F490643
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1137 | 424 | 2274 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300014968|Ga0157379_11528154|Ga0157379_115281541 |
| Length | 117 |
| Sequence | MSAKGDHVYAALALVVGIVAGVFLAPTVPDWLAPYLPIAVVAALDAVFGGLRAKLDAVFDAKVFVVSFVANVLVAAFIVFLGDQLGVGSQLSTAVVVVLGIRIFGNAAAIRRHIFKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 188 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 189 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 191 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 192 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 193 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 201 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 204 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 207 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 208 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 209 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 210 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 211 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 216 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 217 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 218 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 224 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 225 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 226 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 227 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 228 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 231 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 232 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 242 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 243 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 244 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 245 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 246 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 247 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 248 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 249 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 250 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 251 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 252 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 253 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 254 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 255 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 256 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 257 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 258 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 259 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 260 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 261 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 262 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 263 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 264 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 265 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 266 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 267 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 268 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 309 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 310 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 311 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 312 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 313 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 314 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 317 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 318 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 319 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 320 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 321 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 322 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 323 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 324 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 325 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 326 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 327 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 355 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 363 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 364 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 365 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 366 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 377 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 378 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 379 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 382 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 383 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 384 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 385 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 386 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 387 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 388 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 389 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 390 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 391 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 392 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 393 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 394 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 395 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 396 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 397 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 398 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 399 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 400 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 401 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 402 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 403 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 404 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 405 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 406 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 407 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 408 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 409 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 410 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 411 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 412 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 413 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 414 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 415 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 416 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 417 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 418 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 419 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 420 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 421 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 422 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 423 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 424 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.72 |
| Metatranscriptomes | 1.58 |
| Isolates | 3.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.09 |
| Bulb | 0 |
| Endosphere | 1.41 |
| Nodule | 0.09 |
| Rhizoplane | 9.59 |
| Rhizosphere | 83.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157379_11528154 | 3300014968 | Bacteria | 650 |
| 2 | JGI24739J22299_10001443 | 3300001989 | Bacteria | 8960 |
| 3 | JGI24737J22298_10003330 | 3300001990 | Bacteria | 5685 |
| 4 | JGI24735J21928_10009578 | 3300002067 | Bacteria | 3106 |
| 5 | JGI24735J21928_10011363 | 3300002067 | Bacteria | 2826 |
| 6 | Ga0070658_10001601 | 3300005327 | Bacteria | 19133 |
| 7 | Ga0070658_10125694 | 3300005327 | Bacteria | 2134 |
| 8 | Ga0070658_10209150 | 3300005327 | Bacteria | 1648 |
| 9 | Ga0070658_10591516 | 3300005327 | Bacteria | 961 |
| 10 | Ga0070658_11032762 | 3300005327 | Bacteria | 715 |
| 11 | Ga0070676_10313847 | 3300005328 | Bacteria | 1067 |
| 12 | Ga0070683_100019031 | 3300005329 | Bacteria | 6092 |
| 13 | Ga0070683_100783184 | 3300005329 | Bacteria | 914 |
| 14 | Ga0070683_101907861 | 3300005329 | Bacteria | 571 |
| 15 | Ga0068869_100019690 | 3300005334 | Bacteria | 4617 |
| 16 | Ga0068869_100021777 | 3300005334 | Bacteria | 4412 |
| 17 | Ga0068869_100252513 | 3300005334 | Bacteria | 1409 |
| 18 | Ga0070666_10820237 | 3300005335 | Bacteria | 686 |
| 19 | Ga0070680_100297660 | 3300005336 | Bacteria | 1368 |
| 20 | Ga0070680_100455600 | 3300005336 | Bacteria | 1093 |
| 21 | Ga0070682_100002949 | 3300005337 | Bacteria | 9444 |
| 22 | Ga0070682_100084461 | 3300005337 | Bacteria | 2063 |
| 23 | Ga0070682_100097643 | 3300005337 | Bacteria | 1934 |
| 24 | Ga0070682_100184742 | 3300005337 | Bacteria | 1459 |
| 25 | Ga0070682_100238937 | 3300005337 | Bacteria | 1303 |
| 26 | Ga0070682_100397855 | 3300005337 | Bacteria | 1041 |
| 27 | Ga0070682_100461715 | 3300005337 | Bacteria | 975 |
| 28 | Ga0068868_100071671 | 3300005338 | Bacteria | 2763 |
| 29 | Ga0068868_100136027 | 3300005338 | Bacteria | 2014 |
| 30 | Ga0068868_100316393 | 3300005338 | Bacteria | 1329 |
| 31 | Ga0070660_100042696 | 3300005339 | Bacteria | 3462 |
| 32 | Ga0070660_100070805 | 3300005339 | Bacteria | 2722 |
| 33 | Ga0070660_100190976 | 3300005339 | Bacteria | 1659 |
| 34 | Ga0070660_100464013 | 3300005339 | Bacteria | 1051 |
| 35 | Ga0070660_100559722 | 3300005339 | Bacteria | 954 |
| 36 | Ga0070660_101050179 | 3300005339 | Bacteria | 689 |
| 37 | Ga0070689_100262178 | 3300005340 | Bacteria | 1429 |
| 38 | Ga0070691_10026973 | 3300005341 | Bacteria | 2679 |
| 39 | Ga0070687_100360263 | 3300005343 | Bacteria | 941 |
| 40 | Ga0070661_100040415 | 3300005344 | Bacteria | 3403 |
| 41 | Ga0070661_100337481 | 3300005344 | Bacteria | 1180 |
| 42 | Ga0070661_100365911 | 3300005344 | Bacteria | 1134 |
| 43 | Ga0070692_10067349 | 3300005345 | Bacteria | 1900 |
| 44 | Ga0070668_100490754 | 3300005347 | Bacteria | 1062 |
| 45 | Ga0070668_101129817 | 3300005347 | Bacteria | 708 |
| 46 | Ga0070669_101335821 | 3300005353 | Bacteria | 621 |
| 47 | Ga0070675_100008017 | 3300005354 | Bacteria | 8187 |
| 48 | Ga0070675_100140176 | 3300005354 | Bacteria | 2066 |
| 49 | Ga0070671_100007289 | 3300005355 | Bacteria | 8836 |
| 50 | Ga0070671_100239491 | 3300005355 | Bacteria | 1540 |
| 51 | Ga0070674_101767634 | 3300005356 | Bacteria | 560 |
| 52 | Ga0070673_101108492 | 3300005364 | Bacteria | 740 |
| 53 | Ga0070659_100032558 | 3300005366 | Bacteria | 4044 |
| 54 | Ga0070659_100165481 | 3300005366 | Bacteria | 1809 |
| 55 | Ga0070659_102106941 | 3300005366 | Bacteria | 507 |
| 56 | Ga0070667_100005054 | 3300005367 | Bacteria | 11038 |
| 57 | Ga0070667_100160228 | 3300005367 | Bacteria | 1981 |
| 58 | Ga0070667_100386081 | 3300005367 | Bacteria | 1273 |
| 59 | Ga0070667_101207403 | 3300005367 | Bacteria | 708 |
| 60 | Ga0070667_101284042 | 3300005367 | Bacteria | 686 |
| 61 | Ga0070709_10184285 | 3300005434 | Bacteria | 1468 |
| 62 | Ga0070709_11057250 | 3300005434 | Bacteria | 648 |
| 63 | Ga0070714_100089379 | 3300005435 | Bacteria | 2697 |
| 64 | Ga0070714_101085171 | 3300005435 | Bacteria | 780 |
| 65 | Ga0070714_102502361 | 3300005435 | Bacteria | 501 |
| 66 | Ga0070713_100154115 | 3300005436 | Bacteria | 2046 |
| 67 | Ga0070713_100190537 | 3300005436 | Bacteria | 1847 |
| 68 | Ga0070713_100367948 | 3300005436 | Bacteria | 1337 |
| 69 | Ga0070711_100078358 | 3300005439 | Bacteria | 2347 |
| 70 | Ga0070705_100781488 | 3300005440 | Bacteria | 758 |
| 71 | Ga0070705_100992239 | 3300005440 | Bacteria | 681 |
| 72 | Ga0070700_100121130 | 3300005441 | Bacteria | 1753 |
| 73 | Ga0070694_101307458 | 3300005444 | Bacteria | 610 |
| 74 | Ga0070708_100406394 | 3300005445 | Bacteria | 1284 |
| 75 | Ga0070663_100021165 | 3300005455 | Bacteria | 4321 |
| 76 | Ga0070663_100108306 | 3300005455 | Bacteria | 2084 |
| 77 | Ga0070663_100229462 | 3300005455 | Bacteria | 1461 |
| 78 | Ga0070663_100972189 | 3300005455 | Bacteria | 737 |
| 79 | Ga0070663_101026599 | 3300005455 | Bacteria | 718 |
| 80 | Ga0070663_101342589 | 3300005455 | Bacteria | 632 |
| 81 | Ga0070678_100044533 | 3300005456 | Bacteria | 3169 |
| 82 | Ga0070678_100152020 | 3300005456 | Bacteria | 1865 |
| 83 | Ga0070678_100162050 | 3300005456 | Bacteria | 1813 |
| 84 | Ga0070678_100484373 | 3300005456 | Bacteria | 1089 |
| 85 | Ga0070681_10090018 | 3300005458 | Bacteria | 3019 |
| 86 | Ga0070681_10509695 | 3300005458 | Bacteria | 1116 |
| 87 | Ga0070681_10716185 | 3300005458 | Bacteria | 917 |
| 88 | Ga0070681_11190307 | 3300005458 | Bacteria | 684 |
| 89 | Ga0068867_100639366 | 3300005459 | Bacteria | 932 |
| 90 | Ga0068867_101167260 | 3300005459 | Bacteria | 706 |
| 91 | Ga0068867_101304416 | 3300005459 | Bacteria | 670 |
| 92 | Ga0070685_10095132 | 3300005466 | Bacteria | 1810 |
| 93 | Ga0070685_10278328 | 3300005466 | Bacteria | 1119 |
| 94 | Ga0070685_10411610 | 3300005466 | Bacteria | 939 |
| 95 | Ga0070698_100021155 | 3300005471 | Bacteria | 6816 |
| 96 | Ga0070679_100040469 | 3300005530 | Bacteria | 4636 |
| 97 | Ga0070679_100090535 | 3300005530 | Bacteria | 3048 |
| 98 | Ga0070679_100125162 | 3300005530 | Bacteria | 2553 |
| 99 | Ga0070679_100146167 | 3300005530 | Bacteria | 2342 |
| 100 | Ga0070679_100163926 | 3300005530 | Bacteria | 2197 |
| 101 | Ga0070679_100250505 | 3300005530 | Bacteria | 1727 |
| 102 | Ga0070679_101023735 | 3300005530 | Bacteria | 770 |
| 103 | Ga0070679_102171253 | 3300005530 | Bacteria | 505 |
| 104 | Ga0070684_100042712 | 3300005535 | Bacteria | 3915 |
| 105 | Ga0070684_100209746 | 3300005535 | Bacteria | 1775 |
| 106 | Ga0070684_100331418 | 3300005535 | Bacteria | 1399 |
| 107 | Ga0070684_101470602 | 3300005535 | Bacteria | 642 |
| 108 | Ga0068853_100825043 | 3300005539 | Bacteria | 889 |
| 109 | Ga0070672_100224674 | 3300005543 | Bacteria | 1576 |
| 110 | Ga0070672_101111607 | 3300005543 | Bacteria | 702 |
| 111 | Ga0070696_100000806 | 3300005546 | Bacteria | 20145 |
| 112 | Ga0070693_100013235 | 3300005547 | Bacteria | 4198 |
| 113 | Ga0070693_100538221 | 3300005547 | Bacteria | 834 |
| 114 | Ga0070665_100116357 | 3300005548 | Bacteria | 2676 |
| 115 | Ga0070665_100225627 | 3300005548 | Bacteria | 1874 |
| 116 | Ga0070665_100321707 | 3300005548 | Bacteria | 1551 |
| 117 | Ga0070665_101376803 | 3300005548 | Bacteria | 715 |
| 118 | Ga0068855_100007335 | 3300005563 | Bacteria | 13361 |
| 119 | Ga0068855_100010193 | 3300005563 | Bacteria | 11327 |
| 120 | Ga0068855_100015148 | 3300005563 | Bacteria | 9285 |
| 121 | Ga0068855_100452505 | 3300005563 | Bacteria | 1401 |
| 122 | Ga0068855_101138635 | 3300005563 | Bacteria | 814 |
| 123 | Ga0070664_100011912 | 3300005564 | Bacteria | 7058 |
| 124 | Ga0068857_100005416 | 3300005577 | Bacteria | 10883 |
| 125 | Ga0068857_100157945 | 3300005577 | Bacteria | 2056 |
| 126 | Ga0068857_100173664 | 3300005577 | Bacteria | 1960 |
| 127 | Ga0068857_101089946 | 3300005577 | Bacteria | 771 |
| 128 | Ga0068857_101167492 | 3300005577 | Bacteria | 745 |
| 129 | Ga0068857_101622158 | 3300005577 | Bacteria | 632 |
| 130 | Ga0068857_102032374 | 3300005577 | Bacteria | 564 |
| 131 | Ga0068857_102081522 | 3300005577 | Bacteria | 557 |
| 132 | Ga0068854_100003155 | 3300005578 | Bacteria | 10274 |
| 133 | Ga0068854_100043523 | 3300005578 | Bacteria | 3183 |
| 134 | Ga0068854_100071621 | 3300005578 | Bacteria | 2536 |
| 135 | Ga0068856_100006438 | 3300005614 | Bacteria | 11518 |
| 136 | Ga0068856_100006679 | 3300005614 | Bacteria | 11310 |
| 137 | Ga0068856_100279725 | 3300005614 | Bacteria | 1685 |
| 138 | Ga0068856_100564124 | 3300005614 | Bacteria | 1160 |
| 139 | Ga0068856_100785714 | 3300005614 | Bacteria | 972 |
| 140 | Ga0068856_101786920 | 3300005614 | Bacteria | 626 |
| 141 | Ga0068856_102133884 | 3300005614 | Bacteria | 570 |
| 142 | Ga0070702_100012306 | 3300005615 | Bacteria | 4282 |
| 143 | Ga0070702_100329551 | 3300005615 | Bacteria | 1067 |
| 144 | Ga0070702_100971982 | 3300005615 | Bacteria | 670 |
| 145 | Ga0068852_100007296 | 3300005616 | Bacteria | 8060 |
| 146 | Ga0068852_100020286 | 3300005616 | Bacteria | 5283 |
| 147 | Ga0068852_100020773 | 3300005616 | Bacteria | 5225 |
| 148 | Ga0068852_100165344 | 3300005616 | Bacteria | 2070 |
| 149 | Ga0068852_100179670 | 3300005616 | Bacteria | 1989 |
| 150 | Ga0068852_100407354 | 3300005616 | Bacteria | 1339 |
| 151 | Ga0068852_100473701 | 3300005616 | Bacteria | 1243 |
| 152 | Ga0068859_100822423 | 3300005617 | Bacteria | 1016 |
| 153 | Ga0068859_102976817 | 3300005617 | Bacteria | 518 |
| 154 | Ga0068864_100142385 | 3300005618 | Bacteria | 2164 |
| 155 | Ga0068864_101204057 | 3300005618 | Bacteria | 756 |
| 156 | Ga0068864_102381441 | 3300005618 | Bacteria | 536 |
| 157 | Ga0068866_10326054 | 3300005718 | Bacteria | 968 |
| 158 | Ga0068861_100257648 | 3300005719 | Bacteria | 1492 |
| 159 | Ga0068861_101219375 | 3300005719 | Bacteria | 728 |
| 160 | Ga0068851_10063443 | 3300005834 | Bacteria | 1897 |
| 161 | Ga0068870_10189964 | 3300005840 | Bacteria | 1238 |
| 162 | Ga0068870_10461514 | 3300005840 | Bacteria | 839 |
| 163 | Ga0068870_10968923 | 3300005840 | Bacteria | 605 |
| 164 | Ga0068863_100056422 | 3300005841 | Bacteria | 3718 |
| 165 | Ga0068863_101854429 | 3300005841 | Bacteria | 613 |
| 166 | Ga0068858_100853796 | 3300005842 | Bacteria | 889 |
| 167 | Ga0068860_100623066 | 3300005843 | Bacteria | 1085 |
| 168 | Ga0068862_100098112 | 3300005844 | Bacteria | 2559 |
| 169 | Ga0081455_10001727 | 3300005937 | Bacteria | 26458 |
| 170 | Ga0081455_10167140 | 3300005937 | Bacteria | 1679 |
| 171 | Ga0081538_10082192 | 3300005981 | Bacteria | 1709 |
| 172 | Ga0081540_1002115 | 3300005983 | Bacteria | 16543 |
| 173 | Ga0070717_10649064 | 3300006028 | Bacteria | 958 |
| 174 | Ga0075364_10026964 | 3300006051 | Bacteria | 3668 |
| 175 | Ga0075364_10356039 | 3300006051 | Bacteria | 998 |
| 176 | Ga0075432_10094974 | 3300006058 | Bacteria | 1096 |
| 177 | Ga0070716_100608797 | 3300006173 | Bacteria | 823 |
| 178 | Ga0070712_100446642 | 3300006175 | Bacteria | 1076 |
| 179 | Ga0075367_10061989 | 3300006178 | Bacteria | 2233 |
| 180 | Ga0097621_100053144 | 3300006237 | Bacteria | 3301 |
| 181 | Ga0097621_100515165 | 3300006237 | Bacteria | 1085 |
| 182 | Ga0075370_10151543 | 3300006353 | Bacteria | 1359 |
| 183 | Ga0068871_100669454 | 3300006358 | Bacteria | 949 |
| 184 | Ga0068871_101318981 | 3300006358 | Bacteria | 679 |
| 185 | Ga0075428_100316264 | 3300006844 | Bacteria | 1678 |
| 186 | Ga0075428_100620098 | 3300006844 | Bacteria | 1155 |
| 187 | Ga0075431_100038052 | 3300006847 | Bacteria | 4953 |
| 188 | Ga0075431_100302451 | 3300006847 | Bacteria | 1616 |
| 189 | Ga0075433_10039113 | 3300006852 | Bacteria | 4100 |
| 190 | Ga0075434_100053152 | 3300006871 | Bacteria | 4025 |
| 191 | Ga0075429_100262225 | 3300006880 | Bacteria | 1513 |
| 192 | Ga0075429_100568355 | 3300006880 | Bacteria | 994 |
| 193 | Ga0068865_100178180 | 3300006881 | Bacteria | 1635 |
| 194 | Ga0068865_100255956 | 3300006881 | Bacteria | 1384 |
| 195 | Ga0068865_100565500 | 3300006881 | Bacteria | 957 |
| 196 | Ga0068865_100964786 | 3300006881 | Bacteria | 745 |
| 197 | Ga0068865_101639088 | 3300006881 | Bacteria | 579 |
| 198 | Ga0075436_100015576 | 3300006914 | Bacteria | 5205 |
| 199 | Ga0097620_100822456 | 3300006931 | Bacteria | 1016 |
| 200 | Ga0097620_102977056 | 3300006931 | Bacteria | 518 |
| 201 | Ga0075435_100065337 | 3300007076 | Bacteria | 2957 |
| 202 | Ga0105251_10008521 | 3300009011 | Bacteria | 6155 |
| 203 | Ga0105240_10001975 | 3300009093 | Bacteria | 33909 |
| 204 | Ga0105240_10103546 | 3300009093 | Bacteria | 3458 |
| 205 | Ga0105240_10706406 | 3300009093 | Bacteria | 1100 |
| 206 | Ga0105240_12158498 | 3300009093 | Bacteria | 578 |
| 207 | Ga0111539_10005317 | 3300009094 | Bacteria | 16662 |
| 208 | Ga0105245_10007924 | 3300009098 | Bacteria | 9290 |
| 209 | Ga0105245_10015300 | 3300009098 | Bacteria | 6686 |
| 210 | Ga0105245_10048638 | 3300009098 | Bacteria | 3794 |
| 211 | Ga0105245_10118385 | 3300009098 | Bacteria | 2472 |
| 212 | Ga0105245_10257512 | 3300009098 | Bacteria | 1697 |
| 213 | Ga0105245_10459862 | 3300009098 | Bacteria | 1283 |
| 214 | Ga0105245_11777552 | 3300009098 | Bacteria | 669 |
| 215 | Ga0105245_11866144 | 3300009098 | Bacteria | 654 |
| 216 | Ga0105247_10012565 | 3300009101 | Bacteria | 5086 |
| 217 | Ga0105247_10284918 | 3300009101 | Bacteria | 1141 |
| 218 | Ga0105247_10782195 | 3300009101 | Bacteria | 726 |
| 219 | Ga0114129_10191137 | 3300009147 | Bacteria | 2780 |
| 220 | Ga0114129_11207550 | 3300009147 | Bacteria | 942 |
| 221 | Ga0114129_12743898 | 3300009147 | Bacteria | 586 |
| 222 | Ga0105243_10053489 | 3300009148 | Bacteria | 3203 |
| 223 | Ga0105243_10373417 | 3300009148 | Bacteria | 1316 |
| 224 | Ga0105243_10650266 | 3300009148 | Bacteria | 1022 |
| 225 | Ga0105241_10002330 | 3300009174 | Bacteria | 14264 |
| 226 | Ga0105241_10074240 | 3300009174 | Bacteria | 2648 |
| 227 | Ga0105241_10891824 | 3300009174 | Bacteria | 825 |
| 228 | Ga0105241_12269391 | 3300009174 | Bacteria | 539 |
| 229 | Ga0105242_10124878 | 3300009176 | Bacteria | 2214 |
| 230 | Ga0105242_10171122 | 3300009176 | Bacteria | 1909 |
| 231 | Ga0105242_10635168 | 3300009176 | Bacteria | 1036 |
| 232 | Ga0105248_10247850 | 3300009177 | Bacteria | 2005 |
| 233 | Ga0105248_10497255 | 3300009177 | Bacteria | 1375 |
| 234 | Ga0105237_10039938 | 3300009545 | Bacteria | 4734 |
| 235 | Ga0105237_10142330 | 3300009545 | Bacteria | 2393 |
| 236 | Ga0105237_10163149 | 3300009545 | Bacteria | 2227 |
| 237 | Ga0105237_10549891 | 3300009545 | Bacteria | 1161 |
| 238 | Ga0105237_11598374 | 3300009545 | Bacteria | 659 |
| 239 | Ga0105237_11992237 | 3300009545 | Bacteria | 589 |
| 240 | Ga0105238_10004764 | 3300009551 | Bacteria | 13423 |
| 241 | Ga0105238_10037828 | 3300009551 | Bacteria | 4903 |
| 242 | Ga0105238_10168513 | 3300009551 | Bacteria | 2166 |
| 243 | Ga0105238_10324931 | 3300009551 | Bacteria | 1525 |
| 244 | Ga0105238_11310689 | 3300009551 | Bacteria | 750 |
| 245 | Ga0105249_10376537 | 3300009553 | Bacteria | 1445 |
| 246 | Ga0105249_11270671 | 3300009553 | Bacteria | 807 |
| 247 | Ga0105249_11318571 | 3300009553 | Bacteria | 793 |
| 248 | Ga0105239_10027733 | 3300010375 | Bacteria | 6231 |
| 249 | Ga0105239_10072749 | 3300010375 | Bacteria | 3780 |
| 250 | Ga0105239_10086604 | 3300010375 | Bacteria | 3453 |
| 251 | Ga0105239_10112717 | 3300010375 | Bacteria | 3015 |
| 252 | Ga0105239_10226718 | 3300010375 | Bacteria | 2096 |
| 253 | Ga0105239_10314930 | 3300010375 | Bacteria | 1764 |
| 254 | Ga0105239_10630355 | 3300010375 | Bacteria | 1224 |
| 255 | Ga0105239_10741734 | 3300010375 | Bacteria | 1124 |
| 256 | Ga0105239_10791467 | 3300010375 | Bacteria | 1086 |
| 257 | Ga0105239_12367575 | 3300010375 | Bacteria | 618 |
| 258 | Ga0105246_10012689 | 3300011119 | Bacteria | 5265 |
| 259 | Ga0105246_10027239 | 3300011119 | Bacteria | 3743 |
| 260 | Ga0105246_10302952 | 3300011119 | Bacteria | 1291 |
| 261 | Ga0105246_10422348 | 3300011119 | Bacteria | 1113 |
| 262 | Ga0105246_10975287 | 3300011119 | Bacteria | 766 |
| 263 | Ga0105246_11381090 | 3300011119 | Bacteria | 656 |
| 264 | Ga0105246_12585925 | 3300011119 | Bacteria | 501 |
| 265 | Ga0157373_10055852 | 3300013100 | Bacteria | 2804 |
| 266 | Ga0157371_10008106 | 3300013102 | Bacteria | 8394 |
| 267 | Ga0157370_10039127 | 3300013104 | Bacteria | 4583 |
| 268 | Ga0157370_10072372 | 3300013104 | Bacteria | 3253 |
| 269 | Ga0157370_10261795 | 3300013104 | Bacteria | 1598 |
| 270 | Ga0157370_10358507 | 3300013104 | Bacteria | 1344 |
| 271 | Ga0157370_11888346 | 3300013104 | Bacteria | 536 |
| 272 | Ga0157369_10009859 | 3300013105 | Bacteria | 10913 |
| 273 | Ga0157369_10015697 | 3300013105 | Bacteria | 8535 |
| 274 | Ga0157369_10178167 | 3300013105 | Bacteria | 2237 |
| 275 | Ga0157369_10306347 | 3300013105 | Bacteria | 1652 |
| 276 | Ga0157369_10446533 | 3300013105 | Bacteria | 1339 |
| 277 | Ga0157369_11018033 | 3300013105 | Bacteria | 848 |
| 278 | Ga0157369_11199167 | 3300013105 | Bacteria | 775 |
| 279 | Ga0157374_10082348 | 3300013296 | Bacteria | 3055 |
| 280 | Ga0157374_11030678 | 3300013296 | Bacteria | 842 |
| 281 | Ga0157374_11108913 | 3300013296 | Bacteria | 812 |
| 282 | Ga0157374_11732881 | 3300013296 | Bacteria | 650 |
| 283 | Ga0157378_10661121 | 3300013297 | Bacteria | 1061 |
| 284 | Ga0157378_11973173 | 3300013297 | Bacteria | 633 |
| 285 | Ga0163162_10173276 | 3300013306 | Bacteria | 2282 |
| 286 | Ga0163162_10534838 | 3300013306 | Bacteria | 1301 |
| 287 | Ga0157372_10128579 | 3300013307 | Bacteria | 2913 |
| 288 | Ga0157372_10239221 | 3300013307 | Bacteria | 2106 |
| 289 | Ga0157372_10764492 | 3300013307 | Bacteria | 1123 |
| 290 | Ga0157372_10989565 | 3300013307 | Bacteria | 974 |
| 291 | Ga0157372_11043224 | 3300013307 | Bacteria | 946 |
| 292 | Ga0157372_11546062 | 3300013307 | Bacteria | 764 |
| 293 | Ga0157372_11741578 | 3300013307 | Bacteria | 717 |
| 294 | Ga0157372_13443072 | 3300013307 | Bacteria | 503 |
| 295 | Ga0157375_10014213 | 3300013308 | Bacteria | 7096 |
| 296 | Ga0157375_10347581 | 3300013308 | Bacteria | 1649 |
| 297 | Ga0157375_11099479 | 3300013308 | Bacteria | 930 |
| 298 | Ga0157375_11474049 | 3300013308 | Bacteria | 803 |
| 299 | Ga0157375_12436965 | 3300013308 | Bacteria | 625 |
| 300 | Ga0163163_10004668 | 3300014325 | Bacteria | 11717 |
| 301 | Ga0163163_10650842 | 3300014325 | Bacteria | 1117 |
| 302 | Ga0163163_11109423 | 3300014325 | Bacteria | 854 |
| 303 | Ga0163163_11250715 | 3300014325 | Bacteria | 805 |
| 304 | Ga0163163_11511167 | 3300014325 | Bacteria | 733 |
| 305 | Ga0163163_12281737 | 3300014325 | Bacteria | 600 |
| 306 | Ga0157380_10070525 | 3300014326 | Bacteria | 2824 |
| 307 | Ga0157380_10553982 | 3300014326 | Bacteria | 1128 |
| 308 | Ga0157380_11584968 | 3300014326 | Bacteria | 710 |
| 309 | Ga0157380_13229326 | 3300014326 | Bacteria | 521 |
| 310 | Ga0182008_10081757 | 3300014497 | Bacteria | 1590 |
| 311 | Ga0182008_10718816 | 3300014497 | Bacteria | 572 |
| 312 | Ga0182008_10719550 | 3300014497 | Bacteria | 572 |
| 313 | Ga0157377_10246154 | 3300014745 | Bacteria | 1156 |
| 314 | Ga0157377_10372572 | 3300014745 | Bacteria | 964 |
| 315 | Ga0157377_11695878 | 3300014745 | Bacteria | 509 |
| 316 | Ga0157379_10652786 | 3300014968 | Bacteria | 985 |
| 317 | Ga0157376_10266547 | 3300014969 | Bacteria | 1607 |
| 318 | Ga0157376_10439763 | 3300014969 | Bacteria | 1270 |
| 319 | Ga0157376_10802911 | 3300014969 | Bacteria | 954 |
| 320 | Ga0182005_1161971 | 3300015265 | Bacteria | 656 |
| 321 | Ga0206356_10209413 | 3300020070 | Bacteria | 533 |
| 322 | Ga0206356_10501215 | 3300020070 | Bacteria | 1367 |
| 323 | Ga0206356_11742300 | 3300020070 | Bacteria | 1914 |
| 324 | Ga0206354_10981450 | 3300020081 | Bacteria | 6427 |
| 325 | Ga0206354_11201956 | 3300020081 | Bacteria | 1297 |
| 326 | Ga0206354_11469124 | 3300020081 | Bacteria | 2036 |
| 327 | Ga0206353_10253354 | 3300020082 | Bacteria | 6651 |
| 328 | Ga0206353_10492582 | 3300020082 | Bacteria | 1087 |
| 329 | Ga0206353_10783374 | 3300020082 | Bacteria | 1192 |
| 330 | Ga0206353_11459877 | 3300020082 | Bacteria | 503 |
| 331 | Ga0206353_11534795 | 3300020082 | Bacteria | 1468 |
| 332 | Ga0206353_11591169 | 3300020082 | Bacteria | 961 |
| 333 | Ga0206353_11725212 | 3300020082 | Bacteria | 1222 |
| 334 | Ga0206353_11802624 | 3300020082 | Bacteria | 1317 |
| 335 | Ga0206353_11968226 | 3300020082 | Bacteria | 749 |
| 336 | Ga0206353_12029088 | 3300020082 | Bacteria | 795 |
| 337 | Ga0154015_1217639 | 3300020610 | Bacteria | 673 |
| 338 | Ga0213876_10556986 | 3300021384 | Bacteria | 610 |
| 339 | Ga0207697_10542877 | 3300025315 | Bacteria | 511 |
| 340 | Ga0207656_10180310 | 3300025321 | Bacteria | 1013 |
| 341 | Ga0207713_1073728 | 3300025735 | Bacteria | 1251 |
| 342 | Ga0207692_10052395 | 3300025898 | Bacteria | 2074 |
| 343 | Ga0207688_10015915 | 3300025901 | Bacteria | 4078 |
| 344 | Ga0207688_10145162 | 3300025901 | Bacteria | 1398 |
| 345 | Ga0207688_10201689 | 3300025901 | Bacteria | 1193 |
| 346 | Ga0207688_10427961 | 3300025901 | Bacteria | 823 |
| 347 | Ga0207688_10705121 | 3300025901 | Bacteria | 638 |
| 348 | Ga0207680_10979493 | 3300025903 | Bacteria | 606 |
| 349 | Ga0207647_10003439 | 3300025904 | Bacteria | 11882 |
| 350 | Ga0207647_10007825 | 3300025904 | Bacteria | 7693 |
| 351 | Ga0207647_10456002 | 3300025904 | Bacteria | 716 |
| 352 | Ga0207699_10262042 | 3300025906 | Bacteria | 1195 |
| 353 | Ga0207643_10003225 | 3300025908 | Bacteria | 8793 |
| 354 | Ga0207705_10082222 | 3300025909 | Bacteria | 2349 |
| 355 | Ga0207705_10142563 | 3300025909 | Bacteria | 1790 |
| 356 | Ga0207705_10250644 | 3300025909 | Bacteria | 1350 |
| 357 | Ga0207705_11188351 | 3300025909 | Bacteria | 585 |
| 358 | Ga0207654_10019979 | 3300025911 | Bacteria | 3543 |
| 359 | Ga0207654_10333340 | 3300025911 | Bacteria | 1040 |
| 360 | Ga0207707_10059649 | 3300025912 | Bacteria | 3319 |
| 361 | Ga0207707_10075744 | 3300025912 | Bacteria | 2936 |
| 362 | Ga0207707_10299266 | 3300025912 | Bacteria | 1391 |
| 363 | Ga0207695_10006918 | 3300025913 | Bacteria | 14576 |
| 364 | Ga0207695_10126089 | 3300025913 | Bacteria | 2522 |
| 365 | Ga0207695_10322160 | 3300025913 | Bacteria | 1435 |
| 366 | Ga0207695_10357340 | 3300025913 | Bacteria | 1347 |
| 367 | Ga0207671_10000180 | 3300025914 | Bacteria | 96543 |
| 368 | Ga0207671_10023522 | 3300025914 | Bacteria | 4646 |
| 369 | Ga0207671_10837421 | 3300025914 | Bacteria | 729 |
| 370 | Ga0207693_10180146 | 3300025915 | Bacteria | 1663 |
| 371 | Ga0207663_10081950 | 3300025916 | Bacteria | 2115 |
| 372 | Ga0207660_10070880 | 3300025917 | Bacteria | 2534 |
| 373 | Ga0207660_10161250 | 3300025917 | Bacteria | 1730 |
| 374 | Ga0207660_10834357 | 3300025917 | Bacteria | 752 |
| 375 | Ga0207660_11006279 | 3300025917 | Bacteria | 680 |
| 376 | Ga0207660_11133789 | 3300025917 | Bacteria | 637 |
| 377 | Ga0207662_10338468 | 3300025918 | Bacteria | 1008 |
| 378 | Ga0207662_10604825 | 3300025918 | Bacteria | 763 |
| 379 | Ga0207657_10049534 | 3300025919 | Bacteria | 3660 |
| 380 | Ga0207657_10065642 | 3300025919 | Bacteria | 3093 |
| 381 | Ga0207657_10150929 | 3300025919 | Bacteria | 1893 |
| 382 | Ga0207657_10174857 | 3300025919 | Bacteria | 1738 |
| 383 | Ga0207657_10382852 | 3300025919 | Bacteria | 1107 |
| 384 | Ga0207657_11036645 | 3300025919 | Bacteria | 628 |
| 385 | Ga0207649_10017149 | 3300025920 | Bacteria | 4102 |
| 386 | Ga0207649_10154832 | 3300025920 | Bacteria | 1582 |
| 387 | Ga0207649_10223741 | 3300025920 | Bacteria | 1342 |
| 388 | Ga0207649_10360486 | 3300025920 | Bacteria | 1079 |
| 389 | Ga0207649_10634695 | 3300025920 | Bacteria | 824 |
| 390 | Ga0207652_10053079 | 3300025921 | Bacteria | 3481 |
| 391 | Ga0207652_10086777 | 3300025921 | Bacteria | 2744 |
| 392 | Ga0207652_10102311 | 3300025921 | Bacteria | 2532 |
| 393 | Ga0207652_10113935 | 3300025921 | Bacteria | 2400 |
| 394 | Ga0207652_10120269 | 3300025921 | Bacteria | 2336 |
| 395 | Ga0207652_10198842 | 3300025921 | Bacteria | 1804 |
| 396 | Ga0207652_10206884 | 3300025921 | Bacteria | 1766 |
| 397 | Ga0207652_10331990 | 3300025921 | Bacteria | 1373 |
| 398 | Ga0207652_10564150 | 3300025921 | Bacteria | 1022 |
| 399 | Ga0207652_10890200 | 3300025921 | Bacteria | 787 |
| 400 | Ga0207652_11367724 | 3300025921 | Bacteria | 611 |
| 401 | Ga0207681_10259169 | 3300025923 | Bacteria | 1361 |
| 402 | Ga0207681_11721101 | 3300025923 | Bacteria | 524 |
| 403 | Ga0207694_10002826 | 3300025924 | Bacteria | 14007 |
| 404 | Ga0207694_10316726 | 3300025924 | Bacteria | 1287 |
| 405 | Ga0207694_10908707 | 3300025924 | Bacteria | 744 |
| 406 | Ga0207694_11652966 | 3300025924 | Bacteria | 539 |
| 407 | Ga0207650_10184259 | 3300025925 | Bacteria | 1665 |
| 408 | Ga0207650_10642530 | 3300025925 | Bacteria | 894 |
| 409 | Ga0207650_10801995 | 3300025925 | Bacteria | 798 |
| 410 | Ga0207659_10021793 | 3300025926 | Bacteria | 4260 |
| 411 | Ga0207659_10387051 | 3300025926 | Bacteria | 1167 |
| 412 | Ga0207687_10018666 | 3300025927 | Bacteria | 4582 |
| 413 | Ga0207687_10038236 | 3300025927 | Bacteria | 3279 |
| 414 | Ga0207687_10059898 | 3300025927 | Bacteria | 2684 |
| 415 | Ga0207687_10082809 | 3300025927 | Bacteria | 2322 |
| 416 | Ga0207687_10213984 | 3300025927 | Bacteria | 1513 |
| 417 | Ga0207687_10225087 | 3300025927 | Bacteria | 1479 |
| 418 | Ga0207687_11439943 | 3300025927 | Bacteria | 592 |
| 419 | Ga0207700_10286589 | 3300025928 | Bacteria | 1418 |
| 420 | Ga0207700_10438529 | 3300025928 | Bacteria | 1149 |
| 421 | Ga0207700_10911263 | 3300025928 | Bacteria | 787 |
| 422 | Ga0207664_10066052 | 3300025929 | Bacteria | 2898 |
| 423 | Ga0207644_10097942 | 3300025931 | Bacteria | 2197 |
| 424 | Ga0207644_10372107 | 3300025931 | Bacteria | 1164 |
| 425 | Ga0207690_10096974 | 3300025932 | Bacteria | 2097 |
| 426 | Ga0207690_10157898 | 3300025932 | Bacteria | 1688 |
| 427 | Ga0207690_10468679 | 3300025932 | Bacteria | 1015 |
| 428 | Ga0207706_10030957 | 3300025933 | Bacteria | 4771 |
| 429 | Ga0207686_10298069 | 3300025934 | Bacteria | 1196 |
| 430 | Ga0207686_10502841 | 3300025934 | Bacteria | 941 |
| 431 | Ga0207709_10106024 | 3300025935 | Bacteria | 1869 |
| 432 | Ga0207709_10541841 | 3300025935 | Bacteria | 914 |
| 433 | Ga0207670_10077151 | 3300025936 | Bacteria | 2320 |
| 434 | Ga0207669_10139963 | 3300025937 | Bacteria | 1678 |
| 435 | Ga0207704_10145443 | 3300025938 | Bacteria | 1664 |
| 436 | Ga0207704_10660509 | 3300025938 | Bacteria | 862 |
| 437 | Ga0207704_10719234 | 3300025938 | Bacteria | 828 |
| 438 | Ga0207665_10448483 | 3300025939 | Bacteria | 990 |
| 439 | Ga0207691_10053830 | 3300025940 | Bacteria | 3673 |
| 440 | Ga0207691_10187692 | 3300025940 | Bacteria | 1804 |
| 441 | Ga0207711_10361905 | 3300025941 | Bacteria | 1344 |
| 442 | Ga0207689_10001169 | 3300025942 | Bacteria | 25272 |
| 443 | Ga0207689_10028723 | 3300025942 | Bacteria | 4651 |
| 444 | Ga0207689_10510330 | 3300025942 | Bacteria | 1008 |
| 445 | Ga0207661_10010352 | 3300025944 | Bacteria | 6711 |
| 446 | Ga0207661_10034020 | 3300025944 | Bacteria | 3960 |
| 447 | Ga0207661_10090655 | 3300025944 | Bacteria | 2545 |
| 448 | Ga0207661_10135068 | 3300025944 | Bacteria | 2118 |
| 449 | Ga0207661_10144746 | 3300025944 | Bacteria | 2049 |
| 450 | Ga0207661_10732502 | 3300025944 | Bacteria | 910 |
| 451 | Ga0207661_10762640 | 3300025944 | Bacteria | 891 |
| 452 | Ga0207661_11113587 | 3300025944 | Bacteria | 727 |
| 453 | Ga0207661_11924815 | 3300025944 | Bacteria | 537 |
| 454 | Ga0207679_10018405 | 3300025945 | Bacteria | 4679 |
| 455 | Ga0207667_10012023 | 3300025949 | Bacteria | 10016 |
| 456 | Ga0207667_10031551 | 3300025949 | Bacteria | 5719 |
| 457 | Ga0207667_10031902 | 3300025949 | Bacteria | 5682 |
| 458 | Ga0207667_10379626 | 3300025949 | Bacteria | 1440 |
| 459 | Ga0207667_10543525 | 3300025949 | Bacteria | 1175 |
| 460 | Ga0207667_12177342 | 3300025949 | Bacteria | 512 |
| 461 | Ga0207651_10378142 | 3300025960 | Bacteria | 1199 |
| 462 | Ga0207651_11441025 | 3300025960 | Bacteria | 620 |
| 463 | Ga0207712_10196417 | 3300025961 | Bacteria | 1596 |
| 464 | Ga0207712_10197807 | 3300025961 | Bacteria | 1591 |
| 465 | Ga0207668_10141015 | 3300025972 | Bacteria | 1854 |
| 466 | Ga0207668_10825937 | 3300025972 | Bacteria | 822 |
| 467 | Ga0207668_11079087 | 3300025972 | Bacteria | 719 |
| 468 | Ga0207640_10037320 | 3300025981 | Bacteria | 3056 |
| 469 | Ga0207640_11654091 | 3300025981 | Bacteria | 577 |
| 470 | Ga0207640_11695357 | 3300025981 | Bacteria | 570 |
| 471 | Ga0207658_10010475 | 3300025986 | Bacteria | 6297 |
| 472 | Ga0207658_11002639 | 3300025986 | Bacteria | 762 |
| 473 | Ga0207658_11104392 | 3300025986 | Bacteria | 724 |
| 474 | Ga0207658_11385531 | 3300025986 | Bacteria | 643 |
| 475 | Ga0207677_10202064 | 3300026023 | Bacteria | 1580 |
| 476 | Ga0207677_10262806 | 3300026023 | Bacteria | 1408 |
| 477 | Ga0207677_10909833 | 3300026023 | Bacteria | 793 |
| 478 | Ga0207703_10348193 | 3300026035 | Bacteria | 1363 |
| 479 | Ga0207678_10009914 | 3300026067 | Bacteria | 8361 |
| 480 | Ga0207678_10041641 | 3300026067 | Bacteria | 3982 |
| 481 | Ga0207678_10070452 | 3300026067 | Bacteria | 2998 |
| 482 | Ga0207678_10189731 | 3300026067 | Bacteria | 1756 |
| 483 | Ga0207678_10440558 | 3300026067 | Bacteria | 1132 |
| 484 | Ga0207678_11150882 | 3300026067 | Bacteria | 687 |
| 485 | Ga0207708_10105932 | 3300026075 | Bacteria | 2180 |
| 486 | Ga0207708_10177530 | 3300026075 | Bacteria | 1690 |
| 487 | Ga0207702_10007680 | 3300026078 | Bacteria | 9169 |
| 488 | Ga0207702_10026302 | 3300026078 | Bacteria | 4830 |
| 489 | Ga0207702_10079290 | 3300026078 | Bacteria | 2846 |
| 490 | Ga0207702_10229548 | 3300026078 | Bacteria | 1734 |
| 491 | Ga0207702_10235042 | 3300026078 | Bacteria | 1714 |
| 492 | Ga0207702_10535553 | 3300026078 | Bacteria | 1144 |
| 493 | Ga0207702_10852147 | 3300026078 | Bacteria | 902 |
| 494 | Ga0207641_10038739 | 3300026088 | Bacteria | 3985 |
| 495 | Ga0207641_11591223 | 3300026088 | Bacteria | 655 |
| 496 | Ga0207648_10133754 | 3300026089 | Bacteria | 2183 |
| 497 | Ga0207648_10146885 | 3300026089 | Bacteria | 2080 |
| 498 | Ga0207648_10634377 | 3300026089 | Bacteria | 987 |
| 499 | Ga0207676_10024140 | 3300026095 | Bacteria | 4496 |
| 500 | Ga0207676_11641946 | 3300026095 | Bacteria | 641 |
| 501 | Ga0207676_11955346 | 3300026095 | Bacteria | 585 |
| 502 | Ga0207674_10005965 | 3300026116 | Bacteria | 14418 |
| 503 | Ga0207674_10125528 | 3300026116 | Bacteria | 2532 |
| 504 | Ga0207674_10630045 | 3300026116 | Bacteria | 1036 |
| 505 | Ga0207674_10847971 | 3300026116 | Bacteria | 881 |
| 506 | Ga0207674_11180006 | 3300026116 | Bacteria | 735 |
| 507 | Ga0207674_11277990 | 3300026116 | Bacteria | 703 |
| 508 | Ga0207674_11775929 | 3300026116 | Bacteria | 584 |
| 509 | Ga0207675_100128089 | 3300026118 | Bacteria | 2406 |
| 510 | Ga0207675_100181403 | 3300026118 | Bacteria | 2016 |
| 511 | Ga0207675_100350568 | 3300026118 | Bacteria | 1447 |
| 512 | Ga0207683_10016697 | 3300026121 | Bacteria | 6246 |
| 513 | Ga0207683_10029609 | 3300026121 | Bacteria | 4741 |
| 514 | Ga0207683_10367163 | 3300026121 | Bacteria | 1322 |
| 515 | Ga0207683_10497592 | 3300026121 | Bacteria | 1126 |
| 516 | Ga0207683_10948406 | 3300026121 | Bacteria | 799 |
| 517 | Ga0207698_10013815 | 3300026142 | Bacteria | 5343 |
| 518 | Ga0207698_10019257 | 3300026142 | Bacteria | 4669 |
| 519 | Ga0207698_10070478 | 3300026142 | Bacteria | 2770 |
| 520 | Ga0207698_10181108 | 3300026142 | Bacteria | 1867 |
| 521 | Ga0207698_10400601 | 3300026142 | Bacteria | 1311 |
| 522 | Ga0207698_10761554 | 3300026142 | Bacteria | 968 |
| 523 | Ga0207698_10881648 | 3300026142 | Bacteria | 901 |
| 524 | Ga0207698_11088520 | 3300026142 | Bacteria | 812 |
| 525 | Ga0207698_11230140 | 3300026142 | Bacteria | 763 |
| 526 | Ga0207698_11432070 | 3300026142 | Bacteria | 706 |
| 527 | Ga0207698_12743525 | 3300026142 | Bacteria | 501 |
| 528 | Ga0209813_10072119 | 3300027866 | Bacteria | 1125 |
| 529 | Ga0207428_10031985 | 3300027907 | Bacteria | 4333 |
| 530 | Ga0207428_10179231 | 3300027907 | Bacteria | 1602 |
| 531 | Ga0268266_10278026 | 3300028379 | Bacteria | 1556 |
| 532 | Ga0268266_10283801 | 3300028379 | Bacteria | 1540 |
| 533 | Ga0268266_11326553 | 3300028379 | Bacteria | 695 |
| 534 | Ga0268265_10068694 | 3300028380 | Bacteria | 2749 |
| 535 | Ga0268265_10377062 | 3300028380 | Bacteria | 1304 |
| 536 | Ga0268264_10142821 | 3300028381 | Bacteria | 2137 |
| 537 | Ga0268264_10420309 | 3300028381 | Bacteria | 1289 |
| 538 | Ga0265334_10155733 | 3300028573 | Bacteria | 805 |
| 539 | Ga0307517_10247552 | 3300028786 | Bacteria | 1050 |
| 540 | Ga0307515_10019377 | 3300028794 | Bacteria | 12254 |
| 541 | Ga0307515_10253512 | 3300028794 | Bacteria | 1508 |
| 542 | Ga0307515_10467813 | 3300028794 | Bacteria | 874 |
| 543 | Ga0265338_10041533 | 3300028800 | Bacteria | 4300 |
| 544 | Ga0265338_10229138 | 3300028800 | Bacteria | 1383 |
| 545 | Ga0307512_10208165 | 3300030522 | Bacteria | 1045 |
| 546 | Ga0265325_10015736 | 3300031241 | Bacteria | 4245 |
| 547 | Ga0265325_10394833 | 3300031241 | Bacteria | 606 |
| 548 | Ga0265340_10011328 | 3300031247 | Bacteria | 4742 |
| 549 | Ga0265340_10077734 | 3300031247 | Bacteria | 1565 |
| 550 | Ga0265339_10282975 | 3300031249 | Bacteria | 794 |
| 551 | Ga0265331_10120887 | 3300031250 | Bacteria | 1198 |
| 552 | Ga0265316_10261411 | 3300031344 | Bacteria | 1269 |
| 553 | Ga0307513_10241078 | 3300031456 | Bacteria | 1613 |
| 554 | Ga0307513_10459670 | 3300031456 | Bacteria | 996 |
| 555 | Ga0307513_10478690 | 3300031456 | Bacteria | 965 |
| 556 | Ga0307509_10768249 | 3300031507 | Bacteria | 629 |
| 557 | Ga0307408_100238674 | 3300031548 | Bacteria | 1493 |
| 558 | Ga0307408_101007471 | 3300031548 | Bacteria | 768 |
| 559 | Ga0307408_101083314 | 3300031548 | Bacteria | 742 |
| 560 | Ga0307408_101230804 | 3300031548 | Bacteria | 699 |
| 561 | Ga0307408_101366575 | 3300031548 | Bacteria | 666 |
| 562 | Ga0307408_102164367 | 3300031548 | Bacteria | 537 |
| 563 | Ga0307408_102299947 | 3300031548 | Bacteria | 522 |
| 564 | Ga0265313_10053609 | 3300031595 | Bacteria | 1919 |
| 565 | Ga0307508_10415470 | 3300031616 | Bacteria | 937 |
| 566 | Ga0265314_10659394 | 3300031711 | Bacteria | 533 |
| 567 | Ga0265342_10504977 | 3300031712 | Bacteria | 616 |
| 568 | Ga0316576_10327338 | 3300031727 | Bacteria | 1142 |
| 569 | Ga0316578_10032880 | 3300031728 | Bacteria | 2967 |
| 570 | Ga0316578_10344951 | 3300031728 | Unclassified | 887 |
| 571 | Ga0307405_10040001 | 3300031731 | Bacteria | 2838 |
| 572 | Ga0307405_10105332 | 3300031731 | Bacteria | 1899 |
| 573 | Ga0307405_11500786 | 3300031731 | Bacteria | 592 |
| 574 | Ga0316577_10438547 | 3300031733 | Bacteria | 742 |
| 575 | Ga0307413_10018939 | 3300031824 | Bacteria | 3625 |
| 576 | Ga0307413_10035726 | 3300031824 | Bacteria | 2854 |
| 577 | Ga0307413_10439510 | 3300031824 | Bacteria | 1032 |
| 578 | Ga0307413_10458637 | 3300031824 | Bacteria | 1013 |
| 579 | Ga0307413_10745155 | 3300031824 | Bacteria | 818 |
| 580 | Ga0307413_10870552 | 3300031824 | Bacteria | 763 |
| 581 | Ga0307413_11295698 | 3300031824 | Bacteria | 637 |
| 582 | Ga0307518_10410108 | 3300031838 | Bacteria | 750 |
| 583 | Ga0307410_10013296 | 3300031852 | Bacteria | 4797 |
| 584 | Ga0307410_10130085 | 3300031852 | Bacteria | 1848 |
| 585 | Ga0307410_10152421 | 3300031852 | Bacteria | 1722 |
| 586 | Ga0307410_10153917 | 3300031852 | Bacteria | 1715 |
| 587 | Ga0307410_10201574 | 3300031852 | Bacteria | 1519 |
| 588 | Ga0307410_10315805 | 3300031852 | Bacteria | 1238 |
| 589 | Ga0307410_10565793 | 3300031852 | Bacteria | 944 |
| 590 | Ga0307410_10786929 | 3300031852 | Bacteria | 808 |
| 591 | Ga0307410_11018117 | 3300031852 | Bacteria | 715 |
| 592 | Ga0307406_10101991 | 3300031901 | Bacteria | 1957 |
| 593 | Ga0307406_10119133 | 3300031901 | Bacteria | 1832 |
| 594 | Ga0307406_10212181 | 3300031901 | Bacteria | 1433 |
| 595 | Ga0307406_10319150 | 3300031901 | Bacteria | 1201 |
| 596 | Ga0307406_10360075 | 3300031901 | Bacteria | 1140 |
| 597 | Ga0307406_10517458 | 3300031901 | Bacteria | 970 |
| 598 | Ga0307406_11265135 | 3300031901 | Bacteria | 643 |
| 599 | Ga0307406_11991056 | 3300031901 | Bacteria | 519 |
| 600 | Ga0307407_10329707 | 3300031903 | Bacteria | 1074 |
| 601 | Ga0307407_10386360 | 3300031903 | Bacteria | 1001 |
| 602 | Ga0307407_10525143 | 3300031903 | Bacteria | 871 |
| 603 | Ga0307407_10990279 | 3300031903 | Bacteria | 649 |
| 604 | Ga0307412_10540046 | 3300031911 | Bacteria | 977 |
| 605 | Ga0307412_10739058 | 3300031911 | Bacteria | 848 |
| 606 | Ga0307409_100018170 | 3300031995 | Bacteria | 4715 |
| 607 | Ga0307409_100054706 | 3300031995 | Bacteria | 3076 |
| 608 | Ga0307409_100093039 | 3300031995 | Bacteria | 2476 |
| 609 | Ga0307409_100185867 | 3300031995 | Bacteria | 1844 |
| 610 | Ga0307409_100192457 | 3300031995 | Bacteria | 1817 |
| 611 | Ga0307409_100214497 | 3300031995 | Bacteria | 1733 |
| 612 | Ga0307409_100247420 | 3300031995 | Bacteria | 1628 |
| 613 | Ga0307409_100264041 | 3300031995 | Bacteria | 1582 |
| 614 | Ga0307409_100297480 | 3300031995 | Bacteria | 1500 |
| 615 | Ga0307409_100610573 | 3300031995 | Bacteria | 1079 |
| 616 | Ga0307409_100710153 | 3300031995 | Bacteria | 1005 |
| 617 | Ga0307409_100824932 | 3300031995 | Bacteria | 936 |
| 618 | Ga0307409_100910673 | 3300031995 | Bacteria | 893 |
| 619 | Ga0307409_102746275 | 3300031995 | Bacteria | 520 |
| 620 | Ga0307409_102845599 | 3300031995 | Bacteria | 511 |
| 621 | Ga0307416_100040268 | 3300032002 | Bacteria | 3628 |
| 622 | Ga0307416_100125671 | 3300032002 | Bacteria | 2297 |
| 623 | Ga0307416_100157387 | 3300032002 | Bacteria | 2094 |
| 624 | Ga0307416_100169193 | 3300032002 | Bacteria | 2032 |
| 625 | Ga0307416_100357423 | 3300032002 | Bacteria | 1481 |
| 626 | Ga0307416_100363379 | 3300032002 | Bacteria | 1470 |
| 627 | Ga0307416_100506247 | 3300032002 | Bacteria | 1273 |
| 628 | Ga0307416_100676462 | 3300032002 | Bacteria | 1119 |
| 629 | Ga0307416_100732988 | 3300032002 | Bacteria | 1080 |
| 630 | Ga0307416_100851845 | 3300032002 | Bacteria | 1009 |
| 631 | Ga0307416_101038490 | 3300032002 | Bacteria | 923 |
| 632 | Ga0307416_101704845 | 3300032002 | Bacteria | 735 |
| 633 | Ga0307416_102390921 | 3300032002 | Bacteria | 628 |
| 634 | Ga0307416_103690812 | 3300032002 | Bacteria | 512 |
| 635 | Ga0307414_10069035 | 3300032004 | Bacteria | 2539 |
| 636 | Ga0307414_10278549 | 3300032004 | Bacteria | 1404 |
| 637 | Ga0307414_10286254 | 3300032004 | Bacteria | 1387 |
| 638 | Ga0307414_10346304 | 3300032004 | Bacteria | 1274 |
| 639 | Ga0307414_10442287 | 3300032004 | Bacteria | 1138 |
| 640 | Ga0307414_10727867 | 3300032004 | Bacteria | 900 |
| 641 | Ga0307411_10059795 | 3300032005 | Bacteria | 2528 |
| 642 | Ga0307411_10168475 | 3300032005 | Bacteria | 1649 |
| 643 | Ga0307411_10405511 | 3300032005 | Bacteria | 1128 |
| 644 | Ga0307411_10719490 | 3300032005 | Bacteria | 871 |
| 645 | Ga0307411_11658777 | 3300032005 | Bacteria | 591 |
| 646 | Ga0307411_11701008 | 3300032005 | Bacteria | 584 |
| 647 | Ga0307411_12015262 | 3300032005 | Bacteria | 539 |
| 648 | Ga0307415_100014020 | 3300032126 | Bacteria | 4696 |
| 649 | Ga0307415_100031365 | 3300032126 | Bacteria | 3423 |
| 650 | Ga0307415_100031413 | 3300032126 | Bacteria | 3421 |
| 651 | Ga0307415_100069802 | 3300032126 | Bacteria | 2465 |
| 652 | Ga0307415_100112048 | 3300032126 | Bacteria | 2026 |
| 653 | Ga0307415_100384432 | 3300032126 | Bacteria | 1193 |
| 654 | Ga0307415_100655157 | 3300032126 | Bacteria | 942 |
| 655 | Ga0307415_101189108 | 3300032126 | Bacteria | 718 |
| 656 | Ga0307415_101316600 | 3300032126 | Bacteria | 685 |
| 657 | Ga0307415_101363641 | 3300032126 | Bacteria | 674 |
| 658 | Ga0307415_101376492 | 3300032126 | Bacteria | 671 |
| 659 | Ga0316574_0097508 | 3300035398 | Bacteria | 1879 |
| 660 | Ga0373931_0252597 | 3300035691 | Bacteria | 1073 |
| 661 | Ga0373935_0753138 | 3300035692 | Bacteria | 718 |
| 662 | Ga0373947_0539458 | 3300035725 | Bacteria | 794 |
| 663 | Ga0373937_0248938 | 3300036401 | Bacteria | 1675 |
| 664 | Ga0316584_0484077 | 3300036712 | Bacteria | 871 |
| 665 | Ga0395899_0132731 | 3300037312 | Bacteria | 1777 |
| 666 | Ga0395900_0170120 | 3300037418 | Bacteria | 2219 |
| 667 | Ga0395900_0503780 | 3300037418 | Bacteria | 1161 |
| 668 | Ga0395900_1055350 | 3300037418 | Bacteria | 731 |
| 669 | Ga0395900_1112404 | 3300037418 | Bacteria | 707 |
| 670 | Ga0395900_1710531 | 3300037418 | Bacteria | 540 |
| 671 | Ga0395898_0106280 | 3300037466 | Bacteria | 2692 |
| 672 | Ga0395898_0173523 | 3300037466 | Bacteria | 2061 |
| 673 | Ga0395898_0213164 | 3300037466 | Bacteria | 1842 |
| 674 | Ga0395898_0743028 | 3300037466 | Bacteria | 923 |
| 675 | Ga0395905_0917547 | 3300037471 | Bacteria | 779 |
| 676 | Ga0395901_0075412 | 3300038443 | Bacteria | 3518 |
| 677 | Ga0395901_0092995 | 3300038443 | Bacteria | 3157 |
| 678 | Ga0395901_0119980 | 3300038443 | Bacteria | 2763 |
| 679 | Ga0395901_0242836 | 3300038443 | Bacteria | 1878 |
| 680 | Ga0395901_0270540 | 3300038443 | Bacteria | 1767 |
| 681 | Ga0395901_0460571 | 3300038443 | Bacteria | 1299 |
| 682 | Ga0395901_0638734 | 3300038443 | Bacteria | 1069 |
| 683 | Ga0395901_1800314 | 3300038443 | Bacteria | 562 |
| 684 | Ga0436365_0298596 | 3300039437 | Bacteria | 959 |
| 685 | Ga0436365_0506818 | 3300039437 | Bacteria | 1285 |
| 686 | Ga0436365_0556406 | 3300039437 | Bacteria | 1337 |
| 687 | Ga0436363_1246746 | 3300039450 | Bacteria | 779 |
| 688 | Ga0436363_1687996 | 3300039450 | Bacteria | 967 |
| 689 | Ga0439465_0135739 | 3300041413 | Bacteria | 871 |
| 690 | Ga0451787_025773 | 3300041441 | Bacteria | 798 |
| 691 | Ga0451789_0555869 | 3300041443 | Bacteria | 636 |
| 692 | Ga0451791_1575760 | 3300041451 | Bacteria | 1040 |
| 693 | Ga0451793_1387252 | 3300041452 | Bacteria | 4630 |
| 694 | Ga0451797_0104719 | 3300041453 | Bacteria | 3590 |
| 695 | Ga0451798_0565100 | 3300041458 | Bacteria | 749 |
| 696 | Ga0451800_1439755 | 3300041459 | Bacteria | 845 |
| 697 | Ga0451802_0337613 | 3300041460 | Bacteria | 714 |
| 698 | Ga0451807_0035181 | 3300041486 | Bacteria | 615 |
| 699 | Ga0451807_1178085 | 3300041486 | Bacteria | 1359 |
| 700 | Ga0451835_1002227 | 3300041492 | Bacteria | 554 |
| 701 | Ga0451837_0043710 | 3300041494 | Bacteria | 669 |
| 702 | Ga0451843_0490284 | 3300041509 | Bacteria | 1367 |
| 703 | Ga0451853_1642636 | 3300041512 | Bacteria | 5291 |
| 704 | Ga0451853_1991345 | 3300041512 | Bacteria | 502 |
| 705 | Ga0451853_2282637 | 3300041512 | Bacteria | 551 |
| 706 | Ga0451853_3845939 | 3300041512 | Bacteria | 630 |
| 707 | Ga0439448_0096658 | 3300042005 | Bacteria | 1001 |
| 708 | Ga0439451_020780 | 3300042009 | Bacteria | 1323 |
| 709 | Ga0450906_111668 | 3300042145 | Bacteria | 502 |
| 710 | Ga0439435_0170374 | 3300042436 | Bacteria | 707 |
| 711 | Ga0439464_0102498 | 3300042439 | Bacteria | 871 |
| 712 | Ga0439460_0239677 | 3300042461 | Bacteria | 625 |
| 713 | Ga0450901_035297 | 3300042533 | Bacteria | 558 |
| 714 | Ga0451577_0211263 | 3300042876 | Bacteria | 1753 |
| 715 | Ga0439440_0059792 | 3300042993 | Bacteria | 971 |
| 716 | Ga0466969_0040030 | 3300044656 | Bacteria | 2350 |
| 717 | Ga0466969_0083423 | 3300044656 | Bacteria | 1522 |
| 718 | Ga0466969_0408815 | 3300044656 | Bacteria | 616 |
| 719 | Ga0466972_0156389 | 3300044658 | Bacteria | 1071 |
| 720 | Ga0466972_0519466 | 3300044658 | Bacteria | 561 |
| 721 | Ga0466965_0156433 | 3300044683 | Bacteria | 1193 |
| 722 | Ga0466965_0164631 | 3300044683 | Bacteria | 1164 |
| 723 | Ga0466965_0192732 | 3300044683 | Bacteria | 1079 |
| 724 | Ga0466965_0366778 | 3300044683 | Bacteria | 791 |
| 725 | Ga0466965_0532577 | 3300044683 | Bacteria | 662 |
| 726 | Ga0466966_0012157 | 3300044684 | Bacteria | 5703 |
| 727 | Ga0466966_0031407 | 3300044684 | Bacteria | 3444 |
| 728 | Ga0466966_0039724 | 3300044684 | Bacteria | 3030 |
| 729 | Ga0466966_0043544 | 3300044684 | Bacteria | 2877 |
| 730 | Ga0466966_0083076 | 3300044684 | Bacteria | 1993 |
| 731 | Ga0466966_0155547 | 3300044684 | Bacteria | 1393 |
| 732 | Ga0466966_0250410 | 3300044684 | Bacteria | 1067 |
| 733 | Ga0466966_0557059 | 3300044684 | Bacteria | 690 |
| 734 | Ga0466961_0011001 | 3300044693 | Bacteria | 5783 |
| 735 | Ga0466961_0016441 | 3300044693 | Bacteria | 4755 |
| 736 | Ga0466961_0023676 | 3300044693 | Bacteria | 3951 |
| 737 | Ga0466961_0029792 | 3300044693 | Bacteria | 3506 |
| 738 | Ga0466961_0063543 | 3300044693 | Bacteria | 2346 |
| 739 | Ga0466961_0242283 | 3300044693 | Bacteria | 1108 |
| 740 | Ga0466961_0629025 | 3300044693 | Bacteria | 645 |
| 741 | Ga0466963_0004114 | 3300044694 | Bacteria | 8415 |
| 742 | Ga0466963_0005135 | 3300044694 | Bacteria | 7644 |
| 743 | Ga0466963_0024251 | 3300044694 | Bacteria | 3861 |
| 744 | Ga0466963_0026309 | 3300044694 | Bacteria | 3721 |
| 745 | Ga0466963_0029747 | 3300044694 | Bacteria | 3519 |
| 746 | Ga0466963_0107800 | 3300044694 | Bacteria | 1910 |
| 747 | Ga0466963_0202263 | 3300044694 | Bacteria | 1389 |
| 748 | Ga0466963_0271392 | 3300044694 | Bacteria | 1192 |
| 749 | Ga0466963_0346630 | 3300044694 | Bacteria | 1046 |
| 750 | Ga0466963_0530133 | 3300044694 | Bacteria | 831 |
| 751 | Ga0466963_0811094 | 3300044694 | Bacteria | 660 |
| 752 | Ga0466964_0354488 | 3300044706 | Bacteria | 755 |
| 753 | Ga0466971_0054323 | 3300044719 | Bacteria | 1805 |
| 754 | Ga0466971_0090823 | 3300044719 | Bacteria | 1398 |
| 755 | Ga0466970_0001419 | 3300044765 | Bacteria | 11586 |
| 756 | Ga0466970_0033649 | 3300044765 | Bacteria | 2709 |
| 757 | Ga0466970_0034741 | 3300044765 | Bacteria | 2670 |
| 758 | Ga0466970_0125453 | 3300044765 | Bacteria | 1408 |
| 759 | Ga0466970_0156057 | 3300044765 | Bacteria | 1261 |
| 760 | Ga0466970_0446194 | 3300044765 | Bacteria | 741 |
| 761 | Ga0466970_0593083 | 3300044765 | Bacteria | 642 |
| 762 | Ga0466970_0884922 | 3300044765 | Bacteria | 525 |
| 763 | Ga0466957_0015567 | 3300044842 | Bacteria | 4442 |
| 764 | Ga0466957_0126797 | 3300044842 | Bacteria | 1631 |
| 765 | Ga0466957_0588234 | 3300044842 | Bacteria | 778 |
| 766 | Ga0466957_0684994 | 3300044842 | Bacteria | 723 |
| 767 | Ga0466957_1204995 | 3300044842 | Bacteria | 548 |
| 768 | Ga0466957_1265409 | 3300044842 | Bacteria | 535 |
| 769 | Ga0466960_0083249 | 3300044901 | Bacteria | 1616 |
| 770 | Ga0466960_0399971 | 3300044901 | Bacteria | 791 |
| 771 | Ga0466959_0005804 | 3300045049 | Bacteria | 8503 |
| 772 | Ga0466959_0089149 | 3300045049 | Bacteria | 2216 |
| 773 | Ga0466959_0164425 | 3300045049 | Bacteria | 1559 |
| 774 | Ga0466959_0254262 | 3300045049 | Bacteria | 1211 |
| 775 | Ga0466959_0277332 | 3300045049 | Bacteria | 1151 |
| 776 | Ga0466959_0284090 | 3300045049 | Bacteria | 1135 |
| 777 | Ga0466959_1122336 | 3300045049 | Bacteria | 523 |
| 778 | Ga0466958_0009062 | 3300045836 | Bacteria | 5528 |
| 779 | Ga0466958_0030710 | 3300045836 | Bacteria | 3193 |
| 780 | Ga0466958_0043089 | 3300045836 | Bacteria | 2718 |
| 781 | Ga0466958_0054412 | 3300045836 | Bacteria | 2427 |
| 782 | Ga0466958_0291098 | 3300045836 | Bacteria | 1047 |
| 783 | Ga0466958_0309681 | 3300045836 | Bacteria | 1014 |
| 784 | Ga0466958_0312002 | 3300045836 | Bacteria | 1010 |
| 785 | Ga0466958_0433527 | 3300045836 | Bacteria | 850 |
| 786 | Ga0466967_0004748 | 3300045976 | Bacteria | 9247 |
| 787 | Ga0466967_0055840 | 3300045976 | Bacteria | 3479 |
| 788 | Ga0466967_0057734 | 3300045976 | Bacteria | 3427 |
| 789 | Ga0466967_0112084 | 3300045976 | Bacteria | 2508 |
| 790 | Ga0466967_0128174 | 3300045976 | Bacteria | 2353 |
| 791 | Ga0466967_0144209 | 3300045976 | Bacteria | 2220 |
| 792 | Ga0466967_0144597 | 3300045976 | Bacteria | 2217 |
| 793 | Ga0466967_0303876 | 3300045976 | Bacteria | 1535 |
| 794 | Ga0466967_0712248 | 3300045976 | Bacteria | 994 |
| 795 | Ga0466967_0715917 | 3300045976 | Bacteria | 992 |
| 796 | Ga0466967_0731841 | 3300045976 | Bacteria | 981 |
| 797 | Ga0495627_082896 | 3300046453 | Bacteria | 928 |
| 798 | Ga0495629_0142547 | 3300046459 | Bacteria | 1667 |
| 799 | Ga0495629_0171186 | 3300046459 | Bacteria | 1507 |
| 800 | Ga0495629_0371528 | 3300046459 | Bacteria | 974 |
| 801 | Ga0495629_0574777 | 3300046459 | Bacteria | 755 |
| 802 | Ga0495651_0009236 | 3300046462 | Bacteria | 7568 |
| 803 | Ga0495651_0587812 | 3300046462 | Bacteria | 704 |
| 804 | Ga0495582_0155605 | 3300046473 | Bacteria | 1299 |
| 805 | Ga0495582_0279728 | 3300046473 | Bacteria | 958 |
| 806 | Ga0495582_0541696 | 3300046473 | Bacteria | 673 |
| 807 | Ga0495582_0826354 | 3300046473 | Bacteria | 536 |
| 808 | Ga0495662_0223513 | 3300046476 | Bacteria | 928 |
| 809 | Ga0495664_0378632 | 3300046477 | Bacteria | 851 |
| 810 | Ga0495664_0700918 | 3300046477 | Bacteria | 598 |
| 811 | Ga0495585_0065269 | 3300046492 | Bacteria | 1995 |
| 812 | Ga0495596_0033042 | 3300046500 | Bacteria | 2060 |
| 813 | Ga0495608_0068406 | 3300046511 | Bacteria | 2322 |
| 814 | Ga0495608_0945458 | 3300046511 | Bacteria | 503 |
| 815 | Ga0495618_0337412 | 3300046514 | Bacteria | 931 |
| 816 | Ga0495628_0649497 | 3300046516 | Bacteria | 749 |
| 817 | Ga0495644_0097810 | 3300046523 | Bacteria | 1110 |
| 818 | Ga0495652_0000573 | 3300046529 | Bacteria | 42990 |
| 819 | Ga0495652_0082868 | 3300046529 | Bacteria | 2642 |
| 820 | Ga0495665_0471396 | 3300046531 | Bacteria | 634 |
| 821 | Ga0495640_0129946 | 3300046533 | Bacteria | 1631 |
| 822 | Ga0495586_0117203 | 3300046535 | Bacteria | 1486 |
| 823 | Ga0495645_0030803 | 3300046543 | Bacteria | 3909 |
| 824 | Ga0495645_0743806 | 3300046543 | Bacteria | 592 |
| 825 | Ga0495622_0048076 | 3300046557 | Bacteria | 1983 |
| 826 | Ga0495667_0073771 | 3300046559 | Bacteria | 2223 |
| 827 | Ga0495667_0516403 | 3300046559 | Bacteria | 748 |
| 828 | Ga0495667_0901173 | 3300046559 | Bacteria | 542 |
| 829 | Ga0495656_0006406 | 3300046615 | Bacteria | 4129 |
| 830 | Ga0495656_0701234 | 3300046615 | Bacteria | 545 |
| 831 | Ga0495635_0226027 | 3300046663 | Bacteria | 1265 |
| 832 | Ga0495635_0410470 | 3300046663 | Bacteria | 899 |
| 833 | Ga0495635_0861799 | 3300046663 | Bacteria | 581 |
| 834 | Ga0495588_0707533 | 3300046674 | Bacteria | 527 |
| 835 | Ga0495657_0380075 | 3300046675 | Bacteria | 833 |
| 836 | Ga0495647_0124038 | 3300046681 | Bacteria | 1089 |
| 837 | Ga0495647_0310125 | 3300046681 | Bacteria | 713 |
| 838 | Ga0495658_0257741 | 3300046683 | Bacteria | 1098 |
| 839 | Ga0495613_0771572 | 3300046689 | Bacteria | 629 |
| 840 | Ga0495670_0408140 | 3300046691 | Bacteria | 734 |
| 841 | Ga0495649_0398922 | 3300046694 | Bacteria | 691 |
| 842 | Ga0495649_0467496 | 3300046694 | Bacteria | 629 |
| 843 | Ga0495600_0024125 | 3300046809 | Bacteria | 3914 |
| 844 | Ga0495581_0173834 | 3300047315 | Bacteria | 1260 |
| 845 | Ga0495581_0663734 | 3300047315 | Bacteria | 602 |
| 846 | Ga0495581_0805113 | 3300047315 | Bacteria | 539 |
| 847 | Ga0495604_0044539 | 3300047317 | Bacteria | 3466 |
| 848 | Ga0495604_0660183 | 3300047317 | Bacteria | 666 |
| 849 | Ga0495674_0141022 | 3300047319 | Bacteria | 2026 |
| 850 | Ga0495676_0196797 | 3300047321 | Bacteria | 1403 |
| 851 | Ga0495680_0144168 | 3300047322 | Bacteria | 1741 |
| 852 | Ga0495675_0016732 | 3300047444 | Bacteria | 4637 |
| 853 | Ga0495675_0335208 | 3300047444 | Bacteria | 892 |
| 854 | Ga0495675_0521005 | 3300047444 | Bacteria | 681 |
| 855 | Ga0495593_0315469 | 3300047673 | Bacteria | 782 |
| 856 | Ga0495593_0432896 | 3300047673 | Bacteria | 658 |
| 857 | Ga0495593_0586240 | 3300047673 | Bacteria | 560 |
| 858 | Ga0495614_0120449 | 3300048089 | Bacteria | 1157 |
| 859 | Ga0495615_0101098 | 3300048090 | Bacteria | 815 |
| 860 | Ga0495615_0201013 | 3300048090 | Bacteria | 615 |
| 861 | Ga0496100_0080531 | 3300048903 | Bacteria | 2198 |
| 862 | Ga0496100_0344712 | 3300048903 | Bacteria | 1124 |
| 863 | Ga0496100_0476819 | 3300048903 | Bacteria | 959 |
| 864 | Ga0496100_1408036 | 3300048903 | Bacteria | 550 |
| 865 | Ga0496101_0036573 | 3300048904 | Bacteria | 3478 |
| 866 | Ga0496101_0115818 | 3300048904 | Bacteria | 2022 |
| 867 | Ga0496101_0299731 | 3300048904 | Bacteria | 1259 |
| 868 | Ga0496102_0000735 | 3300048905 | Bacteria | 32176 |
| 869 | Ga0496102_0006399 | 3300048905 | Bacteria | 10041 |
| 870 | Ga0496102_0022781 | 3300048905 | Bacteria | 5552 |
| 871 | Ga0496102_0227878 | 3300048905 | Bacteria | 1757 |
| 872 | Ga0496102_0419078 | 3300048905 | Bacteria | 1258 |
| 873 | Ga0496102_0597183 | 3300048905 | Bacteria | 1027 |
| 874 | Ga0496103_0005567 | 3300048906 | Bacteria | 7532 |
| 875 | Ga0496103_0255400 | 3300048906 | Bacteria | 1128 |
| 876 | Ga0496103_0822650 | 3300048906 | Bacteria | 585 |
| 877 | Ga0496104_0001342 | 3300048907 | Bacteria | 21301 |
| 878 | Ga0496104_0040359 | 3300048907 | Bacteria | 4374 |
| 879 | Ga0496104_0085266 | 3300048907 | Bacteria | 3015 |
| 880 | Ga0496104_0247315 | 3300048907 | Bacteria | 1696 |
| 881 | Ga0496104_0308384 | 3300048907 | Bacteria | 1495 |
| 882 | Ga0496104_0347137 | 3300048907 | Bacteria | 1397 |
| 883 | Ga0496104_0418393 | 3300048907 | Bacteria | 1252 |
| 884 | Ga0496104_0466748 | 3300048907 | Bacteria | 1174 |
| 885 | Ga0496104_0974916 | 3300048907 | Bacteria | 752 |
| 886 | Ga0496105_0016468 | 3300048908 | Bacteria | 5903 |
| 887 | Ga0496105_0036384 | 3300048908 | Bacteria | 4055 |
| 888 | Ga0496105_0136573 | 3300048908 | Bacteria | 2020 |
| 889 | Ga0496105_0178579 | 3300048908 | Bacteria | 1739 |
| 890 | Ga0496105_0217889 | 3300048908 | Bacteria | 1554 |
| 891 | Ga0496105_0261919 | 3300048908 | Bacteria | 1398 |
| 892 | Ga0496105_0499261 | 3300048908 | Bacteria | 955 |
| 893 | Ga0496105_0504088 | 3300048908 | Bacteria | 950 |
| 894 | Ga0496106_0127850 | 3300048909 | Bacteria | 1991 |
| 895 | Ga0496106_0166110 | 3300048909 | Bacteria | 1747 |
| 896 | Ga0496106_0608738 | 3300048909 | Bacteria | 875 |
| 897 | Ga0496106_1288219 | 3300048909 | Bacteria | 568 |
| 898 | Ga0496107_0034677 | 3300048910 | Bacteria | 3615 |
| 899 | Ga0496107_0520285 | 3300048910 | Bacteria | 882 |
| 900 | Ga0496108_0000623 | 3300048911 | Bacteria | 27762 |
| 901 | Ga0496108_0023913 | 3300048911 | Bacteria | 5029 |
| 902 | Ga0496108_0061325 | 3300048911 | Bacteria | 3164 |
| 903 | Ga0496108_0112912 | 3300048911 | Bacteria | 2325 |
| 904 | Ga0496108_0311335 | 3300048911 | Bacteria | 1372 |
| 905 | Ga0496108_0479193 | 3300048911 | Bacteria | 1087 |
| 906 | Ga0496108_0585941 | 3300048911 | Bacteria | 972 |
| 907 | Ga0496108_1152676 | 3300048911 | Bacteria | 657 |
| 908 | Ga0496108_1515624 | 3300048911 | Bacteria | 557 |
| 909 | Ga0496108_1542225 | 3300048911 | Bacteria | 551 |
| 910 | Ga0496109_0009375 | 3300048912 | Bacteria | 8339 |
| 911 | Ga0496109_0017787 | 3300048912 | Bacteria | 6234 |
| 912 | Ga0496109_0089327 | 3300048912 | Bacteria | 2848 |
| 913 | Ga0496109_0212317 | 3300048912 | Bacteria | 1820 |
| 914 | Ga0496109_0213703 | 3300048912 | Bacteria | 1814 |
| 915 | Ga0496109_0266325 | 3300048912 | Bacteria | 1614 |
| 916 | Ga0496109_0392717 | 3300048912 | Bacteria | 1311 |
| 917 | Ga0496109_0525856 | 3300048912 | Bacteria | 1116 |
| 918 | Ga0496109_1063750 | 3300048912 | Bacteria | 746 |
| 919 | Ga0496109_1531082 | 3300048912 | Bacteria | 602 |
| 920 | Ga0496110_0004825 | 3300048913 | Bacteria | 10507 |
| 921 | Ga0496110_0216055 | 3300048913 | Bacteria | 1743 |
| 922 | Ga0496110_0385276 | 3300048913 | Bacteria | 1277 |
| 923 | Ga0496110_0467113 | 3300048913 | Bacteria | 1150 |
| 924 | Ga0496110_0471796 | 3300048913 | Bacteria | 1143 |
| 925 | Ga0496110_0585706 | 3300048913 | Bacteria | 1013 |
| 926 | Ga0496110_0840100 | 3300048913 | Bacteria | 823 |
| 927 | Ga0496111_0000994 | 3300048914 | Bacteria | 15537 |
| 928 | Ga0496111_0007779 | 3300048914 | Bacteria | 7058 |
| 929 | Ga0496111_0037201 | 3300048914 | Bacteria | 3483 |
| 930 | Ga0496111_0317855 | 3300048914 | Bacteria | 1153 |
| 931 | Ga0496111_0473304 | 3300048914 | Bacteria | 923 |
| 932 | Ga0496112_0112173 | 3300048915 | Bacteria | 2696 |
| 933 | Ga0496112_1440413 | 3300048915 | Bacteria | 603 |
| 934 | Ga0496113_0014312 | 3300048916 | Bacteria | 5409 |
| 935 | Ga0496113_0024900 | 3300048916 | Bacteria | 4260 |
| 936 | Ga0496113_0039753 | 3300048916 | Bacteria | 3464 |
| 937 | Ga0496113_0043090 | 3300048916 | Bacteria | 3338 |
| 938 | Ga0496113_0106550 | 3300048916 | Bacteria | 2177 |
| 939 | Ga0496113_0120854 | 3300048916 | Bacteria | 2048 |
| 940 | Ga0496113_0249722 | 3300048916 | Bacteria | 1416 |
| 941 | Ga0496113_0630253 | 3300048916 | Bacteria | 858 |
| 942 | Ga0496114_0001130 | 3300048917 | Bacteria | 20173 |
| 943 | Ga0496114_0001454 | 3300048917 | Bacteria | 17979 |
| 944 | Ga0496114_0007721 | 3300048917 | Bacteria | 8509 |
| 945 | Ga0496114_0096811 | 3300048917 | Bacteria | 2513 |
| 946 | Ga0496114_0119071 | 3300048917 | Bacteria | 2269 |
| 947 | Ga0496114_0136307 | 3300048917 | Bacteria | 2123 |
| 948 | Ga0496114_0193852 | 3300048917 | Bacteria | 1778 |
| 949 | Ga0496114_0264001 | 3300048917 | Bacteria | 1516 |
| 950 | Ga0496114_0274326 | 3300048917 | Bacteria | 1486 |
| 951 | Ga0496114_0286998 | 3300048917 | Bacteria | 1451 |
| 952 | Ga0496114_0288898 | 3300048917 | Bacteria | 1447 |
| 953 | Ga0496114_0446478 | 3300048917 | Bacteria | 1145 |
| 954 | Ga0496114_1730512 | 3300048917 | Bacteria | 513 |
| 955 | Ga0496115_0012178 | 3300048918 | Bacteria | 6468 |
| 956 | Ga0496115_0078974 | 3300048918 | Bacteria | 2678 |
| 957 | Ga0496115_0216321 | 3300048918 | Bacteria | 1582 |
| 958 | Ga0496115_0532938 | 3300048918 | Bacteria | 940 |
| 959 | Ga0496115_1194829 | 3300048918 | Bacteria | 572 |
| 960 | Ga0496119_0000960 | 3300048922 | Bacteria | 37110 |
| 961 | Ga0496120_0001834 | 3300048923 | Bacteria | 23688 |
| 962 | Ga0496123_0053390 | 3300048926 | Bacteria | 2671 |
| 963 | Ga0496124_0189176 | 3300048927 | Bacteria | 1577 |
| 964 | Ga0496124_0318532 | 3300048927 | Bacteria | 1115 |
| 965 | Ga0496124_0433443 | 3300048927 | Bacteria | 902 |
| 966 | Ga0496126_0000006 | 3300048929 | Bacteria | 798804 |
| 967 | Ga0496126_0021047 | 3300048929 | Bacteria | 6381 |
| 968 | Ga0496126_0068404 | 3300048929 | Bacteria | 3171 |
| 969 | Ga0496126_0330995 | 3300048929 | Bacteria | 1250 |
| 970 | Ga0501317_110782 | 3300049533 | Bacteria | 504 |
| 971 | Ga0501031_0010365 | 3300049568 | Bacteria | 6069 |
| 972 | Ga0501031_0013183 | 3300049568 | Bacteria | 5395 |
| 973 | Ga0501032_0160508 | 3300049569 | Bacteria | 1476 |
| 974 | Ga0501032_0217545 | 3300049569 | Bacteria | 1244 |
| 975 | Ga0501033_0036579 | 3300049570 | Bacteria | 3678 |
| 976 | Ga0501034_0278084 | 3300049571 | Bacteria | 1614 |
| 977 | Ga0501034_0935879 | 3300049571 | Bacteria | 753 |
| 978 | Ga0501036_0024649 | 3300049572 | Bacteria | 5072 |
| 979 | Ga0501036_0089146 | 3300049572 | Bacteria | 2606 |
| 980 | Ga0501036_0177974 | 3300049572 | Bacteria | 1791 |
| 981 | Ga0501036_1453889 | 3300049572 | Bacteria | 555 |
| 982 | Ga0501037_0031898 | 3300049573 | Bacteria | 3890 |
| 983 | Ga0501037_0055236 | 3300049573 | Bacteria | 2904 |
| 984 | Ga0501038_0192810 | 3300049574 | Bacteria | 1639 |
| 985 | Ga0501038_1044228 | 3300049574 | Bacteria | 598 |
| 986 | Ga0501038_1367958 | 3300049574 | Bacteria | 509 |
| 987 | Ga0501039_0065326 | 3300049575 | Bacteria | 2822 |
| 988 | Ga0501039_0079105 | 3300049575 | Bacteria | 2558 |
| 989 | Ga0501039_0415808 | 3300049575 | Bacteria | 1056 |
| 990 | Ga0501039_0552261 | 3300049575 | Bacteria | 904 |
| 991 | Ga0501040_0015306 | 3300049576 | Bacteria | 5071 |
| 992 | Ga0501040_0090626 | 3300049576 | Bacteria | 2125 |
| 993 | Ga0501040_0299958 | 3300049576 | Bacteria | 1149 |
| 994 | Ga0501040_0329770 | 3300049576 | Bacteria | 1092 |
| 995 | Ga0501040_0614167 | 3300049576 | Bacteria | 786 |
| 996 | Ga0501041_0004209 | 3300049577 | Bacteria | 8326 |
| 997 | Ga0501041_0017796 | 3300049577 | Bacteria | 4229 |
| 998 | Ga0501041_0557763 | 3300049577 | Bacteria | 730 |
| 999 | Ga0501042_0008853 | 3300049578 | Bacteria | 6673 |
| 1000 | Ga0501042_0029797 | 3300049578 | Bacteria | 3849 |
| 1001 | Ga0501043_0014686 | 3300049579 | Bacteria | 6131 |
| 1002 | Ga0501043_0153115 | 3300049579 | Bacteria | 1804 |
| 1003 | Ga0501046_0042248 | 3300049580 | Bacteria | 3635 |
| 1004 | Ga0501046_0249867 | 3300049580 | Bacteria | 1306 |
| 1005 | Ga0501047_0011090 | 3300049581 | Bacteria | 8529 |
| 1006 | Ga0501047_0344857 | 3300049581 | Bacteria | 1326 |
| 1007 | Ga0501048_0013342 | 3300049582 | Bacteria | 6097 |
| 1008 | Ga0501048_0033546 | 3300049582 | Bacteria | 3708 |
| 1009 | Ga0501048_0130640 | 3300049582 | Bacteria | 1776 |
| 1010 | Ga0501048_1042579 | 3300049582 | Bacteria | 588 |
| 1011 | Ga0501067_0507024 | 3300049583 | Bacteria | 675 |
| 1012 | Ga0501068_0078828 | 3300049584 | Bacteria | 2019 |
| 1013 | Ga0501068_0080808 | 3300049584 | Bacteria | 1995 |
| 1014 | Ga0501069_0915709 | 3300049585 | Bacteria | 534 |
| 1015 | Ga0501070_0056403 | 3300049586 | Bacteria | 3256 |
| 1016 | Ga0501070_0201135 | 3300049586 | Bacteria | 1636 |
| 1017 | Ga0501070_0505796 | 3300049586 | Bacteria | 970 |
| 1018 | Ga0501071_0002813 | 3300049587 | Bacteria | 10710 |
| 1019 | Ga0501071_0241329 | 3300049587 | Bacteria | 1362 |
| 1020 | Ga0501072_0032716 | 3300049588 | Bacteria | 4072 |
| 1021 | Ga0501072_0044417 | 3300049588 | Bacteria | 3494 |
| 1022 | Ga0501073_0102156 | 3300049589 | Bacteria | 1991 |
| 1023 | Ga0501073_0425269 | 3300049589 | Bacteria | 918 |
| 1024 | Ga0501074_0023291 | 3300049590 | Bacteria | 4503 |
| 1025 | Ga0501074_0133737 | 3300049590 | Bacteria | 1774 |
| 1026 | Ga0501075_0041137 | 3300049591 | Bacteria | 3463 |
| 1027 | Ga0501076_0010496 | 3300049592 | Bacteria | 6874 |
| 1028 | Ga0501076_0047264 | 3300049592 | Bacteria | 3402 |
| 1029 | Ga0501077_0030486 | 3300049593 | Bacteria | 3432 |
| 1030 | Ga0501246_037638 | 3300049676 | Bacteria | 568 |
| 1031 | Ga0501079_0006491 | 3300049741 | Bacteria | 8784 |
| 1032 | Ga0501079_0218932 | 3300049741 | Bacteria | 1487 |
| 1033 | Ga0501079_0549205 | 3300049741 | Bacteria | 908 |
| 1034 | Ga0501079_0907294 | 3300049741 | Bacteria | 694 |
| 1035 | Ga0501080_0167369 | 3300049742 | Bacteria | 2028 |
| 1036 | Ga0501080_0186037 | 3300049742 | Bacteria | 1910 |
| 1037 | Ga0501080_0359058 | 3300049742 | Bacteria | 1315 |
| 1038 | Ga0501081_0028633 | 3300049743 | Bacteria | 3760 |
| 1039 | Ga0501081_0085638 | 3300049743 | Bacteria | 2212 |
| 1040 | Ga0501083_0980208 | 3300049744 | Bacteria | 550 |
| 1041 | Ga0501035_0023004 | 3300049822 | Bacteria | 5720 |
| 1042 | Ga0501035_0266683 | 3300049822 | Bacteria | 1450 |
| 1043 | Ga0501035_0536331 | 3300049822 | Bacteria | 960 |
| 1044 | Ga0501035_0607211 | 3300049822 | Bacteria | 891 |
| 1045 | Ga0501044_0073543 | 3300049823 | Bacteria | 3474 |
| 1046 | Ga0501044_0305055 | 3300049823 | Bacteria | 1520 |
| 1047 | Ga0501044_0414233 | 3300049823 | Bacteria | 1258 |
| 1048 | Ga0501044_0420241 | 3300049823 | Bacteria | 1247 |
| 1049 | Ga0501044_0437578 | 3300049823 | Bacteria | 1216 |
| 1050 | Ga0501045_0044674 | 3300049824 | Bacteria | 3227 |
| 1051 | Ga0501045_0261705 | 3300049824 | Bacteria | 1287 |
| 1052 | Ga0501045_0715127 | 3300049824 | Bacteria | 739 |
| 1053 | nmdc:mga00v17_3307_c1 | 3300050491 | Bacteria | 3698 |
| 1054 | nmdc:mga00v17_335263_c1 | 3300050491 | Bacteria | 983 |
| 1055 | nmdc:mga0yw44_481290_c1 | 3300050492 | Bacteria | 842 |
| 1056 | nmdc:mga0yw44_80957_c1 | 3300050492 | Bacteria | 2035 |
| 1057 | nmdc:mga0yw44_990912_c1 | 3300050492 | Bacteria | 569 |
| 1058 | nmdc:mga06z11_350563_c1 | 3300050494 | Bacteria | 884 |
| 1059 | nmdc:mga04h51_26732_c1 | 3300050495 | Bacteria | 1787 |
| 1060 | nmdc:mga07m45_152065_c1 | 3300050496 | Bacteria | 1342 |
| 1061 | nmdc:mga05p37_1586837_c1 | 3300050507 | Bacteria | 646 |
| 1062 | nmdc:mga05p37_1821172_c1 | 3300050507 | Bacteria | 586 |
| 1063 | nmdc:mga05p37_280242_c1 | 3300050507 | Bacteria | 1988 |
| 1064 | nmdc:mga09592_173844_c1 | 3300050508 | Bacteria | 1863 |
| 1065 | nmdc:mga09592_423676_c1 | 3300050508 | Bacteria | 1149 |
| 1066 | nmdc:mga09592_76003_c1 | 3300050508 | Bacteria | 2856 |
| 1067 | nmdc:mga06r32_274024_c1 | 3300050510 | Bacteria | 1675 |
| 1068 | nmdc:mga06r32_31347_c1 | 3300050510 | Bacteria | 4992 |
| 1069 | nmdc:mga08y16_139434_c1 | 3300050511 | Bacteria | 2521 |
| 1070 | nmdc:mga08y16_66404_c1 | 3300050511 | Bacteria | 3765 |
| 1071 | nmdc:mga0rr50_198003_c1 | 3300050513 | Bacteria | 1650 |
| 1072 | nmdc:mga08x19_40413_c1 | 3300050514 | Bacteria | 2968 |
| 1073 | Ga0495601_0044939 | 3300053077 | Bacteria | 2777 |
| 1074 | Ga0495601_0633460 | 3300053077 | Bacteria | 685 |
| 1075 | Ga0495612_0000712 | 3300053078 | Bacteria | 13488 |
| 1076 | Ga0495612_0306470 | 3300053078 | Bacteria | 713 |
| 1077 | Ga0495595_0010962 | 3300053084 | Bacteria | 3782 |
| 1078 | Ga0500646_0046481 | 3300053090 | Bacteria | 1239 |
| 1079 | Ga0500641_0003416 | 3300053096 | Bacteria | 5612 |
| 1080 | Ga0500573_0107851 | 3300053140 | Bacteria | 1561 |
| 1081 | Ga0501084_0020842 | 3300054114 | Bacteria | 5467 |
| 1082 | Ga0501084_0068010 | 3300054114 | Bacteria | 2982 |
| 1083 | Ga0501084_1563800 | 3300054114 | Bacteria | 552 |
| 1084 | Ga0501084_1822667 | 3300054114 | Bacteria | 508 |
| 1085 | Ga0501082_0021928 | 3300060353 | Bacteria | 5506 |
| 1086 | Ga0501082_0165241 | 3300060353 | Bacteria | 1923 |
| 1087 | Ga0501082_1518814 | 3300060353 | Bacteria | 585 |
| 1088 | Ga0466962_0013525 | 3300061719 | Bacteria | 3929 |
| 1089 | Ga0466962_0117939 | 3300061719 | Bacteria | 1280 |
| 1090 | Ga0466962_0130751 | 3300061719 | Bacteria | 1213 |
| 1091 | Ga0466962_0148664 | 3300061719 | Bacteria | 1136 |
| 1092 | Ga0466962_0194975 | 3300061719 | Bacteria | 989 |
| 1093 | Ga0530510_0059511 | 3300061734 | Bacteria | 2763 |
| 1094 | Ga0530510_0063017 | 3300061734 | Bacteria | 2684 |
| 1095 | Ga0530510_0500685 | 3300061734 | Bacteria | 921 |
| 1096 | 2515850971 | 2515154155 | Bacteria | 7985436 |
| 1097 | 2643849942 | 2643221567 | Bacteria | 4163945 |
| 1098 | 2644016261 | 2643221601 | Bacteria | 7493239 |
| 1099 | 2644135944 | 2643221624 | Bacteria | 4384879 |
| 1100 | 2644178517 | 2643221631 | Bacteria | 8168043 |
| 1101 | 2644444956 | 2643221679 | Bacteria | 3839507 |
| 1102 | 2644456973 | 2643221681 | Bacteria | 3707866 |
| 1103 | 2644537504 | 2643221697 | Bacteria | 3575694 |
| 1104 | 2644609735 | 2643221711 | Bacteria | 4865335 |
| 1105 | 2645719723 | 2643221961 | Bacteria | 3919167 |
| 1106 | 2645726611 | 2643221962 | Bacteria | 3874254 |
| 1107 | 2676476704 | 2675903058 | Bacteria | 6822861 |
| 1108 | 2738695726 | 2738541272 | Bacteria | 6848551 |
| 1109 | 2739326133 | 2738543027 | Bacteria | 6409078 |
| 1110 | 2739605025 | 2739367654 | Bacteria | 6049412 |
| 1111 | 2740168864 | 2739367898 | Bacteria | 4367674 |
| 1112 | 2760308031 | 2758568522 | Bacteria | 5953541 |
| 1113 | 2760623346 | 2758568621 | Bacteria | 5967089 |
| 1114 | 2768643831 | 2767802112 | Bacteria | 6465194 |
| 1115 | 2784472109 | 2784132109 | Bacteria | 3141763 |
| 1116 | 2808874208 | 2808606365 | Bacteria | 4301966 |
| 1117 | 2809028234 | 2808606394 | Bacteria | 6248540 |
| 1118 | 2812374894 | 2811994882 | Bacteria | 4688362 |
| 1119 | 2816425549 | 2816332119 | Bacteria | 8120218 |
| 1120 | 2819427635 | 2818991318 | Bacteria | 5266538 |
| 1121 | 2819666491 | 2818991458 | Bacteria | 4794049 |
| 1122 | 2819691651 | 2818991462 | Bacteria | 4320267 |
| 1123 | 2819729569 | 2818991469 | Bacteria | 4644110 |
| 1124 | 2819744007 | 2818991472 | Bacteria | 10089953 |
| 1125 | 2827630207 | 2827628540 | Bacteria | 6858585 |
| 1126 | 2837273376 | 2837268691 | Bacteria | 7850704 |
| 1127 | 2848552434 | 2848551377 | Bacteria | 3720646 |
| 1128 | 2861524022 | 2861520306 | Bacteria | 8348283 |
| 1129 | 2867346707 | 2867346516 | Bacteria | 7608576 |
| 1130 | 2868093206 | 2868088558 | Bacteria | 7609351 |
| 1131 | 2887444104 | 2887443736 | Bacteria | 4426037 |
| 1132 | 2984594851 | 2984592036 | Bacteria | 3670284 |
| 1133 | 2995468048 | 2995463766 | Bacteria | 8577691 |
| 1134 | 3001891415 | 3001889506 | Bacteria | 2975194 |
| 1135 | 8053952833 | 8053945823 | Bacteria | 8962862 |
| 1136 | 8054611329 | 8054609563 | Bacteria | 5170090 |
| 1137 | 8057572493 | 8057568493 | Bacteria | 7221719 |
| 1138 | Ga0157379_11528154 | |||
| 1139 | JGI24739J22299_10001443 | |||
| 1140 | JGI24737J22298_10003330 | |||
| 1141 | JGI24735J21928_10009578 | |||
| 1142 | JGI24735J21928_10011363 | |||
| 1143 | Ga0070658_10001601 | |||
| 1144 | Ga0070658_10125694 | |||
| 1145 | Ga0070658_10209150 | |||
| 1146 | Ga0070658_10591516 | |||
| 1147 | Ga0070658_11032762 | |||
| 1148 | Ga0070676_10313847 | |||
| 1149 | Ga0070683_100019031 | |||
| 1150 | Ga0070683_100783184 | |||
| 1151 | Ga0070683_101907861 | |||
| 1152 | Ga0068869_100019690 | |||
| 1153 | Ga0068869_100021777 | |||
| 1154 | Ga0068869_100252513 | |||
| 1155 | Ga0070666_10820237 | |||
| 1156 | Ga0070680_100297660 | |||
| 1157 | Ga0070680_100455600 | |||
| 1158 | Ga0070682_100002949 | |||
| 1159 | Ga0070682_100084461 | |||
| 1160 | Ga0070682_100097643 | |||
| 1161 | Ga0070682_100184742 | |||
| 1162 | Ga0070682_100238937 | |||
| 1163 | Ga0070682_100397855 | |||
| 1164 | Ga0070682_100461715 | |||
| 1165 | Ga0068868_100071671 | |||
| 1166 | Ga0068868_100136027 | |||
| 1167 | Ga0068868_100316393 | |||
| 1168 | Ga0070660_100042696 | |||
| 1169 | Ga0070660_100070805 | |||
| 1170 | Ga0070660_100190976 | |||
| 1171 | Ga0070660_100464013 | |||
| 1172 | Ga0070660_100559722 | |||
| 1173 | Ga0070660_101050179 | |||
| 1174 | Ga0070689_100262178 | |||
| 1175 | Ga0070691_10026973 | |||
| 1176 | Ga0070687_100360263 | |||
| 1177 | Ga0070661_100040415 | |||
| 1178 | Ga0070661_100337481 | |||
| 1179 | Ga0070661_100365911 | |||
| 1180 | Ga0070692_10067349 | |||
| 1181 | Ga0070668_100490754 | |||
| 1182 | Ga0070668_101129817 | |||
| 1183 | Ga0070669_101335821 | |||
| 1184 | Ga0070675_100008017 | |||
| 1185 | Ga0070675_100140176 | |||
| 1186 | Ga0070671_100007289 | |||
| 1187 | Ga0070671_100239491 | |||
| 1188 | Ga0070674_101767634 | |||
| 1189 | Ga0070673_101108492 | |||
| 1190 | Ga0070659_100032558 | |||
| 1191 | Ga0070659_100165481 | |||
| 1192 | Ga0070659_102106941 | |||
| 1193 | Ga0070667_100005054 | |||
| 1194 | Ga0070667_100160228 | |||
| 1195 | Ga0070667_100386081 | |||
| 1196 | Ga0070667_101207403 | |||
| 1197 | Ga0070667_101284042 | |||
| 1198 | Ga0070709_10184285 | |||
| 1199 | Ga0070709_11057250 | |||
| 1200 | Ga0070714_100089379 | |||
| 1201 | Ga0070714_101085171 | |||
| 1202 | Ga0070714_102502361 | |||
| 1203 | Ga0070713_100154115 | |||
| 1204 | Ga0070713_100190537 | |||
| 1205 | Ga0070713_100367948 | |||
| 1206 | Ga0070711_100078358 | |||
| 1207 | Ga0070705_100781488 | |||
| 1208 | Ga0070705_100992239 | |||
| 1209 | Ga0070700_100121130 | |||
| 1210 | Ga0070694_101307458 | |||
| 1211 | Ga0070708_100406394 | |||
| 1212 | Ga0070663_100021165 | |||
| 1213 | Ga0070663_100108306 | |||
| 1214 | Ga0070663_100229462 | |||
| 1215 | Ga0070663_100972189 | |||
| 1216 | Ga0070663_101026599 | |||
| 1217 | Ga0070663_101342589 | |||
| 1218 | Ga0070678_100044533 | |||
| 1219 | Ga0070678_100152020 | |||
| 1220 | Ga0070678_100162050 | |||
| 1221 | Ga0070678_100484373 | |||
| 1222 | Ga0070681_10090018 | |||
| 1223 | Ga0070681_10509695 | |||
| 1224 | Ga0070681_10716185 | |||
| 1225 | Ga0070681_11190307 | |||
| 1226 | Ga0068867_100639366 | |||
| 1227 | Ga0068867_101167260 | |||
| 1228 | Ga0068867_101304416 | |||
| 1229 | Ga0070685_10095132 | |||
| 1230 | Ga0070685_10278328 | |||
| 1231 | Ga0070685_10411610 | |||
| 1232 | Ga0070698_100021155 | |||
| 1233 | Ga0070679_100040469 | |||
| 1234 | Ga0070679_100090535 | |||
| 1235 | Ga0070679_100125162 | |||
| 1236 | Ga0070679_100146167 | |||
| 1237 | Ga0070679_100163926 | |||
| 1238 | Ga0070679_100250505 | |||
| 1239 | Ga0070679_101023735 | |||
| 1240 | Ga0070679_102171253 | |||
| 1241 | Ga0070684_100042712 | |||
| 1242 | Ga0070684_100209746 | |||
| 1243 | Ga0070684_100331418 | |||
| 1244 | Ga0070684_101470602 | |||
| 1245 | Ga0068853_100825043 | |||
| 1246 | Ga0070672_100224674 | |||
| 1247 | Ga0070672_101111607 | |||
| 1248 | Ga0070696_100000806 | |||
| 1249 | Ga0070693_100013235 | |||
| 1250 | Ga0070693_100538221 | |||
| 1251 | Ga0070665_100116357 | |||
| 1252 | Ga0070665_100225627 | |||
| 1253 | Ga0070665_100321707 | |||
| 1254 | Ga0070665_101376803 | |||
| 1255 | Ga0068855_100007335 | |||
| 1256 | Ga0068855_100010193 | |||
| 1257 | Ga0068855_100015148 | |||
| 1258 | Ga0068855_100452505 | |||
| 1259 | Ga0068855_101138635 | |||
| 1260 | Ga0070664_100011912 | |||
| 1261 | Ga0068857_100005416 | |||
| 1262 | Ga0068857_100157945 | |||
| 1263 | Ga0068857_100173664 | |||
| 1264 | Ga0068857_101089946 | |||
| 1265 | Ga0068857_101167492 | |||
| 1266 | Ga0068857_101622158 | |||
| 1267 | Ga0068857_102032374 | |||
| 1268 | Ga0068857_102081522 | |||
| 1269 | Ga0068854_100003155 | |||
| 1270 | Ga0068854_100043523 | |||
| 1271 | Ga0068854_100071621 | |||
| 1272 | Ga0068856_100006438 | |||
| 1273 | Ga0068856_100006679 | |||
| 1274 | Ga0068856_100279725 | |||
| 1275 | Ga0068856_100564124 | |||
| 1276 | Ga0068856_100785714 | |||
| 1277 | Ga0068856_101786920 | |||
| 1278 | Ga0068856_102133884 | |||
| 1279 | Ga0070702_100012306 | |||
| 1280 | Ga0070702_100329551 | |||
| 1281 | Ga0070702_100971982 | |||
| 1282 | Ga0068852_100007296 | |||
| 1283 | Ga0068852_100020286 | |||
| 1284 | Ga0068852_100020773 | |||
| 1285 | Ga0068852_100165344 | |||
| 1286 | Ga0068852_100179670 | |||
| 1287 | Ga0068852_100407354 | |||
| 1288 | Ga0068852_100473701 | |||
| 1289 | Ga0068859_100822423 | |||
| 1290 | Ga0068859_102976817 | |||
| 1291 | Ga0068864_100142385 | |||
| 1292 | Ga0068864_101204057 | |||
| 1293 | Ga0068864_102381441 | |||
| 1294 | Ga0068866_10326054 | |||
| 1295 | Ga0068861_100257648 | |||
| 1296 | Ga0068861_101219375 | |||
| 1297 | Ga0068851_10063443 | |||
| 1298 | Ga0068870_10189964 | |||
| 1299 | Ga0068870_10461514 | |||
| 1300 | Ga0068870_10968923 | |||
| 1301 | Ga0068863_100056422 | |||
| 1302 | Ga0068863_101854429 | |||
| 1303 | Ga0068858_100853796 | |||
| 1304 | Ga0068860_100623066 | |||
| 1305 | Ga0068862_100098112 | |||
| 1306 | Ga0081455_10001727 | |||
| 1307 | Ga0081455_10167140 | |||
| 1308 | Ga0081538_10082192 | |||
| 1309 | Ga0081540_1002115 | |||
| 1310 | Ga0070717_10649064 | |||
| 1311 | Ga0075364_10026964 | |||
| 1312 | Ga0075364_10356039 | |||
| 1313 | Ga0075432_10094974 | |||
| 1314 | Ga0070716_100608797 | |||
| 1315 | Ga0070712_100446642 | |||
| 1316 | Ga0075367_10061989 | |||
| 1317 | Ga0097621_100053144 | |||
| 1318 | Ga0097621_100515165 | |||
| 1319 | Ga0075370_10151543 | |||
| 1320 | Ga0068871_100669454 | |||
| 1321 | Ga0068871_101318981 | |||
| 1322 | Ga0075428_100316264 | |||
| 1323 | Ga0075428_100620098 | |||
| 1324 | Ga0075431_100038052 | |||
| 1325 | Ga0075431_100302451 | |||
| 1326 | Ga0075433_10039113 | |||
| 1327 | Ga0075434_100053152 | |||
| 1328 | Ga0075429_100262225 | |||
| 1329 | Ga0075429_100568355 | |||
| 1330 | Ga0068865_100178180 | |||
| 1331 | Ga0068865_100255956 | |||
| 1332 | Ga0068865_100565500 | |||
| 1333 | Ga0068865_100964786 | |||
| 1334 | Ga0068865_101639088 | |||
| 1335 | Ga0075436_100015576 | |||
| 1336 | Ga0097620_100822456 | |||
| 1337 | Ga0097620_102977056 | |||
| 1338 | Ga0075435_100065337 | |||
| 1339 | Ga0105251_10008521 | |||
| 1340 | Ga0105240_10001975 | |||
| 1341 | Ga0105240_10103546 | |||
| 1342 | Ga0105240_10706406 | |||
| 1343 | Ga0105240_12158498 | |||
| 1344 | Ga0111539_10005317 | |||
| 1345 | Ga0105245_10007924 | |||
| 1346 | Ga0105245_10015300 | |||
| 1347 | Ga0105245_10048638 | |||
| 1348 | Ga0105245_10118385 | |||
| 1349 | Ga0105245_10257512 | |||
| 1350 | Ga0105245_10459862 | |||
| 1351 | Ga0105245_11777552 | |||
| 1352 | Ga0105245_11866144 | |||
| 1353 | Ga0105247_10012565 | |||
| 1354 | Ga0105247_10284918 | |||
| 1355 | Ga0105247_10782195 | |||
| 1356 | Ga0114129_10191137 | |||
| 1357 | Ga0114129_11207550 | |||
| 1358 | Ga0114129_12743898 | |||
| 1359 | Ga0105243_10053489 | |||
| 1360 | Ga0105243_10373417 | |||
| 1361 | Ga0105243_10650266 | |||
| 1362 | Ga0105241_10002330 | |||
| 1363 | Ga0105241_10074240 | |||
| 1364 | Ga0105241_10891824 | |||
| 1365 | Ga0105241_12269391 | |||
| 1366 | Ga0105242_10124878 | |||
| 1367 | Ga0105242_10171122 | |||
| 1368 | Ga0105242_10635168 | |||
| 1369 | Ga0105248_10247850 | |||
| 1370 | Ga0105248_10497255 | |||
| 1371 | Ga0105237_10039938 | |||
| 1372 | Ga0105237_10142330 | |||
| 1373 | Ga0105237_10163149 | |||
| 1374 | Ga0105237_10549891 | |||
| 1375 | Ga0105237_11598374 | |||
| 1376 | Ga0105237_11992237 | |||
| 1377 | Ga0105238_10004764 | |||
| 1378 | Ga0105238_10037828 | |||
| 1379 | Ga0105238_10168513 | |||
| 1380 | Ga0105238_10324931 | |||
| 1381 | Ga0105238_11310689 | |||
| 1382 | Ga0105249_10376537 | |||
| 1383 | Ga0105249_11270671 | |||
| 1384 | Ga0105249_11318571 | |||
| 1385 | Ga0105239_10027733 | |||
| 1386 | Ga0105239_10072749 | |||
| 1387 | Ga0105239_10086604 | |||
| 1388 | Ga0105239_10112717 | |||
| 1389 | Ga0105239_10226718 | |||
| 1390 | Ga0105239_10314930 | |||
| 1391 | Ga0105239_10630355 | |||
| 1392 | Ga0105239_10741734 | |||
| 1393 | Ga0105239_10791467 | |||
| 1394 | Ga0105239_12367575 | |||
| 1395 | Ga0105246_10012689 | |||
| 1396 | Ga0105246_10027239 | |||
| 1397 | Ga0105246_10302952 | |||
| 1398 | Ga0105246_10422348 | |||
| 1399 | Ga0105246_10975287 | |||
| 1400 | Ga0105246_11381090 | |||
| 1401 | Ga0105246_12585925 | |||
| 1402 | Ga0157373_10055852 | |||
| 1403 | Ga0157371_10008106 | |||
| 1404 | Ga0157370_10039127 | |||
| 1405 | Ga0157370_10072372 | |||
| 1406 | Ga0157370_10261795 | |||
| 1407 | Ga0157370_10358507 | |||
| 1408 | Ga0157370_11888346 | |||
| 1409 | Ga0157369_10009859 | |||
| 1410 | Ga0157369_10015697 | |||
| 1411 | Ga0157369_10178167 | |||
| 1412 | Ga0157369_10306347 | |||
| 1413 | Ga0157369_10446533 | |||
| 1414 | Ga0157369_11018033 | |||
| 1415 | Ga0157369_11199167 | |||
| 1416 | Ga0157374_10082348 | |||
| 1417 | Ga0157374_11030678 | |||
| 1418 | Ga0157374_11108913 | |||
| 1419 | Ga0157374_11732881 | |||
| 1420 | Ga0157378_10661121 | |||
| 1421 | Ga0157378_11973173 | |||
| 1422 | Ga0163162_10173276 | |||
| 1423 | Ga0163162_10534838 | |||
| 1424 | Ga0157372_10128579 | |||
| 1425 | Ga0157372_10239221 | |||
| 1426 | Ga0157372_10764492 | |||
| 1427 | Ga0157372_10989565 | |||
| 1428 | Ga0157372_11043224 | |||
| 1429 | Ga0157372_11546062 | |||
| 1430 | Ga0157372_11741578 | |||
| 1431 | Ga0157372_13443072 | |||
| 1432 | Ga0157375_10014213 | |||
| 1433 | Ga0157375_10347581 | |||
| 1434 | Ga0157375_11099479 | |||
| 1435 | Ga0157375_11474049 | |||
| 1436 | Ga0157375_12436965 | |||
| 1437 | Ga0163163_10004668 | |||
| 1438 | Ga0163163_10650842 | |||
| 1439 | Ga0163163_11109423 | |||
| 1440 | Ga0163163_11250715 | |||
| 1441 | Ga0163163_11511167 | |||
| 1442 | Ga0163163_12281737 | |||
| 1443 | Ga0157380_10070525 | |||
| 1444 | Ga0157380_10553982 | |||
| 1445 | Ga0157380_11584968 | |||
| 1446 | Ga0157380_13229326 | |||
| 1447 | Ga0182008_10081757 | |||
| 1448 | Ga0182008_10718816 | |||
| 1449 | Ga0182008_10719550 | |||
| 1450 | Ga0157377_10246154 | |||
| 1451 | Ga0157377_10372572 | |||
| 1452 | Ga0157377_11695878 | |||
| 1453 | Ga0157379_10652786 | |||
| 1454 | Ga0157376_10266547 | |||
| 1455 | Ga0157376_10439763 | |||
| 1456 | Ga0157376_10802911 | |||
| 1457 | Ga0182005_1161971 | |||
| 1458 | Ga0206356_10209413 | |||
| 1459 | Ga0206356_10501215 | |||
| 1460 | Ga0206356_11742300 | |||
| 1461 | Ga0206354_10981450 | |||
| 1462 | Ga0206354_11201956 | |||
| 1463 | Ga0206354_11469124 | |||
| 1464 | Ga0206353_10253354 | |||
| 1465 | Ga0206353_10492582 | |||
| 1466 | Ga0206353_10783374 | |||
| 1467 | Ga0206353_11459877 | |||
| 1468 | Ga0206353_11534795 | |||
| 1469 | Ga0206353_11591169 | |||
| 1470 | Ga0206353_11725212 | |||
| 1471 | Ga0206353_11802624 | |||
| 1472 | Ga0206353_11968226 | |||
| 1473 | Ga0206353_12029088 | |||
| 1474 | Ga0154015_1217639 | |||
| 1475 | Ga0213876_10556986 | |||
| 1476 | Ga0207697_10542877 | |||
| 1477 | Ga0207656_10180310 | |||
| 1478 | Ga0207713_1073728 | |||
| 1479 | Ga0207692_10052395 | |||
| 1480 | Ga0207688_10015915 | |||
| 1481 | Ga0207688_10145162 | |||
| 1482 | Ga0207688_10201689 | |||
| 1483 | Ga0207688_10427961 | |||
| 1484 | Ga0207688_10705121 | |||
| 1485 | Ga0207680_10979493 | |||
| 1486 | Ga0207647_10003439 | |||
| 1487 | Ga0207647_10007825 | |||
| 1488 | Ga0207647_10456002 | |||
| 1489 | Ga0207699_10262042 | |||
| 1490 | Ga0207643_10003225 | |||
| 1491 | Ga0207705_10082222 | |||
| 1492 | Ga0207705_10142563 | |||
| 1493 | Ga0207705_10250644 | |||
| 1494 | Ga0207705_11188351 | |||
| 1495 | Ga0207654_10019979 | |||
| 1496 | Ga0207654_10333340 | |||
| 1497 | Ga0207707_10059649 | |||
| 1498 | Ga0207707_10075744 | |||
| 1499 | Ga0207707_10299266 | |||
| 1500 | Ga0207695_10006918 | |||
| 1501 | Ga0207695_10126089 | |||
| 1502 | Ga0207695_10322160 | |||
| 1503 | Ga0207695_10357340 | |||
| 1504 | Ga0207671_10000180 | |||
| 1505 | Ga0207671_10023522 | |||
| 1506 | Ga0207671_10837421 | |||
| 1507 | Ga0207693_10180146 | |||
| 1508 | Ga0207663_10081950 | |||
| 1509 | Ga0207660_10070880 | |||
| 1510 | Ga0207660_10161250 | |||
| 1511 | Ga0207660_10834357 | |||
| 1512 | Ga0207660_11006279 | |||
| 1513 | Ga0207660_11133789 | |||
| 1514 | Ga0207662_10338468 | |||
| 1515 | Ga0207662_10604825 | |||
| 1516 | Ga0207657_10049534 | |||
| 1517 | Ga0207657_10065642 | |||
| 1518 | Ga0207657_10150929 | |||
| 1519 | Ga0207657_10174857 | |||
| 1520 | Ga0207657_10382852 | |||
| 1521 | Ga0207657_11036645 | |||
| 1522 | Ga0207649_10017149 | |||
| 1523 | Ga0207649_10154832 | |||
| 1524 | Ga0207649_10223741 | |||
| 1525 | Ga0207649_10360486 | |||
| 1526 | Ga0207649_10634695 | |||
| 1527 | Ga0207652_10053079 | |||
| 1528 | Ga0207652_10086777 | |||
| 1529 | Ga0207652_10102311 | |||
| 1530 | Ga0207652_10113935 | |||
| 1531 | Ga0207652_10120269 | |||
| 1532 | Ga0207652_10198842 | |||
| 1533 | Ga0207652_10206884 | |||
| 1534 | Ga0207652_10331990 | |||
| 1535 | Ga0207652_10564150 | |||
| 1536 | Ga0207652_10890200 | |||
| 1537 | Ga0207652_11367724 | |||
| 1538 | Ga0207681_10259169 | |||
| 1539 | Ga0207681_11721101 | |||
| 1540 | Ga0207694_10002826 | |||
| 1541 | Ga0207694_10316726 | |||
| 1542 | Ga0207694_10908707 | |||
| 1543 | Ga0207694_11652966 | |||
| 1544 | Ga0207650_10184259 | |||
| 1545 | Ga0207650_10642530 | |||
| 1546 | Ga0207650_10801995 | |||
| 1547 | Ga0207659_10021793 | |||
| 1548 | Ga0207659_10387051 | |||
| 1549 | Ga0207687_10018666 | |||
| 1550 | Ga0207687_10038236 | |||
| 1551 | Ga0207687_10059898 | |||
| 1552 | Ga0207687_10082809 | |||
| 1553 | Ga0207687_10213984 | |||
| 1554 | Ga0207687_10225087 | |||
| 1555 | Ga0207687_11439943 | |||
| 1556 | Ga0207700_10286589 | |||
| 1557 | Ga0207700_10438529 | |||
| 1558 | Ga0207700_10911263 | |||
| 1559 | Ga0207664_10066052 | |||
| 1560 | Ga0207644_10097942 | |||
| 1561 | Ga0207644_10372107 | |||
| 1562 | Ga0207690_10096974 | |||
| 1563 | Ga0207690_10157898 | |||
| 1564 | Ga0207690_10468679 | |||
| 1565 | Ga0207706_10030957 | |||
| 1566 | Ga0207686_10298069 | |||
| 1567 | Ga0207686_10502841 | |||
| 1568 | Ga0207709_10106024 | |||
| 1569 | Ga0207709_10541841 | |||
| 1570 | Ga0207670_10077151 | |||
| 1571 | Ga0207669_10139963 | |||
| 1572 | Ga0207704_10145443 | |||
| 1573 | Ga0207704_10660509 | |||
| 1574 | Ga0207704_10719234 | |||
| 1575 | Ga0207665_10448483 | |||
| 1576 | Ga0207691_10053830 | |||
| 1577 | Ga0207691_10187692 | |||
| 1578 | Ga0207711_10361905 | |||
| 1579 | Ga0207689_10001169 | |||
| 1580 | Ga0207689_10028723 | |||
| 1581 | Ga0207689_10510330 | |||
| 1582 | Ga0207661_10010352 | |||
| 1583 | Ga0207661_10034020 | |||
| 1584 | Ga0207661_10090655 | |||
| 1585 | Ga0207661_10135068 | |||
| 1586 | Ga0207661_10144746 | |||
| 1587 | Ga0207661_10732502 | |||
| 1588 | Ga0207661_10762640 | |||
| 1589 | Ga0207661_11113587 | |||
| 1590 | Ga0207661_11924815 | |||
| 1591 | Ga0207679_10018405 | |||
| 1592 | Ga0207667_10012023 | |||
| 1593 | Ga0207667_10031551 | |||
| 1594 | Ga0207667_10031902 | |||
| 1595 | Ga0207667_10379626 | |||
| 1596 | Ga0207667_10543525 | |||
| 1597 | Ga0207667_12177342 | |||
| 1598 | Ga0207651_10378142 | |||
| 1599 | Ga0207651_11441025 | |||
| 1600 | Ga0207712_10196417 | |||
| 1601 | Ga0207712_10197807 | |||
| 1602 | Ga0207668_10141015 | |||
| 1603 | Ga0207668_10825937 | |||
| 1604 | Ga0207668_11079087 | |||
| 1605 | Ga0207640_10037320 | |||
| 1606 | Ga0207640_11654091 | |||
| 1607 | Ga0207640_11695357 | |||
| 1608 | Ga0207658_10010475 | |||
| 1609 | Ga0207658_11002639 | |||
| 1610 | Ga0207658_11104392 | |||
| 1611 | Ga0207658_11385531 | |||
| 1612 | Ga0207677_10202064 | |||
| 1613 | Ga0207677_10262806 | |||
| 1614 | Ga0207677_10909833 | |||
| 1615 | Ga0207703_10348193 | |||
| 1616 | Ga0207678_10009914 | |||
| 1617 | Ga0207678_10041641 | |||
| 1618 | Ga0207678_10070452 | |||
| 1619 | Ga0207678_10189731 | |||
| 1620 | Ga0207678_10440558 | |||
| 1621 | Ga0207678_11150882 | |||
| 1622 | Ga0207708_10105932 | |||
| 1623 | Ga0207708_10177530 | |||
| 1624 | Ga0207702_10007680 | |||
| 1625 | Ga0207702_10026302 | |||
| 1626 | Ga0207702_10079290 | |||
| 1627 | Ga0207702_10229548 | |||
| 1628 | Ga0207702_10235042 | |||
| 1629 | Ga0207702_10535553 | |||
| 1630 | Ga0207702_10852147 | |||
| 1631 | Ga0207641_10038739 | |||
| 1632 | Ga0207641_11591223 | |||
| 1633 | Ga0207648_10133754 | |||
| 1634 | Ga0207648_10146885 | |||
| 1635 | Ga0207648_10634377 | |||
| 1636 | Ga0207676_10024140 | |||
| 1637 | Ga0207676_11641946 | |||
| 1638 | Ga0207676_11955346 | |||
| 1639 | Ga0207674_10005965 | |||
| 1640 | Ga0207674_10125528 | |||
| 1641 | Ga0207674_10630045 | |||
| 1642 | Ga0207674_10847971 | |||
| 1643 | Ga0207674_11180006 | |||
| 1644 | Ga0207674_11277990 | |||
| 1645 | Ga0207674_11775929 | |||
| 1646 | Ga0207675_100128089 | |||
| 1647 | Ga0207675_100181403 | |||
| 1648 | Ga0207675_100350568 | |||
| 1649 | Ga0207683_10016697 | |||
| 1650 | Ga0207683_10029609 | |||
| 1651 | Ga0207683_10367163 | |||
| 1652 | Ga0207683_10497592 | |||
| 1653 | Ga0207683_10948406 | |||
| 1654 | Ga0207698_10013815 | |||
| 1655 | Ga0207698_10019257 | |||
| 1656 | Ga0207698_10070478 | |||
| 1657 | Ga0207698_10181108 | |||
| 1658 | Ga0207698_10400601 | |||
| 1659 | Ga0207698_10761554 | |||
| 1660 | Ga0207698_10881648 | |||
| 1661 | Ga0207698_11088520 | |||
| 1662 | Ga0207698_11230140 | |||
| 1663 | Ga0207698_11432070 | |||
| 1664 | Ga0207698_12743525 | |||
| 1665 | Ga0209813_10072119 | |||
| 1666 | Ga0207428_10031985 | |||
| 1667 | Ga0207428_10179231 | |||
| 1668 | Ga0268266_10278026 | |||
| 1669 | Ga0268266_10283801 | |||
| 1670 | Ga0268266_11326553 | |||
| 1671 | Ga0268265_10068694 | |||
| 1672 | Ga0268265_10377062 | |||
| 1673 | Ga0268264_10142821 | |||
| 1674 | Ga0268264_10420309 | |||
| 1675 | Ga0265334_10155733 | |||
| 1676 | Ga0307517_10247552 | |||
| 1677 | Ga0307515_10019377 | |||
| 1678 | Ga0307515_10253512 | |||
| 1679 | Ga0307515_10467813 | |||
| 1680 | Ga0265338_10041533 | |||
| 1681 | Ga0265338_10229138 | |||
| 1682 | Ga0307512_10208165 | |||
| 1683 | Ga0265325_10015736 | |||
| 1684 | Ga0265325_10394833 | |||
| 1685 | Ga0265340_10011328 | |||
| 1686 | Ga0265340_10077734 | |||
| 1687 | Ga0265339_10282975 | |||
| 1688 | Ga0265331_10120887 | |||
| 1689 | Ga0265316_10261411 | |||
| 1690 | Ga0307513_10241078 | |||
| 1691 | Ga0307513_10459670 | |||
| 1692 | Ga0307513_10478690 | |||
| 1693 | Ga0307509_10768249 | |||
| 1694 | Ga0307408_100238674 | |||
| 1695 | Ga0307408_101007471 | |||
| 1696 | Ga0307408_101083314 | |||
| 1697 | Ga0307408_101230804 | |||
| 1698 | Ga0307408_101366575 | |||
| 1699 | Ga0307408_102164367 | |||
| 1700 | Ga0307408_102299947 | |||
| 1701 | Ga0265313_10053609 | |||
| 1702 | Ga0307508_10415470 | |||
| 1703 | Ga0265314_10659394 | |||
| 1704 | Ga0265342_10504977 | |||
| 1705 | Ga0316576_10327338 | |||
| 1706 | Ga0316578_10032880 | |||
| 1707 | Ga0316578_10344951 | |||
| 1708 | Ga0307405_10040001 | |||
| 1709 | Ga0307405_10105332 | |||
| 1710 | Ga0307405_11500786 | |||
| 1711 | Ga0316577_10438547 | |||
| 1712 | Ga0307413_10018939 | |||
| 1713 | Ga0307413_10035726 | |||
| 1714 | Ga0307413_10439510 | |||
| 1715 | Ga0307413_10458637 | |||
| 1716 | Ga0307413_10745155 | |||
| 1717 | Ga0307413_10870552 | |||
| 1718 | Ga0307413_11295698 | |||
| 1719 | Ga0307518_10410108 | |||
| 1720 | Ga0307410_10013296 | |||
| 1721 | Ga0307410_10130085 | |||
| 1722 | Ga0307410_10152421 | |||
| 1723 | Ga0307410_10153917 | |||
| 1724 | Ga0307410_10201574 | |||
| 1725 | Ga0307410_10315805 | |||
| 1726 | Ga0307410_10565793 | |||
| 1727 | Ga0307410_10786929 | |||
| 1728 | Ga0307410_11018117 | |||
| 1729 | Ga0307406_10101991 | |||
| 1730 | Ga0307406_10119133 | |||
| 1731 | Ga0307406_10212181 | |||
| 1732 | Ga0307406_10319150 | |||
| 1733 | Ga0307406_10360075 | |||
| 1734 | Ga0307406_10517458 | |||
| 1735 | Ga0307406_11265135 | |||
| 1736 | Ga0307406_11991056 | |||
| 1737 | Ga0307407_10329707 | |||
| 1738 | Ga0307407_10386360 | |||
| 1739 | Ga0307407_10525143 | |||
| 1740 | Ga0307407_10990279 | |||
| 1741 | Ga0307412_10540046 | |||
| 1742 | Ga0307412_10739058 | |||
| 1743 | Ga0307409_100018170 | |||
| 1744 | Ga0307409_100054706 | |||
| 1745 | Ga0307409_100093039 | |||
| 1746 | Ga0307409_100185867 | |||
| 1747 | Ga0307409_100192457 | |||
| 1748 | Ga0307409_100214497 | |||
| 1749 | Ga0307409_100247420 | |||
| 1750 | Ga0307409_100264041 | |||
| 1751 | Ga0307409_100297480 | |||
| 1752 | Ga0307409_100610573 | |||
| 1753 | Ga0307409_100710153 | |||
| 1754 | Ga0307409_100824932 | |||
| 1755 | Ga0307409_100910673 | |||
| 1756 | Ga0307409_102746275 | |||
| 1757 | Ga0307409_102845599 | |||
| 1758 | Ga0307416_100040268 | |||
| 1759 | Ga0307416_100125671 | |||
| 1760 | Ga0307416_100157387 | |||
| 1761 | Ga0307416_100169193 | |||
| 1762 | Ga0307416_100357423 | |||
| 1763 | Ga0307416_100363379 | |||
| 1764 | Ga0307416_100506247 | |||
| 1765 | Ga0307416_100676462 | |||
| 1766 | Ga0307416_100732988 | |||
| 1767 | Ga0307416_100851845 | |||
| 1768 | Ga0307416_101038490 | |||
| 1769 | Ga0307416_101704845 | |||
| 1770 | Ga0307416_102390921 | |||
| 1771 | Ga0307416_103690812 | |||
| 1772 | Ga0307414_10069035 | |||
| 1773 | Ga0307414_10278549 | |||
| 1774 | Ga0307414_10286254 | |||
| 1775 | Ga0307414_10346304 | |||
| 1776 | Ga0307414_10442287 | |||
| 1777 | Ga0307414_10727867 | |||
| 1778 | Ga0307411_10059795 | |||
| 1779 | Ga0307411_10168475 | |||
| 1780 | Ga0307411_10405511 | |||
| 1781 | Ga0307411_10719490 | |||
| 1782 | Ga0307411_11658777 | |||
| 1783 | Ga0307411_11701008 | |||
| 1784 | Ga0307411_12015262 | |||
| 1785 | Ga0307415_100014020 | |||
| 1786 | Ga0307415_100031365 | |||
| 1787 | Ga0307415_100031413 | |||
| 1788 | Ga0307415_100069802 | |||
| 1789 | Ga0307415_100112048 | |||
| 1790 | Ga0307415_100384432 | |||
| 1791 | Ga0307415_100655157 | |||
| 1792 | Ga0307415_101189108 | |||
| 1793 | Ga0307415_101316600 | |||
| 1794 | Ga0307415_101363641 | |||
| 1795 | Ga0307415_101376492 | |||
| 1796 | Ga0316574_0097508 | |||
| 1797 | Ga0373931_0252597 | |||
| 1798 | Ga0373935_0753138 | |||
| 1799 | Ga0373947_0539458 | |||
| 1800 | Ga0373937_0248938 | |||
| 1801 | Ga0316584_0484077 | |||
| 1802 | Ga0395899_0132731 | |||
| 1803 | Ga0395900_0170120 | |||
| 1804 | Ga0395900_0503780 | |||
| 1805 | Ga0395900_1055350 | |||
| 1806 | Ga0395900_1112404 | |||
| 1807 | Ga0395900_1710531 | |||
| 1808 | Ga0395898_0106280 | |||
| 1809 | Ga0395898_0173523 | |||
| 1810 | Ga0395898_0213164 | |||
| 1811 | Ga0395898_0743028 | |||
| 1812 | Ga0395905_0917547 | |||
| 1813 | Ga0395901_0075412 | |||
| 1814 | Ga0395901_0092995 | |||
| 1815 | Ga0395901_0119980 | |||
| 1816 | Ga0395901_0242836 | |||
| 1817 | Ga0395901_0270540 | |||
| 1818 | Ga0395901_0460571 | |||
| 1819 | Ga0395901_0638734 | |||
| 1820 | Ga0395901_1800314 | |||
| 1821 | Ga0436365_0298596 | |||
| 1822 | Ga0436365_0506818 | |||
| 1823 | Ga0436365_0556406 | |||
| 1824 | Ga0436363_1246746 | |||
| 1825 | Ga0436363_1687996 | |||
| 1826 | Ga0439465_0135739 | |||
| 1827 | Ga0451787_025773 | |||
| 1828 | Ga0451789_0555869 | |||
| 1829 | Ga0451791_1575760 | |||
| 1830 | Ga0451793_1387252 | |||
| 1831 | Ga0451797_0104719 | |||
| 1832 | Ga0451798_0565100 | |||
| 1833 | Ga0451800_1439755 | |||
| 1834 | Ga0451802_0337613 | |||
| 1835 | Ga0451807_0035181 | |||
| 1836 | Ga0451807_1178085 | |||
| 1837 | Ga0451835_1002227 | |||
| 1838 | Ga0451837_0043710 | |||
| 1839 | Ga0451843_0490284 | |||
| 1840 | Ga0451853_1642636 | |||
| 1841 | Ga0451853_1991345 | |||
| 1842 | Ga0451853_2282637 | |||
| 1843 | Ga0451853_3845939 | |||
| 1844 | Ga0439448_0096658 | |||
| 1845 | Ga0439451_020780 | |||
| 1846 | Ga0450906_111668 | |||
| 1847 | Ga0439435_0170374 | |||
| 1848 | Ga0439464_0102498 | |||
| 1849 | Ga0439460_0239677 | |||
| 1850 | Ga0450901_035297 | |||
| 1851 | Ga0451577_0211263 | |||
| 1852 | Ga0439440_0059792 | |||
| 1853 | Ga0466969_0040030 | |||
| 1854 | Ga0466969_0083423 | |||
| 1855 | Ga0466969_0408815 | |||
| 1856 | Ga0466972_0156389 | |||
| 1857 | Ga0466972_0519466 | |||
| 1858 | Ga0466965_0156433 | |||
| 1859 | Ga0466965_0164631 | |||
| 1860 | Ga0466965_0192732 | |||
| 1861 | Ga0466965_0366778 | |||
| 1862 | Ga0466965_0532577 | |||
| 1863 | Ga0466966_0012157 | |||
| 1864 | Ga0466966_0031407 | |||
| 1865 | Ga0466966_0039724 | |||
| 1866 | Ga0466966_0043544 | |||
| 1867 | Ga0466966_0083076 | |||
| 1868 | Ga0466966_0155547 | |||
| 1869 | Ga0466966_0250410 | |||
| 1870 | Ga0466966_0557059 | |||
| 1871 | Ga0466961_0011001 | |||
| 1872 | Ga0466961_0016441 | |||
| 1873 | Ga0466961_0023676 | |||
| 1874 | Ga0466961_0029792 | |||
| 1875 | Ga0466961_0063543 | |||
| 1876 | Ga0466961_0242283 | |||
| 1877 | Ga0466961_0629025 | |||
| 1878 | Ga0466963_0004114 | |||
| 1879 | Ga0466963_0005135 | |||
| 1880 | Ga0466963_0024251 | |||
| 1881 | Ga0466963_0026309 | |||
| 1882 | Ga0466963_0029747 | |||
| 1883 | Ga0466963_0107800 | |||
| 1884 | Ga0466963_0202263 | |||
| 1885 | Ga0466963_0271392 | |||
| 1886 | Ga0466963_0346630 | |||
| 1887 | Ga0466963_0530133 | |||
| 1888 | Ga0466963_0811094 | |||
| 1889 | Ga0466964_0354488 | |||
| 1890 | Ga0466971_0054323 | |||
| 1891 | Ga0466971_0090823 | |||
| 1892 | Ga0466970_0001419 | |||
| 1893 | Ga0466970_0033649 | |||
| 1894 | Ga0466970_0034741 | |||
| 1895 | Ga0466970_0125453 | |||
| 1896 | Ga0466970_0156057 | |||
| 1897 | Ga0466970_0446194 | |||
| 1898 | Ga0466970_0593083 | |||
| 1899 | Ga0466970_0884922 | |||
| 1900 | Ga0466957_0015567 | |||
| 1901 | Ga0466957_0126797 | |||
| 1902 | Ga0466957_0588234 | |||
| 1903 | Ga0466957_0684994 | |||
| 1904 | Ga0466957_1204995 | |||
| 1905 | Ga0466957_1265409 | |||
| 1906 | Ga0466960_0083249 | |||
| 1907 | Ga0466960_0399971 | |||
| 1908 | Ga0466959_0005804 | |||
| 1909 | Ga0466959_0089149 | |||
| 1910 | Ga0466959_0164425 | |||
| 1911 | Ga0466959_0254262 | |||
| 1912 | Ga0466959_0277332 | |||
| 1913 | Ga0466959_0284090 | |||
| 1914 | Ga0466959_1122336 | |||
| 1915 | Ga0466958_0009062 | |||
| 1916 | Ga0466958_0030710 | |||
| 1917 | Ga0466958_0043089 | |||
| 1918 | Ga0466958_0054412 | |||
| 1919 | Ga0466958_0291098 | |||
| 1920 | Ga0466958_0309681 | |||
| 1921 | Ga0466958_0312002 | |||
| 1922 | Ga0466958_0433527 | |||
| 1923 | Ga0466967_0004748 | |||
| 1924 | Ga0466967_0055840 | |||
| 1925 | Ga0466967_0057734 | |||
| 1926 | Ga0466967_0112084 | |||
| 1927 | Ga0466967_0128174 | |||
| 1928 | Ga0466967_0144209 | |||
| 1929 | Ga0466967_0144597 | |||
| 1930 | Ga0466967_0303876 | |||
| 1931 | Ga0466967_0712248 | |||
| 1932 | Ga0466967_0715917 | |||
| 1933 | Ga0466967_0731841 | |||
| 1934 | Ga0495627_082896 | |||
| 1935 | Ga0495629_0142547 | |||
| 1936 | Ga0495629_0171186 | |||
| 1937 | Ga0495629_0371528 | |||
| 1938 | Ga0495629_0574777 | |||
| 1939 | Ga0495651_0009236 | |||
| 1940 | Ga0495651_0587812 | |||
| 1941 | Ga0495582_0155605 | |||
| 1942 | Ga0495582_0279728 | |||
| 1943 | Ga0495582_0541696 | |||
| 1944 | Ga0495582_0826354 | |||
| 1945 | Ga0495662_0223513 | |||
| 1946 | Ga0495664_0378632 | |||
| 1947 | Ga0495664_0700918 | |||
| 1948 | Ga0495585_0065269 | |||
| 1949 | Ga0495596_0033042 | |||
| 1950 | Ga0495608_0068406 | |||
| 1951 | Ga0495608_0945458 | |||
| 1952 | Ga0495618_0337412 | |||
| 1953 | Ga0495628_0649497 | |||
| 1954 | Ga0495644_0097810 | |||
| 1955 | Ga0495652_0000573 | |||
| 1956 | Ga0495652_0082868 | |||
| 1957 | Ga0495665_0471396 | |||
| 1958 | Ga0495640_0129946 | |||
| 1959 | Ga0495586_0117203 | |||
| 1960 | Ga0495645_0030803 | |||
| 1961 | Ga0495645_0743806 | |||
| 1962 | Ga0495622_0048076 | |||
| 1963 | Ga0495667_0073771 | |||
| 1964 | Ga0495667_0516403 | |||
| 1965 | Ga0495667_0901173 | |||
| 1966 | Ga0495656_0006406 | |||
| 1967 | Ga0495656_0701234 | |||
| 1968 | Ga0495635_0226027 | |||
| 1969 | Ga0495635_0410470 | |||
| 1970 | Ga0495635_0861799 | |||
| 1971 | Ga0495588_0707533 | |||
| 1972 | Ga0495657_0380075 | |||
| 1973 | Ga0495647_0124038 | |||
| 1974 | Ga0495647_0310125 | |||
| 1975 | Ga0495658_0257741 | |||
| 1976 | Ga0495613_0771572 | |||
| 1977 | Ga0495670_0408140 | |||
| 1978 | Ga0495649_0398922 | |||
| 1979 | Ga0495649_0467496 | |||
| 1980 | Ga0495600_0024125 | |||
| 1981 | Ga0495581_0173834 | |||
| 1982 | Ga0495581_0663734 | |||
| 1983 | Ga0495581_0805113 | |||
| 1984 | Ga0495604_0044539 | |||
| 1985 | Ga0495604_0660183 | |||
| 1986 | Ga0495674_0141022 | |||
| 1987 | Ga0495676_0196797 | |||
| 1988 | Ga0495680_0144168 | |||
| 1989 | Ga0495675_0016732 | |||
| 1990 | Ga0495675_0335208 | |||
| 1991 | Ga0495675_0521005 | |||
| 1992 | Ga0495593_0315469 | |||
| 1993 | Ga0495593_0432896 | |||
| 1994 | Ga0495593_0586240 | |||
| 1995 | Ga0495614_0120449 | |||
| 1996 | Ga0495615_0101098 | |||
| 1997 | Ga0495615_0201013 | |||
| 1998 | Ga0496100_0080531 | |||
| 1999 | Ga0496100_0344712 | |||
| 2000 | Ga0496100_0476819 | |||
| 2001 | Ga0496100_1408036 | |||
| 2002 | Ga0496101_0036573 | |||
| 2003 | Ga0496101_0115818 | |||
| 2004 | Ga0496101_0299731 | |||
| 2005 | Ga0496102_0000735 | |||
| 2006 | Ga0496102_0006399 | |||
| 2007 | Ga0496102_0022781 | |||
| 2008 | Ga0496102_0227878 | |||
| 2009 | Ga0496102_0419078 | |||
| 2010 | Ga0496102_0597183 | |||
| 2011 | Ga0496103_0005567 | |||
| 2012 | Ga0496103_0255400 | |||
| 2013 | Ga0496103_0822650 | |||
| 2014 | Ga0496104_0001342 | |||
| 2015 | Ga0496104_0040359 | |||
| 2016 | Ga0496104_0085266 | |||
| 2017 | Ga0496104_0247315 | |||
| 2018 | Ga0496104_0308384 | |||
| 2019 | Ga0496104_0347137 | |||
| 2020 | Ga0496104_0418393 | |||
| 2021 | Ga0496104_0466748 | |||
| 2022 | Ga0496104_0974916 | |||
| 2023 | Ga0496105_0016468 | |||
| 2024 | Ga0496105_0036384 | |||
| 2025 | Ga0496105_0136573 | |||
| 2026 | Ga0496105_0178579 | |||
| 2027 | Ga0496105_0217889 | |||
| 2028 | Ga0496105_0261919 | |||
| 2029 | Ga0496105_0499261 | |||
| 2030 | Ga0496105_0504088 | |||
| 2031 | Ga0496106_0127850 | |||
| 2032 | Ga0496106_0166110 | |||
| 2033 | Ga0496106_0608738 | |||
| 2034 | Ga0496106_1288219 | |||
| 2035 | Ga0496107_0034677 | |||
| 2036 | Ga0496107_0520285 | |||
| 2037 | Ga0496108_0000623 | |||
| 2038 | Ga0496108_0023913 | |||
| 2039 | Ga0496108_0061325 | |||
| 2040 | Ga0496108_0112912 | |||
| 2041 | Ga0496108_0311335 | |||
| 2042 | Ga0496108_0479193 | |||
| 2043 | Ga0496108_0585941 | |||
| 2044 | Ga0496108_1152676 | |||
| 2045 | Ga0496108_1515624 | |||
| 2046 | Ga0496108_1542225 | |||
| 2047 | Ga0496109_0009375 | |||
| 2048 | Ga0496109_0017787 | |||
| 2049 | Ga0496109_0089327 | |||
| 2050 | Ga0496109_0212317 | |||
| 2051 | Ga0496109_0213703 | |||
| 2052 | Ga0496109_0266325 | |||
| 2053 | Ga0496109_0392717 | |||
| 2054 | Ga0496109_0525856 | |||
| 2055 | Ga0496109_1063750 | |||
| 2056 | Ga0496109_1531082 | |||
| 2057 | Ga0496110_0004825 | |||
| 2058 | Ga0496110_0216055 | |||
| 2059 | Ga0496110_0385276 | |||
| 2060 | Ga0496110_0467113 | |||
| 2061 | Ga0496110_0471796 | |||
| 2062 | Ga0496110_0585706 | |||
| 2063 | Ga0496110_0840100 | |||
| 2064 | Ga0496111_0000994 | |||
| 2065 | Ga0496111_0007779 | |||
| 2066 | Ga0496111_0037201 | |||
| 2067 | Ga0496111_0317855 | |||
| 2068 | Ga0496111_0473304 | |||
| 2069 | Ga0496112_0112173 | |||
| 2070 | Ga0496112_1440413 | |||
| 2071 | Ga0496113_0014312 | |||
| 2072 | Ga0496113_0024900 | |||
| 2073 | Ga0496113_0039753 | |||
| 2074 | Ga0496113_0043090 | |||
| 2075 | Ga0496113_0106550 | |||
| 2076 | Ga0496113_0120854 | |||
| 2077 | Ga0496113_0249722 | |||
| 2078 | Ga0496113_0630253 | |||
| 2079 | Ga0496114_0001130 | |||
| 2080 | Ga0496114_0001454 | |||
| 2081 | Ga0496114_0007721 | |||
| 2082 | Ga0496114_0096811 | |||
| 2083 | Ga0496114_0119071 | |||
| 2084 | Ga0496114_0136307 | |||
| 2085 | Ga0496114_0193852 | |||
| 2086 | Ga0496114_0264001 | |||
| 2087 | Ga0496114_0274326 | |||
| 2088 | Ga0496114_0286998 | |||
| 2089 | Ga0496114_0288898 | |||
| 2090 | Ga0496114_0446478 | |||
| 2091 | Ga0496114_1730512 | |||
| 2092 | Ga0496115_0012178 | |||
| 2093 | Ga0496115_0078974 | |||
| 2094 | Ga0496115_0216321 | |||
| 2095 | Ga0496115_0532938 | |||
| 2096 | Ga0496115_1194829 | |||
| 2097 | Ga0496119_0000960 | |||
| 2098 | Ga0496120_0001834 | |||
| 2099 | Ga0496123_0053390 | |||
| 2100 | Ga0496124_0189176 | |||
| 2101 | Ga0496124_0318532 | |||
| 2102 | Ga0496124_0433443 | |||
| 2103 | Ga0496126_0000006 | |||
| 2104 | Ga0496126_0021047 | |||
| 2105 | Ga0496126_0068404 | |||
| 2106 | Ga0496126_0330995 | |||
| 2107 | Ga0501317_110782 | |||
| 2108 | Ga0501031_0010365 | |||
| 2109 | Ga0501031_0013183 | |||
| 2110 | Ga0501032_0160508 | |||
| 2111 | Ga0501032_0217545 | |||
| 2112 | Ga0501033_0036579 | |||
| 2113 | Ga0501034_0278084 | |||
| 2114 | Ga0501034_0935879 | |||
| 2115 | Ga0501036_0024649 | |||
| 2116 | Ga0501036_0089146 | |||
| 2117 | Ga0501036_0177974 | |||
| 2118 | Ga0501036_1453889 | |||
| 2119 | Ga0501037_0031898 | |||
| 2120 | Ga0501037_0055236 | |||
| 2121 | Ga0501038_0192810 | |||
| 2122 | Ga0501038_1044228 | |||
| 2123 | Ga0501038_1367958 | |||
| 2124 | Ga0501039_0065326 | |||
| 2125 | Ga0501039_0079105 | |||
| 2126 | Ga0501039_0415808 | |||
| 2127 | Ga0501039_0552261 | |||
| 2128 | Ga0501040_0015306 | |||
| 2129 | Ga0501040_0090626 | |||
| 2130 | Ga0501040_0299958 | |||
| 2131 | Ga0501040_0329770 | |||
| 2132 | Ga0501040_0614167 | |||
| 2133 | Ga0501041_0004209 | |||
| 2134 | Ga0501041_0017796 | |||
| 2135 | Ga0501041_0557763 | |||
| 2136 | Ga0501042_0008853 | |||
| 2137 | Ga0501042_0029797 | |||
| 2138 | Ga0501043_0014686 | |||
| 2139 | Ga0501043_0153115 | |||
| 2140 | Ga0501046_0042248 | |||
| 2141 | Ga0501046_0249867 | |||
| 2142 | Ga0501047_0011090 | |||
| 2143 | Ga0501047_0344857 | |||
| 2144 | Ga0501048_0013342 | |||
| 2145 | Ga0501048_0033546 | |||
| 2146 | Ga0501048_0130640 | |||
| 2147 | Ga0501048_1042579 | |||
| 2148 | Ga0501067_0507024 | |||
| 2149 | Ga0501068_0078828 | |||
| 2150 | Ga0501068_0080808 | |||
| 2151 | Ga0501069_0915709 | |||
| 2152 | Ga0501070_0056403 | |||
| 2153 | Ga0501070_0201135 | |||
| 2154 | Ga0501070_0505796 | |||
| 2155 | Ga0501071_0002813 | |||
| 2156 | Ga0501071_0241329 | |||
| 2157 | Ga0501072_0032716 | |||
| 2158 | Ga0501072_0044417 | |||
| 2159 | Ga0501073_0102156 | |||
| 2160 | Ga0501073_0425269 | |||
| 2161 | Ga0501074_0023291 | |||
| 2162 | Ga0501074_0133737 | |||
| 2163 | Ga0501075_0041137 | |||
| 2164 | Ga0501076_0010496 | |||
| 2165 | Ga0501076_0047264 | |||
| 2166 | Ga0501077_0030486 | |||
| 2167 | Ga0501246_037638 | |||
| 2168 | Ga0501079_0006491 | |||
| 2169 | Ga0501079_0218932 | |||
| 2170 | Ga0501079_0549205 | |||
| 2171 | Ga0501079_0907294 | |||
| 2172 | Ga0501080_0167369 | |||
| 2173 | Ga0501080_0186037 | |||
| 2174 | Ga0501080_0359058 | |||
| 2175 | Ga0501081_0028633 | |||
| 2176 | Ga0501081_0085638 | |||
| 2177 | Ga0501083_0980208 | |||
| 2178 | Ga0501035_0023004 | |||
| 2179 | Ga0501035_0266683 | |||
| 2180 | Ga0501035_0536331 | |||
| 2181 | Ga0501035_0607211 | |||
| 2182 | Ga0501044_0073543 | |||
| 2183 | Ga0501044_0305055 | |||
| 2184 | Ga0501044_0414233 | |||
| 2185 | Ga0501044_0420241 | |||
| 2186 | Ga0501044_0437578 | |||
| 2187 | Ga0501045_0044674 | |||
| 2188 | Ga0501045_0261705 | |||
| 2189 | Ga0501045_0715127 | |||
| 2190 | nmdc:mga00v17_3307_c1 | |||
| 2191 | nmdc:mga00v17_335263_c1 | |||
| 2192 | nmdc:mga0yw44_481290_c1 | |||
| 2193 | nmdc:mga0yw44_80957_c1 | |||
| 2194 | nmdc:mga0yw44_990912_c1 | |||
| 2195 | nmdc:mga06z11_350563_c1 | |||
| 2196 | nmdc:mga04h51_26732_c1 | |||
| 2197 | nmdc:mga07m45_152065_c1 | |||
| 2198 | nmdc:mga05p37_1586837_c1 | |||
| 2199 | nmdc:mga05p37_1821172_c1 | |||
| 2200 | nmdc:mga05p37_280242_c1 | |||
| 2201 | nmdc:mga09592_173844_c1 | |||
| 2202 | nmdc:mga09592_423676_c1 | |||
| 2203 | nmdc:mga09592_76003_c1 | |||
| 2204 | nmdc:mga06r32_274024_c1 | |||
| 2205 | nmdc:mga06r32_31347_c1 | |||
| 2206 | nmdc:mga08y16_139434_c1 | |||
| 2207 | nmdc:mga08y16_66404_c1 | |||
| 2208 | nmdc:mga0rr50_198003_c1 | |||
| 2209 | nmdc:mga08x19_40413_c1 | |||
| 2210 | Ga0495601_0044939 | |||
| 2211 | Ga0495601_0633460 | |||
| 2212 | Ga0495612_0000712 | |||
| 2213 | Ga0495612_0306470 | |||
| 2214 | Ga0495595_0010962 | |||
| 2215 | Ga0500646_0046481 | |||
| 2216 | Ga0500641_0003416 | |||
| 2217 | Ga0500573_0107851 | |||
| 2218 | Ga0501084_0020842 | |||
| 2219 | Ga0501084_0068010 | |||
| 2220 | Ga0501084_1563800 | |||
| 2221 | Ga0501084_1822667 | |||
| 2222 | Ga0501082_0021928 | |||
| 2223 | Ga0501082_0165241 | |||
| 2224 | Ga0501082_1518814 | |||
| 2225 | Ga0466962_0013525 | |||
| 2226 | Ga0466962_0117939 | |||
| 2227 | Ga0466962_0130751 | |||
| 2228 | Ga0466962_0148664 | |||
| 2229 | Ga0466962_0194975 | |||
| 2230 | Ga0530510_0059511 | |||
| 2231 | Ga0530510_0063017 | |||
| 2232 | Ga0530510_0500685 | |||
| 2233 | 2515850971 | |||
| 2234 | 2643849942 | |||
| 2235 | 2644016261 | |||
| 2236 | 2644135944 | |||
| 2237 | 2644178517 | |||
| 2238 | 2644444956 | |||
| 2239 | 2644456973 | |||
| 2240 | 2644537504 | |||
| 2241 | 2644609735 | |||
| 2242 | 2645719723 | |||
| 2243 | 2645726611 | |||
| 2244 | 2676476704 | |||
| 2245 | 2738695726 | |||
| 2246 | 2739326133 | |||
| 2247 | 2739605025 | |||
| 2248 | 2740168864 | |||
| 2249 | 2760308031 | |||
| 2250 | 2760623346 | |||
| 2251 | 2768643831 | |||
| 2252 | 2784472109 | |||
| 2253 | 2808874208 | |||
| 2254 | 2809028234 | |||
| 2255 | 2812374894 | |||
| 2256 | 2816425549 | |||
| 2257 | 2819427635 | |||
| 2258 | 2819666491 | |||
| 2259 | 2819691651 | |||
| 2260 | 2819729569 | |||
| 2261 | 2819744007 | |||
| 2262 | 2827630207 | |||
| 2263 | 2837273376 | |||
| 2264 | 2848552434 | |||
| 2265 | 2861524022 | |||
| 2266 | 2867346707 | |||
| 2267 | 2868093206 | |||
| 2268 | 2887444104 | |||
| 2269 | 2984594851 | |||
| 2270 | 2995468048 | |||
| 2271 | 3001891415 | |||
| 2272 | 8053952833 | |||
| 2273 | 8054611329 | |||
| 2274 | 8057572493 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy