F490677

General Info

Members Datasets Scaffolds Average Seq Length
1139 344 2278 261

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100193624|Ga0068863_1001936242
Length 289
Sequence VVVFDYAAKDLLLCFSNLRPTYFVNNSSMIKVENLVKKFGEVTAVDTVSFDVAAGEIFAFLGPNGAGKTTTIKMLTTLLRPTSGSIEIDGLDPAKQSNEARKRFGIVFQDPSLDQELTAEENMDLHGVLYHVPRKERHERTEMLLNLFELWDRRKDYVKTFSGGMKRRLEIARGFLHTPKILFLDEPTLGLDPQSRNQLWTHVKNLNETEGVTVFLTTHYMDEAERVAERIAVIDHGKIIAQGSPDELKQQTETDSLEAAFLSLTGSTIRDEKAGAADQIREMAKMWRK

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
128 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
131 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
132 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
198 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
199 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
200 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
201 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
202 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
203 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
205 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
206 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
207 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
208 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
209 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
210 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
211 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
212 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
213 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
216 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
217 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
218 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
221 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
234 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
235 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
236 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
237 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
238 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
239 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
240 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
241 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
242 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
243 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
244 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
253 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
254 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
259 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
260 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
261 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
265 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
266 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
269 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
270 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
273 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
293 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
307 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
308 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
317 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
318 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
319 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
323 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
333 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
334 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
337 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
338 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
339 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
340 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
341 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
342 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
343 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
344 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.23
Nodule 0
Rhizoplane 2.9
Rhizosphere 94.03
Stem 0
Stem Tuber 0
Unclassified 3.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100193624 3300005841 Bacteria 1954
2 JGI25406J46586_10038063 3300003203 Bacteria 1727
3 rootH2_10047141 3300003320 Bacteria 3147
4 Ga0065704_10087813 3300005289 Unclassified 2992
5 Ga0065712_10070089 3300005290 Bacteria 6340
6 Ga0065712_10249029 3300005290 Bacteria 964
7 Ga0065715_10007867 3300005293 Bacteria 2745
8 Ga0065715_10036057 3300005293 Bacteria 1684
9 Ga0065715_10091908 3300005293 Bacteria 5469
10 Ga0065715_10093915 3300005293 Bacteria 4501
11 Ga0065715_10126295 3300005293 Bacteria 2111
12 Ga0065715_10136188 3300005293 Bacteria 1926
13 Ga0065715_10140632 3300005293 Bacteria 1859
14 Ga0065715_10170078 3300005293 Bacteria 1539
15 Ga0065715_10297678 3300005293 Bacteria 1048
16 Ga0065715_10314709 3300005293 Bacteria 1009
17 Ga0065707_10001489 3300005295 Bacteria 8230
18 Ga0065707_10108725 3300005295 Bacteria 2499
19 Ga0065707_10130480 3300005295 Bacteria 1922
20 Ga0065707_10179772 3300005295 Bacteria 1426
21 Ga0070658_10015527 3300005327 Bacteria 6090
22 Ga0070658_10015795 3300005327 Bacteria 6035
23 Ga0070658_10017986 3300005327 Bacteria 5653
24 Ga0070658_10290539 3300005327 Bacteria 1393
25 Ga0070676_10168939 3300005328 Bacteria 1413
26 Ga0070683_100010352 3300005329 Bacteria 8021
27 Ga0070683_100026691 3300005329 Bacteria 5204
28 Ga0070683_100084736 3300005329 Bacteria 2970
29 Ga0070683_100132518 3300005329 Bacteria 2359
30 Ga0070683_100213051 3300005329 Bacteria 1835
31 Ga0070690_100248454 3300005330 Unclassified 1257
32 Ga0070690_100457507 3300005330 Bacteria 947
33 Ga0070670_100003870 3300005331 Bacteria 12483
34 Ga0070670_100039116 3300005331 Bacteria 4078
35 Ga0070670_100078395 3300005331 Bacteria 2838
36 Ga0068869_100508392 3300005334 Bacteria 1007
37 Ga0070666_10007317 3300005335 Bacteria 6801
38 Ga0070666_10020706 3300005335 Bacteria 4255
39 Ga0070680_100003359 3300005336 Bacteria 11945
40 Ga0070680_100013727 3300005336 Bacteria 6318
41 Ga0070680_100034123 3300005336 Bacteria 4103
42 Ga0070680_100044726 3300005336 Bacteria 3598
43 Ga0070680_100158449 3300005336 Unclassified 1902
44 Ga0070680_100221344 3300005336 Bacteria 1598
45 Ga0068868_100000334 3300005338 Bacteria 31757
46 Ga0068868_100027015 3300005338 Bacteria 4376
47 Ga0068868_100048637 3300005338 Bacteria 3326
48 Ga0068868_100481114 3300005338 Bacteria 1084
49 Ga0070660_100021915 3300005339 Bacteria 4719
50 Ga0070660_100153244 3300005339 Unclassified 1854
51 Ga0070689_100042290 3300005340 Bacteria 3499
52 Ga0070691_10049289 3300005341 Bacteria 2006
53 Ga0070687_100092813 3300005343 Unclassified 1673
54 Ga0070661_100018189 3300005344 Bacteria 4993
55 Ga0070661_100040306 3300005344 Bacteria 3407
56 Ga0070661_100083627 3300005344 Unclassified 2358
57 Ga0070661_100170960 3300005344 Bacteria 1650
58 Ga0070661_100212886 3300005344 Bacteria 1480
59 Ga0070692_10044725 3300005345 Bacteria 2282
60 Ga0070692_10096318 3300005345 Bacteria 1616
61 Ga0070668_100065167 3300005347 Bacteria 2826
62 Ga0070668_100104923 3300005347 Bacteria 2244
63 Ga0070669_100000753 3300005353 Bacteria 23583
64 Ga0070675_100080217 3300005354 Bacteria 2720
65 Ga0070675_100309584 3300005354 Bacteria 1393
66 Ga0070675_100620468 3300005354 Bacteria 981
67 Ga0070671_100003655 3300005355 Bacteria 12044
68 Ga0070671_100009302 3300005355 Bacteria 7889
69 Ga0070671_100080134 3300005355 Bacteria 2730
70 Ga0070671_100086515 3300005355 Bacteria 2622
71 Ga0070674_100001651 3300005356 Bacteria 12029
72 Ga0070673_100308612 3300005364 Bacteria 1395
73 Ga0070688_100102393 3300005365 Bacteria 1890
74 Ga0070688_100117455 3300005365 Bacteria 1777
75 Ga0070688_100504443 3300005365 Bacteria 913
76 Ga0070659_100009195 3300005366 Bacteria 7252
77 Ga0070659_100015169 3300005366 Bacteria 5764
78 Ga0070659_100060352 3300005366 Bacteria 2995
79 Ga0070659_100206693 3300005366 Bacteria 1617
80 Ga0070659_100623741 3300005366 Unclassified 928
81 Ga0070667_100005910 3300005367 Bacteria 10188
82 Ga0070667_100059664 3300005367 Bacteria 3228
83 Ga0070667_100473703 3300005367 Bacteria 1146
84 Ga0070667_100794449 3300005367 Bacteria 878
85 Ga0070709_10000036 3300005434 Bacteria 109782
86 Ga0070709_10623032 3300005434 Bacteria 833
87 Ga0070714_100027330 3300005435 Bacteria 4724
88 Ga0070713_100027402 3300005436 Bacteria 4486
89 Ga0070713_100032297 3300005436 Bacteria 4179
90 Ga0070713_100463549 3300005436 Bacteria 1192
91 Ga0070713_100717021 3300005436 Bacteria 955
92 Ga0070701_10120425 3300005438 Bacteria 1478
93 Ga0070711_100005677 3300005439 Bacteria 7478
94 Ga0070711_100164780 3300005439 Bacteria 1684
95 Ga0070711_100376316 3300005439 Unclassified 1147
96 Ga0070705_100013983 3300005440 Bacteria 4117
97 Ga0070705_100016605 3300005440 Bacteria 3826
98 Ga0070705_100033562 3300005440 Bacteria 2861
99 Ga0070705_100210379 3300005440 Bacteria 1340
100 Ga0070705_100281849 3300005440 Bacteria 1182
101 Ga0070700_100131334 3300005441 Bacteria 1690
102 Ga0070694_100017957 3300005444 Bacteria 4480
103 Ga0070694_100020313 3300005444 Bacteria 4232
104 Ga0070694_100038927 3300005444 Bacteria 3162
105 Ga0070694_100057428 3300005444 Bacteria 2646
106 Ga0070694_100122871 3300005444 Unclassified 1865
107 Ga0070694_100334111 3300005444 Bacteria 1170
108 Ga0070694_100434253 3300005444 Bacteria 1034
109 Ga0070708_100112270 3300005445 Bacteria 2506
110 Ga0070708_100244674 3300005445 Bacteria 1684
111 Ga0070708_100527790 3300005445 Bacteria 1114
112 Ga0070708_100551356 3300005445 Bacteria 1087
113 Ga0070708_100704578 3300005445 Bacteria 950
114 Ga0070663_100017312 3300005455 Bacteria 4702
115 Ga0070663_100060560 3300005455 Bacteria 2723
116 Ga0070663_100141752 3300005455 Bacteria 1836
117 Ga0070663_100174332 3300005455 Bacteria 1664
118 Ga0070678_100073632 3300005456 Bacteria 2564
119 Ga0070678_100074439 3300005456 Bacteria 2552
120 Ga0070662_100114849 3300005457 Bacteria 2056
121 Ga0070662_100173039 3300005457 Archaea 1697
122 Ga0070662_100196598 3300005457 Bacteria 1598
123 Ga0070681_10004147 3300005458 Bacteria 13706
124 Ga0070681_10004187 3300005458 Bacteria 13662
125 Ga0070681_10015731 3300005458 Bacteria 7541
126 Ga0070681_10016961 3300005458 Bacteria 7276
127 Ga0070681_10048573 3300005458 Bacteria 4240
128 Ga0070681_10055693 3300005458 Bacteria 3936
129 Ga0070681_10087996 3300005458 Bacteria 3058
130 Ga0070681_10095673 3300005458 Bacteria 2919
131 Ga0070681_10114509 3300005458 Bacteria 2635
132 Ga0070681_10138667 3300005458 Bacteria 2362
133 Ga0068867_100085189 3300005459 Bacteria 2389
134 Ga0070685_10056844 3300005466 Bacteria 2276
135 Ga0070706_100131609 3300005467 Bacteria 2334
136 Ga0070706_100244201 3300005467 Bacteria 1676
137 Ga0070706_100248858 3300005467 Unclassified 1659
138 Ga0070706_100313001 3300005467 Bacteria 1464
139 Ga0070706_100421137 3300005467 Bacteria 1243
140 Ga0070707_100010399 3300005468 Bacteria 8665
141 Ga0070707_100012497 3300005468 Bacteria 7930
142 Ga0070707_100052238 3300005468 Bacteria 3918
143 Ga0070707_100073818 3300005468 Bacteria 3289
144 Ga0070707_100432277 3300005468 Bacteria 1277
145 Ga0070698_100002332 3300005471 Bacteria 20989
146 Ga0070698_100007637 3300005471 Bacteria 11701
147 Ga0070698_100022665 3300005471 Bacteria 6567
148 Ga0070698_100022874 3300005471 Bacteria 6535
149 Ga0070698_100027886 3300005471 Bacteria 5866
150 Ga0070698_100511376 3300005471 Bacteria 1139
151 Ga0070698_100614465 3300005471 Bacteria 1028
152 Ga0070699_100044394 3300005518 Bacteria 3848
153 Ga0070699_100076203 3300005518 Bacteria 2919
154 Ga0070699_100122372 3300005518 Bacteria 2289
155 Ga0070699_100131115 3300005518 Bacteria 2210
156 Ga0070699_100209136 3300005518 Bacteria 1736
157 Ga0070699_100331305 3300005518 Bacteria 1369
158 Ga0070699_100364322 3300005518 Bacteria 1303
159 Ga0070679_100010428 3300005530 Bacteria 8814
160 Ga0070679_100013889 3300005530 Bacteria 7716
161 Ga0070679_100028437 3300005530 Bacteria 5512
162 Ga0070679_100039829 3300005530 Bacteria 4672
163 Ga0070679_100082291 3300005530 Bacteria 3209
164 Ga0070679_100098814 3300005530 Bacteria 2906
165 Ga0070679_100194250 3300005530 Unclassified 1997
166 Ga0070684_100000769 3300005535 Bacteria 22213
167 Ga0070684_100001161 3300005535 Bacteria 18892
168 Ga0070684_100001218 3300005535 Bacteria 18489
169 Ga0070684_100015041 3300005535 Bacteria 6288
170 Ga0070684_100063826 3300005535 Bacteria 3230
171 Ga0070684_100123489 3300005535 Bacteria 2330
172 Ga0070684_100248940 3300005535 Bacteria 1624
173 Ga0070684_100422446 3300005535 Bacteria 1231
174 Ga0070697_100007487 3300005536 Bacteria 8499
175 Ga0070697_100026143 3300005536 Bacteria 4659
176 Ga0070697_100028478 3300005536 Bacteria 4473
177 Ga0070697_100046990 3300005536 Bacteria 3500
178 Ga0070697_100180802 3300005536 Bacteria 1788
179 Ga0070697_100214348 3300005536 Unclassified 1640
180 Ga0070697_100298530 3300005536 Bacteria 1384
181 Ga0070697_100328362 3300005536 Bacteria 1318
182 Ga0068853_100000800 3300005539 Bacteria 21859
183 Ga0068853_100008301 3300005539 Bacteria 8338
184 Ga0068853_100012173 3300005539 Bacteria 6995
185 Ga0068853_100159575 3300005539 Bacteria 2034
186 Ga0068853_100222480 3300005539 Bacteria 1724
187 Ga0068853_100237649 3300005539 Bacteria 1669
188 Ga0068853_100335947 3300005539 Bacteria 1403
189 Ga0068853_100385282 3300005539 Bacteria 1310
190 Ga0070672_100031167 3300005543 Unclassified 4011
191 Ga0070672_100448474 3300005543 Bacteria 1111
192 Ga0070686_100204500 3300005544 Bacteria 1418
193 Ga0070686_100329402 3300005544 Bacteria 1141
194 Ga0070695_100022246 3300005545 Bacteria 3888
195 Ga0070695_100062194 3300005545 Bacteria 2424
196 Ga0070695_100169390 3300005545 Bacteria 1540
197 Ga0070695_100170084 3300005545 Unclassified 1537
198 Ga0070695_100234331 3300005545 Bacteria 1329
199 Ga0070696_100004749 3300005546 Bacteria 9076
200 Ga0070696_100026821 3300005546 Bacteria 3921
201 Ga0070696_100032721 3300005546 Bacteria 3568
202 Ga0070696_100062371 3300005546 Bacteria 2609
203 Ga0070693_100012709 3300005547 Bacteria 4268
204 Ga0070693_100070946 3300005547 Bacteria 2051
205 Ga0070693_100142540 3300005547 Bacteria 1510
206 Ga0070665_100024853 3300005548 Bacteria 6036
207 Ga0070665_100040854 3300005548 Bacteria 4662
208 Ga0070665_100073208 3300005548 Bacteria 3433
209 Ga0070665_100108497 3300005548 Bacteria 2778
210 Ga0070665_100187674 3300005548 Unclassified 2068
211 Ga0070665_100232612 3300005548 Bacteria 1843
212 Ga0070665_100795964 3300005548 Bacteria 958
213 Ga0070704_100004317 3300005549 Bacteria 8216
214 Ga0070704_100005237 3300005549 Bacteria 7551
215 Ga0070704_100005336 3300005549 Bacteria 7484
216 Ga0070704_100066750 3300005549 Bacteria 2595
217 Ga0070704_100245707 3300005549 Bacteria 1467
218 Ga0070704_100544501 3300005549 Unclassified 1013
219 Ga0068855_100000619 3300005563 Bacteria 43655
220 Ga0068855_100000808 3300005563 Bacteria 38711
221 Ga0068855_100004110 3300005563 Bacteria 17753
222 Ga0068855_100006367 3300005563 Bacteria 14387
223 Ga0068855_100028309 3300005563 Bacteria 6702
224 Ga0068855_100054875 3300005563 Bacteria 4682
225 Ga0068855_100165531 3300005563 Bacteria 2507
226 Ga0068855_100321640 3300005563 Bacteria 1710
227 Ga0068855_100536733 3300005563 Bacteria 1268
228 Ga0068855_100688070 3300005563 Bacteria 1095
229 Ga0070664_100007454 3300005564 Bacteria 8833
230 Ga0070664_100017236 3300005564 Bacteria 5931
231 Ga0070664_100018865 3300005564 Bacteria 5670
232 Ga0070664_100132489 3300005564 Bacteria 2190
233 Ga0070664_100139367 3300005564 Bacteria 2135
234 Ga0070664_100146363 3300005564 Unclassified 2084
235 Ga0070664_100170611 3300005564 Bacteria 1930
236 Ga0070664_100406141 3300005564 Bacteria 1246
237 Ga0070664_100540925 3300005564 Bacteria 1076
238 Ga0070664_100652333 3300005564 Bacteria 978
239 Ga0068857_100000395 3300005577 Bacteria 30659
240 Ga0068857_100005271 3300005577 Bacteria 11008
241 Ga0068857_100005485 3300005577 Bacteria 10817
242 Ga0068857_100011755 3300005577 Bacteria 7611
243 Ga0068857_100062459 3300005577 Bacteria 3311
244 Ga0068857_100217749 3300005577 Bacteria 1743
245 Ga0068857_100241996 3300005577 Bacteria 1652
246 Ga0068857_100315710 3300005577 Bacteria 1442
247 Ga0068854_100011707 3300005578 Bacteria 5721
248 Ga0068854_100046340 3300005578 Bacteria 3095
249 Ga0068856_100006431 3300005614 Bacteria 11528
250 Ga0068856_100016868 3300005614 Bacteria 7078
251 Ga0068856_100020994 3300005614 Bacteria 6346
252 Ga0068856_100024969 3300005614 Bacteria 5825
253 Ga0068856_100153472 3300005614 Bacteria 2312
254 Ga0068856_100202628 3300005614 Bacteria 1999
255 Ga0068856_100462277 3300005614 Bacteria 1290
256 Ga0070702_100106993 3300005615 Bacteria 1726
257 Ga0068852_100000009 3300005616 Bacteria 149600
258 Ga0068852_100002047 3300005616 Bacteria 13739
259 Ga0068852_100077649 3300005616 Bacteria 2936
260 Ga0068852_100116482 3300005616 Bacteria 2438
261 Ga0068852_100196924 3300005616 Bacteria 1905
262 Ga0068852_100888525 3300005616 Bacteria 908
263 Ga0068859_100003529 3300005617 Bacteria 15926
264 Ga0068859_100096135 3300005617 Bacteria 3015
265 Ga0068859_100220259 3300005617 Unclassified 1985
266 Ga0068859_100312628 3300005617 Bacteria 1665
267 Ga0068859_100319689 3300005617 Bacteria 1646
268 Ga0068864_100000703 3300005618 Bacteria 28109
269 Ga0068864_100039721 3300005618 Bacteria 4022
270 Ga0068864_100094216 3300005618 Bacteria 2646
271 Ga0068864_100094938 3300005618 Bacteria 2637
272 Ga0068864_100275063 3300005618 Bacteria 1570
273 Ga0068864_100400904 3300005618 Unclassified 1303
274 Ga0068866_10134513 3300005718 Bacteria 1411
275 Ga0068866_10321124 3300005718 Bacteria 974
276 Ga0068861_100013889 3300005719 Bacteria 5644
277 Ga0068861_100080069 3300005719 Bacteria 2555
278 Ga0068851_10003027 3300005834 Bacteria 7428
279 Ga0068851_10016410 3300005834 Bacteria 3543
280 Ga0068851_10018155 3300005834 Bacteria 3388
281 Ga0068851_10026983 3300005834 Bacteria 2827
282 Ga0068851_10047116 3300005834 Bacteria 2182
283 Ga0068870_10088436 3300005840 Bacteria 1727
284 Ga0068863_100002707 3300005841 Bacteria 17508
285 Ga0068863_100048815 3300005841 Bacteria 4013
286 Ga0068863_100079747 3300005841 Bacteria 3100
287 Ga0068863_100278110 3300005841 Bacteria 1621
288 Ga0068863_100458710 3300005841 Bacteria 1251
289 Ga0068863_100647272 3300005841 Bacteria 1048
290 Ga0068863_100751378 3300005841 Bacteria 971
291 Ga0068858_100004230 3300005842 Bacteria 14131
292 Ga0068858_100004379 3300005842 Bacteria 13856
293 Ga0068858_100136747 3300005842 Bacteria 2299
294 Ga0068858_100140372 3300005842 Bacteria 2268
295 Ga0068858_100545805 3300005842 Bacteria 1122
296 Ga0068860_100001296 3300005843 Bacteria 27187
297 Ga0068860_100019101 3300005843 Bacteria 6654
298 Ga0068860_100078877 3300005843 Bacteria 3131
299 Ga0068860_100122063 3300005843 Bacteria 2495
300 Ga0068860_100747504 3300005843 Bacteria 989
301 Ga0068862_100010077 3300005844 Bacteria 7802
302 Ga0068862_100172085 3300005844 Bacteria 1939
303 Ga0081455_10031083 3300005937 Bacteria 4836
304 Ga0081455_10055113 3300005937 Bacteria 3383
305 Ga0081455_10446412 3300005937 Bacteria 885
306 Ga0081539_10000055 3300005985 Bacteria 257359
307 Ga0081539_10022432 3300005985 Bacteria 4177
308 Ga0070717_10009476 3300006028 Bacteria 7321
309 Ga0070716_100022321 3300006173 Bacteria 3343
310 Ga0070716_100317613 3300006173 Bacteria 1090
311 Ga0070716_100334618 3300006173 Bacteria 1066
312 Ga0070712_100194853 3300006175 Bacteria 1588
313 Ga0070712_100228993 3300006175 Bacteria 1475
314 Ga0070712_100494695 3300006175 Bacteria 1024
315 Ga0075362_10047983 3300006177 Bacteria 1904
316 Ga0075367_10006204 3300006178 Bacteria 6020
317 Ga0075366_10217895 3300006195 Bacteria 1163
318 Ga0097621_100000518 3300006237 Bacteria 27043
319 Ga0097621_100067863 3300006237 Bacteria 2940
320 Ga0097621_100114097 3300006237 Bacteria 2285
321 Ga0097621_100492725 3300006237 Bacteria 1109
322 Ga0068871_100000818 3300006358 Bacteria 20836
323 Ga0068871_100003031 3300006358 Bacteria 11526
324 Ga0068871_100042042 3300006358 Bacteria 3667
325 Ga0068871_100098178 3300006358 Bacteria 2450
326 Ga0075428_100001699 3300006844 Bacteria 23490
327 Ga0075428_100003643 3300006844 Bacteria 16890
328 Ga0075428_100024691 3300006844 Bacteria 6651
329 Ga0075428_100113931 3300006844 Bacteria 2946
330 Ga0075428_100369811 3300006844 Bacteria 1537
331 Ga0075430_100024591 3300006846 Bacteria 5123
332 Ga0075430_100162420 3300006846 Bacteria 1859
333 Ga0075430_100165978 3300006846 Bacteria 1837
334 Ga0075431_100001487 3300006847 Bacteria 21652
335 Ga0075431_100003529 3300006847 Bacteria 15162
336 Ga0075431_100056248 3300006847 Bacteria 4058
337 Ga0075431_100869306 3300006847 Bacteria 872
338 Ga0075433_10002802 3300006852 Bacteria 13356
339 Ga0075433_10063330 3300006852 Bacteria 3239
340 Ga0075434_100004994 3300006871 Bacteria 12040
341 Ga0075434_100008396 3300006871 Bacteria 9605
342 Ga0075434_100010728 3300006871 Bacteria 8602
343 Ga0075434_100319126 3300006871 Bacteria 1574
344 Ga0075429_100002658 3300006880 Bacteria 15038
345 Ga0075429_100008631 3300006880 Bacteria 8864
346 Ga0075429_100441042 3300006880 Bacteria 1141
347 Ga0068865_100111541 3300006881 Bacteria 2018
348 Ga0075436_100148868 3300006914 Bacteria 1646
349 Ga0075436_100163321 3300006914 Bacteria 1570
350 Ga0097620_100003529 3300006931 Bacteria 15926
351 Ga0097620_100096127 3300006931 Bacteria 3015
352 Ga0097620_100220275 3300006931 Unclassified 1985
353 Ga0097620_100312629 3300006931 Bacteria 1665
354 Ga0097620_100319676 3300006931 Bacteria 1646
355 Ga0075435_100020958 3300007076 Bacteria 5020
356 Ga0075435_100061587 3300007076 Bacteria 3044
357 Ga0075435_100067655 3300007076 Bacteria 2909
358 Ga0075435_100416619 3300007076 Bacteria 1157
359 Ga0099794_10091357 3300007265 Bacteria 1511
360 Ga0099795_10053828 3300007788 Bacteria 1474
361 Ga0105240_10000148 3300009093 Bacteria 142265
362 Ga0105240_10000184 3300009093 Bacteria 126650
363 Ga0105240_10003298 3300009093 Bacteria 25231
364 Ga0105240_10004349 3300009093 Bacteria 21628
365 Ga0105240_10010183 3300009093 Bacteria 13233
366 Ga0105240_10011941 3300009093 Bacteria 12042
367 Ga0105240_10021102 3300009093 Bacteria 8671
368 Ga0105240_10024402 3300009093 Bacteria 7969
369 Ga0105240_10028713 3300009093 Bacteria 7257
370 Ga0105240_10038192 3300009093 Bacteria 6161
371 Ga0105240_10143954 3300009093 Bacteria 2846
372 Ga0105240_10272043 3300009093 Archaea 1950
373 Ga0105240_10658544 3300009093 Bacteria 1147
374 Ga0105240_10740363 3300009093 Bacteria 1070
375 Ga0111539_10004031 3300009094 Bacteria 19287
376 Ga0111539_10004761 3300009094 Bacteria 17715
377 Ga0111539_10005537 3300009094 Bacteria 16328
378 Ga0111539_10012274 3300009094 Bacteria 10742
379 Ga0111539_10013833 3300009094 Bacteria 10087
380 Ga0111539_10020590 3300009094 Bacteria 8123
381 Ga0111539_10025777 3300009094 Bacteria 7200
382 Ga0111539_10056310 3300009094 Bacteria 4673
383 Ga0111539_10067977 3300009094 Bacteria 4207
384 Ga0111539_10079222 3300009094 Bacteria 3864
385 Ga0111539_10138344 3300009094 Bacteria 2852
386 Ga0105245_10001000 3300009098 Bacteria 25662
387 Ga0105245_10016213 3300009098 Bacteria 6493
388 Ga0105245_10062815 3300009098 Bacteria 3351
389 Ga0105247_10003975 3300009101 Bacteria 9513
390 Ga0105247_10086936 3300009101 Bacteria 1979
391 Ga0114129_10001009 3300009147 Bacteria 36681
392 Ga0114129_10002566 3300009147 Bacteria 25226
393 Ga0114129_10003006 3300009147 Bacteria 23632
394 Ga0114129_10003920 3300009147 Bacteria 21000
395 Ga0114129_10039121 3300009147 Bacteria 6687
396 Ga0114129_10107121 3300009147 Bacteria 3861
397 Ga0114129_10162273 3300009147 Bacteria 3052
398 Ga0114129_10189984 3300009147 Bacteria 2790
399 Ga0114129_10195322 3300009147 Bacteria 2744
400 Ga0114129_10652042 3300009147 Bacteria 1358
401 Ga0114129_10717705 3300009147 Bacteria 1283
402 Ga0114129_11039182 3300009147 Bacteria 1029
403 Ga0105243_10257804 3300009148 Bacteria 1560
404 Ga0105243_10271223 3300009148 Bacteria 1524
405 Ga0105241_10000034 3300009174 Bacteria 115663
406 Ga0105241_10000869 3300009174 Bacteria 22911
407 Ga0105241_10002836 3300009174 Bacteria 12950
408 Ga0105241_10084467 3300009174 Bacteria 2493
409 Ga0105241_10223847 3300009174 Bacteria 1583
410 Ga0105241_10254422 3300009174 Bacteria 1490
411 Ga0105241_10278414 3300009174 Bacteria 1428
412 Ga0105242_10059102 3300009176 Unclassified 3145
413 Ga0105242_10060496 3300009176 Bacteria 3112
414 Ga0105242_10138894 3300009176 Bacteria 2106
415 Ga0105242_10171792 3300009176 Bacteria 1906
416 Ga0105242_10496937 3300009176 Bacteria 1159
417 Ga0105248_10004803 3300009177 Bacteria 14957
418 Ga0105248_10062272 3300009177 Bacteria 4190
419 Ga0105248_10085918 3300009177 Unclassified 3540
420 Ga0105248_10215162 3300009177 Bacteria 2165
421 Ga0105248_10286182 3300009177 Bacteria 1856
422 Ga0105248_10676749 3300009177 Bacteria 1164
423 Ga0105248_10903053 3300009177 Bacteria 997
424 Ga0105237_10001697 3300009545 Bacteria 28502
425 Ga0105237_10003833 3300009545 Bacteria 17682
426 Ga0105237_10008032 3300009545 Bacteria 11478
427 Ga0105237_10043216 3300009545 Bacteria 4541
428 Ga0105237_10054048 3300009545 Bacteria 4025
429 Ga0105237_10075044 3300009545 Bacteria 3373
430 Ga0105237_10184379 3300009545 Bacteria 2087
431 Ga0105237_10253363 3300009545 Bacteria 1762
432 Ga0105237_10309387 3300009545 Bacteria 1583
433 Ga0105238_10001126 3300009551 Bacteria 26949
434 Ga0105238_10002350 3300009551 Bacteria 19022
435 Ga0105238_10040172 3300009551 Bacteria 4741
436 Ga0105238_10057905 3300009551 Bacteria 3884
437 Ga0105238_10076722 3300009551 Bacteria 3334
438 Ga0105238_10115317 3300009551 Bacteria 2666
439 Ga0105249_10010662 3300009553 Bacteria 8073
440 Ga0105249_10014871 3300009553 Bacteria 6883
441 Ga0105249_10026046 3300009553 Bacteria 5267
442 Ga0105249_10041833 3300009553 Bacteria 4166
443 Ga0105249_10055929 3300009553 Bacteria 3612
444 Ga0105249_10066887 3300009553 Bacteria 3309
445 Ga0105249_10856251 3300009553 Archaea 975
446 Ga0105239_10003426 3300010375 Bacteria 19426
447 Ga0105239_10037615 3300010375 Bacteria 5303
448 Ga0105239_10056049 3300010375 Bacteria 4323
449 Ga0105239_10057259 3300010375 Bacteria 4275
450 Ga0105239_10081750 3300010375 Unclassified 3556
451 Ga0105239_10152910 3300010375 Unclassified 2575
452 Ga0105239_10220324 3300010375 Bacteria 2128
453 Ga0105246_10001916 3300011119 Bacteria 12536
454 Ga0105246_10091838 3300011119 Bacteria 2189
455 Ga0157373_10072112 3300013100 Unclassified 2438
456 Ga0157373_10079961 3300013100 Bacteria 2305
457 Ga0157373_10236939 3300013100 Bacteria 1289
458 Ga0157373_10382748 3300013100 Bacteria 1007
459 Ga0157373_10465815 3300013100 Bacteria 911
460 Ga0157371_10062981 3300013102 Bacteria 2629
461 Ga0157370_10000059 3300013104 Bacteria 116740
462 Ga0157370_10013611 3300013104 Bacteria 8371
463 Ga0157370_10109377 3300013104 Bacteria 2584
464 Ga0157370_10334328 3300013104 Bacteria 1396
465 Ga0157370_10472918 3300013104 Bacteria 1152
466 Ga0157369_10000035 3300013105 Bacteria 191300
467 Ga0157369_10011332 3300013105 Bacteria 10125
468 Ga0157369_10024763 3300013105 Bacteria 6668
469 Ga0157369_10026388 3300013105 Bacteria 6444
470 Ga0157369_10029532 3300013105 Bacteria 6058
471 Ga0157369_10032558 3300013105 Bacteria 5732
472 Ga0157369_10036583 3300013105 Bacteria 5377
473 Ga0157369_10097070 3300013105 Bacteria 3143
474 Ga0157369_10120565 3300013105 Bacteria 2783
475 Ga0157369_10127321 3300013105 Bacteria 2699
476 Ga0157369_10350765 3300013105 Bacteria 1532
477 Ga0157369_10383321 3300013105 Bacteria 1459
478 Ga0157369_10400764 3300013105 Bacteria 1423
479 Ga0157369_10427512 3300013105 Bacteria 1373
480 Ga0157374_10005708 3300013296 Bacteria 10498
481 Ga0157374_10023027 3300013296 Bacteria 5565
482 Ga0157374_10046200 3300013296 Bacteria 4031
483 Ga0157374_10057535 3300013296 Bacteria 3631
484 Ga0157374_10286875 3300013296 Bacteria 1626
485 Ga0157378_10001112 3300013297 Bacteria 24468
486 Ga0157378_10005047 3300013297 Bacteria 11590
487 Ga0157378_10033955 3300013297 Bacteria 4512
488 Ga0157378_10182388 3300013297 Bacteria 1975
489 Ga0157378_10420093 3300013297 Bacteria 1321
490 Ga0163162_10008087 3300013306 Bacteria 10265
491 Ga0163162_10020297 3300013306 Bacteria 6526
492 Ga0163162_10022648 3300013306 Bacteria 6193
493 Ga0163162_10374536 3300013306 Bacteria 1557
494 Ga0163162_10402585 3300013306 Bacteria 1501
495 Ga0163162_11195514 3300013306 Bacteria 863
496 Ga0163162_11212929 3300013306 Archaea 856
497 Ga0157372_10000049 3300013307 Bacteria 142350
498 Ga0157372_10002058 3300013307 Bacteria 21864
499 Ga0157372_10010693 3300013307 Bacteria 9765
500 Ga0157372_10024244 3300013307 Bacteria 6587
501 Ga0157372_10054588 3300013307 Bacteria 4458
502 Ga0157372_10056725 3300013307 Bacteria 4376
503 Ga0157372_10062710 3300013307 Bacteria 4165
504 Ga0157372_10086625 3300013307 Bacteria 3553
505 Ga0157372_10121006 3300013307 Bacteria 3006
506 Ga0157372_10140329 3300013307 Bacteria 2784
507 Ga0157372_10146617 3300013307 Bacteria 2722
508 Ga0157372_10197845 3300013307 Bacteria 2328
509 Ga0157372_10242510 3300013307 Bacteria 2091
510 Ga0157375_10001018 3300013308 Bacteria 24251
511 Ga0157375_10107822 3300013308 Bacteria 2879
512 Ga0157375_10124706 3300013308 Bacteria 2689
513 Ga0157375_10241941 3300013308 Unclassified 1964
514 Ga0157375_10638340 3300013308 Bacteria 1222
515 Ga0157375_10841136 3300013308 Bacteria 1065
516 Ga0163163_10001812 3300014325 Bacteria 18020
517 Ga0163163_10010158 3300014325 Bacteria 8448
518 Ga0163163_10011286 3300014325 Bacteria 8097
519 Ga0163163_10054406 3300014325 Bacteria 3954
520 Ga0163163_10159668 3300014325 Bacteria 2299
521 Ga0163163_10167041 3300014325 Unclassified 2247
522 Ga0157379_10000232 3300014968 Bacteria 43528
523 Ga0157379_10089213 3300014968 Bacteria 2766
524 Ga0157379_10124261 3300014968 Bacteria 2322
525 Ga0157379_10188154 3300014968 Bacteria 1866
526 Ga0157379_10249185 3300014968 Unclassified 1612
527 Ga0157376_10001933 3300014969 Bacteria 13831
528 Ga0157376_10079079 3300014969 Bacteria 2818
529 Ga0157376_10088948 3300014969 Bacteria 2669
530 Ga0157376_10161024 3300014969 Bacteria 2034
531 Ga0157376_10205628 3300014969 Bacteria 1814
532 Ga0157376_10234235 3300014969 Bacteria 1707
533 Ga0157376_10257731 3300014969 Bacteria 1632
534 Ga0157376_10285970 3300014969 Bacteria 1555
535 Ga0157376_10447399 3300014969 Bacteria 1259
536 Ga0157376_10643840 3300014969 Bacteria 1059
537 Ga0163161_10011698 3300017792 Bacteria 6089
538 Ga0163161_10181950 3300017792 Bacteria 1612
539 Ga0213873_10003636 3300021358 Bacteria 2800
540 Ga0213872_10000391 3300021361 Bacteria 36442
541 Ga0213872_10001235 3300021361 Bacteria 17254
542 Ga0213872_10025887 3300021361 Archaea 2696
543 Ga0213876_10000006 3300021384 Bacteria 700803
544 Ga0213876_10000076 3300021384 Bacteria 116109
545 Ga0213876_10008599 3300021384 Bacteria 5525
546 Ga0213876_10035000 3300021384 Bacteria 2650
547 Ga0213875_10008669 3300021388 Bacteria 5192
548 Ga0213871_10000242 3300021441 Bacteria 6577
549 Ga0207666_1019023 3300025271 Bacteria 1000
550 Ga0207697_10015188 3300025315 Bacteria 3185
551 Ga0207656_10019237 3300025321 Bacteria 2700
552 Ga0207656_10085422 3300025321 Bacteria 1425
553 Ga0207653_10020466 3300025885 Bacteria 2094
554 Ga0207653_10042838 3300025885 Bacteria 1489
555 Ga0207642_10003077 3300025899 Bacteria 5226
556 Ga0207688_10125770 3300025901 Bacteria 1499
557 Ga0207680_10069024 3300025903 Bacteria 2183
558 Ga0207680_10326349 3300025903 Bacteria 1074
559 Ga0207647_10000813 3300025904 Bacteria 24219
560 Ga0207647_10004346 3300025904 Bacteria 10508
561 Ga0207647_10011180 3300025904 Bacteria 6306
562 Ga0207647_10038931 3300025904 Bacteria 3003
563 Ga0207647_10272839 3300025904 Bacteria 967
564 Ga0207699_10000078 3300025906 Bacteria 76220
565 Ga0207699_10051271 3300025906 Bacteria 2438
566 Ga0207699_10182587 3300025906 Bacteria 1411
567 Ga0207645_10010986 3300025907 Bacteria 6195
568 Ga0207705_10000024 3300025909 Bacteria 259977
569 Ga0207705_10016740 3300025909 Bacteria 5250
570 Ga0207705_10029614 3300025909 Bacteria 3903
571 Ga0207705_10030773 3300025909 Bacteria 3830
572 Ga0207684_10012549 3300025910 Bacteria 7363
573 Ga0207684_10026897 3300025910 Bacteria 4906
574 Ga0207684_10177530 3300025910 Bacteria 1836
575 Ga0207684_10225076 3300025910 Unclassified 1619
576 Ga0207684_10313439 3300025910 Bacteria 1352
577 Ga0207684_10610494 3300025910 Bacteria 931
578 Ga0207654_10000029 3300025911 Bacteria 123429
579 Ga0207654_10000470 3300025911 Bacteria 23002
580 Ga0207654_10002356 3300025911 Bacteria 9686
581 Ga0207654_10117359 3300025911 Bacteria 1665
582 Ga0207707_10000024 3300025912 Bacteria 183501
583 Ga0207707_10000202 3300025912 Bacteria 63576
584 Ga0207707_10005457 3300025912 Bacteria 11116
585 Ga0207707_10011081 3300025912 Bacteria 7841
586 Ga0207707_10022340 3300025912 Bacteria 5531
587 Ga0207707_10027065 3300025912 Bacteria 5013
588 Ga0207707_10112586 3300025912 Unclassified 2379
589 Ga0207707_10160531 3300025912 Bacteria 1965
590 Ga0207707_10392482 3300025912 Bacteria 1192
591 Ga0207695_10000096 3300025913 Bacteria 265048
592 Ga0207695_10000105 3300025913 Bacteria 254764
593 Ga0207695_10000166 3300025913 Bacteria 195439
594 Ga0207695_10000518 3300025913 Bacteria 81729
595 Ga0207695_10002137 3300025913 Bacteria 29919
596 Ga0207695_10003839 3300025913 Bacteria 20799
597 Ga0207695_10007362 3300025913 Bacteria 14045
598 Ga0207695_10015229 3300025913 Bacteria 9067
599 Ga0207695_10019695 3300025913 Bacteria 7760
600 Ga0207695_10020085 3300025913 Bacteria 7664
601 Ga0207695_10025204 3300025913 Bacteria 6665
602 Ga0207695_10031490 3300025913 Bacteria 5815
603 Ga0207695_10092750 3300025913 Bacteria 3030
604 Ga0207695_10235241 3300025913 Bacteria 1735
605 Ga0207671_10000258 3300025914 Bacteria 79486
606 Ga0207671_10000953 3300025914 Bacteria 35931
607 Ga0207671_10022643 3300025914 Bacteria 4747
608 Ga0207671_10030569 3300025914 Bacteria 4016
609 Ga0207671_10162376 3300025914 Bacteria 1731
610 Ga0207693_10315802 3300025915 Bacteria 1223
611 Ga0207693_10468346 3300025915 Bacteria 984
612 Ga0207663_10080876 3300025916 Bacteria 2126
613 Ga0207663_10085038 3300025916 Bacteria 2082
614 Ga0207660_10004800 3300025917 Bacteria 8794
615 Ga0207660_10009941 3300025917 Bacteria 6164
616 Ga0207660_10094704 3300025917 Bacteria 2220
617 Ga0207660_10126975 3300025917 Unclassified 1938
618 Ga0207660_10413056 3300025917 Bacteria 1088
619 Ga0207657_10002640 3300025919 Bacteria 19354
620 Ga0207657_10022053 3300025919 Bacteria 5977
621 Ga0207657_10143419 3300025919 Bacteria 1950
622 Ga0207657_10224080 3300025919 Unclassified 1505
623 Ga0207649_10016523 3300025920 Bacteria 4165
624 Ga0207649_10057700 3300025920 Bacteria 2428
625 Ga0207649_10116744 3300025920 Bacteria 1793
626 Ga0207649_10132713 3300025920 Bacteria 1694
627 Ga0207649_10204143 3300025920 Bacteria 1398
628 Ga0207652_10001822 3300025921 Bacteria 18473
629 Ga0207652_10002197 3300025921 Bacteria 16654
630 Ga0207652_10052984 3300025921 Bacteria 3484
631 Ga0207652_10073347 3300025921 Bacteria 2977
632 Ga0207652_10079279 3300025921 Bacteria 2869
633 Ga0207652_10118706 3300025921 Bacteria 2351
634 Ga0207652_10352983 3300025921 Unclassified 1327
635 Ga0207652_10559359 3300025921 Bacteria 1027
636 Ga0207646_10010031 3300025922 Bacteria 9297
637 Ga0207646_10022574 3300025922 Bacteria 5795
638 Ga0207646_10078698 3300025922 Bacteria 2947
639 Ga0207646_10105078 3300025922 Bacteria 2532
640 Ga0207646_10717496 3300025922 Bacteria 893
641 Ga0207681_10018736 3300025923 Bacteria 4365
642 Ga0207694_10000561 3300025924 Bacteria 33644
643 Ga0207694_10002454 3300025924 Bacteria 15131
644 Ga0207694_10008745 3300025924 Bacteria 7640
645 Ga0207694_10009213 3300025924 Bacteria 7449
646 Ga0207694_10011077 3300025924 Bacteria 6810
647 Ga0207694_10028300 3300025924 Bacteria 4273
648 Ga0207694_10070491 3300025924 Bacteria 2731
649 Ga0207694_10100146 3300025924 Bacteria 2296
650 Ga0207694_10357752 3300025924 Bacteria 1209
651 Ga0207650_10008841 3300025925 Bacteria 6882
652 Ga0207650_10010891 3300025925 Bacteria 6250
653 Ga0207650_10384134 3300025925 Bacteria 1160
654 Ga0207659_10190447 3300025926 Bacteria 1632
655 Ga0207659_10499404 3300025926 Bacteria 1030
656 Ga0207687_10003324 3300025927 Bacteria 10862
657 Ga0207700_10015394 3300025928 Bacteria 5045
658 Ga0207700_10016845 3300025928 Bacteria 4867
659 Ga0207700_10032889 3300025928 Bacteria 3704
660 Ga0207700_10054236 3300025928 Bacteria 3008
661 Ga0207700_10086237 3300025928 Bacteria 2467
662 Ga0207664_10068493 3300025929 Bacteria 2851
663 Ga0207664_10288272 3300025929 Bacteria 1442
664 Ga0207644_10009284 3300025931 Bacteria 6454
665 Ga0207644_10040403 3300025931 Bacteria 3297
666 Ga0207644_10045956 3300025931 Bacteria 3108
667 Ga0207644_10371078 3300025931 Bacteria 1166
668 Ga0207690_10107366 3300025932 Bacteria 2005
669 Ga0207690_10156759 3300025932 Bacteria 1693
670 Ga0207690_10214112 3300025932 Bacteria 1471
671 Ga0207706_10021099 3300025933 Bacteria 5851
672 Ga0207686_10027901 3300025934 Bacteria 3312
673 Ga0207686_10120640 3300025934 Unclassified 1784
674 Ga0207670_10185037 3300025936 Bacteria 1572
675 Ga0207704_10070317 3300025938 Bacteria 2215
676 Ga0207704_10104176 3300025938 Bacteria 1899
677 Ga0207665_10028391 3300025939 Bacteria 3695
678 Ga0207665_10129560 3300025939 Bacteria 1789
679 Ga0207665_10333812 3300025939 Bacteria 1141
680 Ga0207691_10070555 3300025940 Bacteria 3154
681 Ga0207711_10005794 3300025941 Bacteria 10439
682 Ga0207711_10007356 3300025941 Bacteria 9216
683 Ga0207711_10142940 3300025941 Bacteria 2154
684 Ga0207711_10162714 3300025941 Bacteria 2021
685 Ga0207711_10165704 3300025941 Unclassified 2003
686 Ga0207711_10168778 3300025941 Bacteria 1985
687 Ga0207711_10317754 3300025941 Bacteria 1438
688 Ga0207711_10388687 3300025941 Bacteria 1295
689 Ga0207689_10001771 3300025942 Bacteria 20387
690 Ga0207689_10026550 3300025942 Bacteria 4850
691 Ga0207689_10036520 3300025942 Bacteria 4078
692 Ga0207689_10218921 3300025942 Bacteria 1573
693 Ga0207689_10379817 3300025942 Bacteria 1176
694 Ga0207661_10010817 3300025944 Bacteria 6581
695 Ga0207661_10025005 3300025944 Bacteria 4534
696 Ga0207661_10044957 3300025944 Bacteria 3492
697 Ga0207679_10101698 3300025945 Bacteria 2249
698 Ga0207679_10117362 3300025945 Bacteria 2112
699 Ga0207679_10120640 3300025945 Unclassified 2086
700 Ga0207679_10206760 3300025945 Bacteria 1644
701 Ga0207679_10225217 3300025945 Bacteria 1580
702 Ga0207667_10001884 3300025949 Bacteria 26389
703 Ga0207667_10002989 3300025949 Bacteria 21004
704 Ga0207667_10024971 3300025949 Bacteria 6552
705 Ga0207667_10026724 3300025949 Bacteria 6300
706 Ga0207667_10046686 3300025949 Bacteria 4587
707 Ga0207667_10051706 3300025949 Bacteria 4330
708 Ga0207667_10114828 3300025949 Bacteria 2775
709 Ga0207667_10218583 3300025949 Bacteria 1952
710 Ga0207667_10361434 3300025949 Bacteria 1480
711 Ga0207651_10125378 3300025960 Bacteria 1956
712 Ga0207651_10219459 3300025960 Bacteria 1536
713 Ga0207712_10017309 3300025961 Bacteria 4679
714 Ga0207712_10055435 3300025961 Bacteria 2788
715 Ga0207712_10059597 3300025961 Bacteria 2703
716 Ga0207712_10119561 3300025961 Bacteria 1991
717 Ga0207712_10181331 3300025961 Bacteria 1654
718 Ga0207712_10377815 3300025961 Bacteria 1185
719 Ga0207668_10379160 3300025972 Bacteria 1190
720 Ga0207668_10550827 3300025972 Bacteria 999
721 Ga0207640_10035297 3300025981 Bacteria 3128
722 Ga0207640_10151843 3300025981 Bacteria 1703
723 Ga0207658_10032673 3300025986 Bacteria 3706
724 Ga0207658_10040409 3300025986 Bacteria 3372
725 Ga0207658_10110994 3300025986 Bacteria 2168
726 Ga0207677_10014977 3300026023 Bacteria 4545
727 Ga0207703_10010351 3300026035 Bacteria 7299
728 Ga0207703_10057387 3300026035 Bacteria 3174
729 Ga0207703_10060550 3300026035 Bacteria 3096
730 Ga0207703_10074588 3300026035 Bacteria 2810
731 Ga0207703_10192210 3300026035 Bacteria 1808
732 Ga0207639_10001162 3300026041 Bacteria 17856
733 Ga0207639_10008886 3300026041 Bacteria 6910
734 Ga0207639_10023787 3300026041 Bacteria 4426
735 Ga0207639_10039053 3300026041 Bacteria 3535
736 Ga0207639_10086260 3300026041 Bacteria 2499
737 Ga0207639_10272806 3300026041 Bacteria 1484
738 Ga0207639_10284962 3300026041 Bacteria 1454
739 Ga0207639_10330979 3300026041 Bacteria 1355
740 Ga0207639_10337087 3300026041 Bacteria 1343
741 Ga0207678_10025937 3300026067 Bacteria 5114
742 Ga0207678_10027159 3300026067 Bacteria 4992
743 Ga0207678_10043589 3300026067 Bacteria 3882
744 Ga0207678_10131372 3300026067 Bacteria 2136
745 Ga0207678_10211147 3300026067 Bacteria 1660
746 Ga0207678_10236586 3300026067 Bacteria 1564
747 Ga0207678_10286080 3300026067 Bacteria 1415
748 Ga0207678_10465412 3300026067 Bacteria 1100
749 Ga0207708_10064957 3300026075 Bacteria 2789
750 Ga0207708_10069602 3300026075 Bacteria 2694
751 Ga0207708_10516929 3300026075 Bacteria 1003
752 Ga0207702_10001922 3300026078 Bacteria 20316
753 Ga0207702_10055710 3300026078 Bacteria 3354
754 Ga0207702_10163277 3300026078 Bacteria 2036
755 Ga0207702_10370834 3300026078 Bacteria 1374
756 Ga0207641_10012473 3300026088 Bacteria 6966
757 Ga0207641_10067688 3300026088 Bacteria 3060
758 Ga0207641_10159629 3300026088 Bacteria 2049
759 Ga0207641_10390454 3300026088 Bacteria 1335
760 Ga0207648_10148006 3300026089 Bacteria 2072
761 Ga0207648_10342911 3300026089 Bacteria 1346
762 Ga0207676_10001831 3300026095 Bacteria 15573
763 Ga0207676_10017288 3300026095 Bacteria 5227
764 Ga0207676_10060911 3300026095 Bacteria 2987
765 Ga0207674_10000449 3300026116 Bacteria 53656
766 Ga0207674_10002944 3300026116 Bacteria 21149
767 Ga0207674_10004324 3300026116 Bacteria 17128
768 Ga0207674_10008806 3300026116 Bacteria 11617
769 Ga0207674_10048569 3300026116 Bacteria 4343
770 Ga0207674_10056044 3300026116 Bacteria 4004
771 Ga0207674_10127204 3300026116 Unclassified 2513
772 Ga0207674_10269270 3300026116 Bacteria 1651
773 Ga0207674_10957134 3300026116 Bacteria 825
774 Ga0207675_100037682 3300026118 Bacteria 4510
775 Ga0207675_100111385 3300026118 Bacteria 2582
776 Ga0207683_10008254 3300026121 Bacteria 8907
777 Ga0207683_10016731 3300026121 Bacteria 6241
778 Ga0207683_10274502 3300026121 Bacteria 1540
779 Ga0207698_10000020 3300026142 Bacteria 139630
780 Ga0207698_10007447 3300026142 Bacteria 6854
781 Ga0207698_10110877 3300026142 Bacteria 2299
782 Ga0207698_10204395 3300026142 Bacteria 1772
783 Ga0207698_10400169 3300026142 Bacteria 1312
784 Ga0207698_10427201 3300026142 Bacteria 1273
785 Ga0207698_10705354 3300026142 Bacteria 1004
786 Ga0207428_10004830 3300027907 Bacteria 12720
787 Ga0207428_10007912 3300027907 Bacteria 9661
788 Ga0207428_10009694 3300027907 Bacteria 8629
789 Ga0207428_10014428 3300027907 Bacteria 6866
790 Ga0268266_10001402 3300028379 Bacteria 28793
791 Ga0268266_10007152 3300028379 Bacteria 10110
792 Ga0268266_10063734 3300028379 Bacteria 3182
793 Ga0268266_10154336 3300028379 Unclassified 2072
794 Ga0268266_10193549 3300028379 Bacteria 1858
795 Ga0268266_10220222 3300028379 Bacteria 1744
796 Ga0268266_10570873 3300028379 Bacteria 1085
797 Ga0268266_10692409 3300028379 Bacteria 982
798 Ga0268265_10008032 3300028380 Bacteria 7125
799 Ga0268265_10021744 3300028380 Bacteria 4498
800 Ga0268265_10053504 3300028380 Bacteria 3059
801 Ga0268265_10103418 3300028380 Bacteria 2306
802 Ga0268264_10010592 3300028381 Bacteria 7622
803 Ga0268264_10023468 3300028381 Bacteria 5031
804 Ga0268264_10676751 3300028381 Bacteria 1023
805 Ga0265319_1034019 3300028563 Bacteria 1756
806 Ga0265334_10000347 3300028573 Bacteria 24794
807 Ga0265334_10050592 3300028573 Bacteria 1595
808 Ga0265318_10000314 3300028577 Bacteria 38817
809 Ga0265336_10014841 3300028666 Bacteria 2573
810 Ga0265338_10004672 3300028800 Bacteria 18373
811 Ga0265338_10032152 3300028800 Bacteria 5127
812 Ga0265338_10032174 3300028800 Bacteria 5123
813 Ga0265338_10055362 3300028800 Bacteria 3529
814 Ga0265338_10068304 3300028800 Bacteria 3063
815 Ga0307511_10004768 3300030521 Bacteria 13862
816 Ga0265760_10048125 3300031090 Bacteria 1281
817 Ga0265330_10000616 3300031235 Bacteria 22948
818 Ga0265330_10002336 3300031235 Bacteria 10403
819 Ga0265332_10001542 3300031238 Bacteria 12682
820 Ga0265332_10028049 3300031238 Bacteria 2465
821 Ga0265328_10001271 3300031239 Bacteria 11643
822 Ga0265328_10016301 3300031239 Bacteria 2894
823 Ga0265320_10013057 3300031240 Bacteria 4793
824 Ga0265320_10099752 3300031240 Bacteria 1338
825 Ga0265325_10000460 3300031241 Bacteria 29419
826 Ga0265325_10027432 3300031241 Bacteria 3078
827 Ga0265329_10008681 3300031242 Bacteria 3837
828 Ga0265340_10036576 3300031247 Bacteria 2432
829 Ga0265340_10082459 3300031247 Bacteria 1512
830 Ga0265339_10000055 3300031249 Bacteria 99907
831 Ga0265339_10005330 3300031249 Bacteria 8570
832 Ga0265339_10019989 3300031249 Bacteria 3919
833 Ga0265339_10093538 3300031249 Bacteria 1573
834 Ga0265331_10024034 3300031250 Bacteria 3088
835 Ga0265316_10111292 3300031344 Bacteria 2073
836 Ga0265316_10115489 3300031344 Bacteria 2029
837 Ga0307408_100006841 3300031548 Bacteria 7560
838 Ga0307408_100064541 3300031548 Bacteria 2682
839 Ga0307408_100165879 3300031548 Bacteria 1759
840 Ga0265313_10001288 3300031595 Bacteria 23723
841 Ga0265313_10012387 3300031595 Bacteria 5210
842 Ga0265313_10039157 3300031595 Bacteria 2353
843 Ga0265314_10000033 3300031711 Bacteria 254594
844 Ga0265314_10010701 3300031711 Bacteria 7633
845 Ga0265314_10053262 3300031711 Bacteria 2807
846 Ga0265314_10056063 3300031711 Bacteria 2715
847 Ga0265314_10101540 3300031711 Bacteria 1848
848 Ga0265314_10116112 3300031711 Bacteria 1693
849 Ga0265314_10229318 3300031711 Bacteria 1078
850 Ga0265342_10000955 3300031712 Bacteria 28783
851 Ga0265342_10001335 3300031712 Bacteria 23137
852 Ga0265342_10002405 3300031712 Bacteria 16202
853 Ga0265342_10040441 3300031712 Bacteria 2827
854 Ga0265342_10084427 3300031712 Bacteria 1829
855 Ga0265342_10122082 3300031712 Bacteria 1466
856 Ga0307516_10285459 3300031730 Bacteria 1331
857 Ga0307413_10350601 3300031824 Bacteria 1139
858 Ga0307407_10387077 3300031903 Bacteria 1000
859 Ga0307409_100429226 3300031995 Bacteria 1270
860 Ga0307416_100711923 3300032002 Bacteria 1094
861 Ga0307416_100992477 3300032002 Bacteria 942
862 Ga0307411_10204363 3300032005 Bacteria 1520
863 Ga0307415_100163518 3300032126 Bacteria 1728
864 Ga0373955_0210100 3300035172 Bacteria 1160
865 Ga0373933_0011987 3300035724 Bacteria 4786
866 Ga0373933_0331159 3300035724 Bacteria 988
867 Ga0373947_0030780 3300035725 Bacteria 3155
868 Ga0373937_0118842 3300036401 Bacteria 2462
869 Ga0373937_0281422 3300036401 Bacteria 1571
870 Ga0373925_0003829 3300037068 Bacteria 11544
871 Ga0373925_0200647 3300037068 Bacteria 1586
872 Ga0395900_0099126 3300037418 Bacteria 2994
873 Ga0395898_0335798 3300037466 Bacteria 1441
874 Ga0395905_0020148 3300037471 Bacteria 6318
875 Ga0395905_0139942 3300037471 Unclassified 2277
876 Ga0436364_0325433 3300037853 Bacteria 10850
877 Ga0436364_0452510 3300037853 Bacteria 2314
878 Ga0436364_0546849 3300037853 Bacteria 1700
879 Ga0436364_0601985 3300037853 Bacteria 3449
880 Ga0436364_1129496 3300037853 Bacteria 1384
881 Ga0436365_0381867 3300039437 Bacteria 4506
882 Ga0436365_0695157 3300039437 Bacteria 511493
883 Ga0436365_0717035 3300039437 Bacteria 1009
884 Ga0436365_0763529 3300039437 Bacteria 4107
885 Ga0436365_1357444 3300039437 Bacteria 7704
886 Ga0436365_1893186 3300039437 Bacteria 48707
887 Ga0436360_0190098 3300039438 Bacteria 1945
888 Ga0436360_0497631 3300039438 Bacteria 8276
889 Ga0436360_1050644 3300039438 Bacteria 16432
890 Ga0436361_0497831 3300039447 Bacteria 66397
891 Ga0436361_0527966 3300039447 Bacteria 15794
892 Ga0436361_0734004 3300039447 Bacteria 3899
893 Ga0436361_0905898 3300039447 Archaea 3855
894 Ga0436361_1046051 3300039447 Bacteria 3803
895 Ga0436363_1635986 3300039450 Bacteria 9195
896 Ga0436362_0853993 3300039453 Bacteria 1664
897 Ga0436362_0967602 3300039453 Bacteria 7213
898 Ga0451804_0720165 3300041463 Bacteria 988
899 Ga0439464_0008115 3300042439 Bacteria 2753
900 Ga0439460_0080063 3300042461 Bacteria 1024
901 Ga0453683_0010878 3300044673 Bacteria 6016
902 Ga0453683_0280589 3300044673 Bacteria 1064
903 Ga0466966_0084015 3300044684 Bacteria 1981
904 Ga0466966_0145667 3300044684 Bacteria 1446
905 Ga0453684_0477163 3300044712 Bacteria 1384
906 Ga0466957_0200406 3300044842 Bacteria 1311
907 Ga0466959_0044457 3300045049 Bacteria 3273
908 Ga0466959_0061411 3300045049 Bacteria 2732
909 Ga0466959_0255697 3300045049 Bacteria 1207
910 Ga0451576_0003922 3300045051 Bacteria 19857
911 Ga0451576_0005636 3300045051 Bacteria 15630
912 Ga0451576_0453166 3300045051 Bacteria 1347
913 Ga0466967_0070827 3300045976 Bacteria 3120
914 Ga0466967_0465485 3300045976 Bacteria 1237
915 Ga0466967_0770507 3300045976 Bacteria 955
916 Ga0495592_0018064 3300046454 Bacteria 5357
917 Ga0495592_0163928 3300046454 Bacteria 1527
918 Ga0495603_0044384 3300046455 Bacteria 2653
919 Ga0495629_0113270 3300046459 Bacteria 1891
920 Ga0495638_0002613 3300046460 Bacteria 14498
921 Ga0495651_0210410 3300046462 Bacteria 1354
922 Ga0495650_0001767 3300046471 Bacteria 19625
923 Ga0495580_0061085 3300046472 Bacteria 2647
924 Ga0495580_0081583 3300046472 Bacteria 2254
925 Ga0495583_0007715 3300046506 Bacteria 6702
926 Ga0495628_0153020 3300046516 Bacteria 1756
927 Ga0495643_0003303 3300046522 Bacteria 11914
928 Ga0495643_0116863 3300046522 Bacteria 1351
929 Ga0495587_0023949 3300046536 Bacteria 3746
930 Ga0495645_0020015 3300046543 Bacteria 4825
931 Ga0495645_0024163 3300046543 Bacteria 4409
932 Ga0495667_0005313 3300046559 Bacteria 8707
933 Ga0495668_0004256 3300046616 Bacteria 10281
934 Ga0495625_0000788 3300046660 Bacteria 43972
935 Ga0495625_0023848 3300046660 Bacteria 4668
936 Ga0495659_0011676 3300046664 Bacteria 2831
937 Ga0495659_0026194 3300046664 Bacteria 2002
938 Ga0495659_0033327 3300046664 Bacteria 1808
939 Ga0495588_0027381 3300046674 Bacteria 2849
940 Ga0495647_0066609 3300046681 Bacteria 1433
941 Ga0495658_0147355 3300046683 Bacteria 1444
942 Ga0495613_0225044 3300046689 Bacteria 1316
943 Ga0495613_0315364 3300046689 Bacteria 1080
944 Ga0495649_0126584 3300046694 Bacteria 1349
945 Ga0495581_0126623 3300047315 Bacteria 1488
946 Ga0495674_0690684 3300047319 Bacteria 802
947 Ga0495672_0004541 3300047320 Bacteria 11310
948 Ga0495672_0084538 3300047320 Bacteria 1760
949 Ga0495672_0203684 3300047320 Bacteria 988
950 Ga0495673_0053388 3300047469 Bacteria 1762
951 Ga0495684_0205168 3300047471 Bacteria 1452
952 Ga0495602_0218920 3300048088 Bacteria 1439
953 Ga0496101_0193712 3300048904 Bacteria 1569
954 Ga0496101_0303447 3300048904 Bacteria 1251
955 Ga0496102_0018499 3300048905 Bacteria 6124
956 Ga0496102_0359069 3300048905 Bacteria 1372
957 Ga0496103_0007465 3300048906 Bacteria 6518
958 Ga0496104_0003885 3300048907 Bacteria 12931
959 Ga0496104_0013442 3300048907 Bacteria 7377
960 Ga0496104_0250645 3300048907 Bacteria 1683
961 Ga0496105_0013721 3300048908 Bacteria 6433
962 Ga0496105_0021811 3300048908 Bacteria 5185
963 Ga0496105_0041888 3300048908 Bacteria 3774
964 Ga0496105_0054767 3300048908 Bacteria 3293
965 Ga0496106_0029166 3300048909 Bacteria 4111
966 Ga0496106_0526447 3300048909 Unclassified 949
967 Ga0496107_0064050 3300048910 Unclassified 2665
968 Ga0496108_0013213 3300048911 Bacteria 6728
969 Ga0496109_0012315 3300048912 Bacteria 7384
970 Ga0496109_0073965 3300048912 Bacteria 3132
971 Ga0496110_0003685 3300048913 Bacteria 11793
972 Ga0496110_0045625 3300048913 Bacteria 3832
973 Ga0496110_0077859 3300048913 Bacteria 2951
974 Ga0496111_0029330 3300048914 Bacteria 3907
975 Ga0496111_0031668 3300048914 Bacteria 3768
976 Ga0496111_0279581 3300048914 Bacteria 1238
977 Ga0496111_0299087 3300048914 Unclassified 1193
978 Ga0496112_0003441 3300048915 Bacteria 13073
979 Ga0496112_0074500 3300048915 Bacteria 3356
980 Ga0496113_0119125 3300048916 Bacteria 2062
981 Ga0496113_0226845 3300048916 Bacteria 1489
982 Ga0496114_0032609 3300048917 Bacteria 4288
983 Ga0496114_0313453 3300048917 Bacteria 1386
984 Ga0496115_0149292 3300048918 Bacteria 1929
985 Ga0496126_0007962 3300048929 Bacteria 11514
986 Ga0501293_006348 3300049516 Bacteria 962
987 Ga0501031_0011501 3300049568 Bacteria 5768
988 Ga0501032_0014947 3300049569 Bacteria 5490
989 Ga0501032_0018041 3300049569 Bacteria 4950
990 Ga0501032_0041514 3300049569 Bacteria 3123
991 Ga0501033_0005294 3300049570 Bacteria 10231
992 Ga0501033_0007580 3300049570 Bacteria 8442
993 Ga0501033_0180129 3300049570 Bacteria 1515
994 Ga0501034_0079374 3300049571 Bacteria 3285
995 Ga0501034_0097347 3300049571 Bacteria 2938
996 Ga0501034_0146022 3300049571 Bacteria 2342
997 Ga0501034_0168458 3300049571 Bacteria 2158
998 Ga0501034_0300982 3300049571 Bacteria 1540
999 Ga0501036_0002291 3300049572 Bacteria 14971
1000 Ga0501036_0013610 3300049572 Bacteria 6763
1001 Ga0501036_0015997 3300049572 Bacteria 6266
1002 Ga0501036_0025669 3300049572 Bacteria 4972
1003 Ga0501037_0003808 3300049573 Bacteria 10945
1004 Ga0501037_0007855 3300049573 Bacteria 7814
1005 Ga0501037_0194866 3300049573 Bacteria 1433
1006 Ga0501037_0276218 3300049573 Bacteria 1171
1007 Ga0501038_0010640 3300049574 Bacteria 8412
1008 Ga0501038_0033029 3300049574 Bacteria 4559
1009 Ga0501038_0080323 3300049574 Bacteria 2749
1010 Ga0501038_0415208 3300049574 Bacteria 1039
1011 Ga0501038_0498342 3300049574 Bacteria 931
1012 Ga0501039_0056909 3300049575 Bacteria 3029
1013 Ga0501039_0091136 3300049575 Bacteria 2376
1014 Ga0501042_0035389 3300049578 Bacteria 3542
1015 Ga0501042_0166463 3300049578 Bacteria 1591
1016 Ga0501043_0010309 3300049579 Bacteria 7327
1017 Ga0501046_0002763 3300049580 Bacteria 16333
1018 Ga0501046_0024561 3300049580 Bacteria 4942
1019 Ga0501046_0047523 3300049580 Bacteria 3402
1020 Ga0501046_0197347 3300049580 Bacteria 1498
1021 Ga0501047_0000308 3300049581 Bacteria 56269
1022 Ga0501047_0021643 3300049581 Bacteria 6175
1023 Ga0501047_0033125 3300049581 Bacteria 4988
1024 Ga0501047_0041640 3300049581 Bacteria 4438
1025 Ga0501047_0053929 3300049581 Bacteria 3889
1026 Ga0501047_0134759 3300049581 Bacteria 2350
1027 Ga0501048_0008820 3300049582 Bacteria 7595
1028 Ga0501048_0048543 3300049582 Bacteria 3027
1029 Ga0501067_0012186 3300049583 Bacteria 4766
1030 Ga0501067_0053490 3300049583 Bacteria 2237
1031 Ga0501068_0020779 3300049584 Bacteria 3830
1032 Ga0501068_0029054 3300049584 Bacteria 3272
1033 Ga0501069_0032350 3300049585 Bacteria 2878
1034 Ga0501069_0048590 3300049585 Bacteria 2356
1035 Ga0501070_0008203 3300049586 Bacteria 8834
1036 Ga0501070_0016898 3300049586 Bacteria 6123
1037 Ga0501070_0074045 3300049586 Bacteria 2818
1038 Ga0501070_0083763 3300049586 Bacteria 2640
1039 Ga0501071_0033537 3300049587 Bacteria 3647
1040 Ga0501072_0010157 3300049588 Bacteria 7170
1041 Ga0501072_0055947 3300049588 Bacteria 3109
1042 Ga0501073_0004731 3300049589 Bacteria 10221
1043 Ga0501073_0011606 3300049589 Bacteria 6438
1044 Ga0501073_0099744 3300049589 Bacteria 2016
1045 Ga0501073_0207979 3300049589 Bacteria 1352
1046 Ga0501074_0014534 3300049590 Bacteria 5728
1047 Ga0501074_0263915 3300049590 Bacteria 1224
1048 Ga0501075_0105492 3300049591 Bacteria 2141
1049 Ga0501076_0208346 3300049592 Bacteria 1597
1050 Ga0501079_0004211 3300049741 Bacteria 10671
1051 Ga0501079_0005840 3300049741 Bacteria 9203
1052 Ga0501080_0003720 3300049742 Bacteria 13455
1053 Ga0501080_0066617 3300049742 Bacteria 3349
1054 Ga0501080_0165550 3300049742 Bacteria 2040
1055 Ga0501080_0281914 3300049742 Bacteria 1510
1056 Ga0501081_0047137 3300049743 Bacteria 2965
1057 Ga0501083_0000883 3300049744 Bacteria 19840
1058 Ga0501035_0030476 3300049822 Bacteria 4916
1059 Ga0501035_0032286 3300049822 Bacteria 4764
1060 Ga0501035_0040103 3300049822 Bacteria 4233
1061 Ga0501035_0129218 3300049822 Bacteria 2203
1062 Ga0501044_0006950 3300049823 Bacteria 12453
1063 Ga0501044_0019198 3300049823 Bacteria 7318
1064 Ga0501044_0041677 3300049823 Bacteria 4780
1065 Ga0501044_0072553 3300049823 Bacteria 3499
1066 Ga0501044_0534800 3300049823 Bacteria 1070
1067 Ga0501045_0019848 3300049824 Bacteria 4797
1068 Ga0501045_0276368 3300049824 Bacteria 1250
1069 Ga0501045_0392056 3300049824 Bacteria 1034
1070 nmdc:mga00v17_20415_c1 3300050491 Bacteria 3794
1071 nmdc:mga0k408_124969_c1 3300050493 Bacteria 1525
1072 nmdc:mga0k408_251650_c1 3300050493 Bacteria 1055
1073 nmdc:mga06z11_16441_c1 3300050494 Bacteria 3333
1074 nmdc:mga06z11_67472_c1 3300050494 Bacteria 1883
1075 nmdc:mga05p37_122080_c1 3300050507 Bacteria 2399
1076 nmdc:mga05p37_13471_c1 3300050507 Bacteria 9799
1077 nmdc:mga05p37_135522_c1 3300050507 Bacteria 3020
1078 nmdc:mga05p37_207345_c1 3300050507 Bacteria 2370
1079 nmdc:mga05p37_231802_c1 3300050507 Bacteria 2224
1080 nmdc:mga05p37_2674_c1 3300050507 Bacteria 20751
1081 nmdc:mga05p37_3089_c1 3300050507 Bacteria 19345
1082 nmdc:mga05p37_50479_c1 3300050507 Bacteria 5116
1083 nmdc:mga05p37_505720_c1 3300050507 Bacteria 1385
1084 nmdc:mga05p37_9879_c1 3300050507 Bacteria 11322
1085 nmdc:mga09592_102874_c1 3300050508 Bacteria 2447
1086 nmdc:mga09592_1412_c1 3300050508 Bacteria 19239
1087 nmdc:mga09592_168143_c1 3300050508 Bacteria 1895
1088 nmdc:mga09592_67986_c1 3300050508 Bacteria 3022
1089 nmdc:mga0qj67_44560_c1 3300050509 Bacteria 3497
1090 nmdc:mga06r32_1883_c1 3300050510 Bacteria 18705
1091 nmdc:mga06r32_35548_c1 3300050510 Bacteria 4701
1092 nmdc:mga06r32_599295_c1 3300050510 Bacteria 1073
1093 nmdc:mga06r32_816588_c1 3300050510 Bacteria 892
1094 nmdc:mga06r32_87515_c1 3300050510 Bacteria 3040
1095 nmdc:mga08y16_10806_c1 3300050511 Bacteria 9584
1096 nmdc:mga08y16_1790_c1 3300050511 Bacteria 21774
1097 nmdc:mga08y16_19304_c1 3300050511 Bacteria 7185
1098 nmdc:mga08y16_38972_c1 3300050511 Bacteria 4987
1099 nmdc:mga08y16_441085_c1 3300050511 Bacteria 1329
1100 nmdc:mga08y16_69179_c1 3300050511 Bacteria 3681
1101 nmdc:mga08y16_87781_c1 3300050511 Bacteria 3240
1102 nmdc:mga08y16_94397_c2 3300050511 Bacteria 2330
1103 nmdc:mga0n895_203847_c1 3300050512 Bacteria 2008
1104 nmdc:mga0n895_215173_c1 3300050512 Bacteria 1951
1105 nmdc:mga0n895_233014_c1 3300050512 Unclassified 1869
1106 nmdc:mga0n895_2730_c1 3300050512 Bacteria 13921
1107 nmdc:mga0n895_317130_c1 3300050512 Bacteria 1580
1108 nmdc:mga0n895_57173_c1 3300050512 Bacteria 3845
1109 nmdc:mga0rr50_162374_c1 3300050513 Bacteria 1814
1110 nmdc:mga0rr50_192093_c1 3300050513 Bacteria 1674
1111 nmdc:mga0rr50_65448_c1 3300050513 Bacteria 2753
1112 nmdc:mga08x19_239213_c1 3300050514 Bacteria 1251
1113 nmdc:mga08x19_34449_c1 3300050514 Bacteria 3201
1114 nmdc:mga0a205_14851_c1 3300050515 Bacteria 7268
1115 nmdc:mga0a205_157925_c1 3300050515 Bacteria 2166
1116 nmdc:mga0a205_316178_c1 3300050515 Bacteria 1433
1117 nmdc:mga0a205_36405_c1 3300050515 Bacteria 4728
1118 nmdc:mga0a205_401519_c1 3300050515 Bacteria 1234
1119 nmdc:mga0a205_713499_c1 3300050515 Bacteria 852
1120 nmdc:mga0a205_76457_c1 3300050515 Bacteria 3235
1121 nmdc:mga0a205_8478_c1 3300050515 Bacteria 2741
1122 Ga0495601_0012926 3300053077 Bacteria 5013
1123 Ga0495601_0055141 3300053077 Bacteria 2516
1124 Ga0495619_0006414 3300053085 Bacteria 7454
1125 Ga0500583_0101203 3300053092 Bacteria 1411
1126 Ga0500641_0007372 3300053096 Bacteria 3921
1127 Ga0500617_017963 3300053124 Bacteria 3075
1128 Ga0500658_0033886 3300053134 Bacteria 2011
1129 Ga0500577_0113290 3300053142 Bacteria 1122
1130 Ga0500588_0002915 3300053146 Bacteria 3552
1131 Ga0501084_0002104 3300054114 Bacteria 15904
1132 Ga0501084_0011857 3300054114 Bacteria 7215
1133 Ga0501084_0115577 3300054114 Bacteria 2255
1134 Ga0501084_0574448 3300054114 Bacteria 953
1135 Ga0501082_0020119 3300060353 Bacteria 5751
1136 Ga0501082_0041398 3300060353 Bacteria 3972
1137 Ga0501082_0145995 3300060353 Bacteria 2053
1138 Ga0501082_0158153 3300060353 Bacteria 1969
1139 Ga0501082_0307836 3300060353 Bacteria 1380
1140 Ga0068863_100193624
1141 JGI25406J46586_10038063
1142 rootH2_10047141
1143 Ga0065704_10087813
1144 Ga0065712_10070089
1145 Ga0065712_10249029
1146 Ga0065715_10007867
1147 Ga0065715_10036057
1148 Ga0065715_10091908
1149 Ga0065715_10093915
1150 Ga0065715_10126295
1151 Ga0065715_10136188
1152 Ga0065715_10140632
1153 Ga0065715_10170078
1154 Ga0065715_10297678
1155 Ga0065715_10314709
1156 Ga0065707_10001489
1157 Ga0065707_10108725
1158 Ga0065707_10130480
1159 Ga0065707_10179772
1160 Ga0070658_10015527
1161 Ga0070658_10015795
1162 Ga0070658_10017986
1163 Ga0070658_10290539
1164 Ga0070676_10168939
1165 Ga0070683_100010352
1166 Ga0070683_100026691
1167 Ga0070683_100084736
1168 Ga0070683_100132518
1169 Ga0070683_100213051
1170 Ga0070690_100248454
1171 Ga0070690_100457507
1172 Ga0070670_100003870
1173 Ga0070670_100039116
1174 Ga0070670_100078395
1175 Ga0068869_100508392
1176 Ga0070666_10007317
1177 Ga0070666_10020706
1178 Ga0070680_100003359
1179 Ga0070680_100013727
1180 Ga0070680_100034123
1181 Ga0070680_100044726
1182 Ga0070680_100158449
1183 Ga0070680_100221344
1184 Ga0068868_100000334
1185 Ga0068868_100027015
1186 Ga0068868_100048637
1187 Ga0068868_100481114
1188 Ga0070660_100021915
1189 Ga0070660_100153244
1190 Ga0070689_100042290
1191 Ga0070691_10049289
1192 Ga0070687_100092813
1193 Ga0070661_100018189
1194 Ga0070661_100040306
1195 Ga0070661_100083627
1196 Ga0070661_100170960
1197 Ga0070661_100212886
1198 Ga0070692_10044725
1199 Ga0070692_10096318
1200 Ga0070668_100065167
1201 Ga0070668_100104923
1202 Ga0070669_100000753
1203 Ga0070675_100080217
1204 Ga0070675_100309584
1205 Ga0070675_100620468
1206 Ga0070671_100003655
1207 Ga0070671_100009302
1208 Ga0070671_100080134
1209 Ga0070671_100086515
1210 Ga0070674_100001651
1211 Ga0070673_100308612
1212 Ga0070688_100102393
1213 Ga0070688_100117455
1214 Ga0070688_100504443
1215 Ga0070659_100009195
1216 Ga0070659_100015169
1217 Ga0070659_100060352
1218 Ga0070659_100206693
1219 Ga0070659_100623741
1220 Ga0070667_100005910
1221 Ga0070667_100059664
1222 Ga0070667_100473703
1223 Ga0070667_100794449
1224 Ga0070709_10000036
1225 Ga0070709_10623032
1226 Ga0070714_100027330
1227 Ga0070713_100027402
1228 Ga0070713_100032297
1229 Ga0070713_100463549
1230 Ga0070713_100717021
1231 Ga0070701_10120425
1232 Ga0070711_100005677
1233 Ga0070711_100164780
1234 Ga0070711_100376316
1235 Ga0070705_100013983
1236 Ga0070705_100016605
1237 Ga0070705_100033562
1238 Ga0070705_100210379
1239 Ga0070705_100281849
1240 Ga0070700_100131334
1241 Ga0070694_100017957
1242 Ga0070694_100020313
1243 Ga0070694_100038927
1244 Ga0070694_100057428
1245 Ga0070694_100122871
1246 Ga0070694_100334111
1247 Ga0070694_100434253
1248 Ga0070708_100112270
1249 Ga0070708_100244674
1250 Ga0070708_100527790
1251 Ga0070708_100551356
1252 Ga0070708_100704578
1253 Ga0070663_100017312
1254 Ga0070663_100060560
1255 Ga0070663_100141752
1256 Ga0070663_100174332
1257 Ga0070678_100073632
1258 Ga0070678_100074439
1259 Ga0070662_100114849
1260 Ga0070662_100173039
1261 Ga0070662_100196598
1262 Ga0070681_10004147
1263 Ga0070681_10004187
1264 Ga0070681_10015731
1265 Ga0070681_10016961
1266 Ga0070681_10048573
1267 Ga0070681_10055693
1268 Ga0070681_10087996
1269 Ga0070681_10095673
1270 Ga0070681_10114509
1271 Ga0070681_10138667
1272 Ga0068867_100085189
1273 Ga0070685_10056844
1274 Ga0070706_100131609
1275 Ga0070706_100244201
1276 Ga0070706_100248858
1277 Ga0070706_100313001
1278 Ga0070706_100421137
1279 Ga0070707_100010399
1280 Ga0070707_100012497
1281 Ga0070707_100052238
1282 Ga0070707_100073818
1283 Ga0070707_100432277
1284 Ga0070698_100002332
1285 Ga0070698_100007637
1286 Ga0070698_100022665
1287 Ga0070698_100022874
1288 Ga0070698_100027886
1289 Ga0070698_100511376
1290 Ga0070698_100614465
1291 Ga0070699_100044394
1292 Ga0070699_100076203
1293 Ga0070699_100122372
1294 Ga0070699_100131115
1295 Ga0070699_100209136
1296 Ga0070699_100331305
1297 Ga0070699_100364322
1298 Ga0070679_100010428
1299 Ga0070679_100013889
1300 Ga0070679_100028437
1301 Ga0070679_100039829
1302 Ga0070679_100082291
1303 Ga0070679_100098814
1304 Ga0070679_100194250
1305 Ga0070684_100000769
1306 Ga0070684_100001161
1307 Ga0070684_100001218
1308 Ga0070684_100015041
1309 Ga0070684_100063826
1310 Ga0070684_100123489
1311 Ga0070684_100248940
1312 Ga0070684_100422446
1313 Ga0070697_100007487
1314 Ga0070697_100026143
1315 Ga0070697_100028478
1316 Ga0070697_100046990
1317 Ga0070697_100180802
1318 Ga0070697_100214348
1319 Ga0070697_100298530
1320 Ga0070697_100328362
1321 Ga0068853_100000800
1322 Ga0068853_100008301
1323 Ga0068853_100012173
1324 Ga0068853_100159575
1325 Ga0068853_100222480
1326 Ga0068853_100237649
1327 Ga0068853_100335947
1328 Ga0068853_100385282
1329 Ga0070672_100031167
1330 Ga0070672_100448474
1331 Ga0070686_100204500
1332 Ga0070686_100329402
1333 Ga0070695_100022246
1334 Ga0070695_100062194
1335 Ga0070695_100169390
1336 Ga0070695_100170084
1337 Ga0070695_100234331
1338 Ga0070696_100004749
1339 Ga0070696_100026821
1340 Ga0070696_100032721
1341 Ga0070696_100062371
1342 Ga0070693_100012709
1343 Ga0070693_100070946
1344 Ga0070693_100142540
1345 Ga0070665_100024853
1346 Ga0070665_100040854
1347 Ga0070665_100073208
1348 Ga0070665_100108497
1349 Ga0070665_100187674
1350 Ga0070665_100232612
1351 Ga0070665_100795964
1352 Ga0070704_100004317
1353 Ga0070704_100005237
1354 Ga0070704_100005336
1355 Ga0070704_100066750
1356 Ga0070704_100245707
1357 Ga0070704_100544501
1358 Ga0068855_100000619
1359 Ga0068855_100000808
1360 Ga0068855_100004110
1361 Ga0068855_100006367
1362 Ga0068855_100028309
1363 Ga0068855_100054875
1364 Ga0068855_100165531
1365 Ga0068855_100321640
1366 Ga0068855_100536733
1367 Ga0068855_100688070
1368 Ga0070664_100007454
1369 Ga0070664_100017236
1370 Ga0070664_100018865
1371 Ga0070664_100132489
1372 Ga0070664_100139367
1373 Ga0070664_100146363
1374 Ga0070664_100170611
1375 Ga0070664_100406141
1376 Ga0070664_100540925
1377 Ga0070664_100652333
1378 Ga0068857_100000395
1379 Ga0068857_100005271
1380 Ga0068857_100005485
1381 Ga0068857_100011755
1382 Ga0068857_100062459
1383 Ga0068857_100217749
1384 Ga0068857_100241996
1385 Ga0068857_100315710
1386 Ga0068854_100011707
1387 Ga0068854_100046340
1388 Ga0068856_100006431
1389 Ga0068856_100016868
1390 Ga0068856_100020994
1391 Ga0068856_100024969
1392 Ga0068856_100153472
1393 Ga0068856_100202628
1394 Ga0068856_100462277
1395 Ga0070702_100106993
1396 Ga0068852_100000009
1397 Ga0068852_100002047
1398 Ga0068852_100077649
1399 Ga0068852_100116482
1400 Ga0068852_100196924
1401 Ga0068852_100888525
1402 Ga0068859_100003529
1403 Ga0068859_100096135
1404 Ga0068859_100220259
1405 Ga0068859_100312628
1406 Ga0068859_100319689
1407 Ga0068864_100000703
1408 Ga0068864_100039721
1409 Ga0068864_100094216
1410 Ga0068864_100094938
1411 Ga0068864_100275063
1412 Ga0068864_100400904
1413 Ga0068866_10134513
1414 Ga0068866_10321124
1415 Ga0068861_100013889
1416 Ga0068861_100080069
1417 Ga0068851_10003027
1418 Ga0068851_10016410
1419 Ga0068851_10018155
1420 Ga0068851_10026983
1421 Ga0068851_10047116
1422 Ga0068870_10088436
1423 Ga0068863_100002707
1424 Ga0068863_100048815
1425 Ga0068863_100079747
1426 Ga0068863_100278110
1427 Ga0068863_100458710
1428 Ga0068863_100647272
1429 Ga0068863_100751378
1430 Ga0068858_100004230
1431 Ga0068858_100004379
1432 Ga0068858_100136747
1433 Ga0068858_100140372
1434 Ga0068858_100545805
1435 Ga0068860_100001296
1436 Ga0068860_100019101
1437 Ga0068860_100078877
1438 Ga0068860_100122063
1439 Ga0068860_100747504
1440 Ga0068862_100010077
1441 Ga0068862_100172085
1442 Ga0081455_10031083
1443 Ga0081455_10055113
1444 Ga0081455_10446412
1445 Ga0081539_10000055
1446 Ga0081539_10022432
1447 Ga0070717_10009476
1448 Ga0070716_100022321
1449 Ga0070716_100317613
1450 Ga0070716_100334618
1451 Ga0070712_100194853
1452 Ga0070712_100228993
1453 Ga0070712_100494695
1454 Ga0075362_10047983
1455 Ga0075367_10006204
1456 Ga0075366_10217895
1457 Ga0097621_100000518
1458 Ga0097621_100067863
1459 Ga0097621_100114097
1460 Ga0097621_100492725
1461 Ga0068871_100000818
1462 Ga0068871_100003031
1463 Ga0068871_100042042
1464 Ga0068871_100098178
1465 Ga0075428_100001699
1466 Ga0075428_100003643
1467 Ga0075428_100024691
1468 Ga0075428_100113931
1469 Ga0075428_100369811
1470 Ga0075430_100024591
1471 Ga0075430_100162420
1472 Ga0075430_100165978
1473 Ga0075431_100001487
1474 Ga0075431_100003529
1475 Ga0075431_100056248
1476 Ga0075431_100869306
1477 Ga0075433_10002802
1478 Ga0075433_10063330
1479 Ga0075434_100004994
1480 Ga0075434_100008396
1481 Ga0075434_100010728
1482 Ga0075434_100319126
1483 Ga0075429_100002658
1484 Ga0075429_100008631
1485 Ga0075429_100441042
1486 Ga0068865_100111541
1487 Ga0075436_100148868
1488 Ga0075436_100163321
1489 Ga0097620_100003529
1490 Ga0097620_100096127
1491 Ga0097620_100220275
1492 Ga0097620_100312629
1493 Ga0097620_100319676
1494 Ga0075435_100020958
1495 Ga0075435_100061587
1496 Ga0075435_100067655
1497 Ga0075435_100416619
1498 Ga0099794_10091357
1499 Ga0099795_10053828
1500 Ga0105240_10000148
1501 Ga0105240_10000184
1502 Ga0105240_10003298
1503 Ga0105240_10004349
1504 Ga0105240_10010183
1505 Ga0105240_10011941
1506 Ga0105240_10021102
1507 Ga0105240_10024402
1508 Ga0105240_10028713
1509 Ga0105240_10038192
1510 Ga0105240_10143954
1511 Ga0105240_10272043
1512 Ga0105240_10658544
1513 Ga0105240_10740363
1514 Ga0111539_10004031
1515 Ga0111539_10004761
1516 Ga0111539_10005537
1517 Ga0111539_10012274
1518 Ga0111539_10013833
1519 Ga0111539_10020590
1520 Ga0111539_10025777
1521 Ga0111539_10056310
1522 Ga0111539_10067977
1523 Ga0111539_10079222
1524 Ga0111539_10138344
1525 Ga0105245_10001000
1526 Ga0105245_10016213
1527 Ga0105245_10062815
1528 Ga0105247_10003975
1529 Ga0105247_10086936
1530 Ga0114129_10001009
1531 Ga0114129_10002566
1532 Ga0114129_10003006
1533 Ga0114129_10003920
1534 Ga0114129_10039121
1535 Ga0114129_10107121
1536 Ga0114129_10162273
1537 Ga0114129_10189984
1538 Ga0114129_10195322
1539 Ga0114129_10652042
1540 Ga0114129_10717705
1541 Ga0114129_11039182
1542 Ga0105243_10257804
1543 Ga0105243_10271223
1544 Ga0105241_10000034
1545 Ga0105241_10000869
1546 Ga0105241_10002836
1547 Ga0105241_10084467
1548 Ga0105241_10223847
1549 Ga0105241_10254422
1550 Ga0105241_10278414
1551 Ga0105242_10059102
1552 Ga0105242_10060496
1553 Ga0105242_10138894
1554 Ga0105242_10171792
1555 Ga0105242_10496937
1556 Ga0105248_10004803
1557 Ga0105248_10062272
1558 Ga0105248_10085918
1559 Ga0105248_10215162
1560 Ga0105248_10286182
1561 Ga0105248_10676749
1562 Ga0105248_10903053
1563 Ga0105237_10001697
1564 Ga0105237_10003833
1565 Ga0105237_10008032
1566 Ga0105237_10043216
1567 Ga0105237_10054048
1568 Ga0105237_10075044
1569 Ga0105237_10184379
1570 Ga0105237_10253363
1571 Ga0105237_10309387
1572 Ga0105238_10001126
1573 Ga0105238_10002350
1574 Ga0105238_10040172
1575 Ga0105238_10057905
1576 Ga0105238_10076722
1577 Ga0105238_10115317
1578 Ga0105249_10010662
1579 Ga0105249_10014871
1580 Ga0105249_10026046
1581 Ga0105249_10041833
1582 Ga0105249_10055929
1583 Ga0105249_10066887
1584 Ga0105249_10856251
1585 Ga0105239_10003426
1586 Ga0105239_10037615
1587 Ga0105239_10056049
1588 Ga0105239_10057259
1589 Ga0105239_10081750
1590 Ga0105239_10152910
1591 Ga0105239_10220324
1592 Ga0105246_10001916
1593 Ga0105246_10091838
1594 Ga0157373_10072112
1595 Ga0157373_10079961
1596 Ga0157373_10236939
1597 Ga0157373_10382748
1598 Ga0157373_10465815
1599 Ga0157371_10062981
1600 Ga0157370_10000059
1601 Ga0157370_10013611
1602 Ga0157370_10109377
1603 Ga0157370_10334328
1604 Ga0157370_10472918
1605 Ga0157369_10000035
1606 Ga0157369_10011332
1607 Ga0157369_10024763
1608 Ga0157369_10026388
1609 Ga0157369_10029532
1610 Ga0157369_10032558
1611 Ga0157369_10036583
1612 Ga0157369_10097070
1613 Ga0157369_10120565
1614 Ga0157369_10127321
1615 Ga0157369_10350765
1616 Ga0157369_10383321
1617 Ga0157369_10400764
1618 Ga0157369_10427512
1619 Ga0157374_10005708
1620 Ga0157374_10023027
1621 Ga0157374_10046200
1622 Ga0157374_10057535
1623 Ga0157374_10286875
1624 Ga0157378_10001112
1625 Ga0157378_10005047
1626 Ga0157378_10033955
1627 Ga0157378_10182388
1628 Ga0157378_10420093
1629 Ga0163162_10008087
1630 Ga0163162_10020297
1631 Ga0163162_10022648
1632 Ga0163162_10374536
1633 Ga0163162_10402585
1634 Ga0163162_11195514
1635 Ga0163162_11212929
1636 Ga0157372_10000049
1637 Ga0157372_10002058
1638 Ga0157372_10010693
1639 Ga0157372_10024244
1640 Ga0157372_10054588
1641 Ga0157372_10056725
1642 Ga0157372_10062710
1643 Ga0157372_10086625
1644 Ga0157372_10121006
1645 Ga0157372_10140329
1646 Ga0157372_10146617
1647 Ga0157372_10197845
1648 Ga0157372_10242510
1649 Ga0157375_10001018
1650 Ga0157375_10107822
1651 Ga0157375_10124706
1652 Ga0157375_10241941
1653 Ga0157375_10638340
1654 Ga0157375_10841136
1655 Ga0163163_10001812
1656 Ga0163163_10010158
1657 Ga0163163_10011286
1658 Ga0163163_10054406
1659 Ga0163163_10159668
1660 Ga0163163_10167041
1661 Ga0157379_10000232
1662 Ga0157379_10089213
1663 Ga0157379_10124261
1664 Ga0157379_10188154
1665 Ga0157379_10249185
1666 Ga0157376_10001933
1667 Ga0157376_10079079
1668 Ga0157376_10088948
1669 Ga0157376_10161024
1670 Ga0157376_10205628
1671 Ga0157376_10234235
1672 Ga0157376_10257731
1673 Ga0157376_10285970
1674 Ga0157376_10447399
1675 Ga0157376_10643840
1676 Ga0163161_10011698
1677 Ga0163161_10181950
1678 Ga0213873_10003636
1679 Ga0213872_10000391
1680 Ga0213872_10001235
1681 Ga0213872_10025887
1682 Ga0213876_10000006
1683 Ga0213876_10000076
1684 Ga0213876_10008599
1685 Ga0213876_10035000
1686 Ga0213875_10008669
1687 Ga0213871_10000242
1688 Ga0207666_1019023
1689 Ga0207697_10015188
1690 Ga0207656_10019237
1691 Ga0207656_10085422
1692 Ga0207653_10020466
1693 Ga0207653_10042838
1694 Ga0207642_10003077
1695 Ga0207688_10125770
1696 Ga0207680_10069024
1697 Ga0207680_10326349
1698 Ga0207647_10000813
1699 Ga0207647_10004346
1700 Ga0207647_10011180
1701 Ga0207647_10038931
1702 Ga0207647_10272839
1703 Ga0207699_10000078
1704 Ga0207699_10051271
1705 Ga0207699_10182587
1706 Ga0207645_10010986
1707 Ga0207705_10000024
1708 Ga0207705_10016740
1709 Ga0207705_10029614
1710 Ga0207705_10030773
1711 Ga0207684_10012549
1712 Ga0207684_10026897
1713 Ga0207684_10177530
1714 Ga0207684_10225076
1715 Ga0207684_10313439
1716 Ga0207684_10610494
1717 Ga0207654_10000029
1718 Ga0207654_10000470
1719 Ga0207654_10002356
1720 Ga0207654_10117359
1721 Ga0207707_10000024
1722 Ga0207707_10000202
1723 Ga0207707_10005457
1724 Ga0207707_10011081
1725 Ga0207707_10022340
1726 Ga0207707_10027065
1727 Ga0207707_10112586
1728 Ga0207707_10160531
1729 Ga0207707_10392482
1730 Ga0207695_10000096
1731 Ga0207695_10000105
1732 Ga0207695_10000166
1733 Ga0207695_10000518
1734 Ga0207695_10002137
1735 Ga0207695_10003839
1736 Ga0207695_10007362
1737 Ga0207695_10015229
1738 Ga0207695_10019695
1739 Ga0207695_10020085
1740 Ga0207695_10025204
1741 Ga0207695_10031490
1742 Ga0207695_10092750
1743 Ga0207695_10235241
1744 Ga0207671_10000258
1745 Ga0207671_10000953
1746 Ga0207671_10022643
1747 Ga0207671_10030569
1748 Ga0207671_10162376
1749 Ga0207693_10315802
1750 Ga0207693_10468346
1751 Ga0207663_10080876
1752 Ga0207663_10085038
1753 Ga0207660_10004800
1754 Ga0207660_10009941
1755 Ga0207660_10094704
1756 Ga0207660_10126975
1757 Ga0207660_10413056
1758 Ga0207657_10002640
1759 Ga0207657_10022053
1760 Ga0207657_10143419
1761 Ga0207657_10224080
1762 Ga0207649_10016523
1763 Ga0207649_10057700
1764 Ga0207649_10116744
1765 Ga0207649_10132713
1766 Ga0207649_10204143
1767 Ga0207652_10001822
1768 Ga0207652_10002197
1769 Ga0207652_10052984
1770 Ga0207652_10073347
1771 Ga0207652_10079279
1772 Ga0207652_10118706
1773 Ga0207652_10352983
1774 Ga0207652_10559359
1775 Ga0207646_10010031
1776 Ga0207646_10022574
1777 Ga0207646_10078698
1778 Ga0207646_10105078
1779 Ga0207646_10717496
1780 Ga0207681_10018736
1781 Ga0207694_10000561
1782 Ga0207694_10002454
1783 Ga0207694_10008745
1784 Ga0207694_10009213
1785 Ga0207694_10011077
1786 Ga0207694_10028300
1787 Ga0207694_10070491
1788 Ga0207694_10100146
1789 Ga0207694_10357752
1790 Ga0207650_10008841
1791 Ga0207650_10010891
1792 Ga0207650_10384134
1793 Ga0207659_10190447
1794 Ga0207659_10499404
1795 Ga0207687_10003324
1796 Ga0207700_10015394
1797 Ga0207700_10016845
1798 Ga0207700_10032889
1799 Ga0207700_10054236
1800 Ga0207700_10086237
1801 Ga0207664_10068493
1802 Ga0207664_10288272
1803 Ga0207644_10009284
1804 Ga0207644_10040403
1805 Ga0207644_10045956
1806 Ga0207644_10371078
1807 Ga0207690_10107366
1808 Ga0207690_10156759
1809 Ga0207690_10214112
1810 Ga0207706_10021099
1811 Ga0207686_10027901
1812 Ga0207686_10120640
1813 Ga0207670_10185037
1814 Ga0207704_10070317
1815 Ga0207704_10104176
1816 Ga0207665_10028391
1817 Ga0207665_10129560
1818 Ga0207665_10333812
1819 Ga0207691_10070555
1820 Ga0207711_10005794
1821 Ga0207711_10007356
1822 Ga0207711_10142940
1823 Ga0207711_10162714
1824 Ga0207711_10165704
1825 Ga0207711_10168778
1826 Ga0207711_10317754
1827 Ga0207711_10388687
1828 Ga0207689_10001771
1829 Ga0207689_10026550
1830 Ga0207689_10036520
1831 Ga0207689_10218921
1832 Ga0207689_10379817
1833 Ga0207661_10010817
1834 Ga0207661_10025005
1835 Ga0207661_10044957
1836 Ga0207679_10101698
1837 Ga0207679_10117362
1838 Ga0207679_10120640
1839 Ga0207679_10206760
1840 Ga0207679_10225217
1841 Ga0207667_10001884
1842 Ga0207667_10002989
1843 Ga0207667_10024971
1844 Ga0207667_10026724
1845 Ga0207667_10046686
1846 Ga0207667_10051706
1847 Ga0207667_10114828
1848 Ga0207667_10218583
1849 Ga0207667_10361434
1850 Ga0207651_10125378
1851 Ga0207651_10219459
1852 Ga0207712_10017309
1853 Ga0207712_10055435
1854 Ga0207712_10059597
1855 Ga0207712_10119561
1856 Ga0207712_10181331
1857 Ga0207712_10377815
1858 Ga0207668_10379160
1859 Ga0207668_10550827
1860 Ga0207640_10035297
1861 Ga0207640_10151843
1862 Ga0207658_10032673
1863 Ga0207658_10040409
1864 Ga0207658_10110994
1865 Ga0207677_10014977
1866 Ga0207703_10010351
1867 Ga0207703_10057387
1868 Ga0207703_10060550
1869 Ga0207703_10074588
1870 Ga0207703_10192210
1871 Ga0207639_10001162
1872 Ga0207639_10008886
1873 Ga0207639_10023787
1874 Ga0207639_10039053
1875 Ga0207639_10086260
1876 Ga0207639_10272806
1877 Ga0207639_10284962
1878 Ga0207639_10330979
1879 Ga0207639_10337087
1880 Ga0207678_10025937
1881 Ga0207678_10027159
1882 Ga0207678_10043589
1883 Ga0207678_10131372
1884 Ga0207678_10211147
1885 Ga0207678_10236586
1886 Ga0207678_10286080
1887 Ga0207678_10465412
1888 Ga0207708_10064957
1889 Ga0207708_10069602
1890 Ga0207708_10516929
1891 Ga0207702_10001922
1892 Ga0207702_10055710
1893 Ga0207702_10163277
1894 Ga0207702_10370834
1895 Ga0207641_10012473
1896 Ga0207641_10067688
1897 Ga0207641_10159629
1898 Ga0207641_10390454
1899 Ga0207648_10148006
1900 Ga0207648_10342911
1901 Ga0207676_10001831
1902 Ga0207676_10017288
1903 Ga0207676_10060911
1904 Ga0207674_10000449
1905 Ga0207674_10002944
1906 Ga0207674_10004324
1907 Ga0207674_10008806
1908 Ga0207674_10048569
1909 Ga0207674_10056044
1910 Ga0207674_10127204
1911 Ga0207674_10269270
1912 Ga0207674_10957134
1913 Ga0207675_100037682
1914 Ga0207675_100111385
1915 Ga0207683_10008254
1916 Ga0207683_10016731
1917 Ga0207683_10274502
1918 Ga0207698_10000020
1919 Ga0207698_10007447
1920 Ga0207698_10110877
1921 Ga0207698_10204395
1922 Ga0207698_10400169
1923 Ga0207698_10427201
1924 Ga0207698_10705354
1925 Ga0207428_10004830
1926 Ga0207428_10007912
1927 Ga0207428_10009694
1928 Ga0207428_10014428
1929 Ga0268266_10001402
1930 Ga0268266_10007152
1931 Ga0268266_10063734
1932 Ga0268266_10154336
1933 Ga0268266_10193549
1934 Ga0268266_10220222
1935 Ga0268266_10570873
1936 Ga0268266_10692409
1937 Ga0268265_10008032
1938 Ga0268265_10021744
1939 Ga0268265_10053504
1940 Ga0268265_10103418
1941 Ga0268264_10010592
1942 Ga0268264_10023468
1943 Ga0268264_10676751
1944 Ga0265319_1034019
1945 Ga0265334_10000347
1946 Ga0265334_10050592
1947 Ga0265318_10000314
1948 Ga0265336_10014841
1949 Ga0265338_10004672
1950 Ga0265338_10032152
1951 Ga0265338_10032174
1952 Ga0265338_10055362
1953 Ga0265338_10068304
1954 Ga0307511_10004768
1955 Ga0265760_10048125
1956 Ga0265330_10000616
1957 Ga0265330_10002336
1958 Ga0265332_10001542
1959 Ga0265332_10028049
1960 Ga0265328_10001271
1961 Ga0265328_10016301
1962 Ga0265320_10013057
1963 Ga0265320_10099752
1964 Ga0265325_10000460
1965 Ga0265325_10027432
1966 Ga0265329_10008681
1967 Ga0265340_10036576
1968 Ga0265340_10082459
1969 Ga0265339_10000055
1970 Ga0265339_10005330
1971 Ga0265339_10019989
1972 Ga0265339_10093538
1973 Ga0265331_10024034
1974 Ga0265316_10111292
1975 Ga0265316_10115489
1976 Ga0307408_100006841
1977 Ga0307408_100064541
1978 Ga0307408_100165879
1979 Ga0265313_10001288
1980 Ga0265313_10012387
1981 Ga0265313_10039157
1982 Ga0265314_10000033
1983 Ga0265314_10010701
1984 Ga0265314_10053262
1985 Ga0265314_10056063
1986 Ga0265314_10101540
1987 Ga0265314_10116112
1988 Ga0265314_10229318
1989 Ga0265342_10000955
1990 Ga0265342_10001335
1991 Ga0265342_10002405
1992 Ga0265342_10040441
1993 Ga0265342_10084427
1994 Ga0265342_10122082
1995 Ga0307516_10285459
1996 Ga0307413_10350601
1997 Ga0307407_10387077
1998 Ga0307409_100429226
1999 Ga0307416_100711923
2000 Ga0307416_100992477
2001 Ga0307411_10204363
2002 Ga0307415_100163518
2003 Ga0373955_0210100
2004 Ga0373933_0011987
2005 Ga0373933_0331159
2006 Ga0373947_0030780
2007 Ga0373937_0118842
2008 Ga0373937_0281422
2009 Ga0373925_0003829
2010 Ga0373925_0200647
2011 Ga0395900_0099126
2012 Ga0395898_0335798
2013 Ga0395905_0020148
2014 Ga0395905_0139942
2015 Ga0436364_0325433
2016 Ga0436364_0452510
2017 Ga0436364_0546849
2018 Ga0436364_0601985
2019 Ga0436364_1129496
2020 Ga0436365_0381867
2021 Ga0436365_0695157
2022 Ga0436365_0717035
2023 Ga0436365_0763529
2024 Ga0436365_1357444
2025 Ga0436365_1893186
2026 Ga0436360_0190098
2027 Ga0436360_0497631
2028 Ga0436360_1050644
2029 Ga0436361_0497831
2030 Ga0436361_0527966
2031 Ga0436361_0734004
2032 Ga0436361_0905898
2033 Ga0436361_1046051
2034 Ga0436363_1635986
2035 Ga0436362_0853993
2036 Ga0436362_0967602
2037 Ga0451804_0720165
2038 Ga0439464_0008115
2039 Ga0439460_0080063
2040 Ga0453683_0010878
2041 Ga0453683_0280589
2042 Ga0466966_0084015
2043 Ga0466966_0145667
2044 Ga0453684_0477163
2045 Ga0466957_0200406
2046 Ga0466959_0044457
2047 Ga0466959_0061411
2048 Ga0466959_0255697
2049 Ga0451576_0003922
2050 Ga0451576_0005636
2051 Ga0451576_0453166
2052 Ga0466967_0070827
2053 Ga0466967_0465485
2054 Ga0466967_0770507
2055 Ga0495592_0018064
2056 Ga0495592_0163928
2057 Ga0495603_0044384
2058 Ga0495629_0113270
2059 Ga0495638_0002613
2060 Ga0495651_0210410
2061 Ga0495650_0001767
2062 Ga0495580_0061085
2063 Ga0495580_0081583
2064 Ga0495583_0007715
2065 Ga0495628_0153020
2066 Ga0495643_0003303
2067 Ga0495643_0116863
2068 Ga0495587_0023949
2069 Ga0495645_0020015
2070 Ga0495645_0024163
2071 Ga0495667_0005313
2072 Ga0495668_0004256
2073 Ga0495625_0000788
2074 Ga0495625_0023848
2075 Ga0495659_0011676
2076 Ga0495659_0026194
2077 Ga0495659_0033327
2078 Ga0495588_0027381
2079 Ga0495647_0066609
2080 Ga0495658_0147355
2081 Ga0495613_0225044
2082 Ga0495613_0315364
2083 Ga0495649_0126584
2084 Ga0495581_0126623
2085 Ga0495674_0690684
2086 Ga0495672_0004541
2087 Ga0495672_0084538
2088 Ga0495672_0203684
2089 Ga0495673_0053388
2090 Ga0495684_0205168
2091 Ga0495602_0218920
2092 Ga0496101_0193712
2093 Ga0496101_0303447
2094 Ga0496102_0018499
2095 Ga0496102_0359069
2096 Ga0496103_0007465
2097 Ga0496104_0003885
2098 Ga0496104_0013442
2099 Ga0496104_0250645
2100 Ga0496105_0013721
2101 Ga0496105_0021811
2102 Ga0496105_0041888
2103 Ga0496105_0054767
2104 Ga0496106_0029166
2105 Ga0496106_0526447
2106 Ga0496107_0064050
2107 Ga0496108_0013213
2108 Ga0496109_0012315
2109 Ga0496109_0073965
2110 Ga0496110_0003685
2111 Ga0496110_0045625
2112 Ga0496110_0077859
2113 Ga0496111_0029330
2114 Ga0496111_0031668
2115 Ga0496111_0279581
2116 Ga0496111_0299087
2117 Ga0496112_0003441
2118 Ga0496112_0074500
2119 Ga0496113_0119125
2120 Ga0496113_0226845
2121 Ga0496114_0032609
2122 Ga0496114_0313453
2123 Ga0496115_0149292
2124 Ga0496126_0007962
2125 Ga0501293_006348
2126 Ga0501031_0011501
2127 Ga0501032_0014947
2128 Ga0501032_0018041
2129 Ga0501032_0041514
2130 Ga0501033_0005294
2131 Ga0501033_0007580
2132 Ga0501033_0180129
2133 Ga0501034_0079374
2134 Ga0501034_0097347
2135 Ga0501034_0146022
2136 Ga0501034_0168458
2137 Ga0501034_0300982
2138 Ga0501036_0002291
2139 Ga0501036_0013610
2140 Ga0501036_0015997
2141 Ga0501036_0025669
2142 Ga0501037_0003808
2143 Ga0501037_0007855
2144 Ga0501037_0194866
2145 Ga0501037_0276218
2146 Ga0501038_0010640
2147 Ga0501038_0033029
2148 Ga0501038_0080323
2149 Ga0501038_0415208
2150 Ga0501038_0498342
2151 Ga0501039_0056909
2152 Ga0501039_0091136
2153 Ga0501042_0035389
2154 Ga0501042_0166463
2155 Ga0501043_0010309
2156 Ga0501046_0002763
2157 Ga0501046_0024561
2158 Ga0501046_0047523
2159 Ga0501046_0197347
2160 Ga0501047_0000308
2161 Ga0501047_0021643
2162 Ga0501047_0033125
2163 Ga0501047_0041640
2164 Ga0501047_0053929
2165 Ga0501047_0134759
2166 Ga0501048_0008820
2167 Ga0501048_0048543
2168 Ga0501067_0012186
2169 Ga0501067_0053490
2170 Ga0501068_0020779
2171 Ga0501068_0029054
2172 Ga0501069_0032350
2173 Ga0501069_0048590
2174 Ga0501070_0008203
2175 Ga0501070_0016898
2176 Ga0501070_0074045
2177 Ga0501070_0083763
2178 Ga0501071_0033537
2179 Ga0501072_0010157
2180 Ga0501072_0055947
2181 Ga0501073_0004731
2182 Ga0501073_0011606
2183 Ga0501073_0099744
2184 Ga0501073_0207979
2185 Ga0501074_0014534
2186 Ga0501074_0263915
2187 Ga0501075_0105492
2188 Ga0501076_0208346
2189 Ga0501079_0004211
2190 Ga0501079_0005840
2191 Ga0501080_0003720
2192 Ga0501080_0066617
2193 Ga0501080_0165550
2194 Ga0501080_0281914
2195 Ga0501081_0047137
2196 Ga0501083_0000883
2197 Ga0501035_0030476
2198 Ga0501035_0032286
2199 Ga0501035_0040103
2200 Ga0501035_0129218
2201 Ga0501044_0006950
2202 Ga0501044_0019198
2203 Ga0501044_0041677
2204 Ga0501044_0072553
2205 Ga0501044_0534800
2206 Ga0501045_0019848
2207 Ga0501045_0276368
2208 Ga0501045_0392056
2209 nmdc:mga00v17_20415_c1
2210 nmdc:mga0k408_124969_c1
2211 nmdc:mga0k408_251650_c1
2212 nmdc:mga06z11_16441_c1
2213 nmdc:mga06z11_67472_c1
2214 nmdc:mga05p37_122080_c1
2215 nmdc:mga05p37_13471_c1
2216 nmdc:mga05p37_135522_c1
2217 nmdc:mga05p37_207345_c1
2218 nmdc:mga05p37_231802_c1
2219 nmdc:mga05p37_2674_c1
2220 nmdc:mga05p37_3089_c1
2221 nmdc:mga05p37_50479_c1
2222 nmdc:mga05p37_505720_c1
2223 nmdc:mga05p37_9879_c1
2224 nmdc:mga09592_102874_c1
2225 nmdc:mga09592_1412_c1
2226 nmdc:mga09592_168143_c1
2227 nmdc:mga09592_67986_c1
2228 nmdc:mga0qj67_44560_c1
2229 nmdc:mga06r32_1883_c1
2230 nmdc:mga06r32_35548_c1
2231 nmdc:mga06r32_599295_c1
2232 nmdc:mga06r32_816588_c1
2233 nmdc:mga06r32_87515_c1
2234 nmdc:mga08y16_10806_c1
2235 nmdc:mga08y16_1790_c1
2236 nmdc:mga08y16_19304_c1
2237 nmdc:mga08y16_38972_c1
2238 nmdc:mga08y16_441085_c1
2239 nmdc:mga08y16_69179_c1
2240 nmdc:mga08y16_87781_c1
2241 nmdc:mga08y16_94397_c2
2242 nmdc:mga0n895_203847_c1
2243 nmdc:mga0n895_215173_c1
2244 nmdc:mga0n895_233014_c1
2245 nmdc:mga0n895_2730_c1
2246 nmdc:mga0n895_317130_c1
2247 nmdc:mga0n895_57173_c1
2248 nmdc:mga0rr50_162374_c1
2249 nmdc:mga0rr50_192093_c1
2250 nmdc:mga0rr50_65448_c1
2251 nmdc:mga08x19_239213_c1
2252 nmdc:mga08x19_34449_c1
2253 nmdc:mga0a205_14851_c1
2254 nmdc:mga0a205_157925_c1
2255 nmdc:mga0a205_316178_c1
2256 nmdc:mga0a205_36405_c1
2257 nmdc:mga0a205_401519_c1
2258 nmdc:mga0a205_713499_c1
2259 nmdc:mga0a205_76457_c1
2260 nmdc:mga0a205_8478_c1
2261 Ga0495601_0012926
2262 Ga0495601_0055141
2263 Ga0495619_0006414
2264 Ga0500583_0101203
2265 Ga0500641_0007372
2266 Ga0500617_017963
2267 Ga0500658_0033886
2268 Ga0500577_0113290
2269 Ga0500588_0002915
2270 Ga0501084_0002104
2271 Ga0501084_0011857
2272 Ga0501084_0115577
2273 Ga0501084_0574448
2274 Ga0501082_0020119
2275 Ga0501082_0041398
2276 Ga0501082_0145995
2277 Ga0501082_0158153
2278 Ga0501082_0307836

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

45

189

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9259 2 206
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.9017 2 206
4rvc-assembly1.cif.gz_A structure of atp binding subunit of abc transporter 0.8406 1 222
2awn-assembly1.cif.gz_A crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.8369 2 206
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.8311 2 230
ID Description Score Start End Superfamily
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9281 2 64 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9223 2 201 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9197 2 64 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9039 2 201 3.40.50.300
af_A0A0R0IY12_408_566_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9017 2 83 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A348VXU7-F1-model_v4 3-dehydroquinate dehydratase 0.8528 1 223 GO:0005524
GO:0016887
AF-A0A4Y8I3Q6-F1-model_v4 ABC transporter ATP-binding protein 0.8522 1 224 GO:0005524
GO:0016887
AF-A0A550GP06-F1-model_v4 ABC transporter ATP-binding protein 0.8517 2 230 GO:0005524
GO:0016887
AF-A0A7G9W9I9-F1-model_v4 ABC transporter ATP-binding protein 0.8492 1 222 GO:0005524
GO:0016887
AF-A0A2M7E6X7-F1-model_v4 ABC transporter 0.8478 1 223 GO:0005524
GO:0016887

Map