673_100213175
1212 Ga0070659_100050519
1213 Ga0070667_100149367
1214 Ga0070667_100200492
1215 Ga0070714_100231515
1216 Ga0070701_10143799
1217 Ga0070700_100070726
1218 Ga0070700_100223878
1219 Ga0070663_100000598
1220 Ga0070663_100017095
1221 Ga0070663_100019221
1222 Ga0070663_100083818
1223 Ga0070678_100024855
1224 Ga0070678_100078094
1225 Ga0070678_100134028
1226 Ga0070678_100142321
1227 Ga0070678_100158056
1228 Ga0070678_100278143
1229 Ga0070662_100007191
1230 Ga0070662_100015533
1231 Ga0070662_100073350
1232 Ga0070681_10104996
1233 Ga0070681_10139645
1234 Ga0070681_10141265
1235 Ga0068867_100164012
1236 Ga0068867_100387304
1237 Ga0070706_100159540
1238 Ga0070679_100240604
1239 Ga0070679_100262422
1240 Ga0070679_100354758
1241 Ga0070684_100122197
1242 Ga0070684_100408283
1243 Ga0070684_100588559
1244 Ga0068853_100051162
1245 Ga0068853_100068809
1246 Ga0068853_100175878
1247 Ga0068853_100201553
1248 Ga0068853_100257283
1249 Ga0070672_100104298
1250 Ga0070672_100127479
1251 Ga0070686_100042506
1252 Ga0070693_100040702
1253 Ga0070665_100010827
1254 Ga0070665_100015557
1255 Ga0070665_100015812
1256 Ga0070665_100123562
1257 Ga0070665_100134738
1258 Ga0070665_100368750
1259 Ga0070665_100370198
1260 Ga0070665_100370216
1261 Ga0068855_100019755
1262 Ga0068855_100110183
1263 Ga0068855_100134239
1264 Ga0068855_100355831
1265 Ga0068855_100454851
1266 Ga0068855_100565992
1267 Ga0070664_100003791
1268 Ga0070664_100082048
1269 Ga0070664_100089380
1270 Ga0068857_100085354
1271 Ga0068854_100805751
1272 Ga0068856_100002355
1273 Ga0068856_100083923
1274 Ga0068856_100368275
1275 Ga0068856_100649046
1276 Ga0070702_100249769
1277 Ga0070702_100281751
1278 Ga0068852_100008549
1279 Ga0068852_100018956
1280 Ga0068852_100082923
1281 Ga0068852_100229094
1282 Ga0068852_100280195
1283 Ga0068852_100360141
1284 Ga0068852_100579129
1285 Ga0068852_100714906
1286 Ga0068859_100016877
1287 Ga0068859_100166317
1288 Ga0068859_100584304
1289 Ga0068864_100027680
1290 Ga0068864_100821211
1291 Ga0068861_100064658
1292 Ga0068861_100092252
1293 Ga0068861_100096747
1294 Ga0068851_10129435
1295 Ga0068851_10324908
1296 Ga0068870_10139812
1297 Ga0068870_10175109
1298 Ga0068863_100086085
1299 Ga0068858_100151471
1300 Ga0068858_100153798
1301 Ga0068858_100365844
1302 Ga0068858_100404129
1303 Ga0068858_101072092
1304 Ga0068860_100000577
1305 Ga0068860_100177029
1306 Ga0068860_100222173
1307 Ga0068860_100296370
1308 Ga0068860_100337864
1309 Ga0068862_100012465
1310 Ga0068862_100036297
1311 Ga0068862_100052418
1312 Ga0068862_100253887
1313 Ga0068862_100489020
1314 Ga0081455_10004895
1315 Ga0081455_10013363
1316 Ga0081455_10065600
1317 Ga0081540_1004561
1318 Ga0081540_1005048
1319 Ga0081540_1010591
1320 Ga0081540_1011487
1321 Ga0081540_1011797
1322 Ga0081540_1013781
1323 Ga0081540_1031452
1324 Ga0081540_1036693
1325 Ga0081540_1051966
1326 Ga0081539_10019046
1327 Ga0075365_10004812
1328 Ga0075365_10011993
1329 Ga0075365_10093839
1330 Ga0075365_10116414
1331 Ga0075365_10199218
1332 Ga0075365_10311713
1333 Ga0075368_10035929
1334 Ga0075368_10141535
1335 Ga0075363_100003163
1336 Ga0075363_100070001
1337 Ga0075364_10011381
1338 Ga0075364_10020053
1339 Ga0075364_10044928
1340 Ga0075364_10223317
1341 Ga0075364_10287374
1342 Ga0075362_10177018
1343 Ga0075367_10018509
1344 Ga0075367_10159273
1345 Ga0075367_10186630
1346 Ga0075369_10063085
1347 Ga0075366_10138885
1348 Ga0075366_10205646
1349 Ga0097621_100079086
1350 Ga0075370_10012846
1351 Ga0075370_10058931
1352 Ga0068871_100221194
1353 Ga0068871_100302702
1354 Ga0068871_100508328
1355 Ga0075428_100014565
1356 Ga0075434_100669941
1357 Ga0068865_100077817
1358 Ga0068865_100425324
1359 Ga0097620_100016876
1360 Ga0097620_100166318
1361 Ga0097620_100584282
1362 Ga0075435_100222013
1363 Ga0075435_100416675
1364 Ga0105250_10069082
1365 Ga0105240_10015922
1366 Ga0105240_10199785
1367 Ga0105240_10575624
1368 Ga0111539_10042663
1369 Ga0105245_10009744
1370 Ga0105245_10041488
1371 Ga0105245_10044825
1372 Ga0105245_10183066
1373 Ga0105245_10262667
1374 Ga0105247_10009734
1375 Ga0105247_10187484
1376 Ga0105247_10348157
1377 Ga0114129_10209945
1378 Ga0114129_10364713
1379 Ga0105243_10138872
1380 Ga0105243_10249007
1381 Ga0105243_10504984
1382 Ga0105241_10174490
1383 Ga0105241_10412078
1384 Ga0105242_10018681
1385 Ga0105242_10087044
1386 Ga0105242_10632323
1387 Ga0105242_10928944
1388 Ga0105248_10037824
1389 Ga0105248_10303341
1390 Ga0105248_10315684
1391 Ga0105248_10372403
1392 Ga0105248_10942923
1393 Ga0105248_11196719
1394 Ga0105237_10009776
1395 Ga0105237_10016276
1396 Ga0105237_10061924
1397 Ga0105237_10065294
1398 Ga0105237_10834968
1399 Ga0105238_10116422
1400 Ga0105238_10351489
1401 Ga0105238_10685202
1402 Ga0105249_10369478
1403 Ga0123340_1000167
1404 Ga0123341_1010909
1405 Ga0123341_1063720
1406 Ga0123342_1018186
1407 Ga0099796_10011789
1408 Ga0105239_10032831
1409 Ga0105239_10040749
1410 Ga0105239_10046379
1411 Ga0105239_10060369
1412 Ga0105239_10094671
1413 Ga0105239_10120138
1414 Ga0105239_10371891
1415 Ga0105239_10620053
1416 Ga0105246_10022753
1417 Ga0105246_10081357
1418 Ga0105246_10203546
1419 Ga0105246_10386997
1420 Ga0157373_10000647
1421 Ga0157373_10049148
1422 Ga0157371_10028934
1423 Ga0157371_10173482
1424 Ga0157371_10436736
1425 Ga0157370_10022331
1426 Ga0157370_10029317
1427 Ga0157370_10031768
1428 Ga0157370_10194746
1429 Ga0157369_10011194
1430 Ga0157369_10159097
1431 Ga0157369_10215276
1432 Ga0157374_10016521
1433 Ga0157374_10164035
1434 Ga0157378_10014932
1435 Ga0157378_10225469
1436 Ga0157378_10302560
1437 Ga0163162_10274922
1438 Ga0163162_10323237
1439 Ga0157372_10000593
1440 Ga0157372_10027954
1441 Ga0157375_10283930
1442 Ga0163163_10042519
1443 Ga0163163_10845215
1444 Ga0157380_10152327
1445 Ga0157380_10534424
1446 Ga0157377_10027973
1447 Ga0157377_10214457
1448 Ga0157379_10053440
1449 Ga0157379_10112157
1450 Ga0157376_10009078
1451 Ga0157376_10023064
1452 Ga0157376_10032010
1453 Ga0157376_10160662
1454 Ga0157376_10713806
1455 Ga0163161_10079952
1456 Ga0163161_10145217
1457 Ga0206356_10161480
1458 Ga0206354_10602836
1459 Ga0213876_10077997
1460 Ga0209563_100670
1461 Ga0207425_1010250
1462 Ga0207425_1017347
1463 Ga0209677_100221
1464 Ga0209677_101711
1465 Ga0209129_1000489
1466 Ga0209233_1002119
1467 Ga0209455_1022391
1468 Ga0209455_1031154
1469 Ga0209025_1000003
1470 Ga0209025_1002657
1471 Ga0209564_1006843
1472 Ga0209758_1000030
1473 Ga0209758_1001470
1474 Ga0209758_1002448
1475 Ga0209758_1003221
1476 Ga0209758_1003848
1477 Ga0209758_1004001
1478 Ga0209758_1007239
1479 Ga0209758_1031807
1480 Ga0209758_1036140
1481 Ga0209758_1041277
1482 Ga0209758_1051646
1483 Ga0209256_1004427
1484 Ga0207426_1001583
1485 Ga0207426_1010110
1486 Ga0209257_1003693
1487 Ga0209257_1007061
1488 Ga0207697_10108442
1489 Ga0207710_10077684
1490 Ga0207710_10133009
1491 Ga0207688_10026849
1492 Ga0207688_10083585
1493 Ga0207688_10256468
1494 Ga0207647_10002968
1495 Ga0207645_10112693
1496 Ga0207645_10256861
1497 Ga0207643_10107871
1498 Ga0207705_10034198
1499 Ga0207705_10318544
1500 Ga0207705_10348081
1501 Ga0207654_10042739
1502 Ga0207707_10159207
1503 Ga0207707_10190557
1504 Ga0207695_10001156
1505 Ga0207695_10195650
1506 Ga0207695_10483740
1507 Ga0207671_10009815
1508 Ga0207671_10084741
1509 Ga0207671_10208480
1510 Ga0207671_10215184
1511 Ga0207671_10218399
1512 Ga0207660_10012643
1513 Ga0207660_10085154
1514 Ga0207660_10329673
1515 Ga0207657_10000510
1516 Ga0207657_10030292
1517 Ga0207657_10032543
1518 Ga0207657_10053216
1519 Ga0207657_10187229
1520 Ga0207657_10212004
1521 Ga0207657_10350377
1522 Ga0207649_10018858
1523 Ga0207649_10139777
1524 Ga0207652_10023363
1525 Ga0207652_10042542
1526 Ga0207652_10180515
1527 Ga0207652_10632312
1528 Ga0207646_10639630
1529 Ga0207681_10047401
1530 Ga0207681_10383193
1531 Ga0207694_10120369
1532 Ga0207694_10223641
1533 Ga0207650_10728091
1534 Ga0207659_10500644
1535 Ga0207664_10270537
1536 Ga0207644_10003534
1537 Ga0207690_10000725
1538 Ga0207690_10079258
1539 Ga0207690_10566500
1540 Ga0207706_10000093
1541 Ga0207706_10039680
1542 Ga0207706_10107804
1543 Ga0207686_10257785
1544 Ga0207709_10258685
1545 Ga0207709_10356389
1546 Ga0207709_10529046
1547 Ga0207670_10344009
1548 Ga0207669_10042091
1549 Ga0207704_10087655
1550 Ga0207704_10455356
1551 Ga0207691_10056371
1552 Ga0207691_10419708
1553 Ga0207711_10023938
1554 Ga0207711_10056621
1555 Ga0207711_10310148
1556 Ga0207689_10009995
1557 Ga0207679_10068588
1558 Ga0207679_10139755
1559 Ga0207679_10352563
1560 Ga0207667_10003071
1561 Ga0207667_10076640
1562 Ga0207667_10091474
1563 Ga0207667_10375327
1564 Ga0207667_11023390
1565 Ga0207651_10226524
1566 Ga0207651_10433481
1567 Ga0207712_10032642
1568 Ga0207668_10239790
1569 Ga0207640_10062308
1570 Ga0207658_10046691
1571 Ga0207658_10110777
1572 Ga0207658_10845704
1573 Ga0207677_10068509
1574 Ga0207703_10036511
1575 Ga0207703_10075570
1576 Ga0207703_10307582
1577 Ga0207703_10599310
1578 Ga0207639_10051447
1579 Ga0207639_10123494
1580 Ga0207639_10139648
1581 Ga0207639_10182571
1582 Ga0207639_10303926
1583 Ga0207678_10019543
1584 Ga0207678_10030242
1585 Ga0207678_10320935
1586 Ga0207708_10011392
1587 Ga0207708_10072081
1588 Ga0207702_10004987
1589 Ga0207702_10052978
1590 Ga0207702_10263990
1591 Ga0207702_10452340
1592 Ga0207702_11196976
1593 Ga0207641_10358026
1594 Ga0207641_10404061
1595 Ga0207648_10193731
1596 Ga0207648_10250267
1597 Ga0207648_10782948
1598 Ga0207676_10098407
1599 Ga0207676_10680803
1600 Ga0207674_10097268
1601 Ga0207675_100025561
1602 Ga0207675_100030002
1603 Ga0207683_10011692
1604 Ga0207683_10049887
1605 Ga0207683_10078177
1606 Ga0207683_10166455
1607 Ga0207683_10170942
1608 Ga0207683_10237400
1609 Ga0207698_10054572
1610 Ga0207698_10114172
1611 Ga0209389_1000163
1612 Ga0209489_101100
1613 Ga0209700_100014
1614 Ga0268266_10004510
1615 Ga0268266_10014493
1616 Ga0268266_10250808
1617 Ga0268266_10263322
1618 Ga0268266_10688045
1619 Ga0268265_10002012
1620 Ga0268265_10557746
1621 Ga0268264_10000107
1622 Ga0268264_10101045
1623 Ga0268264_10745597
1624 Ga0265334_10017875
1625 Ga0265318_10009533
1626 Ga0265323_10000706
1627 Ga0265336_10000683
1628 Ga0307517_10001121
1629 Ga0307515_10048703
1630 Ga0265338_10001041
1631 Ga0265324_10004820
1632 Ga0316177_1142486
1633 Ga0316178_1062662
1634 Ga0307513_10170936
1635 Ga0307513_10238570
1636 Ga0307513_10326987
1637 Ga0307509_10032140
1638 Ga0307509_10306562
1639 Ga0307509_10355137
1640 Ga0307408_100000252
1641 Ga0265313_10085917
1642 Ga0307508_10000154
1643 Ga0307508_10144852
1644 Ga0307508_10199788
1645 Ga0307508_10284103
1646 Ga0265314_10084709
1647 Ga0265342_10000687
1648 Ga0307516_10009658
1649 Ga0307516_10046891
1650 Ga0307516_10048561
1651 Ga0307516_10058550
1652 Ga0307405_10166428
1653 Ga0307405_10239103
1654 Ga0307416_100250974
1655 Ga0307416_100369373
1656 Ga0307411_10079962
1657 Ga0307415_100195771
1658 Ga0307510_10020868
1659 Ga0307510_10035200
1660 Ga0307510_10210970
1661 Ga0307510_10229271
1662 Ga0373930_0038620
1663 Ga0373936_0034200
1664 Ga0373936_0050697
1665 Ga0373941_0018909
1666 Ga0373945_0023969
1667 Ga0373954_0049206
1668 Ga0373956_0016462
1669 Ga0373943_0019761
1670 Ga0373946_0077904
1671 Ga0373946_0156936
1672 Ga0373924_0105697
1673 Ga0373931_0000922
1674 Ga0373931_0069916
1675 Ga0373931_0401473
1676 Ga0373935_0007139
1677 Ga0373935_0061490
1678 Ga0373927_0003207
1679 Ga0373927_0027031
1680 Ga0373927_0130679
1681 Ga0373927_0304999
1682 Ga0373927_0310865
1683 Ga0373927_0369211
1684 Ga0373947_0016126
1685 Ga0373925_0051695
1686 Ga0373925_0386573
1687 Ga0373925_0448791
1688 Ga0395898_0333998
1689 Ga0395905_0003426
1690 Ga0395905_0072293
1691 Ga0395905_0177334
1692 Ga0395905_0213892
1693 Ga0436364_1376044
1694 Ga0436365_1627177
1695 Ga0436363_0270101
1696 Ga0439465_0010459
1697 Ga0451791_0655594
1698 Ga0451849_1322946
1699 Ga0439459_0008892
1700 Ga0466972_0078620
1701 Ga0466963_0274646
1702 Ga0466957_0195755
1703 Ga0466957_0380207
1704 Ga0466960_0235099
1705 Ga0466959_0221764
1706 Ga0466958_0104327
1707 Ga0466967_0001133
1708 Ga0495617_058050
1709 Ga0495592_0037169
1710 Ga0495603_0000182
1711 Ga0495603_0004488
1712 Ga0495603_0030757
1713 Ga0495603_0148374
1714 Ga0495603_0363663
1715 Ga0495629_0000314
1716 Ga0495641_0001508
1717 Ga0495641_0041135
1718 Ga0495651_0012151
1719 Ga0495651_0180065
1720 Ga0495653_0101966
1721 Ga0495653_0109029
1722 Ga0495580_0036094
1723 Ga0495582_0000597
1724 Ga0495582_0016511
1725 Ga0495605_0120213
1726 Ga0495639_0000235
1727 Ga0495639_0089101
1728 Ga0495662_0001470
1729 Ga0495664_0005693
1730 Ga0495664_0315894
1731 Ga0495584_0015964
1732 Ga0495585_0048788
1733 Ga0495594_0000302
1734 Ga0495607_0142450
1735 Ga0495606_0047029
1736 Ga0495606_0106966
1737 Ga0495606_0116102
1738 Ga0495606_0159498
1739 Ga0495610_0099204
1740 Ga0495610_0136409
1741 Ga0495616_0020136
1742 Ga0495616_0032705
1743 Ga0495628_0029830
1744 Ga0495628_0274453
1745 Ga0495628_0294238
1746 Ga0495628_0376855
1747 Ga0495630_0002415
1748 Ga0495632_0067614
1749 Ga0495637_0087103
1750 Ga0495643_0208714
1751 Ga0495644_0072945
1752 Ga0495648_0000619
1753 Ga0495648_0006267
1754 Ga0495666_0035782
1755 Ga0495652_0006258
1756 Ga0495652_0041525
1757 Ga0495652_0232304
1758 Ga0495665_0000619
1759 Ga0495640_0000308
1760 Ga0495640_0124019
1761 Ga0495640_0229529
1762 Ga0495587_0032889
1763 Ga0495609_0102427
1764 Ga0495609_0155626
1765 Ga0495621_0064946
1766 Ga0495645_0002277
1767 Ga0495622_0033182
1768 Ga0495622_0056752
1769 Ga0495622_0072635
1770 Ga0495633_0012187
1771 Ga0495633_0063792
1772 Ga0495667_0008896
1773 Ga0495656_0042782
1774 Ga0495668_0017158
1775 Ga0495668_0052268
1776 Ga0495668_0069062
1777 Ga0495668_0131199
1778 Ga0495634_0001483
1779 Ga0495634_0047054
1780 Ga0495611_0113091
1781 Ga0495625_0123597
1782 Ga0495625_0134632
1783 Ga0495625_0164807
1784 Ga0495625_0195089
1785 Ga0495635_0003423
1786 Ga0495635_0045072
1787 Ga0495661_0102372
1788 Ga0495661_0137567
1789 Ga0495588_0004152
1790 Ga0495588_0006111
1791 Ga0495588_0081788
1792 Ga0495657_0021179
1793 Ga0495657_0060848
1794 Ga0495657_0135004
1795 Ga0495599_0032491
1796 Ga0495623_0124232
1797 Ga0495646_0077067
1798 Ga0495647_0000405
1799 Ga0495647_0047624
1800 Ga0495647_0119342
1801 Ga0495658_0000936
1802 Ga0495658_0259591
1803 Ga0495669_0035983
1804 Ga0495669_0096619
1805 Ga0495613_0004828
1806 Ga0495613_0082107
1807 Ga0495624_0000810
1808 Ga0495624_0116093
1809 Ga0495670_0076587
1810 Ga0495670_0276454
1811 Ga0495671_0106338
1812 Ga0495589_0092108
1813 Ga0495600_0004756
1814 Ga0495600_0049276
1815 Ga0495600_0211607
1816 Ga0495660_0165806
1817 Ga0495581_0000683
1818 Ga0495581_0037772
1819 Ga0495604_0005707
1820 Ga0495604_0321556
1821 Ga0495604_0347989
1822 Ga0495636_0027019
1823 Ga0495674_0033870
1824 Ga0495672_0018381
1825 Ga0495672_0091395
1826 Ga0495676_0005624
1827 Ga0495676_0146325
1828 Ga0495676_0165304
1829 Ga0495680_0181214
1830 Ga0495680_0201624
1831 Ga0495683_0026647
1832 Ga0495683_0048443
1833 Ga0495683_0068885
1834 Ga0495683_0203252
1835 Ga0495687_003554
1836 Ga0495687_029783
1837 Ga0495675_0022183
1838 Ga0495677_0019823
1839 Ga0495673_0024196
1840 Ga0495684_0014657
1841 Ga0495686_0139174
1842 Ga0495686_0174065
1843 Ga0495686_0329425
1844 Ga0495593_0000370
1845 Ga0495602_0055398
1846 Ga0495614_0067848
1847 Ga0496100_0057050
1848 Ga0496100_0059644
1849 Ga0496101_0011788
1850 Ga0496101_0079991
1851 Ga0496102_0035160
1852 Ga0496102_0039885
1853 Ga0496102_0182086
1854 Ga0496102_0296367
1855 Ga0496102_0650350
1856 Ga0496103_0050386
1857 Ga0496103_0199871
1858 Ga0496104_0027452
1859 Ga0496104_0046793
1860 Ga0496104_0145388
1861 Ga0496104_0156640
1862 Ga0496104_0259136
1863 Ga0496105_0248534
1864 Ga0496105_0492742
1865 Ga0496105_0636787
1866 Ga0496106_0000788
1867 Ga0496106_0006629
1868 Ga0496106_0010327
1869 Ga0496106_0071909
1870 Ga0496106_0085959
1871 Ga0496106_0399575
1872 Ga0496107_0010427
1873 Ga0496107_0073394
1874 Ga0496108_0029240
1875 Ga0496108_0041613
1876 Ga0496108_0138390
1877 Ga0496108_0378606
1878 Ga0496108_0874853
1879 Ga0496109_0074114
1880 Ga0496109_0216868
1881 Ga0496110_0009815
1882 Ga0496110_0035698
1883 Ga0496111_0002060
1884 Ga0496111_0021035
1885 Ga0496112_0074644
1886 Ga0496112_0150982
1887 Ga0496112_0168267
1888 Ga0496112_0242858
1889 Ga0496113_0005020
1890 Ga0496113_0048688
1891 Ga0496113_0049431
1892 Ga0496114_0002069
1893 Ga0496114_0117355
1894 Ga0496114_0519902
1895 Ga0496115_0005035
1896 Ga0496115_0051684
1897 Ga0496115_0081154
1898 Ga0496116_0026977
1899 Ga0496116_0135082
1900 Ga0496117_0008719
1901 Ga0496117_0105573
1902 Ga0496117_0139628
1903 Ga0496117_0148990
1904 Ga0496118_0004035
1905 Ga0496118_0067376
1906 Ga0496118_0104340
1907 Ga0496118_0243986
1908 Ga0496119_0022541
1909 Ga0496119_0140231
1910 Ga0496120_0111142
1911 Ga0496120_0223240
1912 Ga0496121_0000640
1913 Ga0496121_0006350
1914 Ga0496121_0014968
1915 Ga0496121_0018042
1916 Ga0496121_0027740
1917 Ga0496121_0042560
1918 Ga0496121_0097728
1919 Ga0496121_0117532
1920 Ga0496121_0176268
1921 Ga0496121_0355383
1922 Ga0496122_0000072
1923 Ga0496122_0096390
1924 Ga0496123_0000035
1925 Ga0496124_0000004
1926 Ga0496124_0007008
1927 Ga0496124_0049279
1928 Ga0496124_0051307
1929 Ga0496124_0068381
1930 Ga0496124_0340935
1931 Ga0496125_0000136
1932 Ga0496125_0049499
1933 Ga0496125_0052528
1934 Ga0496125_0063712
1935 Ga0496125_0071712
1936 Ga0496125_0124627
1937 Ga0496125_0379349
1938 Ga0496126_0013134
1939 Ga0496126_0030491
1940 Ga0496126_0064381
1941 Ga0496126_0067186
1942 Ga0496126_0108383
1943 Ga0496126_0185856
1944 Ga0496126_0360985
1945 Ga0496126_0462019
1946 Ga0501036_0080390
1947 Ga0501036_0478362
1948 Ga0501038_0280696
1949 Ga0501039_0272995
1950 Ga0501042_0159742
1951 Ga0501047_0009703
1952 Ga0501047_0191466
1953 Ga0501069_0197914
1954 Ga0501076_0021084
1955 Ga0501222_019810
1956 Ga0501227_002739
1957 Ga0501079_0125280
1958 Ga0501080_0452554
1959 Ga0501279_002614
1960 Ga0501279_005909
1961 Ga0501044_0214807
1962 nmdc:mga03683_144337_c1
1963 nmdc:mga03683_147991_c1
1964 nmdc:mga03683_82892_c1
1965 nmdc:mga03n38_989_c1
1966 nmdc:mga00v17_11205_c1
1967 nmdc:mga00v17_171917_c1
1968 nmdc:mga00v17_407537_c1
1969 nmdc:mga00v17_51920_c1
1970 nmdc:mga0yw44_143278_c1
1971 nmdc:mga0yw44_15824_c1
1972 nmdc:mga0yw44_20383_c1
1973 nmdc:mga0yw44_24975_c1
1974 nmdc:mga0yw44_311142_c1
1975 nmdc:mga0yw44_331579_c1
1976 nmdc:mga0yw44_71313_c1
1977 nmdc:mga0k408_100771_c1
1978 nmdc:mga0k408_1944_c1
1979 nmdc:mga0k408_247264_c1
1980 nmdc:mga0k408_341162_c1
1981 nmdc:mga06z11_3558_c1
1982 nmdc:mga06z11_47899_c1
1983 nmdc:mga06z11_94031_c1
1984 nmdc:mga07m45_115683_c1
1985 nmdc:mga07m45_130042_c1
1986 nmdc:mga07m45_269500_c1
1987 nmdc:mga07m45_6373_c1
1988 nmdc:mga09592_656276_c1
1989 nmdc:mga0qj67_354668_c1
1990 nmdc:mga0n895_196917_c1
1991 nmdc:mga0n895_243665_c1
1992 nmdc:mga0n895_80087_c1
1993 nmdc:mga0rr50_32574_c1
1994 nmdc:mga0a205_393136_c1
1995 nmdc:mga0sz30_102954_c1
1996 nmdc:mga0sz30_2977_c1
1997 nmdc:mga0sz30_37766_c1
1998 nmdc:mga0sz30_98394_c1
1999 Ga0495601_0170003
2000 Ga0495612_0037009
2001 Ga0500635_0001720
2002 Ga0500635_0019869
2003 Ga0500635_0141489
2004 Ga0495595_0046772
2005 Ga0495619_0238218
2006 Ga0495619_0295850
2007 Ga0500578_0154790
2008 Ga0500578_0187342
2009 Ga0500578_0271687
2010 Ga0500643_000160
2011 Ga0500643_018379
2012 Ga0500581_145907
2013 Ga0500583_0171510
2014 Ga0500651_0010771
2015 Ga0500651_0272163
2016 Ga0500566_0001345
2017 Ga0500566_0003268
2018 Ga0500566_0025753
2019 Ga0500566_0194611
2020 Ga0500640_027308
2021 Ga0500641_0004044
2022 Ga0500641_0028998
2023 Ga0500554_010606
2024 Ga0500555_049236
2025 Ga0500556_0008987
2026 Ga0500557_000128
2027 Ga0500562_021788
2028 Ga0500569_008127
2029 Ga0500572_003155
2030 Ga0500572_004302
2031 Ga0500572_022921
2032 Ga0500593_118304
2033 Ga0500595_000095
2034 Ga0500595_003348
2035 Ga0500595_003752
2036 Ga0500595_012265
2037 Ga0500595_012487
2038 Ga0500595_037246
2039 Ga0500595_046973
2040 Ga0500607_059315
2041 Ga0500642_0000477
2042 Ga0500642_0045664
2043 Ga0500642_0061116
2044 Ga0500559_0059280
2045 Ga0500564_172143
2046 Ga0500568_0027931
2047 Ga0500573_0027650
2048 Ga0500586_000452
2049 Ga0500590_000992
2050 Ga0500590_037623
2051 Ga0500603_000280
2052 Ga0500603_001503
2053 Ga0500616_0022308
2054 Ga0500619_105282
2055 Ga0500638_007811
2056 Ga0500638_139429
2057 Ga0500639_013828
2058 Ga0500639_062419
2059 Ga0500639_073945
2060 Ga0500636_0001993
2061 Ga0500636_0005628
2062 Ga0500637_0000653
2063 Ga0500637_0032662
2064 Ga0500637_0144347
2065 Ga0500609_015376
2066 Ga0500596_005506
2067 Ga0500599_007382
2068 Ga0500601_000310
2069 Ga0500661_000198
2070 Ga0466962_0088477
2071 Ga0530510_0531238
2072 2507505509
2073 2508539394
2074 2508695725
2075 2511397412
2076 2513642384
2077 2513652611
2078 2513698872
2079 2513721907
2080 2513879266
2081 2514016903
2082 2515630195
2083 2517107618
2084 2524441949
2085 2524468123
2086 2528851899
2087 2617354363
2088 2643814134
2089 2719669412
2090 2720494428
2091 2720610765
2092 2720616643
2093 2720628000
2094 2720771580
2095 2723563343
2096 2723571334
2097 2723841887
2098 2724087129
2099 2724100840
2100 2724108081
2101 2745082749
2102 2757571902
2103 2774869488
2104 2793065716
2105 2793079183
2106 2793296096
2107 2793328629
2108 2793334728
2109 2793348682
2110 2793357190
2111 2805921586
2112 2805929688
2113 2805933036
2114 2818239028
2115 2824660248
2116 2824678909
2117 2824695431
2118 2824703809
2119 2824714418
2120 2824761398
2121 2824768529
2122 2824781310
2123 2838019532
2124 2838066316
2125 2838072696
2126 2838130159
2127 2841949206
2128 2841956988
2129 2841964872
2130 2841974462
2131 2841977394
2132 2841990707
2133 2842041240
2134 2842049282
2135 2842208620
2136 2842282034
2137 2842289080
2138 2842313122
2139 2842407286
2140 2842413465
2141 2842420108
2142 2842426206
2143 2842430009
2144 2842442750
2145 2842453813
2146 2842464626
2147 2842471006
2148 2842490798
2149 2847931313
2150 2847942404
2151 2855734093
2152 2855769683
2153 2857516435
2154 2857547434
2155 2874592584
2156 2874610517
2157 2874619948
2158 2874622988
2159 2874647408
2160 2876763769
2161 2876772708
2162 2876818214
2163 2876820041
2164 2879076546
2165 2879087646
2166 2879106863
2167 2879115161
2168 2879129180
2169 2879144819
2170 2881414021
2171 2882458745
2172 2885388425
2173 2888379326
2174 2888420018
2175 2889035199
2176 2904668950
2177 2904714030
2178 2922363274
2179 2922369231
2180 2922388801
2181 2929618869
2182 2929630946
2183 2932791058
2184 2932800044
2185 2932809053
2186 2932817942
2187 2932820573
2188 2932837136
2189 2933580421
2190 2935614565
2191 2935624367
2192 2935644358
2193 2935654728
2194 2935663608
2195 2935674727
2196 2935684713
2197 2935686659
2198 2935701663
2199 2935710391
2200 2935716347
2201 2935723528
2202 2935735084
2203 2935744125
2204 2935752625
2205 2935764945
2206 2935778272
2207 2935789056
2208 2935796806
2209 2935810511
2210 2935816823
2211 2935826403
2212 2935833398
2213 2935846046
2214 2935853890
2215 2935863086
2216 2935873458
2217 2935879980
2218 2935888260
2219 2935915432
2220 2935925092
2221 2935933327
2222 2935941419
2223 2935949522
2224 2935958303
2225 2935966552
2226 2935974891
2227 2935983154
2228 2935985219
2229 2935997798
2230 2936010994
2231 2936017764
2232 2936026267
2233 2936035014
2234 2936043814
2235 2936053229
2236 2936057020
2237 2940558538
2238 2941537946
2239 2941547073
2240 2996887414
2241 2996895469
2242 3005511457
2243 3005595304
2244 8005261976
2245 8005287517
2246 8005292323
2247 8005321941
2248 8005384299
2249 8005401504
2250 8005435996
2251 8005503668
2252 8005625669
2253 8005632215
2254 8005675546
2255 8006930251
2256 8006969418
2257 8006988467
2258 8007000710
2259 8016517909
2260 8016531464
2261 8016544674
2262 8016557405
2263 8016565759
2264 8016569732
2265 8016582335
2266 8016603363
2267 8016606295
2268 8016618202
2269 8016635363
2270 8017058727
2271 8019540262
2272 8019576926
2273 8019594988
2274 8019606752
2275 8019611756
2276 8019623231
2277 8019629866
2278 8019640744
2279 8019666704
2280 8019679526
2281 8019695985
2282 8024507098
2283 8055227679
2284 8055436055
2285 8055742718
2286 8056383013
2287 8056678600
2288 8056975788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07729

FCD

FCD domain

89

246

0.99

PF00392

GntR

Bacterial regulatory proteins, gntR family

50

112

0.97

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

71

103

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7u5q-assembly2.cif.gz_B crystal structure of transcriptional regulator, gntr family, from brucella melitensis 0.951 23 237
7u5q-assembly2.cif.gz_B crystal structure of transcriptional regulator, gntr family, from brucella melitensis 0.9467 23 237
4egz-assembly1.cif.gz_B crystal structure of arar(dbd) in complex with operator orr3 0.9275 24 87
4wwc-assembly1.cif.gz_A crystal structure of full length yvoa in complex with palindromic operator dna 0.9201 25 87
5d4r-assembly1.cif.gz_A crystal structure of arar(dbd) in complex with operator ore1 0.9189 22 87
ID Description Score Start End Superfamily
af_P0ACM2_11_76_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9928 22 87 1.10.10.10
af_P0ACM2_11_76_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9781 22 87 1.10.10.10
2hs5A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.972 25 87 1.10.10.10
af_P0ACM2_81_217_1.20.120.530 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);GntR ligand-binding domain-like 0.959 93 227 1.20.120.530
af_Q79G00_16_82_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9565 23 86 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4Q7EVA1-F1-model_v4 GntR family transcriptional regulator 0.999 26 238 GO:0003677
GO:0003700
AF-A0A4Q7EVA1-F1-model_v4 GntR family transcriptional regulator 0.9943 26 238 GO:0003677
GO:0003700
AF-A0A2S8VD96-F1-model_v4 GntR family transcriptional regulator 0.9942 17 238 GO:0003677
GO:0003700
AF-A0A1H7UXU4-F1-model_v4 DNA-binding transcriptional regulator, GntR family 0.9936 17 238 GO:0003677
GO:0003700
AF-A0A7X4KI93-F1-model_v4 FCD domain-containing protein 0.9933 17 238 GO:0003677
GO:0003700

Map