F490643

General Info

Members Datasets Scaffolds Average Seq Length
1137 424 2274 108

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_11528154|Ga0157379_115281541
Length 117
Sequence MSAKGDHVYAALALVVGIVAGVFLAPTVPDWLAPYLPIAVVAALDAVFGGLRAKLDAVFDAKVFVVSFVANVLVAAFIVFLGDQLGVGSQLSTAVVVVLGIRIFGNAAAIRRHIFKA

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
187 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
193 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
200 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
203 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
204 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
207 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
208 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
224 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
231 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
232 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
233 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
234 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
235 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
236 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
237 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
238 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
239 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
240 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
241 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
242 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
243 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
244 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
245 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
246 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
247 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
248 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
249 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
250 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
251 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
254 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
255 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
256 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
257 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
258 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
259 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
260 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
261 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
262 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
263 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
264 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
265 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
266 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
271 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
272 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
273 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
274 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
275 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
276 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
277 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
278 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
279 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
280 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
281 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
282 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
283 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
284 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
285 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
286 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
287 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
288 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
289 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
290 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
291 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
292 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
293 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
294 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
295 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
296 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
297 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
298 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
299 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
300 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
301 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
302 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
305 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
306 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
310 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
313 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
314 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
317 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
318 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
319 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
323 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
324 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
327 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
344 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
345 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
346 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
347 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
348 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
349 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
350 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
351 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
354 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
355 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
356 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
357 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
358 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
359 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
362 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
363 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
364 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
365 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
366 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
367 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
368 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
369 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
370 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
371 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
372 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
373 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
374 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
375 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
376 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
377 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
378 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
379 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
380 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
381 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
382 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
383 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
384 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
385 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
386 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
387 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
388 2643221679 Angustibacter sp. Root456 Isolate Unclassified
389 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
390 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
391 2643221711 Terrabacter sp. Root85 Isolate Unclassified
392 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
393 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
394 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
395 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
396 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
397 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
398 2739367898 Nocardioides sp. CF479 Isolate Unclassified
399 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
400 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
401 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
402 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
403 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
404 2808606394 Promicromonospora sp. C35 Isolate Unclassified
405 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
406 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
407 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
408 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
409 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
410 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
411 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
412 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
413 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
414 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
415 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
416 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
417 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
418 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
419 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
420 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
421 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
422 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
423 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
424 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.72
Metatranscriptomes 1.58
Isolates 3.69

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 1.41
Nodule 0.09
Rhizoplane 9.59
Rhizosphere 83.47
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_11528154 3300014968 Bacteria 650
2 JGI24739J22299_10001443 3300001989 Bacteria 8960
3 JGI24737J22298_10003330 3300001990 Bacteria 5685
4 JGI24735J21928_10009578 3300002067 Bacteria 3106
5 JGI24735J21928_10011363 3300002067 Bacteria 2826
6 Ga0070658_10001601 3300005327 Bacteria 19133
7 Ga0070658_10125694 3300005327 Bacteria 2134
8 Ga0070658_10209150 3300005327 Bacteria 1648
9 Ga0070658_10591516 3300005327 Bacteria 961
10 Ga0070658_11032762 3300005327 Bacteria 715
11 Ga0070676_10313847 3300005328 Bacteria 1067
12 Ga0070683_100019031 3300005329 Bacteria 6092
13 Ga0070683_100783184 3300005329 Bacteria 914
14 Ga0070683_101907861 3300005329 Bacteria 571
15 Ga0068869_100019690 3300005334 Bacteria 4617
16 Ga0068869_100021777 3300005334 Bacteria 4412
17 Ga0068869_100252513 3300005334 Bacteria 1409
18 Ga0070666_10820237 3300005335 Bacteria 686
19 Ga0070680_100297660 3300005336 Bacteria 1368
20 Ga0070680_100455600 3300005336 Bacteria 1093
21 Ga0070682_100002949 3300005337 Bacteria 9444
22 Ga0070682_100084461 3300005337 Bacteria 2063
23 Ga0070682_100097643 3300005337 Bacteria 1934
24 Ga0070682_100184742 3300005337 Bacteria 1459
25 Ga0070682_100238937 3300005337 Bacteria 1303
26 Ga0070682_100397855 3300005337 Bacteria 1041
27 Ga0070682_100461715 3300005337 Bacteria 975
28 Ga0068868_100071671 3300005338 Bacteria 2763
29 Ga0068868_100136027 3300005338 Bacteria 2014
30 Ga0068868_100316393 3300005338 Bacteria 1329
31 Ga0070660_100042696 3300005339 Bacteria 3462
32 Ga0070660_100070805 3300005339 Bacteria 2722
33 Ga0070660_100190976 3300005339 Bacteria 1659
34 Ga0070660_100464013 3300005339 Bacteria 1051
35 Ga0070660_100559722 3300005339 Bacteria 954
36 Ga0070660_101050179 3300005339 Bacteria 689
37 Ga0070689_100262178 3300005340 Bacteria 1429
38 Ga0070691_10026973 3300005341 Bacteria 2679
39 Ga0070687_100360263 3300005343 Bacteria 941
40 Ga0070661_100040415 3300005344 Bacteria 3403
41 Ga0070661_100337481 3300005344 Bacteria 1180
42 Ga0070661_100365911 3300005344 Bacteria 1134
43 Ga0070692_10067349 3300005345 Bacteria 1900
44 Ga0070668_100490754 3300005347 Bacteria 1062
45 Ga0070668_101129817 3300005347 Bacteria 708
46 Ga0070669_101335821 3300005353 Bacteria 621
47 Ga0070675_100008017 3300005354 Bacteria 8187
48 Ga0070675_100140176 3300005354 Bacteria 2066
49 Ga0070671_100007289 3300005355 Bacteria 8836
50 Ga0070671_100239491 3300005355 Bacteria 1540
51 Ga0070674_101767634 3300005356 Bacteria 560
52 Ga0070673_101108492 3300005364 Bacteria 740
53 Ga0070659_100032558 3300005366 Bacteria 4044
54 Ga0070659_100165481 3300005366 Bacteria 1809
55 Ga0070659_102106941 3300005366 Bacteria 507
56 Ga0070667_100005054 3300005367 Bacteria 11038
57 Ga0070667_100160228 3300005367 Bacteria 1981
58 Ga0070667_100386081 3300005367 Bacteria 1273
59 Ga0070667_101207403 3300005367 Bacteria 708
60 Ga0070667_101284042 3300005367 Bacteria 686
61 Ga0070709_10184285 3300005434 Bacteria 1468
62 Ga0070709_11057250 3300005434 Bacteria 648
63 Ga0070714_100089379 3300005435 Bacteria 2697
64 Ga0070714_101085171 3300005435 Bacteria 780
65 Ga0070714_102502361 3300005435 Bacteria 501
66 Ga0070713_100154115 3300005436 Bacteria 2046
67 Ga0070713_100190537 3300005436 Bacteria 1847
68 Ga0070713_100367948 3300005436 Bacteria 1337
69 Ga0070711_100078358 3300005439 Bacteria 2347
70 Ga0070705_100781488 3300005440 Bacteria 758
71 Ga0070705_100992239 3300005440 Bacteria 681
72 Ga0070700_100121130 3300005441 Bacteria 1753
73 Ga0070694_101307458 3300005444 Bacteria 610
74 Ga0070708_100406394 3300005445 Bacteria 1284
75 Ga0070663_100021165 3300005455 Bacteria 4321
76 Ga0070663_100108306 3300005455 Bacteria 2084
77 Ga0070663_100229462 3300005455 Bacteria 1461
78 Ga0070663_100972189 3300005455 Bacteria 737
79 Ga0070663_101026599 3300005455 Bacteria 718
80 Ga0070663_101342589 3300005455 Bacteria 632
81 Ga0070678_100044533 3300005456 Bacteria 3169
82 Ga0070678_100152020 3300005456 Bacteria 1865
83 Ga0070678_100162050 3300005456 Bacteria 1813
84 Ga0070678_100484373 3300005456 Bacteria 1089
85 Ga0070681_10090018 3300005458 Bacteria 3019
86 Ga0070681_10509695 3300005458 Bacteria 1116
87 Ga0070681_10716185 3300005458 Bacteria 917
88 Ga0070681_11190307 3300005458 Bacteria 684
89 Ga0068867_100639366 3300005459 Bacteria 932
90 Ga0068867_101167260 3300005459 Bacteria 706
91 Ga0068867_101304416 3300005459 Bacteria 670
92 Ga0070685_10095132 3300005466 Bacteria 1810
93 Ga0070685_10278328 3300005466 Bacteria 1119
94 Ga0070685_10411610 3300005466 Bacteria 939
95 Ga0070698_100021155 3300005471 Bacteria 6816
96 Ga0070679_100040469 3300005530 Bacteria 4636
97 Ga0070679_100090535 3300005530 Bacteria 3048
98 Ga0070679_100125162 3300005530 Bacteria 2553
99 Ga0070679_100146167 3300005530 Bacteria 2342
100 Ga0070679_100163926 3300005530 Bacteria 2197
101 Ga0070679_100250505 3300005530 Bacteria 1727
102 Ga0070679_101023735 3300005530 Bacteria 770
103 Ga0070679_102171253 3300005530 Bacteria 505
104 Ga0070684_100042712 3300005535 Bacteria 3915
105 Ga0070684_100209746 3300005535 Bacteria 1775
106 Ga0070684_100331418 3300005535 Bacteria 1399
107 Ga0070684_101470602 3300005535 Bacteria 642
108 Ga0068853_100825043 3300005539 Bacteria 889
109 Ga0070672_100224674 3300005543 Bacteria 1576
110 Ga0070672_101111607 3300005543 Bacteria 702
111 Ga0070696_100000806 3300005546 Bacteria 20145
112 Ga0070693_100013235 3300005547 Bacteria 4198
113 Ga0070693_100538221 3300005547 Bacteria 834
114 Ga0070665_100116357 3300005548 Bacteria 2676
115 Ga0070665_100225627 3300005548 Bacteria 1874
116 Ga0070665_100321707 3300005548 Bacteria 1551
117 Ga0070665_101376803 3300005548 Bacteria 715
118 Ga0068855_100007335 3300005563 Bacteria 13361
119 Ga0068855_100010193 3300005563 Bacteria 11327
120 Ga0068855_100015148 3300005563 Bacteria 9285
121 Ga0068855_100452505 3300005563 Bacteria 1401
122 Ga0068855_101138635 3300005563 Bacteria 814
123 Ga0070664_100011912 3300005564 Bacteria 7058
124 Ga0068857_100005416 3300005577 Bacteria 10883
125 Ga0068857_100157945 3300005577 Bacteria 2056
126 Ga0068857_100173664 3300005577 Bacteria 1960
127 Ga0068857_101089946 3300005577 Bacteria 771
128 Ga0068857_101167492 3300005577 Bacteria 745
129 Ga0068857_101622158 3300005577 Bacteria 632
130 Ga0068857_102032374 3300005577 Bacteria 564
131 Ga0068857_102081522 3300005577 Bacteria 557
132 Ga0068854_100003155 3300005578 Bacteria 10274
133 Ga0068854_100043523 3300005578 Bacteria 3183
134 Ga0068854_100071621 3300005578 Bacteria 2536
135 Ga0068856_100006438 3300005614 Bacteria 11518
136 Ga0068856_100006679 3300005614 Bacteria 11310
137 Ga0068856_100279725 3300005614 Bacteria 1685
138 Ga0068856_100564124 3300005614 Bacteria 1160
139 Ga0068856_100785714 3300005614 Bacteria 972
140 Ga0068856_101786920 3300005614 Bacteria 626
141 Ga0068856_102133884 3300005614 Bacteria 570
142 Ga0070702_100012306 3300005615 Bacteria 4282
143 Ga0070702_100329551 3300005615 Bacteria 1067
144 Ga0070702_100971982 3300005615 Bacteria 670
145 Ga0068852_100007296 3300005616 Bacteria 8060
146 Ga0068852_100020286 3300005616 Bacteria 5283
147 Ga0068852_100020773 3300005616 Bacteria 5225
148 Ga0068852_100165344 3300005616 Bacteria 2070
149 Ga0068852_100179670 3300005616 Bacteria 1989
150 Ga0068852_100407354 3300005616 Bacteria 1339
151 Ga0068852_100473701 3300005616 Bacteria 1243
152 Ga0068859_100822423 3300005617 Bacteria 1016
153 Ga0068859_102976817 3300005617 Bacteria 518
154 Ga0068864_100142385 3300005618 Bacteria 2164
155 Ga0068864_101204057 3300005618 Bacteria 756
156 Ga0068864_102381441 3300005618 Bacteria 536
157 Ga0068866_10326054 3300005718 Bacteria 968
158 Ga0068861_100257648 3300005719 Bacteria 1492
159 Ga0068861_101219375 3300005719 Bacteria 728
160 Ga0068851_10063443 3300005834 Bacteria 1897
161 Ga0068870_10189964 3300005840 Bacteria 1238
162 Ga0068870_10461514 3300005840 Bacteria 839
163 Ga0068870_10968923 3300005840 Bacteria 605
164 Ga0068863_100056422 3300005841 Bacteria 3718
165 Ga0068863_101854429 3300005841 Bacteria 613
166 Ga0068858_100853796 3300005842 Bacteria 889
167 Ga0068860_100623066 3300005843 Bacteria 1085
168 Ga0068862_100098112 3300005844 Bacteria 2559
169 Ga0081455_10001727 3300005937 Bacteria 26458
170 Ga0081455_10167140 3300005937 Bacteria 1679
171 Ga0081538_10082192 3300005981 Bacteria 1709
172 Ga0081540_1002115 3300005983 Bacteria 16543
173 Ga0070717_10649064 3300006028 Bacteria 958
174 Ga0075364_10026964 3300006051 Bacteria 3668
175 Ga0075364_10356039 3300006051 Bacteria 998
176 Ga0075432_10094974 3300006058 Bacteria 1096
177 Ga0070716_100608797 3300006173 Bacteria 823
178 Ga0070712_100446642 3300006175 Bacteria 1076
179 Ga0075367_10061989 3300006178 Bacteria 2233
180 Ga0097621_100053144 3300006237 Bacteria 3301
181 Ga0097621_100515165 3300006237 Bacteria 1085
182 Ga0075370_10151543 3300006353 Bacteria 1359
183 Ga0068871_100669454 3300006358 Bacteria 949
184 Ga0068871_101318981 3300006358 Bacteria 679
185 Ga0075428_100316264 3300006844 Bacteria 1678
186 Ga0075428_100620098 3300006844 Bacteria 1155
187 Ga0075431_100038052 3300006847 Bacteria 4953
188 Ga0075431_100302451 3300006847 Bacteria 1616
189 Ga0075433_10039113 3300006852 Bacteria 4100
190 Ga0075434_100053152 3300006871 Bacteria 4025
191 Ga0075429_100262225 3300006880 Bacteria 1513
192 Ga0075429_100568355 3300006880 Bacteria 994
193 Ga0068865_100178180 3300006881 Bacteria 1635
194 Ga0068865_100255956 3300006881 Bacteria 1384
195 Ga0068865_100565500 3300006881 Bacteria 957
196 Ga0068865_100964786 3300006881 Bacteria 745
197 Ga0068865_101639088 3300006881 Bacteria 579
198 Ga0075436_100015576 3300006914 Bacteria 5205
199 Ga0097620_100822456 3300006931 Bacteria 1016
200 Ga0097620_102977056 3300006931 Bacteria 518
201 Ga0075435_100065337 3300007076 Bacteria 2957
202 Ga0105251_10008521 3300009011 Bacteria 6155
203 Ga0105240_10001975 3300009093 Bacteria 33909
204 Ga0105240_10103546 3300009093 Bacteria 3458
205 Ga0105240_10706406 3300009093 Bacteria 1100
206 Ga0105240_12158498 3300009093 Bacteria 578
207 Ga0111539_10005317 3300009094 Bacteria 16662
208 Ga0105245_10007924 3300009098 Bacteria 9290
209 Ga0105245_10015300 3300009098 Bacteria 6686
210 Ga0105245_10048638 3300009098 Bacteria 3794
211 Ga0105245_10118385 3300009098 Bacteria 2472
212 Ga0105245_10257512 3300009098 Bacteria 1697
213 Ga0105245_10459862 3300009098 Bacteria 1283
214 Ga0105245_11777552 3300009098 Bacteria 669
215 Ga0105245_11866144 3300009098 Bacteria 654
216 Ga0105247_10012565 3300009101 Bacteria 5086
217 Ga0105247_10284918 3300009101 Bacteria 1141
218 Ga0105247_10782195 3300009101 Bacteria 726
219 Ga0114129_10191137 3300009147 Bacteria 2780
220 Ga0114129_11207550 3300009147 Bacteria 942
221 Ga0114129_12743898 3300009147 Bacteria 586
222 Ga0105243_10053489 3300009148 Bacteria 3203
223 Ga0105243_10373417 3300009148 Bacteria 1316
224 Ga0105243_10650266 3300009148 Bacteria 1022
225 Ga0105241_10002330 3300009174 Bacteria 14264
226 Ga0105241_10074240 3300009174 Bacteria 2648
227 Ga0105241_10891824 3300009174 Bacteria 825
228 Ga0105241_12269391 3300009174 Bacteria 539
229 Ga0105242_10124878 3300009176 Bacteria 2214
230 Ga0105242_10171122 3300009176 Bacteria 1909
231 Ga0105242_10635168 3300009176 Bacteria 1036
232 Ga0105248_10247850 3300009177 Bacteria 2005
233 Ga0105248_10497255 3300009177 Bacteria 1375
234 Ga0105237_10039938 3300009545 Bacteria 4734
235 Ga0105237_10142330 3300009545 Bacteria 2393
236 Ga0105237_10163149 3300009545 Bacteria 2227
237 Ga0105237_10549891 3300009545 Bacteria 1161
238 Ga0105237_11598374 3300009545 Bacteria 659
239 Ga0105237_11992237 3300009545 Bacteria 589
240 Ga0105238_10004764 3300009551 Bacteria 13423
241 Ga0105238_10037828 3300009551 Bacteria 4903
242 Ga0105238_10168513 3300009551 Bacteria 2166
243 Ga0105238_10324931 3300009551 Bacteria 1525
244 Ga0105238_11310689 3300009551 Bacteria 750
245 Ga0105249_10376537 3300009553 Bacteria 1445
246 Ga0105249_11270671 3300009553 Bacteria 807
247 Ga0105249_11318571 3300009553 Bacteria 793
248 Ga0105239_10027733 3300010375 Bacteria 6231
249 Ga0105239_10072749 3300010375 Bacteria 3780
250 Ga0105239_10086604 3300010375 Bacteria 3453
251 Ga0105239_10112717 3300010375 Bacteria 3015
252 Ga0105239_10226718 3300010375 Bacteria 2096
253 Ga0105239_10314930 3300010375 Bacteria 1764
254 Ga0105239_10630355 3300010375 Bacteria 1224
255 Ga0105239_10741734 3300010375 Bacteria 1124
256 Ga0105239_10791467 3300010375 Bacteria 1086
257 Ga0105239_12367575 3300010375 Bacteria 618
258 Ga0105246_10012689 3300011119 Bacteria 5265
259 Ga0105246_10027239 3300011119 Bacteria 3743
260 Ga0105246_10302952 3300011119 Bacteria 1291
261 Ga0105246_10422348 3300011119 Bacteria 1113
262 Ga0105246_10975287 3300011119 Bacteria 766
263 Ga0105246_11381090 3300011119 Bacteria 656
264 Ga0105246_12585925 3300011119 Bacteria 501
265 Ga0157373_10055852 3300013100 Bacteria 2804
266 Ga0157371_10008106 3300013102 Bacteria 8394
267 Ga0157370_10039127 3300013104 Bacteria 4583
268 Ga0157370_10072372 3300013104 Bacteria 3253
269 Ga0157370_10261795 3300013104 Bacteria 1598
270 Ga0157370_10358507 3300013104 Bacteria 1344
271 Ga0157370_11888346 3300013104 Bacteria 536
272 Ga0157369_10009859 3300013105 Bacteria 10913
273 Ga0157369_10015697 3300013105 Bacteria 8535
274 Ga0157369_10178167 3300013105 Bacteria 2237
275 Ga0157369_10306347 3300013105 Bacteria 1652
276 Ga0157369_10446533 3300013105 Bacteria 1339
277 Ga0157369_11018033 3300013105 Bacteria 848
278 Ga0157369_11199167 3300013105 Bacteria 775
279 Ga0157374_10082348 3300013296 Bacteria 3055
280 Ga0157374_11030678 3300013296 Bacteria 842
281 Ga0157374_11108913 3300013296 Bacteria 812
282 Ga0157374_11732881 3300013296 Bacteria 650
283 Ga0157378_10661121 3300013297 Bacteria 1061
284 Ga0157378_11973173 3300013297 Bacteria 633
285 Ga0163162_10173276 3300013306 Bacteria 2282
286 Ga0163162_10534838 3300013306 Bacteria 1301
287 Ga0157372_10128579 3300013307 Bacteria 2913
288 Ga0157372_10239221 3300013307 Bacteria 2106
289 Ga0157372_10764492 3300013307 Bacteria 1123
290 Ga0157372_10989565 3300013307 Bacteria 974
291 Ga0157372_11043224 3300013307 Bacteria 946
292 Ga0157372_11546062 3300013307 Bacteria 764
293 Ga0157372_11741578 3300013307 Bacteria 717
294 Ga0157372_13443072 3300013307 Bacteria 503
295 Ga0157375_10014213 3300013308 Bacteria 7096
296 Ga0157375_10347581 3300013308 Bacteria 1649
297 Ga0157375_11099479 3300013308 Bacteria 930
298 Ga0157375_11474049 3300013308 Bacteria 803
299 Ga0157375_12436965 3300013308 Bacteria 625
300 Ga0163163_10004668 3300014325 Bacteria 11717
301 Ga0163163_10650842 3300014325 Bacteria 1117
302 Ga0163163_11109423 3300014325 Bacteria 854
303 Ga0163163_11250715 3300014325 Bacteria 805
304 Ga0163163_11511167 3300014325 Bacteria 733
305 Ga0163163_12281737 3300014325 Bacteria 600
306 Ga0157380_10070525 3300014326 Bacteria 2824
307 Ga0157380_10553982 3300014326 Bacteria 1128
308 Ga0157380_11584968 3300014326 Bacteria 710
309 Ga0157380_13229326 3300014326 Bacteria 521
310 Ga0182008_10081757 3300014497 Bacteria 1590
311 Ga0182008_10718816 3300014497 Bacteria 572
312 Ga0182008_10719550 3300014497 Bacteria 572
313 Ga0157377_10246154 3300014745 Bacteria 1156
314 Ga0157377_10372572 3300014745 Bacteria 964
315 Ga0157377_11695878 3300014745 Bacteria 509
316 Ga0157379_10652786 3300014968 Bacteria 985
317 Ga0157376_10266547 3300014969 Bacteria 1607
318 Ga0157376_10439763 3300014969 Bacteria 1270
319 Ga0157376_10802911 3300014969 Bacteria 954
320 Ga0182005_1161971 3300015265 Bacteria 656
321 Ga0206356_10209413 3300020070 Bacteria 533
322 Ga0206356_10501215 3300020070 Bacteria 1367
323 Ga0206356_11742300 3300020070 Bacteria 1914
324 Ga0206354_10981450 3300020081 Bacteria 6427
325 Ga0206354_11201956 3300020081 Bacteria 1297
326 Ga0206354_11469124 3300020081 Bacteria 2036
327 Ga0206353_10253354 3300020082 Bacteria 6651
328 Ga0206353_10492582 3300020082 Bacteria 1087
329 Ga0206353_10783374 3300020082 Bacteria 1192
330 Ga0206353_11459877 3300020082 Bacteria 503
331 Ga0206353_11534795 3300020082 Bacteria 1468
332 Ga0206353_11591169 3300020082 Bacteria 961
333 Ga0206353_11725212 3300020082 Bacteria 1222
334 Ga0206353_11802624 3300020082 Bacteria 1317
335 Ga0206353_11968226 3300020082 Bacteria 749
336 Ga0206353_12029088 3300020082 Bacteria 795
337 Ga0154015_1217639 3300020610 Bacteria 673
338 Ga0213876_10556986 3300021384 Bacteria 610
339 Ga0207697_10542877 3300025315 Bacteria 511
340 Ga0207656_10180310 3300025321 Bacteria 1013
341 Ga0207713_1073728 3300025735 Bacteria 1251
342 Ga0207692_10052395 3300025898 Bacteria 2074
343 Ga0207688_10015915 3300025901 Bacteria 4078
344 Ga0207688_10145162 3300025901 Bacteria 1398
345 Ga0207688_10201689 3300025901 Bacteria 1193
346 Ga0207688_10427961 3300025901 Bacteria 823
347 Ga0207688_10705121 3300025901 Bacteria 638
348 Ga0207680_10979493 3300025903 Bacteria 606
349 Ga0207647_10003439 3300025904 Bacteria 11882
350 Ga0207647_10007825 3300025904 Bacteria 7693
351 Ga0207647_10456002 3300025904 Bacteria 716
352 Ga0207699_10262042 3300025906 Bacteria 1195
353 Ga0207643_10003225 3300025908 Bacteria 8793
354 Ga0207705_10082222 3300025909 Bacteria 2349
355 Ga0207705_10142563 3300025909 Bacteria 1790
356 Ga0207705_10250644 3300025909 Bacteria 1350
357 Ga0207705_11188351 3300025909 Bacteria 585
358 Ga0207654_10019979 3300025911 Bacteria 3543
359 Ga0207654_10333340 3300025911 Bacteria 1040
360 Ga0207707_10059649 3300025912 Bacteria 3319
361 Ga0207707_10075744 3300025912 Bacteria 2936
362 Ga0207707_10299266 3300025912 Bacteria 1391
363 Ga0207695_10006918 3300025913 Bacteria 14576
364 Ga0207695_10126089 3300025913 Bacteria 2522
365 Ga0207695_10322160 3300025913 Bacteria 1435
366 Ga0207695_10357340 3300025913 Bacteria 1347
367 Ga0207671_10000180 3300025914 Bacteria 96543
368 Ga0207671_10023522 3300025914 Bacteria 4646
369 Ga0207671_10837421 3300025914 Bacteria 729
370 Ga0207693_10180146 3300025915 Bacteria 1663
371 Ga0207663_10081950 3300025916 Bacteria 2115
372 Ga0207660_10070880 3300025917 Bacteria 2534
373 Ga0207660_10161250 3300025917 Bacteria 1730
374 Ga0207660_10834357 3300025917 Bacteria 752
375 Ga0207660_11006279 3300025917 Bacteria 680
376 Ga0207660_11133789 3300025917 Bacteria 637
377 Ga0207662_10338468 3300025918 Bacteria 1008
378 Ga0207662_10604825 3300025918 Bacteria 763
379 Ga0207657_10049534 3300025919 Bacteria 3660
380 Ga0207657_10065642 3300025919 Bacteria 3093
381 Ga0207657_10150929 3300025919 Bacteria 1893
382 Ga0207657_10174857 3300025919 Bacteria 1738
383 Ga0207657_10382852 3300025919 Bacteria 1107
384 Ga0207657_11036645 3300025919 Bacteria 628
385 Ga0207649_10017149 3300025920 Bacteria 4102
386 Ga0207649_10154832 3300025920 Bacteria 1582
387 Ga0207649_10223741 3300025920 Bacteria 1342
388 Ga0207649_10360486 3300025920 Bacteria 1079
389 Ga0207649_10634695 3300025920 Bacteria 824
390 Ga0207652_10053079 3300025921 Bacteria 3481
391 Ga0207652_10086777 3300025921 Bacteria 2744
392 Ga0207652_10102311 3300025921 Bacteria 2532
393 Ga0207652_10113935 3300025921 Bacteria 2400
394 Ga0207652_10120269 3300025921 Bacteria 2336
395 Ga0207652_10198842 3300025921 Bacteria 1804
396 Ga0207652_10206884 3300025921 Bacteria 1766
397 Ga0207652_10331990 3300025921 Bacteria 1373
398 Ga0207652_10564150 3300025921 Bacteria 1022
399 Ga0207652_10890200 3300025921 Bacteria 787
400 Ga0207652_11367724 3300025921 Bacteria 611
401 Ga0207681_10259169 3300025923 Bacteria 1361
402 Ga0207681_11721101 3300025923 Bacteria 524
403 Ga0207694_10002826 3300025924 Bacteria 14007
404 Ga0207694_10316726 3300025924 Bacteria 1287
405 Ga0207694_10908707 3300025924 Bacteria 744
406 Ga0207694_11652966 3300025924 Bacteria 539
407 Ga0207650_10184259 3300025925 Bacteria 1665
408 Ga0207650_10642530 3300025925 Bacteria 894
409 Ga0207650_10801995 3300025925 Bacteria 798
410 Ga0207659_10021793 3300025926 Bacteria 4260
411 Ga0207659_10387051 3300025926 Bacteria 1167
412 Ga0207687_10018666 3300025927 Bacteria 4582
413 Ga0207687_10038236 3300025927 Bacteria 3279
414 Ga0207687_10059898 3300025927 Bacteria 2684
415 Ga0207687_10082809 3300025927 Bacteria 2322
416 Ga0207687_10213984 3300025927 Bacteria 1513
417 Ga0207687_10225087 3300025927 Bacteria 1479
418 Ga0207687_11439943 3300025927 Bacteria 592
419 Ga0207700_10286589 3300025928 Bacteria 1418
420 Ga0207700_10438529 3300025928 Bacteria 1149
421 Ga0207700_10911263 3300025928 Bacteria 787
422 Ga0207664_10066052 3300025929 Bacteria 2898
423 Ga0207644_10097942 3300025931 Bacteria 2197
424 Ga0207644_10372107 3300025931 Bacteria 1164
425 Ga0207690_10096974 3300025932 Bacteria 2097
426 Ga0207690_10157898 3300025932 Bacteria 1688
427 Ga0207690_10468679 3300025932 Bacteria 1015
428 Ga0207706_10030957 3300025933 Bacteria 4771
429 Ga0207686_10298069 3300025934 Bacteria 1196
430 Ga0207686_10502841 3300025934 Bacteria 941
431 Ga0207709_10106024 3300025935 Bacteria 1869
432 Ga0207709_10541841 3300025935 Bacteria 914
433 Ga0207670_10077151 3300025936 Bacteria 2320
434 Ga0207669_10139963 3300025937 Bacteria 1678
435 Ga0207704_10145443 3300025938 Bacteria 1664
436 Ga0207704_10660509 3300025938 Bacteria 862
437 Ga0207704_10719234 3300025938 Bacteria 828
438 Ga0207665_10448483 3300025939 Bacteria 990
439 Ga0207691_10053830 3300025940 Bacteria 3673
440 Ga0207691_10187692 3300025940 Bacteria 1804
441 Ga0207711_10361905 3300025941 Bacteria 1344
442 Ga0207689_10001169 3300025942 Bacteria 25272
443 Ga0207689_10028723 3300025942 Bacteria 4651
444 Ga0207689_10510330 3300025942 Bacteria 1008
445 Ga0207661_10010352 3300025944 Bacteria 6711
446 Ga0207661_10034020 3300025944 Bacteria 3960
447 Ga0207661_10090655 3300025944 Bacteria 2545
448 Ga0207661_10135068 3300025944 Bacteria 2118
449 Ga0207661_10144746 3300025944 Bacteria 2049
450 Ga0207661_10732502 3300025944 Bacteria 910
451 Ga0207661_10762640 3300025944 Bacteria 891
452 Ga0207661_11113587 3300025944 Bacteria 727
453 Ga0207661_11924815 3300025944 Bacteria 537
454 Ga0207679_10018405 3300025945 Bacteria 4679
455 Ga0207667_10012023 3300025949 Bacteria 10016
456 Ga0207667_10031551 3300025949 Bacteria 5719
457 Ga0207667_10031902 3300025949 Bacteria 5682
458 Ga0207667_10379626 3300025949 Bacteria 1440
459 Ga0207667_10543525 3300025949 Bacteria 1175
460 Ga0207667_12177342 3300025949 Bacteria 512
461 Ga0207651_10378142 3300025960 Bacteria 1199
462 Ga0207651_11441025 3300025960 Bacteria 620
463 Ga0207712_10196417 3300025961 Bacteria 1596
464 Ga0207712_10197807 3300025961 Bacteria 1591
465 Ga0207668_10141015 3300025972 Bacteria 1854
466 Ga0207668_10825937 3300025972 Bacteria 822
467 Ga0207668_11079087 3300025972 Bacteria 719
468 Ga0207640_10037320 3300025981 Bacteria 3056
469 Ga0207640_11654091 3300025981 Bacteria 577
470 Ga0207640_11695357 3300025981 Bacteria 570
471 Ga0207658_10010475 3300025986 Bacteria 6297
472 Ga0207658_11002639 3300025986 Bacteria 762
473 Ga0207658_11104392 3300025986 Bacteria 724
474 Ga0207658_11385531 3300025986 Bacteria 643
475 Ga0207677_10202064 3300026023 Bacteria 1580
476 Ga0207677_10262806 3300026023 Bacteria 1408
477 Ga0207677_10909833 3300026023 Bacteria 793
478 Ga0207703_10348193 3300026035 Bacteria 1363
479 Ga0207678_10009914 3300026067 Bacteria 8361
480 Ga0207678_10041641 3300026067 Bacteria 3982
481 Ga0207678_10070452 3300026067 Bacteria 2998
482 Ga0207678_10189731 3300026067 Bacteria 1756
483 Ga0207678_10440558 3300026067 Bacteria 1132
484 Ga0207678_11150882 3300026067 Bacteria 687
485 Ga0207708_10105932 3300026075 Bacteria 2180
486 Ga0207708_10177530 3300026075 Bacteria 1690
487 Ga0207702_10007680 3300026078 Bacteria 9169
488 Ga0207702_10026302 3300026078 Bacteria 4830
489 Ga0207702_10079290 3300026078 Bacteria 2846
490 Ga0207702_10229548 3300026078 Bacteria 1734
491 Ga0207702_10235042 3300026078 Bacteria 1714
492 Ga0207702_10535553 3300026078 Bacteria 1144
493 Ga0207702_10852147 3300026078 Bacteria 902
494 Ga0207641_10038739 3300026088 Bacteria 3985
495 Ga0207641_11591223 3300026088 Bacteria 655
496 Ga0207648_10133754 3300026089 Bacteria 2183
497 Ga0207648_10146885 3300026089 Bacteria 2080
498 Ga0207648_10634377 3300026089 Bacteria 987
499 Ga0207676_10024140 3300026095 Bacteria 4496
500 Ga0207676_11641946 3300026095 Bacteria 641
501 Ga0207676_11955346 3300026095 Bacteria 585
502 Ga0207674_10005965 3300026116 Bacteria 14418
503 Ga0207674_10125528 3300026116 Bacteria 2532
504 Ga0207674_10630045 3300026116 Bacteria 1036
505 Ga0207674_10847971 3300026116 Bacteria 881
506 Ga0207674_11180006 3300026116 Bacteria 735
507 Ga0207674_11277990 3300026116 Bacteria 703
508 Ga0207674_11775929 3300026116 Bacteria 584
509 Ga0207675_100128089 3300026118 Bacteria 2406
510 Ga0207675_100181403 3300026118 Bacteria 2016
511 Ga0207675_100350568 3300026118 Bacteria 1447
512 Ga0207683_10016697 3300026121 Bacteria 6246
513 Ga0207683_10029609 3300026121 Bacteria 4741
514 Ga0207683_10367163 3300026121 Bacteria 1322
515 Ga0207683_10497592 3300026121 Bacteria 1126
516 Ga0207683_10948406 3300026121 Bacteria 799
517 Ga0207698_10013815 3300026142 Bacteria 5343
518 Ga0207698_10019257 3300026142 Bacteria 4669
519 Ga0207698_10070478 3300026142 Bacteria 2770
520 Ga0207698_10181108 3300026142 Bacteria 1867
521 Ga0207698_10400601 3300026142 Bacteria 1311
522 Ga0207698_10761554 3300026142 Bacteria 968
523 Ga0207698_10881648 3300026142 Bacteria 901
524 Ga0207698_11088520 3300026142 Bacteria 812
525 Ga0207698_11230140 3300026142 Bacteria 763
526 Ga0207698_11432070 3300026142 Bacteria 706
527 Ga0207698_12743525 3300026142 Bacteria 501
528 Ga0209813_10072119 3300027866 Bacteria 1125
529 Ga0207428_10031985 3300027907 Bacteria 4333
530 Ga0207428_10179231 3300027907 Bacteria 1602
531 Ga0268266_10278026 3300028379 Bacteria 1556
532 Ga0268266_10283801 3300028379 Bacteria 1540
533 Ga0268266_11326553 3300028379 Bacteria 695
534 Ga0268265_10068694 3300028380 Bacteria 2749
535 Ga0268265_10377062 3300028380 Bacteria 1304
536 Ga0268264_10142821 3300028381 Bacteria 2137
537 Ga0268264_10420309 3300028381 Bacteria 1289
538 Ga0265334_10155733 3300028573 Bacteria 805
539 Ga0307517_10247552 3300028786 Bacteria 1050
540 Ga0307515_10019377 3300028794 Bacteria 12254
541 Ga0307515_10253512 3300028794 Bacteria 1508
542 Ga0307515_10467813 3300028794 Bacteria 874
543 Ga0265338_10041533 3300028800 Bacteria 4300
544 Ga0265338_10229138 3300028800 Bacteria 1383
545 Ga0307512_10208165 3300030522 Bacteria 1045
546 Ga0265325_10015736 3300031241 Bacteria 4245
547 Ga0265325_10394833 3300031241 Bacteria 606
548 Ga0265340_10011328 3300031247 Bacteria 4742
549 Ga0265340_10077734 3300031247 Bacteria 1565
550 Ga0265339_10282975 3300031249 Bacteria 794
551 Ga0265331_10120887 3300031250 Bacteria 1198
552 Ga0265316_10261411 3300031344 Bacteria 1269
553 Ga0307513_10241078 3300031456 Bacteria 1613
554 Ga0307513_10459670 3300031456 Bacteria 996
555 Ga0307513_10478690 3300031456 Bacteria 965
556 Ga0307509_10768249 3300031507 Bacteria 629
557 Ga0307408_100238674 3300031548 Bacteria 1493
558 Ga0307408_101007471 3300031548 Bacteria 768
559 Ga0307408_101083314 3300031548 Bacteria 742
560 Ga0307408_101230804 3300031548 Bacteria 699
561 Ga0307408_101366575 3300031548 Bacteria 666
562 Ga0307408_102164367 3300031548 Bacteria 537
563 Ga0307408_102299947 3300031548 Bacteria 522
564 Ga0265313_10053609 3300031595 Bacteria 1919
565 Ga0307508_10415470 3300031616 Bacteria 937
566 Ga0265314_10659394 3300031711 Bacteria 533
567 Ga0265342_10504977 3300031712 Bacteria 616
568 Ga0316576_10327338 3300031727 Bacteria 1142
569 Ga0316578_10032880 3300031728 Bacteria 2967
570 Ga0316578_10344951 3300031728 Unclassified 887
571 Ga0307405_10040001 3300031731 Bacteria 2838
572 Ga0307405_10105332 3300031731 Bacteria 1899
573 Ga0307405_11500786 3300031731 Bacteria 592
574 Ga0316577_10438547 3300031733 Bacteria 742
575 Ga0307413_10018939 3300031824 Bacteria 3625
576 Ga0307413_10035726 3300031824 Bacteria 2854
577 Ga0307413_10439510 3300031824 Bacteria 1032
578 Ga0307413_10458637 3300031824 Bacteria 1013
579 Ga0307413_10745155 3300031824 Bacteria 818
580 Ga0307413_10870552 3300031824 Bacteria 763
581 Ga0307413_11295698 3300031824 Bacteria 637
582 Ga0307518_10410108 3300031838 Bacteria 750
583 Ga0307410_10013296 3300031852 Bacteria 4797
584 Ga0307410_10130085 3300031852 Bacteria 1848
585 Ga0307410_10152421 3300031852 Bacteria 1722
586 Ga0307410_10153917 3300031852 Bacteria 1715
587 Ga0307410_10201574 3300031852 Bacteria 1519
588 Ga0307410_10315805 3300031852 Bacteria 1238
589 Ga0307410_10565793 3300031852 Bacteria 944
590 Ga0307410_10786929 3300031852 Bacteria 808
591 Ga0307410_11018117 3300031852 Bacteria 715
592 Ga0307406_10101991 3300031901 Bacteria 1957
593 Ga0307406_10119133 3300031901 Bacteria 1832
594 Ga0307406_10212181 3300031901 Bacteria 1433
595 Ga0307406_10319150 3300031901 Bacteria 1201
596 Ga0307406_10360075 3300031901 Bacteria 1140
597 Ga0307406_10517458 3300031901 Bacteria 970
598 Ga0307406_11265135 3300031901 Bacteria 643
599 Ga0307406_11991056 3300031901 Bacteria 519
600 Ga0307407_10329707 3300031903 Bacteria 1074
601 Ga0307407_10386360 3300031903 Bacteria 1001
602 Ga0307407_10525143 3300031903 Bacteria 871
603 Ga0307407_10990279 3300031903 Bacteria 649
604 Ga0307412_10540046 3300031911 Bacteria 977
605 Ga0307412_10739058 3300031911 Bacteria 848
606 Ga0307409_100018170 3300031995 Bacteria 4715
607 Ga0307409_100054706 3300031995 Bacteria 3076
608 Ga0307409_100093039 3300031995 Bacteria 2476
609 Ga0307409_100185867 3300031995 Bacteria 1844
610 Ga0307409_100192457 3300031995 Bacteria 1817
611 Ga0307409_100214497 3300031995 Bacteria 1733
612 Ga0307409_100247420 3300031995 Bacteria 1628
613 Ga0307409_100264041 3300031995 Bacteria 1582
614 Ga0307409_100297480 3300031995 Bacteria 1500
615 Ga0307409_100610573 3300031995 Bacteria 1079
616 Ga0307409_100710153 3300031995 Bacteria 1005
617 Ga0307409_100824932 3300031995 Bacteria 936
618 Ga0307409_100910673 3300031995 Bacteria 893
619 Ga0307409_102746275 3300031995 Bacteria 520
620 Ga0307409_102845599 3300031995 Bacteria 511
621 Ga0307416_100040268 3300032002 Bacteria 3628
622 Ga0307416_100125671 3300032002 Bacteria 2297
623 Ga0307416_100157387 3300032002 Bacteria 2094
624 Ga0307416_100169193 3300032002 Bacteria 2032
625 Ga0307416_100357423 3300032002 Bacteria 1481
626 Ga0307416_100363379 3300032002 Bacteria 1470
627 Ga0307416_100506247 3300032002 Bacteria 1273
628 Ga0307416_100676462 3300032002 Bacteria 1119
629 Ga0307416_100732988 3300032002 Bacteria 1080
630 Ga0307416_100851845 3300032002 Bacteria 1009
631 Ga0307416_101038490 3300032002 Bacteria 923
632 Ga0307416_101704845 3300032002 Bacteria 735
633 Ga0307416_102390921 3300032002 Bacteria 628
634 Ga0307416_103690812 3300032002 Bacteria 512
635 Ga0307414_10069035 3300032004 Bacteria 2539
636 Ga0307414_10278549 3300032004 Bacteria 1404
637 Ga0307414_10286254 3300032004 Bacteria 1387
638 Ga0307414_10346304 3300032004 Bacteria 1274
639 Ga0307414_10442287 3300032004 Bacteria 1138
640 Ga0307414_10727867 3300032004 Bacteria 900
641 Ga0307411_10059795 3300032005 Bacteria 2528
642 Ga0307411_10168475 3300032005 Bacteria 1649
643 Ga0307411_10405511 3300032005 Bacteria 1128
644 Ga0307411_10719490 3300032005 Bacteria 871
645 Ga0307411_11658777 3300032005 Bacteria 591
646 Ga0307411_11701008 3300032005 Bacteria 584
647 Ga0307411_12015262 3300032005 Bacteria 539
648 Ga0307415_100014020 3300032126 Bacteria 4696
649 Ga0307415_100031365 3300032126 Bacteria 3423
650 Ga0307415_100031413 3300032126 Bacteria 3421
651 Ga0307415_100069802 3300032126 Bacteria 2465
652 Ga0307415_100112048 3300032126 Bacteria 2026
653 Ga0307415_100384432 3300032126 Bacteria 1193
654 Ga0307415_100655157 3300032126 Bacteria 942
655 Ga0307415_101189108 3300032126 Bacteria 718
656 Ga0307415_101316600 3300032126 Bacteria 685
657 Ga0307415_101363641 3300032126 Bacteria 674
658 Ga0307415_101376492 3300032126 Bacteria 671
659 Ga0316574_0097508 3300035398 Bacteria 1879
660 Ga0373931_0252597 3300035691 Bacteria 1073
661 Ga0373935_0753138 3300035692 Bacteria 718
662 Ga0373947_0539458 3300035725 Bacteria 794
663 Ga0373937_0248938 3300036401 Bacteria 1675
664 Ga0316584_0484077 3300036712 Bacteria 871
665 Ga0395899_0132731 3300037312 Bacteria 1777
666 Ga0395900_0170120 3300037418 Bacteria 2219
667 Ga0395900_0503780 3300037418 Bacteria 1161
668 Ga0395900_1055350 3300037418 Bacteria 731
669 Ga0395900_1112404 3300037418 Bacteria 707
670 Ga0395900_1710531 3300037418 Bacteria 540
671 Ga0395898_0106280 3300037466 Bacteria 2692
672 Ga0395898_0173523 3300037466 Bacteria 2061
673 Ga0395898_0213164 3300037466 Bacteria 1842
674 Ga0395898_0743028 3300037466 Bacteria 923
675 Ga0395905_0917547 3300037471 Bacteria 779
676 Ga0395901_0075412 3300038443 Bacteria 3518
677 Ga0395901_0092995 3300038443 Bacteria 3157
678 Ga0395901_0119980 3300038443 Bacteria 2763
679 Ga0395901_0242836 3300038443 Bacteria 1878
680 Ga0395901_0270540 3300038443 Bacteria 1767
681 Ga0395901_0460571 3300038443 Bacteria 1299
682 Ga0395901_0638734 3300038443 Bacteria 1069
683 Ga0395901_1800314 3300038443 Bacteria 562
684 Ga0436365_0298596 3300039437 Bacteria 959
685 Ga0436365_0506818 3300039437 Bacteria 1285
686 Ga0436365_0556406 3300039437 Bacteria 1337
687 Ga0436363_1246746 3300039450 Bacteria 779
688 Ga0436363_1687996 3300039450 Bacteria 967
689 Ga0439465_0135739 3300041413 Bacteria 871
690 Ga0451787_025773 3300041441 Bacteria 798
691 Ga0451789_0555869 3300041443 Bacteria 636
692 Ga0451791_1575760 3300041451 Bacteria 1040
693 Ga0451793_1387252 3300041452 Bacteria 4630
694 Ga0451797_0104719 3300041453 Bacteria 3590
695 Ga0451798_0565100 3300041458 Bacteria 749
696 Ga0451800_1439755 3300041459 Bacteria 845
697 Ga0451802_0337613 3300041460 Bacteria 714
698 Ga0451807_0035181 3300041486 Bacteria 615
699 Ga0451807_1178085 3300041486 Bacteria 1359
700 Ga0451835_1002227 3300041492 Bacteria 554
701 Ga0451837_0043710 3300041494 Bacteria 669
702 Ga0451843_0490284 3300041509 Bacteria 1367
703 Ga0451853_1642636 3300041512 Bacteria 5291
704 Ga0451853_1991345 3300041512 Bacteria 502
705 Ga0451853_2282637 3300041512 Bacteria 551
706 Ga0451853_3845939 3300041512 Bacteria 630
707 Ga0439448_0096658 3300042005 Bacteria 1001
708 Ga0439451_020780 3300042009 Bacteria 1323
709 Ga0450906_111668 3300042145 Bacteria 502
710 Ga0439435_0170374 3300042436 Bacteria 707
711 Ga0439464_0102498 3300042439 Bacteria 871
712 Ga0439460_0239677 3300042461 Bacteria 625
713 Ga0450901_035297 3300042533 Bacteria 558
714 Ga0451577_0211263 3300042876 Bacteria 1753
715 Ga0439440_0059792 3300042993 Bacteria 971
716 Ga0466969_0040030 3300044656 Bacteria 2350
717 Ga0466969_0083423 3300044656 Bacteria 1522
718 Ga0466969_0408815 3300044656 Bacteria 616
719 Ga0466972_0156389 3300044658 Bacteria 1071
720 Ga0466972_0519466 3300044658 Bacteria 561
721 Ga0466965_0156433 3300044683 Bacteria 1193
722 Ga0466965_0164631 3300044683 Bacteria 1164
723 Ga0466965_0192732 3300044683 Bacteria 1079
724 Ga0466965_0366778 3300044683 Bacteria 791
725 Ga0466965_0532577 3300044683 Bacteria 662
726 Ga0466966_0012157 3300044684 Bacteria 5703
727 Ga0466966_0031407 3300044684 Bacteria 3444
728 Ga0466966_0039724 3300044684 Bacteria 3030
729 Ga0466966_0043544 3300044684 Bacteria 2877
730 Ga0466966_0083076 3300044684 Bacteria 1993
731 Ga0466966_0155547 3300044684 Bacteria 1393
732 Ga0466966_0250410 3300044684 Bacteria 1067
733 Ga0466966_0557059 3300044684 Bacteria 690
734 Ga0466961_0011001 3300044693 Bacteria 5783
735 Ga0466961_0016441 3300044693 Bacteria 4755
736 Ga0466961_0023676 3300044693 Bacteria 3951
737 Ga0466961_0029792 3300044693 Bacteria 3506
738 Ga0466961_0063543 3300044693 Bacteria 2346
739 Ga0466961_0242283 3300044693 Bacteria 1108
740 Ga0466961_0629025 3300044693 Bacteria 645
741 Ga0466963_0004114 3300044694 Bacteria 8415
742 Ga0466963_0005135 3300044694 Bacteria 7644
743 Ga0466963_0024251 3300044694 Bacteria 3861
744 Ga0466963_0026309 3300044694 Bacteria 3721
745 Ga0466963_0029747 3300044694 Bacteria 3519
746 Ga0466963_0107800 3300044694 Bacteria 1910
747 Ga0466963_0202263 3300044694 Bacteria 1389
748 Ga0466963_0271392 3300044694 Bacteria 1192
749 Ga0466963_0346630 3300044694 Bacteria 1046
750 Ga0466963_0530133 3300044694 Bacteria 831
751 Ga0466963_0811094 3300044694 Bacteria 660
752 Ga0466964_0354488 3300044706 Bacteria 755
753 Ga0466971_0054323 3300044719 Bacteria 1805
754 Ga0466971_0090823 3300044719 Bacteria 1398
755 Ga0466970_0001419 3300044765 Bacteria 11586
756 Ga0466970_0033649 3300044765 Bacteria 2709
757 Ga0466970_0034741 3300044765 Bacteria 2670
758 Ga0466970_0125453 3300044765 Bacteria 1408
759 Ga0466970_0156057 3300044765 Bacteria 1261
760 Ga0466970_0446194 3300044765 Bacteria 741
761 Ga0466970_0593083 3300044765 Bacteria 642
762 Ga0466970_0884922 3300044765 Bacteria 525
763 Ga0466957_0015567 3300044842 Bacteria 4442
764 Ga0466957_0126797 3300044842 Bacteria 1631
765 Ga0466957_0588234 3300044842 Bacteria 778
766 Ga0466957_0684994 3300044842 Bacteria 723
767 Ga0466957_1204995 3300044842 Bacteria 548
768 Ga0466957_1265409 3300044842 Bacteria 535
769 Ga0466960_0083249 3300044901 Bacteria 1616
770 Ga0466960_0399971 3300044901 Bacteria 791
771 Ga0466959_0005804 3300045049 Bacteria 8503
772 Ga0466959_0089149 3300045049 Bacteria 2216
773 Ga0466959_0164425 3300045049 Bacteria 1559
774 Ga0466959_0254262 3300045049 Bacteria 1211
775 Ga0466959_0277332 3300045049 Bacteria 1151
776 Ga0466959_0284090 3300045049 Bacteria 1135
777 Ga0466959_1122336 3300045049 Bacteria 523
778 Ga0466958_0009062 3300045836 Bacteria 5528
779 Ga0466958_0030710 3300045836 Bacteria 3193
780 Ga0466958_0043089 3300045836 Bacteria 2718
781 Ga0466958_0054412 3300045836 Bacteria 2427
782 Ga0466958_0291098 3300045836 Bacteria 1047
783 Ga0466958_0309681 3300045836 Bacteria 1014
784 Ga0466958_0312002 3300045836 Bacteria 1010
785 Ga0466958_0433527 3300045836 Bacteria 850
786 Ga0466967_0004748 3300045976 Bacteria 9247
787 Ga0466967_0055840 3300045976 Bacteria 3479
788 Ga0466967_0057734 3300045976 Bacteria 3427
789 Ga0466967_0112084 3300045976 Bacteria 2508
790 Ga0466967_0128174 3300045976 Bacteria 2353
791 Ga0466967_0144209 3300045976 Bacteria 2220
792 Ga0466967_0144597 3300045976 Bacteria 2217
793 Ga0466967_0303876 3300045976 Bacteria 1535
794 Ga0466967_0712248 3300045976 Bacteria 994
795 Ga0466967_0715917 3300045976 Bacteria 992
796 Ga0466967_0731841 3300045976 Bacteria 981
797 Ga0495627_082896 3300046453 Bacteria 928
798 Ga0495629_0142547 3300046459 Bacteria 1667
799 Ga0495629_0171186 3300046459 Bacteria 1507
800 Ga0495629_0371528 3300046459 Bacteria 974
801 Ga0495629_0574777 3300046459 Bacteria 755
802 Ga0495651_0009236 3300046462 Bacteria 7568
803 Ga0495651_0587812 3300046462 Bacteria 704
804 Ga0495582_0155605 3300046473 Bacteria 1299
805 Ga0495582_0279728 3300046473 Bacteria 958
806 Ga0495582_0541696 3300046473 Bacteria 673
807 Ga0495582_0826354 3300046473 Bacteria 536
808 Ga0495662_0223513 3300046476 Bacteria 928
809 Ga0495664_0378632 3300046477 Bacteria 851
810 Ga0495664_0700918 3300046477 Bacteria 598
811 Ga0495585_0065269 3300046492 Bacteria 1995
812 Ga0495596_0033042 3300046500 Bacteria 2060
813 Ga0495608_0068406 3300046511 Bacteria 2322
814 Ga0495608_0945458 3300046511 Bacteria 503
815 Ga0495618_0337412 3300046514 Bacteria 931
816 Ga0495628_0649497 3300046516 Bacteria 749
817 Ga0495644_0097810 3300046523 Bacteria 1110
818 Ga0495652_0000573 3300046529 Bacteria 42990
819 Ga0495652_0082868 3300046529 Bacteria 2642
820 Ga0495665_0471396 3300046531 Bacteria 634
821 Ga0495640_0129946 3300046533 Bacteria 1631
822 Ga0495586_0117203 3300046535 Bacteria 1486
823 Ga0495645_0030803 3300046543 Bacteria 3909
824 Ga0495645_0743806 3300046543 Bacteria 592
825 Ga0495622_0048076 3300046557 Bacteria 1983
826 Ga0495667_0073771 3300046559 Bacteria 2223
827 Ga0495667_0516403 3300046559 Bacteria 748
828 Ga0495667_0901173 3300046559 Bacteria 542
829 Ga0495656_0006406 3300046615 Bacteria 4129
830 Ga0495656_0701234 3300046615 Bacteria 545
831 Ga0495635_0226027 3300046663 Bacteria 1265
832 Ga0495635_0410470 3300046663 Bacteria 899
833 Ga0495635_0861799 3300046663 Bacteria 581
834 Ga0495588_0707533 3300046674 Bacteria 527
835 Ga0495657_0380075 3300046675 Bacteria 833
836 Ga0495647_0124038 3300046681 Bacteria 1089
837 Ga0495647_0310125 3300046681 Bacteria 713
838 Ga0495658_0257741 3300046683 Bacteria 1098
839 Ga0495613_0771572 3300046689 Bacteria 629
840 Ga0495670_0408140 3300046691 Bacteria 734
841 Ga0495649_0398922 3300046694 Bacteria 691
842 Ga0495649_0467496 3300046694 Bacteria 629
843 Ga0495600_0024125 3300046809 Bacteria 3914
844 Ga0495581_0173834 3300047315 Bacteria 1260
845 Ga0495581_0663734 3300047315 Bacteria 602
846 Ga0495581_0805113 3300047315 Bacteria 539
847 Ga0495604_0044539 3300047317 Bacteria 3466
848 Ga0495604_0660183 3300047317 Bacteria 666
849 Ga0495674_0141022 3300047319 Bacteria 2026
850 Ga0495676_0196797 3300047321 Bacteria 1403
851 Ga0495680_0144168 3300047322 Bacteria 1741
852 Ga0495675_0016732 3300047444 Bacteria 4637
853 Ga0495675_0335208 3300047444 Bacteria 892
854 Ga0495675_0521005 3300047444 Bacteria 681
855 Ga0495593_0315469 3300047673 Bacteria 782
856 Ga0495593_0432896 3300047673 Bacteria 658
857 Ga0495593_0586240 3300047673 Bacteria 560
858 Ga0495614_0120449 3300048089 Bacteria 1157
859 Ga0495615_0101098 3300048090 Bacteria 815
860 Ga0495615_0201013 3300048090 Bacteria 615
861 Ga0496100_0080531 3300048903 Bacteria 2198
862 Ga0496100_0344712 3300048903 Bacteria 1124
863 Ga0496100_0476819 3300048903 Bacteria 959
864 Ga0496100_1408036 3300048903 Bacteria 550
865 Ga0496101_0036573 3300048904 Bacteria 3478
866 Ga0496101_0115818 3300048904 Bacteria 2022
867 Ga0496101_0299731 3300048904 Bacteria 1259
868 Ga0496102_0000735 3300048905 Bacteria 32176
869 Ga0496102_0006399 3300048905 Bacteria 10041
870 Ga0496102_0022781 3300048905 Bacteria 5552
871 Ga0496102_0227878 3300048905 Bacteria 1757
872 Ga0496102_0419078 3300048905 Bacteria 1258
873 Ga0496102_0597183 3300048905 Bacteria 1027
874 Ga0496103_0005567 3300048906 Bacteria 7532
875 Ga0496103_0255400 3300048906 Bacteria 1128
876 Ga0496103_0822650 3300048906 Bacteria 585
877 Ga0496104_0001342 3300048907 Bacteria 21301
878 Ga0496104_0040359 3300048907 Bacteria 4374
879 Ga0496104_0085266 3300048907 Bacteria 3015
880 Ga0496104_0247315 3300048907 Bacteria 1696
881 Ga0496104_0308384 3300048907 Bacteria 1495
882 Ga0496104_0347137 3300048907 Bacteria 1397
883 Ga0496104_0418393 3300048907 Bacteria 1252
884 Ga0496104_0466748 3300048907 Bacteria 1174
885 Ga0496104_0974916 3300048907 Bacteria 752
886 Ga0496105_0016468 3300048908 Bacteria 5903
887 Ga0496105_0036384 3300048908 Bacteria 4055
888 Ga0496105_0136573 3300048908 Bacteria 2020
889 Ga0496105_0178579 3300048908 Bacteria 1739
890 Ga0496105_0217889 3300048908 Bacteria 1554
891 Ga0496105_0261919 3300048908 Bacteria 1398
892 Ga0496105_0499261 3300048908 Bacteria 955
893 Ga0496105_0504088 3300048908 Bacteria 950
894 Ga0496106_0127850 3300048909 Bacteria 1991
895 Ga0496106_0166110 3300048909 Bacteria 1747
896 Ga0496106_0608738 3300048909 Bacteria 875
897 Ga0496106_1288219 3300048909 Bacteria 568
898 Ga0496107_0034677 3300048910 Bacteria 3615
899 Ga0496107_0520285 3300048910 Bacteria 882
900 Ga0496108_0000623 3300048911 Bacteria 27762
901 Ga0496108_0023913 3300048911 Bacteria 5029
902 Ga0496108_0061325 3300048911 Bacteria 3164
903 Ga0496108_0112912 3300048911 Bacteria 2325
904 Ga0496108_0311335 3300048911 Bacteria 1372
905 Ga0496108_0479193 3300048911 Bacteria 1087
906 Ga0496108_0585941 3300048911 Bacteria 972
907 Ga0496108_1152676 3300048911 Bacteria 657
908 Ga0496108_1515624 3300048911 Bacteria 557
909 Ga0496108_1542225 3300048911 Bacteria 551
910 Ga0496109_0009375 3300048912 Bacteria 8339
911 Ga0496109_0017787 3300048912 Bacteria 6234
912 Ga0496109_0089327 3300048912 Bacteria 2848
913 Ga0496109_0212317 3300048912 Bacteria 1820
914 Ga0496109_0213703 3300048912 Bacteria 1814
915 Ga0496109_0266325 3300048912 Bacteria 1614
916 Ga0496109_0392717 3300048912 Bacteria 1311
917 Ga0496109_0525856 3300048912 Bacteria 1116
918 Ga0496109_1063750 3300048912 Bacteria 746
919 Ga0496109_1531082 3300048912 Bacteria 602
920 Ga0496110_0004825 3300048913 Bacteria 10507
921 Ga0496110_0216055 3300048913 Bacteria 1743
922 Ga0496110_0385276 3300048913 Bacteria 1277
923 Ga0496110_0467113 3300048913 Bacteria 1150
924 Ga0496110_0471796 3300048913 Bacteria 1143
925 Ga0496110_0585706 3300048913 Bacteria 1013
926 Ga0496110_0840100 3300048913 Bacteria 823
927 Ga0496111_0000994 3300048914 Bacteria 15537
928 Ga0496111_0007779 3300048914 Bacteria 7058
929 Ga0496111_0037201 3300048914 Bacteria 3483
930 Ga0496111_0317855 3300048914 Bacteria 1153
931 Ga0496111_0473304 3300048914 Bacteria 923
932 Ga0496112_0112173 3300048915 Bacteria 2696
933 Ga0496112_1440413 3300048915 Bacteria 603
934 Ga0496113_0014312 3300048916 Bacteria 5409
935 Ga0496113_0024900 3300048916 Bacteria 4260
936 Ga0496113_0039753 3300048916 Bacteria 3464
937 Ga0496113_0043090 3300048916 Bacteria 3338
938 Ga0496113_0106550 3300048916 Bacteria 2177
939 Ga0496113_0120854 3300048916 Bacteria 2048
940 Ga0496113_0249722 3300048916 Bacteria 1416
941 Ga0496113_0630253 3300048916 Bacteria 858
942 Ga0496114_0001130 3300048917 Bacteria 20173
943 Ga0496114_0001454 3300048917 Bacteria 17979
944 Ga0496114_0007721 3300048917 Bacteria 8509
945 Ga0496114_0096811 3300048917 Bacteria 2513
946 Ga0496114_0119071 3300048917 Bacteria 2269
947 Ga0496114_0136307 3300048917 Bacteria 2123
948 Ga0496114_0193852 3300048917 Bacteria 1778
949 Ga0496114_0264001 3300048917 Bacteria 1516
950 Ga0496114_0274326 3300048917 Bacteria 1486
951 Ga0496114_0286998 3300048917 Bacteria 1451
952 Ga0496114_0288898 3300048917 Bacteria 1447
953 Ga0496114_0446478 3300048917 Bacteria 1145
954 Ga0496114_1730512 3300048917 Bacteria 513
955 Ga0496115_0012178 3300048918 Bacteria 6468
956 Ga0496115_0078974 3300048918 Bacteria 2678
957 Ga0496115_0216321 3300048918 Bacteria 1582
958 Ga0496115_0532938 3300048918 Bacteria 940
959 Ga0496115_1194829 3300048918 Bacteria 572
960 Ga0496119_0000960 3300048922 Bacteria 37110
961 Ga0496120_0001834 3300048923 Bacteria 23688
962 Ga0496123_0053390 3300048926 Bacteria 2671
963 Ga0496124_0189176 3300048927 Bacteria 1577
964 Ga0496124_0318532 3300048927 Bacteria 1115
965 Ga0496124_0433443 3300048927 Bacteria 902
966 Ga0496126_0000006 3300048929 Bacteria 798804
967 Ga0496126_0021047 3300048929 Bacteria 6381
968 Ga0496126_0068404 3300048929 Bacteria 3171
969 Ga0496126_0330995 3300048929 Bacteria 1250
970 Ga0501317_110782 3300049533 Bacteria 504
971 Ga0501031_0010365 3300049568 Bacteria 6069
972 Ga0501031_0013183 3300049568 Bacteria 5395
973 Ga0501032_0160508 3300049569 Bacteria 1476
974 Ga0501032_0217545 3300049569 Bacteria 1244
975 Ga0501033_0036579 3300049570 Bacteria 3678
976 Ga0501034_0278084 3300049571 Bacteria 1614
977 Ga0501034_0935879 3300049571 Bacteria 753
978 Ga0501036_0024649 3300049572 Bacteria 5072
979 Ga0501036_0089146 3300049572 Bacteria 2606
980 Ga0501036_0177974 3300049572 Bacteria 1791
981 Ga0501036_1453889 3300049572 Bacteria 555
982 Ga0501037_0031898 3300049573 Bacteria 3890
983 Ga0501037_0055236 3300049573 Bacteria 2904
984 Ga0501038_0192810 3300049574 Bacteria 1639
985 Ga0501038_1044228 3300049574 Bacteria 598
986 Ga0501038_1367958 3300049574 Bacteria 509
987 Ga0501039_0065326 3300049575 Bacteria 2822
988 Ga0501039_0079105 3300049575 Bacteria 2558
989 Ga0501039_0415808 3300049575 Bacteria 1056
990 Ga0501039_0552261 3300049575 Bacteria 904
991 Ga0501040_0015306 3300049576 Bacteria 5071
992 Ga0501040_0090626 3300049576 Bacteria 2125
993 Ga0501040_0299958 3300049576 Bacteria 1149
994 Ga0501040_0329770 3300049576 Bacteria 1092
995 Ga0501040_0614167 3300049576 Bacteria 786
996 Ga0501041_0004209 3300049577 Bacteria 8326
997 Ga0501041_0017796 3300049577 Bacteria 4229
998 Ga0501041_0557763 3300049577 Bacteria 730
999 Ga0501042_0008853 3300049578 Bacteria 6673
1000 Ga0501042_0029797 3300049578 Bacteria 3849
1001 Ga0501043_0014686 3300049579 Bacteria 6131
1002 Ga0501043_0153115 3300049579 Bacteria 1804
1003 Ga0501046_0042248 3300049580 Bacteria 3635
1004 Ga0501046_0249867 3300049580 Bacteria 1306
1005 Ga0501047_0011090 3300049581 Bacteria 8529
1006 Ga0501047_0344857 3300049581 Bacteria 1326
1007 Ga0501048_0013342 3300049582 Bacteria 6097
1008 Ga0501048_0033546 3300049582 Bacteria 3708
1009 Ga0501048_0130640 3300049582 Bacteria 1776
1010 Ga0501048_1042579 3300049582 Bacteria 588
1011 Ga0501067_0507024 3300049583 Bacteria 675
1012 Ga0501068_0078828 3300049584 Bacteria 2019
1013 Ga0501068_0080808 3300049584 Bacteria 1995
1014 Ga0501069_0915709 3300049585 Bacteria 534
1015 Ga0501070_0056403 3300049586 Bacteria 3256
1016 Ga0501070_0201135 3300049586 Bacteria 1636
1017 Ga0501070_0505796 3300049586 Bacteria 970
1018 Ga0501071_0002813 3300049587 Bacteria 10710
1019 Ga0501071_0241329 3300049587 Bacteria 1362
1020 Ga0501072_0032716 3300049588 Bacteria 4072
1021 Ga0501072_0044417 3300049588 Bacteria 3494
1022 Ga0501073_0102156 3300049589 Bacteria 1991
1023 Ga0501073_0425269 3300049589 Bacteria 918
1024 Ga0501074_0023291 3300049590 Bacteria 4503
1025 Ga0501074_0133737 3300049590 Bacteria 1774
1026 Ga0501075_0041137 3300049591 Bacteria 3463
1027 Ga0501076_0010496 3300049592 Bacteria 6874
1028 Ga0501076_0047264 3300049592 Bacteria 3402
1029 Ga0501077_0030486 3300049593 Bacteria 3432
1030 Ga0501246_037638 3300049676 Bacteria 568
1031 Ga0501079_0006491 3300049741 Bacteria 8784
1032 Ga0501079_0218932 3300049741 Bacteria 1487
1033 Ga0501079_0549205 3300049741 Bacteria 908
1034 Ga0501079_0907294 3300049741 Bacteria 694
1035 Ga0501080_0167369 3300049742 Bacteria 2028
1036 Ga0501080_0186037 3300049742 Bacteria 1910
1037 Ga0501080_0359058 3300049742 Bacteria 1315
1038 Ga0501081_0028633 3300049743 Bacteria 3760
1039 Ga0501081_0085638 3300049743 Bacteria 2212
1040 Ga0501083_0980208 3300049744 Bacteria 550
1041 Ga0501035_0023004 3300049822 Bacteria 5720
1042 Ga0501035_0266683 3300049822 Bacteria 1450
1043 Ga0501035_0536331 3300049822 Bacteria 960
1044 Ga0501035_0607211 3300049822 Bacteria 891
1045 Ga0501044_0073543 3300049823 Bacteria 3474
1046 Ga0501044_0305055 3300049823 Bacteria 1520
1047 Ga0501044_0414233 3300049823 Bacteria 1258
1048 Ga0501044_0420241 3300049823 Bacteria 1247
1049 Ga0501044_0437578 3300049823 Bacteria 1216
1050 Ga0501045_0044674 3300049824 Bacteria 3227
1051 Ga0501045_0261705 3300049824 Bacteria 1287
1052 Ga0501045_0715127 3300049824 Bacteria 739
1053 nmdc:mga00v17_3307_c1 3300050491 Bacteria 3698
1054 nmdc:mga00v17_335263_c1 3300050491 Bacteria 983
1055 nmdc:mga0yw44_481290_c1 3300050492 Bacteria 842
1056 nmdc:mga0yw44_80957_c1 3300050492 Bacteria 2035
1057 nmdc:mga0yw44_990912_c1 3300050492 Bacteria 569
1058 nmdc:mga06z11_350563_c1 3300050494 Bacteria 884
1059 nmdc:mga04h51_26732_c1 3300050495 Bacteria 1787
1060 nmdc:mga07m45_152065_c1 3300050496 Bacteria 1342
1061 nmdc:mga05p37_1586837_c1 3300050507 Bacteria 646
1062 nmdc:mga05p37_1821172_c1 3300050507 Bacteria 586
1063 nmdc:mga05p37_280242_c1 3300050507 Bacteria 1988
1064 nmdc:mga09592_173844_c1 3300050508 Bacteria 1863
1065 nmdc:mga09592_423676_c1 3300050508 Bacteria 1149
1066 nmdc:mga09592_76003_c1 3300050508 Bacteria 2856
1067 nmdc:mga06r32_274024_c1 3300050510 Bacteria 1675
1068 nmdc:mga06r32_31347_c1 3300050510 Bacteria 4992
1069 nmdc:mga08y16_139434_c1 3300050511 Bacteria 2521
1070 nmdc:mga08y16_66404_c1 3300050511 Bacteria 3765
1071 nmdc:mga0rr50_198003_c1 3300050513 Bacteria 1650
1072 nmdc:mga08x19_40413_c1 3300050514 Bacteria 2968
1073 Ga0495601_0044939 3300053077 Bacteria 2777
1074 Ga0495601_0633460 3300053077 Bacteria 685
1075 Ga0495612_0000712 3300053078 Bacteria 13488
1076 Ga0495612_0306470 3300053078 Bacteria 713
1077 Ga0495595_0010962 3300053084 Bacteria 3782
1078 Ga0500646_0046481 3300053090 Bacteria 1239
1079 Ga0500641_0003416 3300053096 Bacteria 5612
1080 Ga0500573_0107851 3300053140 Bacteria 1561
1081 Ga0501084_0020842 3300054114 Bacteria 5467
1082 Ga0501084_0068010 3300054114 Bacteria 2982
1083 Ga0501084_1563800 3300054114 Bacteria 552
1084 Ga0501084_1822667 3300054114 Bacteria 508
1085 Ga0501082_0021928 3300060353 Bacteria 5506
1086 Ga0501082_0165241 3300060353 Bacteria 1923
1087 Ga0501082_1518814 3300060353 Bacteria 585
1088 Ga0466962_0013525 3300061719 Bacteria 3929
1089 Ga0466962_0117939 3300061719 Bacteria 1280
1090 Ga0466962_0130751 3300061719 Bacteria 1213
1091 Ga0466962_0148664 3300061719 Bacteria 1136
1092 Ga0466962_0194975 3300061719 Bacteria 989
1093 Ga0530510_0059511 3300061734 Bacteria 2763
1094 Ga0530510_0063017 3300061734 Bacteria 2684
1095 Ga0530510_0500685 3300061734 Bacteria 921
1096 2515850971 2515154155 Bacteria 7985436
1097 2643849942 2643221567 Bacteria 4163945
1098 2644016261 2643221601 Bacteria 7493239
1099 2644135944 2643221624 Bacteria 4384879
1100 2644178517 2643221631 Bacteria 8168043
1101 2644444956 2643221679 Bacteria 3839507
1102 2644456973 2643221681 Bacteria 3707866
1103 2644537504 2643221697 Bacteria 3575694
1104 2644609735 2643221711 Bacteria 4865335
1105 2645719723 2643221961 Bacteria 3919167
1106 2645726611 2643221962 Bacteria 3874254
1107 2676476704 2675903058 Bacteria 6822861
1108 2738695726 2738541272 Bacteria 6848551
1109 2739326133 2738543027 Bacteria 6409078
1110 2739605025 2739367654 Bacteria 6049412
1111 2740168864 2739367898 Bacteria 4367674
1112 2760308031 2758568522 Bacteria 5953541
1113 2760623346 2758568621 Bacteria 5967089
1114 2768643831 2767802112 Bacteria 6465194
1115 2784472109 2784132109 Bacteria 3141763
1116 2808874208 2808606365 Bacteria 4301966
1117 2809028234 2808606394 Bacteria 6248540
1118 2812374894 2811994882 Bacteria 4688362
1119 2816425549 2816332119 Bacteria 8120218
1120 2819427635 2818991318 Bacteria 5266538
1121 2819666491 2818991458 Bacteria 4794049
1122 2819691651 2818991462 Bacteria 4320267
1123 2819729569 2818991469 Bacteria 4644110
1124 2819744007 2818991472 Bacteria 10089953
1125 2827630207 2827628540 Bacteria 6858585
1126 2837273376 2837268691 Bacteria 7850704
1127 2848552434 2848551377 Bacteria 3720646
1128 2861524022 2861520306 Bacteria 8348283
1129 2867346707 2867346516 Bacteria 7608576
1130 2868093206 2868088558 Bacteria 7609351
1131 2887444104 2887443736 Bacteria 4426037
1132 2984594851 2984592036 Bacteria 3670284
1133 2995468048 2995463766 Bacteria 8577691
1134 3001891415 3001889506 Bacteria 2975194
1135 8053952833 8053945823 Bacteria 8962862
1136 8054611329 8054609563 Bacteria 5170090
1137 8057572493 8057568493 Bacteria 7221719
1138 Ga0157379_11528154
1139 JGI24739J22299_10001443
1140 JGI24737J22298_10003330
1141 JGI24735J21928_10009578
1142 JGI24735J21928_10011363
1143 Ga0070658_10001601
1144 Ga0070658_10125694
1145 Ga0070658_10209150
1146 Ga0070658_10591516
1147 Ga0070658_11032762
1148 Ga0070676_10313847
1149 Ga0070683_100019031
1150 Ga0070683_100783184
1151 Ga0070683_101907861
1152 Ga0068869_100019690
1153 Ga0068869_100021777
1154 Ga0068869_100252513
1155 Ga0070666_10820237
1156 Ga0070680_100297660
1157 Ga0070680_100455600
1158 Ga0070682_100002949
1159 Ga0070682_100084461
1160 Ga0070682_100097643
1161 Ga0070682_100184742
1162 Ga0070682_100238937
1163 Ga0070682_100397855
1164 Ga0070682_100461715
1165 Ga0068868_100071671
1166 Ga0068868_100136027
1167 Ga0068868_100316393
1168 Ga0070660_100042696
1169 Ga0070660_100070805
1170 Ga0070660_100190976
1171 Ga0070660_100464013
1172 Ga0070660_100559722
1173 Ga0070660_101050179
1174 Ga0070689_100262178
1175 Ga0070691_10026973
1176 Ga0070687_100360263
1177 Ga0070661_100040415
1178 Ga0070661_100337481
1179 Ga0070661_100365911
1180 Ga0070692_10067349
1181 Ga0070668_100490754
1182 Ga0070668_101129817
1183 Ga0070669_101335821
1184 Ga0070675_100008017
1185 Ga0070675_100140176
1186 Ga0070671_100007289
1187 Ga0070671_100239491
1188 Ga0070674_101767634
1189 Ga0070673_101108492
1190 Ga0070659_100032558
1191 Ga0070659_100165481
1192 Ga0070659_102106941
1193 Ga0070667_100005054
1194 Ga0070667_100160228
1195 Ga0070667_100386081
1196 Ga0070667_101207403
1197 Ga0070667_101284042
1198 Ga0070709_10184285
1199 Ga0070709_11057250
1200 Ga0070714_100089379
1201 Ga0070714_101085171
1202 Ga0070714_102502361
1203 Ga0070713_100154115
1204 Ga0070713_100190537
1205 Ga0070713_100367948
1206 Ga0070711_100078358
1207 Ga0070705_100781488
1208 Ga0070705_100992239
1209 Ga0070700_100121130
1210 Ga0070694_101307458
1211 Ga0070708_100406394
1212 Ga0070663_100021165
1213 Ga0070663_100108306
1214 Ga0070663_100229462
1215 Ga0070663_100972189
1216 Ga0070663_101026599
1217 Ga0070663_101342589
1218 Ga0070678_100044533
1219 Ga0070678_100152020
1220 Ga0070678_100162050
1221 Ga0070678_100484373
1222 Ga0070681_10090018
1223 Ga0070681_10509695
1224 Ga0070681_10716185
1225 Ga0070681_11190307
1226 Ga0068867_100639366
1227 Ga0068867_101167260
1228 Ga0068867_101304416
1229 Ga0070685_10095132
1230 Ga0070685_10278328
1231 Ga0070685_10411610
1232 Ga0070698_100021155
1233 Ga0070679_100040469
1234 Ga0070679_100090535
1235 Ga0070679_100125162
1236 Ga0070679_100146167
1237 Ga0070679_100163926
1238 Ga0070679_100250505
1239 Ga0070679_101023735
1240 Ga0070679_102171253
1241 Ga0070684_100042712
1242 Ga0070684_100209746
1243 Ga0070684_100331418
1244 Ga0070684_101470602
1245 Ga0068853_100825043
1246 Ga0070672_100224674
1247 Ga0070672_101111607
1248 Ga0070696_100000806
1249 Ga0070693_100013235
1250 Ga0070693_100538221
1251 Ga0070665_100116357
1252 Ga0070665_100225627
1253 Ga0070665_100321707
1254 Ga0070665_101376803
1255 Ga0068855_100007335
1256 Ga0068855_100010193
1257 Ga0068855_100015148
1258 Ga0068855_100452505
1259 Ga0068855_101138635
1260 Ga0070664_100011912
1261 Ga0068857_100005416
1262 Ga0068857_100157945
1263 Ga0068857_100173664
1264 Ga0068857_101089946
1265 Ga0068857_101167492
1266 Ga0068857_101622158
1267 Ga0068857_102032374
1268 Ga0068857_102081522
1269 Ga0068854_100003155
1270 Ga0068854_100043523
1271 Ga0068854_100071621
1272 Ga0068856_100006438
1273 Ga0068856_100006679
1274 Ga0068856_100279725
1275 Ga0068856_100564124
1276 Ga0068856_100785714
1277 Ga0068856_101786920
1278 Ga0068856_102133884
1279 Ga0070702_100012306
1280 Ga0070702_100329551
1281 Ga0070702_100971982
1282 Ga0068852_100007296
1283 Ga0068852_100020286
1284 Ga0068852_100020773
1285 Ga0068852_100165344
1286 Ga0068852_100179670
1287 Ga0068852_100407354
1288 Ga0068852_100473701
1289 Ga0068859_100822423
1290 Ga0068859_102976817
1291 Ga0068864_100142385
1292 Ga0068864_101204057
1293 Ga0068864_102381441
1294 Ga0068866_10326054
1295 Ga0068861_100257648
1296 Ga0068861_101219375
1297 Ga0068851_10063443
1298 Ga0068870_10189964
1299 Ga0068870_10461514
1300 Ga0068870_10968923
1301 Ga0068863_100056422
1302 Ga0068863_101854429
1303 Ga0068858_100853796
1304 Ga0068860_100623066
1305 Ga0068862_100098112
1306 Ga0081455_10001727
1307 Ga0081455_10167140
1308 Ga0081538_10082192
1309 Ga0081540_1002115
1310 Ga0070717_10649064
1311 Ga0075364_10026964
1312 Ga0075364_10356039
1313 Ga0075432_10094974
1314 Ga0070716_100608797
1315 Ga0070712_100446642
1316 Ga0075367_10061989
1317 Ga0097621_100053144
1318 Ga0097621_100515165
1319 Ga0075370_10151543
1320 Ga0068871_100669454
1321 Ga0068871_101318981
1322 Ga0075428_100316264
1323 Ga0075428_100620098
1324 Ga0075431_100038052
1325 Ga0075431_100302451
1326 Ga0075433_10039113
1327 Ga0075434_100053152
1328 Ga0075429_100262225
1329 Ga0075429_100568355
1330 Ga0068865_100178180
1331 Ga0068865_100255956
1332 Ga0068865_100565500
1333 Ga0068865_100964786
1334 Ga0068865_101639088
1335 Ga0075436_100015576
1336 Ga0097620_100822456
1337 Ga0097620_102977056
1338 Ga0075435_100065337
1339 Ga0105251_10008521
1340 Ga0105240_10001975
1341 Ga0105240_10103546
1342 Ga0105240_10706406
1343 Ga0105240_12158498
1344 Ga0111539_10005317
1345 Ga0105245_10007924
1346 Ga0105245_10015300
1347 Ga0105245_10048638
1348 Ga0105245_10118385
1349 Ga0105245_10257512
1350 Ga0105245_10459862
1351 Ga0105245_11777552
1352 Ga0105245_11866144
1353 Ga0105247_10012565
1354 Ga0105247_10284918
1355 Ga0105247_10782195
1356 Ga0114129_10191137
1357 Ga0114129_11207550
1358 Ga0114129_12743898
1359 Ga0105243_10053489
1360 Ga0105243_10373417
1361 Ga0105243_10650266
1362 Ga0105241_10002330
1363 Ga0105241_10074240
1364 Ga0105241_10891824
1365 Ga0105241_12269391
1366 Ga0105242_10124878
1367 Ga0105242_10171122
1368 Ga0105242_10635168
1369 Ga0105248_10247850
1370 Ga0105248_10497255
1371 Ga0105237_10039938
1372 Ga0105237_10142330
1373 Ga0105237_10163149
1374 Ga0105237_10549891
1375 Ga0105237_11598374
1376 Ga0105237_11992237
1377 Ga0105238_10004764
1378 Ga0105238_10037828
1379 Ga0105238_10168513
1380 Ga0105238_10324931
1381 Ga0105238_11310689
1382 Ga0105249_10376537
1383 Ga0105249_11270671
1384 Ga0105249_11318571
1385 Ga0105239_10027733
1386 Ga0105239_10072749
1387 Ga0105239_10086604
1388 Ga0105239_10112717
1389 Ga0105239_10226718
1390 Ga0105239_10314930
1391 Ga0105239_10630355
1392 Ga0105239_10741734
1393 Ga0105239_10791467
1394 Ga0105239_12367575
1395 Ga0105246_10012689
1396 Ga0105246_10027239
1397 Ga0105246_10302952
1398 Ga0105246_10422348
1399 Ga0105246_10975287
1400 Ga0105246_11381090
1401 Ga0105246_12585925
1402 Ga0157373_10055852
1403 Ga0157371_10008106
1404 Ga0157370_10039127
1405 Ga0157370_10072372
1406 Ga0157370_10261795
1407 Ga0157370_10358507
1408 Ga0157370_11888346
1409 Ga0157369_10009859
1410 Ga0157369_10015697
1411 Ga0157369_10178167
1412 Ga0157369_10306347
1413 Ga0157369_10446533
1414 Ga0157369_11018033
1415 Ga0157369_11199167
1416 Ga0157374_10082348
1417 Ga0157374_11030678
1418 Ga0157374_11108913
1419 Ga0157374_11732881
1420 Ga0157378_10661121
1421 Ga0157378_11973173
1422 Ga0163162_10173276
1423 Ga0163162_10534838
1424 Ga0157372_10128579
1425 Ga0157372_10239221
1426 Ga0157372_10764492
1427 Ga0157372_10989565
1428 Ga0157372_11043224
1429 Ga0157372_11546062
1430 Ga0157372_11741578
1431 Ga0157372_13443072
1432 Ga0157375_10014213
1433 Ga0157375_10347581
1434 Ga0157375_11099479
1435 Ga0157375_11474049
1436 Ga0157375_12436965
1437 Ga0163163_10004668
1438 Ga0163163_10650842
1439 Ga0163163_11109423
1440 Ga0163163_11250715
1441 Ga0163163_11511167
1442 Ga0163163_12281737
1443 Ga0157380_10070525
1444 Ga0157380_10553982
1445 Ga0157380_11584968
1446 Ga0157380_13229326
1447 Ga0182008_10081757
1448 Ga0182008_10718816
1449 Ga0182008_10719550
1450 Ga0157377_10246154
1451 Ga0157377_10372572
1452 Ga0157377_11695878
1453 Ga0157379_10652786
1454 Ga0157376_10266547
1455 Ga0157376_10439763
1456 Ga0157376_10802911
1457 Ga0182005_1161971
1458 Ga0206356_10209413
1459 Ga0206356_10501215
1460 Ga0206356_11742300
1461 Ga0206354_10981450
1462 Ga0206354_11201956
1463 Ga0206354_11469124
1464 Ga0206353_10253354
1465 Ga0206353_10492582
1466 Ga0206353_10783374
1467 Ga0206353_11459877
1468 Ga0206353_11534795
1469 Ga0206353_11591169
1470 Ga0206353_11725212
1471 Ga0206353_11802624
1472 Ga0206353_11968226
1473 Ga0206353_12029088
1474 Ga0154015_1217639
1475 Ga0213876_10556986
1476 Ga0207697_10542877
1477 Ga0207656_10180310
1478 Ga0207713_1073728
1479 Ga0207692_10052395
1480 Ga0207688_10015915
1481 Ga0207688_10145162
1482 Ga0207688_10201689
1483 Ga0207688_10427961
1484 Ga0207688_10705121
1485 Ga0207680_10979493
1486 Ga0207647_10003439
1487 Ga0207647_10007825
1488 Ga0207647_10456002
1489 Ga0207699_10262042
1490 Ga0207643_10003225
1491 Ga0207705_10082222
1492 Ga0207705_10142563
1493 Ga0207705_10250644
1494 Ga0207705_11188351
1495 Ga0207654_10019979
1496 Ga0207654_10333340
1497 Ga0207707_10059649
1498 Ga0207707_10075744
1499 Ga0207707_10299266
1500 Ga0207695_10006918
1501 Ga0207695_10126089
1502 Ga0207695_10322160
1503 Ga0207695_10357340
1504 Ga0207671_10000180
1505 Ga0207671_10023522
1506 Ga0207671_10837421
1507 Ga0207693_10180146
1508 Ga0207663_10081950
1509 Ga0207660_10070880
1510 Ga0207660_10161250
1511 Ga0207660_10834357
1512 Ga0207660_11006279
1513 Ga0207660_11133789
1514 Ga0207662_10338468
1515 Ga0207662_10604825
1516 Ga0207657_10049534
1517 Ga0207657_10065642
1518 Ga0207657_10150929
1519 Ga0207657_10174857
1520 Ga0207657_10382852
1521 Ga0207657_11036645
1522 Ga0207649_10017149
1523 Ga0207649_10154832
1524 Ga0207649_10223741
1525 Ga0207649_10360486
1526 Ga0207649_10634695
1527 Ga0207652_10053079
1528 Ga0207652_10086777
1529 Ga0207652_10102311
1530 Ga0207652_10113935
1531 Ga0207652_10120269
1532 Ga0207652_10198842
1533 Ga0207652_10206884
1534 Ga0207652_10331990
1535 Ga0207652_10564150
1536 Ga0207652_10890200
1537 Ga0207652_11367724
1538 Ga0207681_10259169
1539 Ga0207681_11721101
1540 Ga0207694_10002826
1541 Ga0207694_10316726
1542 Ga0207694_10908707
1543 Ga0207694_11652966
1544 Ga0207650_10184259
1545 Ga0207650_10642530
1546 Ga0207650_10801995
1547 Ga0207659_10021793
1548 Ga0207659_10387051
1549 Ga0207687_10018666
1550 Ga0207687_10038236
1551 Ga0207687_10059898
1552 Ga0207687_10082809
1553 Ga0207687_10213984
1554 Ga0207687_10225087
1555 Ga0207687_11439943
1556 Ga0207700_10286589
1557 Ga0207700_10438529
1558 Ga0207700_10911263
1559 Ga0207664_10066052
1560 Ga0207644_10097942
1561 Ga0207644_10372107
1562 Ga0207690_10096974
1563 Ga0207690_10157898
1564 Ga0207690_10468679
1565 Ga0207706_10030957
1566 Ga0207686_10298069
1567 Ga0207686_10502841
1568 Ga0207709_10106024
1569 Ga0207709_10541841
1570 Ga0207670_10077151
1571 Ga0207669_10139963
1572 Ga0207704_10145443
1573 Ga0207704_10660509
1574 Ga0207704_10719234
1575 Ga0207665_10448483
1576 Ga0207691_10053830
1577 Ga0207691_10187692
1578 Ga0207711_10361905
1579 Ga0207689_10001169
1580 Ga0207689_10028723
1581 Ga0207689_10510330
1582 Ga0207661_10010352
1583 Ga0207661_10034020
1584 Ga0207661_10090655
1585 Ga0207661_10135068
1586 Ga0207661_10144746
1587 Ga0207661_10732502
1588 Ga0207661_10762640
1589 Ga0207661_11113587
1590 Ga0207661_11924815
1591 Ga0207679_10018405
1592 Ga0207667_10012023
1593 Ga0207667_10031551
1594 Ga0207667_10031902
1595 Ga0207667_10379626
1596 Ga0207667_10543525
1597 Ga0207667_12177342
1598 Ga0207651_10378142
1599 Ga0207651_11441025
1600 Ga0207712_10196417
1601 Ga0207712_10197807
1602 Ga0207668_10141015
1603 Ga0207668_10825937
1604 Ga0207668_11079087
1605 Ga0207640_10037320
1606 Ga0207640_11654091
1607 Ga0207640_11695357
1608 Ga0207658_10010475
1609 Ga0207658_11002639
1610 Ga0207658_11104392
1611 Ga0207658_11385531
1612 Ga0207677_10202064
1613 Ga0207677_10262806
1614 Ga0207677_10909833
1615 Ga0207703_10348193
1616 Ga0207678_10009914
1617 Ga0207678_10041641
1618 Ga0207678_10070452
1619 Ga0207678_10189731
1620 Ga0207678_10440558
1621 Ga0207678_11150882
1622 Ga0207708_10105932
1623 Ga0207708_10177530
1624 Ga0207702_10007680
1625 Ga0207702_10026302
1626 Ga0207702_10079290
1627 Ga0207702_10229548
1628 Ga0207702_10235042
1629 Ga0207702_10535553
1630 Ga0207702_10852147
1631 Ga0207641_10038739
1632 Ga0207641_11591223
1633 Ga0207648_10133754
1634 Ga0207648_10146885
1635 Ga0207648_10634377
1636 Ga0207676_10024140
1637 Ga0207676_11641946
1638 Ga0207676_11955346
1639 Ga0207674_10005965
1640 Ga0207674_10125528
1641 Ga0207674_10630045
1642 Ga0207674_10847971
1643 Ga0207674_11180006
1644 Ga0207674_11277990
1645 Ga0207674_11775929
1646 Ga0207675_100128089
1647 Ga0207675_100181403
1648 Ga0207675_100350568
1649 Ga0207683_10016697
1650 Ga0207683_10029609
1651 Ga0207683_10367163
1652 Ga0207683_10497592
1653 Ga0207683_10948406
1654 Ga0207698_10013815
1655 Ga0207698_10019257
1656 Ga0207698_10070478
1657 Ga0207698_10181108
1658 Ga0207698_10400601
1659 Ga0207698_10761554
1660 Ga0207698_10881648
1661 Ga0207698_11088520
1662 Ga0207698_11230140
1663 Ga0207698_11432070
1664 Ga0207698_12743525
1665 Ga0209813_10072119
1666 Ga0207428_10031985
1667 Ga0207428_10179231
1668 Ga0268266_10278026
1669 Ga0268266_10283801
1670 Ga0268266_11326553
1671 Ga0268265_10068694
1672 Ga0268265_10377062
1673 Ga0268264_10142821
1674 Ga0268264_10420309
1675 Ga0265334_10155733
1676 Ga0307517_10247552
1677 Ga0307515_10019377
1678 Ga0307515_10253512
1679 Ga0307515_10467813
1680 Ga0265338_10041533
1681 Ga0265338_10229138
1682 Ga0307512_10208165
1683 Ga0265325_10015736
1684 Ga0265325_10394833
1685 Ga0265340_10011328
1686 Ga0265340_10077734
1687 Ga0265339_10282975
1688 Ga0265331_10120887
1689 Ga0265316_10261411
1690 Ga0307513_10241078
1691 Ga0307513_10459670
1692 Ga0307513_10478690
1693 Ga0307509_10768249
1694 Ga0307408_100238674
1695 Ga0307408_101007471
1696 Ga0307408_101083314
1697 Ga0307408_101230804
1698 Ga0307408_101366575
1699 Ga0307408_102164367
1700 Ga0307408_102299947
1701 Ga0265313_10053609
1702 Ga0307508_10415470
1703 Ga0265314_10659394
1704 Ga0265342_10504977
1705 Ga0316576_10327338
1706 Ga0316578_10032880
1707 Ga0316578_10344951
1708 Ga0307405_10040001
1709 Ga0307405_10105332
1710 Ga0307405_11500786
1711 Ga0316577_10438547
1712 Ga0307413_10018939
1713 Ga0307413_10035726
1714 Ga0307413_10439510
1715 Ga0307413_10458637
1716 Ga0307413_10745155
1717 Ga0307413_10870552
1718 Ga0307413_11295698
1719 Ga0307518_10410108
1720 Ga0307410_10013296
1721 Ga0307410_10130085
1722 Ga0307410_10152421
1723 Ga0307410_10153917
1724 Ga0307410_10201574
1725 Ga0307410_10315805
1726 Ga0307410_10565793
1727 Ga0307410_10786929
1728 Ga0307410_11018117
1729 Ga0307406_10101991
1730 Ga0307406_10119133
1731 Ga0307406_10212181
1732 Ga0307406_10319150
1733 Ga0307406_10360075
1734 Ga0307406_10517458
1735 Ga0307406_11265135
1736 Ga0307406_11991056
1737 Ga0307407_10329707
1738 Ga0307407_10386360
1739 Ga0307407_10525143
1740 Ga0307407_10990279
1741 Ga0307412_10540046
1742 Ga0307412_10739058
1743 Ga0307409_100018170
1744 Ga0307409_100054706
1745 Ga0307409_100093039
1746 Ga0307409_100185867
1747 Ga0307409_100192457
1748 Ga0307409_100214497
1749 Ga0307409_100247420
1750 Ga0307409_100264041
1751 Ga0307409_100297480
1752 Ga0307409_100610573
1753 Ga0307409_100710153
1754 Ga0307409_100824932
1755 Ga0307409_100910673
1756 Ga0307409_102746275
1757 Ga0307409_102845599
1758 Ga0307416_100040268
1759 Ga0307416_100125671
1760 Ga0307416_100157387
1761 Ga0307416_100169193
1762 Ga0307416_100357423
1763 Ga0307416_100363379
1764 Ga0307416_100506247
1765 Ga0307416_100676462
1766 Ga0307416_100732988
1767 Ga0307416_100851845
1768 Ga0307416_101038490
1769 Ga0307416_101704845
1770 Ga0307416_102390921
1771 Ga0307416_103690812
1772 Ga0307414_10069035
1773 Ga0307414_10278549
1774 Ga0307414_10286254
1775 Ga0307414_10346304
1776 Ga0307414_10442287
1777 Ga0307414_10727867
1778 Ga0307411_10059795
1779 Ga0307411_10168475
1780 Ga0307411_10405511
1781 Ga0307411_10719490
1782 Ga0307411_11658777
1783 Ga0307411_11701008
1784 Ga0307411_12015262
1785 Ga0307415_100014020
1786 Ga0307415_100031365
1787 Ga0307415_100031413
1788 Ga0307415_100069802
1789 Ga0307415_100112048
1790 Ga0307415_100384432
1791 Ga0307415_100655157
1792 Ga0307415_101189108
1793 Ga0307415_101316600
1794 Ga0307415_101363641
1795 Ga0307415_101376492
1796 Ga0316574_0097508
1797 Ga0373931_0252597
1798 Ga0373935_0753138
1799 Ga0373947_0539458
1800 Ga0373937_0248938
1801 Ga0316584_0484077
1802 Ga0395899_0132731
1803 Ga0395900_0170120
1804 Ga0395900_0503780
1805 Ga0395900_1055350
1806 Ga0395900_1112404
1807 Ga0395900_1710531
1808 Ga0395898_0106280
1809 Ga0395898_0173523
1810 Ga0395898_0213164
1811 Ga0395898_0743028
1812 Ga0395905_0917547
1813 Ga0395901_0075412
1814 Ga0395901_0092995
1815 Ga0395901_0119980
1816 Ga0395901_0242836
1817 Ga0395901_0270540
1818 Ga0395901_0460571
1819 Ga0395901_0638734
1820 Ga0395901_1800314
1821 Ga0436365_0298596
1822 Ga0436365_0506818
1823 Ga0436365_0556406
1824 Ga0436363_1246746
1825 Ga0436363_1687996
1826 Ga0439465_0135739
1827 Ga0451787_025773
1828 Ga0451789_0555869
1829 Ga0451791_1575760
1830 Ga0451793_1387252
1831 Ga0451797_0104719
1832 Ga0451798_0565100
1833 Ga0451800_1439755
1834 Ga0451802_0337613
1835 Ga0451807_0035181
1836 Ga0451807_1178085
1837 Ga0451835_1002227
1838 Ga0451837_0043710
1839 Ga0451843_0490284
1840 Ga0451853_1642636
1841 Ga0451853_1991345
1842 Ga0451853_2282637
1843 Ga0451853_3845939
1844 Ga0439448_0096658
1845 Ga0439451_020780
1846 Ga0450906_111668
1847 Ga0439435_0170374
1848 Ga0439464_0102498
1849 Ga0439460_0239677
1850 Ga0450901_035297
1851 Ga0451577_0211263
1852 Ga0439440_0059792
1853 Ga0466969_0040030
1854 Ga0466969_0083423
1855 Ga0466969_0408815
1856 Ga0466972_0156389
1857 Ga0466972_0519466
1858 Ga0466965_0156433
1859 Ga0466965_0164631
1860 Ga0466965_0192732
1861 Ga0466965_0366778
1862 Ga0466965_0532577
1863 Ga0466966_0012157
1864 Ga0466966_0031407
1865 Ga0466966_0039724
1866 Ga0466966_0043544
1867 Ga0466966_0083076
1868 Ga0466966_0155547
1869 Ga0466966_0250410
1870 Ga0466966_0557059
1871 Ga0466961_0011001
1872 Ga0466961_0016441
1873 Ga0466961_0023676
1874 Ga0466961_0029792
1875 Ga0466961_0063543
1876 Ga0466961_0242283
1877 Ga0466961_0629025
1878 Ga0466963_0004114
1879 Ga0466963_0005135
1880 Ga0466963_0024251
1881 Ga0466963_0026309
1882 Ga0466963_0029747
1883 Ga0466963_0107800
1884 Ga0466963_0202263
1885 Ga0466963_0271392
1886 Ga0466963_0346630
1887 Ga0466963_0530133
1888 Ga0466963_0811094
1889 Ga0466964_0354488
1890 Ga0466971_0054323
1891 Ga0466971_0090823
1892 Ga0466970_0001419
1893 Ga0466970_0033649
1894 Ga0466970_0034741
1895 Ga0466970_0125453
1896 Ga0466970_0156057
1897 Ga0466970_0446194
1898 Ga0466970_0593083
1899 Ga0466970_0884922
1900 Ga0466957_0015567
1901 Ga0466957_0126797
1902 Ga0466957_0588234
1903 Ga0466957_0684994
1904 Ga0466957_1204995
1905 Ga0466957_1265409
1906 Ga0466960_0083249
1907 Ga0466960_0399971
1908 Ga0466959_0005804
1909 Ga0466959_0089149
1910 Ga0466959_0164425
1911 Ga0466959_0254262
1912 Ga0466959_0277332
1913 Ga0466959_0284090
1914 Ga0466959_1122336
1915 Ga0466958_0009062
1916 Ga0466958_0030710
1917 Ga0466958_0043089
1918 Ga0466958_0054412
1919 Ga0466958_0291098
1920 Ga0466958_0309681
1921 Ga0466958_0312002
1922 Ga0466958_0433527
1923 Ga0466967_0004748
1924 Ga0466967_0055840
1925 Ga0466967_0057734
1926 Ga0466967_0112084
1927 Ga0466967_0128174
1928 Ga0466967_0144209
1929 Ga0466967_0144597
1930 Ga0466967_0303876
1931 Ga0466967_0712248
1932 Ga0466967_0715917
1933 Ga0466967_0731841
1934 Ga0495627_082896
1935 Ga0495629_0142547
1936 Ga0495629_0171186
1937 Ga0495629_0371528
1938 Ga0495629_0574777
1939 Ga0495651_0009236
1940 Ga0495651_0587812
1941 Ga0495582_0155605
1942 Ga0495582_0279728
1943 Ga0495582_0541696
1944 Ga0495582_0826354
1945 Ga0495662_0223513
1946 Ga0495664_0378632
1947 Ga0495664_0700918
1948 Ga0495585_0065269
1949 Ga0495596_0033042
1950 Ga0495608_0068406
1951 Ga0495608_0945458
1952 Ga0495618_0337412
1953 Ga0495628_0649497
1954 Ga0495644_0097810
1955 Ga0495652_0000573
1956 Ga0495652_0082868
1957 Ga0495665_0471396
1958 Ga0495640_0129946
1959 Ga0495586_0117203
1960 Ga0495645_0030803
1961 Ga0495645_0743806
1962 Ga0495622_0048076
1963 Ga0495667_0073771
1964 Ga0495667_0516403
1965 Ga0495667_0901173
1966 Ga0495656_0006406
1967 Ga0495656_0701234
1968 Ga0495635_0226027
1969 Ga0495635_0410470
1970 Ga0495635_0861799
1971 Ga0495588_0707533
1972 Ga0495657_0380075
1973 Ga0495647_0124038
1974 Ga0495647_0310125
1975 Ga0495658_0257741
1976 Ga0495613_0771572
1977 Ga0495670_0408140
1978 Ga0495649_0398922
1979 Ga0495649_0467496
1980 Ga0495600_0024125
1981 Ga0495581_0173834
1982 Ga0495581_0663734
1983 Ga0495581_0805113
1984 Ga0495604_0044539
1985 Ga0495604_0660183
1986 Ga0495674_0141022
1987 Ga0495676_0196797
1988 Ga0495680_0144168
1989 Ga0495675_0016732
1990 Ga0495675_0335208
1991 Ga0495675_0521005
1992 Ga0495593_0315469
1993 Ga0495593_0432896
1994 Ga0495593_0586240
1995 Ga0495614_0120449
1996 Ga0495615_0101098
1997 Ga0495615_0201013
1998 Ga0496100_0080531
1999 Ga0496100_0344712
2000 Ga0496100_0476819
2001 Ga0496100_1408036
2002 Ga0496101_0036573
2003 Ga0496101_0115818
2004 Ga0496101_0299731
2005 Ga0496102_0000735
2006 Ga0496102_0006399
2007 Ga0496102_0022781
2008 Ga0496102_0227878
2009 Ga0496102_0419078
2010 Ga0496102_0597183
2011 Ga0496103_0005567
2012 Ga0496103_0255400
2013 Ga0496103_0822650
2014 Ga0496104_0001342
2015 Ga0496104_0040359
2016 Ga0496104_0085266
2017 Ga0496104_0247315
2018 Ga0496104_0308384
2019 Ga0496104_0347137
2020 Ga0496104_0418393
2021 Ga0496104_0466748
2022 Ga0496104_0974916
2023 Ga0496105_0016468
2024 Ga0496105_0036384
2025 Ga0496105_0136573
2026 Ga0496105_0178579
2027 Ga0496105_0217889
2028 Ga0496105_0261919
2029 Ga0496105_0499261
2030 Ga0496105_0504088
2031 Ga0496106_0127850
2032 Ga0496106_0166110
2033 Ga0496106_0608738
2034 Ga0496106_1288219
2035 Ga0496107_0034677
2036 Ga0496107_0520285
2037 Ga0496108_0000623
2038 Ga0496108_0023913
2039 Ga0496108_0061325
2040 Ga0496108_0112912
2041 Ga0496108_0311335
2042 Ga0496108_0479193
2043 Ga0496108_0585941
2044 Ga0496108_1152676
2045 Ga0496108_1515624
2046 Ga0496108_1542225
2047 Ga0496109_0009375
2048 Ga0496109_0017787
2049 Ga0496109_0089327
2050 Ga0496109_0212317
2051 Ga0496109_0213703
2052 Ga0496109_0266325
2053 Ga0496109_0392717
2054 Ga0496109_0525856
2055 Ga0496109_1063750
2056 Ga0496109_1531082
2057 Ga0496110_0004825
2058 Ga0496110_0216055
2059 Ga0496110_0385276
2060 Ga0496110_0467113
2061 Ga0496110_0471796
2062 Ga0496110_0585706
2063 Ga0496110_0840100
2064 Ga0496111_0000994
2065 Ga0496111_0007779
2066 Ga0496111_0037201
2067 Ga0496111_0317855
2068 Ga0496111_0473304
2069 Ga0496112_0112173
2070 Ga0496112_1440413
2071 Ga0496113_0014312
2072 Ga0496113_0024900
2073 Ga0496113_0039753
2074 Ga0496113_0043090
2075 Ga0496113_0106550
2076 Ga0496113_0120854
2077 Ga0496113_0249722
2078 Ga0496113_0630253
2079 Ga0496114_0001130
2080 Ga0496114_0001454
2081 Ga0496114_0007721
2082 Ga0496114_0096811
2083 Ga0496114_0119071
2084 Ga0496114_0136307
2085 Ga0496114_0193852
2086 Ga0496114_0264001
2087 Ga0496114_0274326
2088 Ga0496114_0286998
2089 Ga0496114_0288898
2090 Ga0496114_0446478
2091 Ga0496114_1730512
2092 Ga0496115_0012178
2093 Ga0496115_0078974
2094 Ga0496115_0216321
2095 Ga0496115_0532938
2096 Ga0496115_1194829
2097 Ga0496119_0000960
2098 Ga0496120_0001834
2099 Ga0496123_0053390
2100 Ga0496124_0189176
2101 Ga0496124_0318532
2102 Ga0496124_0433443
2103 Ga0496126_0000006
2104 Ga0496126_0021047
2105 Ga0496126_0068404
2106 Ga0496126_0330995
2107 Ga0501317_110782
2108 Ga0501031_0010365
2109 Ga0501031_0013183
2110 Ga0501032_0160508
2111 Ga0501032_0217545
2112 Ga0501033_0036579
2113 Ga0501034_0278084
2114 Ga0501034_0935879
2115 Ga0501036_0024649
2116 Ga0501036_0089146
2117 Ga0501036_0177974
2118 Ga0501036_1453889
2119 Ga0501037_0031898
2120 Ga0501037_0055236
2121 Ga0501038_0192810
2122 Ga0501038_1044228
2123 Ga0501038_1367958
2124 Ga0501039_0065326
2125 Ga0501039_0079105
2126 Ga0501039_0415808
2127 Ga0501039_0552261
2128 Ga0501040_0015306
2129 Ga0501040_0090626
2130 Ga0501040_0299958
2131 Ga0501040_0329770
2132 Ga0501040_0614167
2133 Ga0501041_0004209
2134 Ga0501041_0017796
2135 Ga0501041_0557763
2136 Ga0501042_0008853
2137 Ga0501042_0029797
2138 Ga0501043_0014686
2139 Ga0501043_0153115
2140 Ga0501046_0042248
2141 Ga0501046_0249867
2142 Ga0501047_0011090
2143 Ga0501047_0344857
2144 Ga0501048_0013342
2145 Ga0501048_0033546
2146 Ga0501048_0130640
2147 Ga0501048_1042579
2148 Ga0501067_0507024
2149 Ga0501068_0078828
2150 Ga0501068_0080808
2151 Ga0501069_0915709
2152 Ga0501070_0056403
2153 Ga0501070_0201135
2154 Ga0501070_0505796
2155 Ga0501071_0002813
2156 Ga0501071_0241329
2157 Ga0501072_0032716
2158 Ga0501072_0044417
2159 Ga0501073_0102156
2160 Ga0501073_0425269
2161 Ga0501074_0023291
2162 Ga0501074_0133737
2163 Ga0501075_0041137
2164 Ga0501076_0010496
2165 Ga0501076_0047264
2166 Ga0501077_0030486
2167 Ga0501246_037638
2168 Ga0501079_0006491
2169 Ga0501079_0218932
2170 Ga0501079_0549205
2171 Ga0501079_0907294
2172 Ga0501080_0167369
2173 Ga0501080_0186037
2174 Ga0501080_0359058
2175 Ga0501081_0028633
2176 Ga0501081_0085638
2177 Ga0501083_0980208
2178 Ga0501035_0023004
2179 Ga0501035_0266683
2180 Ga0501035_0536331
2181 Ga0501035_0607211
2182 Ga0501044_0073543
2183 Ga0501044_0305055
2184 Ga0501044_0414233
2185 Ga0501044_0420241
2186 Ga0501044_0437578
2187 Ga0501045_0044674
2188 Ga0501045_0261705
2189 Ga0501045_0715127
2190 nmdc:mga00v17_3307_c1
2191 nmdc:mga00v17_335263_c1
2192 nmdc:mga0yw44_481290_c1
2193 nmdc:mga0yw44_80957_c1
2194 nmdc:mga0yw44_990912_c1
2195 nmdc:mga06z11_350563_c1
2196 nmdc:mga04h51_26732_c1
2197 nmdc:mga07m45_152065_c1
2198 nmdc:mga05p37_1586837_c1
2199 nmdc:mga05p37_1821172_c1
2200 nmdc:mga05p37_280242_c1
2201 nmdc:mga09592_173844_c1
2202 nmdc:mga09592_423676_c1
2203 nmdc:mga09592_76003_c1
2204 nmdc:mga06r32_274024_c1
2205 nmdc:mga06r32_31347_c1
2206 nmdc:mga08y16_139434_c1
2207 nmdc:mga08y16_66404_c1
2208 nmdc:mga0rr50_198003_c1
2209 nmdc:mga08x19_40413_c1
2210 Ga0495601_0044939
2211 Ga0495601_0633460
2212 Ga0495612_0000712
2213 Ga0495612_0306470
2214 Ga0495595_0010962
2215 Ga0500646_0046481
2216 Ga0500641_0003416
2217 Ga0500573_0107851
2218 Ga0501084_0020842
2219 Ga0501084_0068010
2220 Ga0501084_1563800
2221 Ga0501084_1822667
2222 Ga0501082_0021928
2223 Ga0501082_0165241
2224 Ga0501082_1518814
2225 Ga0466962_0013525
2226 Ga0466962_0117939
2227 Ga0466962_0130751
2228 Ga0466962_0148664
2229 Ga0466962_0194975
2230 Ga0530510_0059511
2231 Ga0530510_0063017
2232 Ga0530510_0500685
2233 2515850971
2234 2643849942
2235 2644016261
2236 2644135944
2237 2644178517
2238 2644444956
2239 2644456973
2240 2644537504
2241 2644609735
2242 2645719723
2243 2645726611
2244 2676476704
2245 2738695726
2246 2739326133
2247 2739605025
2248 2740168864
2249 2760308031
2250 2760623346
2251 2768643831
2252 2784472109
2253 2808874208
2254 2809028234
2255 2812374894
2256 2816425549
2257 2819427635
2258 2819666491
2259 2819691651
2260 2819729569
2261 2819744007
2262 2827630207
2263 2837273376
2264 2848552434
2265 2861524022
2266 2867346707
2267 2868093206
2268 2887444104
2269 2984594851
2270 2995468048
2271 3001891415
2272 8053952833
2273 8054611329
2274 8057572493

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06947

DUF1290

Protein of unknown function (DUF1290)

28

115

0.99

Map