F490620

General Info

Members Datasets Scaffolds Average Seq Length
1135 561 976 332

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0014402|Ga0495585_0014402_2659_3762
Length 367
Sequence MKRGAAAALENDHRMPLRRRVRFNESRFTITIRRHRMKFKPMTAVLLAATLISGSAFAQGPIVIKFSHVVANDTPKGKGALKFKELAEKATNGRVKVEVYPNSTLYKDKEEMEALQMGSVQMLAPSLAKFGPLGVKEFEAFDMPFIFPDTKALTRVTEGPAGKWFFSKLEPKGIRGLAYWDNGFKDMTANKPLHTPADFRGLKMRIQSSKVLDAQFRALGANPQVLAFSESYQALQTGVVDGTENTPSNLYTQKMHEVQKHMTISDHGYIGYAVIVNKNFWDKLPADIRTELEGAMKEATVYTNKIAQEENEQALEGIKKAGKTTIYTLTPAERAQWRTAMAPVYKQMEGRVGKDALQQIEKAVAAK

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
3 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
4 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
5 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
6 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
7 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
8 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
9 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
10 2547132512 Azospira oryzae 6a3 Isolate Unclassified
11 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
12 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
13 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
14 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
15 2643221638 Duganella sp. Root336D2 Isolate Unclassified
16 2643221645 Massilia sp. Root351 Isolate Unclassified
17 2643221664 Massilia sp. Root418 Isolate Unclassified
18 2738541280 Massilia sp. GV090 Isolate Unclassified
19 2738541300 Massilia sp. GV016 Isolate Unclassified
20 2738543018 Massilia sp. GV045 Isolate Unclassified
21 2738543030 Massilia sp. GV097 Isolate Unclassified
22 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
23 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
24 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
25 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
26 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
27 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
28 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
29 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
30 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
31 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
32 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
33 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
34 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
35 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
36 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
37 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
38 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
39 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
40 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
41 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
42 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
43 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
44 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
45 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
46 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
47 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
48 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
49 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
50 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
51 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
52 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
53 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
54 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
55 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
56 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
57 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
58 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
59 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
60 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
61 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
62 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
63 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
64 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
65 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
66 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
67 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
68 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
69 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
70 2922368715
71 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
72 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
73 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
74 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
75 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
76 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
77 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
78 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
79 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
80 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
81 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
82 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
83 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
84 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
85 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
86 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
87 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
88 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
89 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
90 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
91 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
92 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
93 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
94 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
95 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
96 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
97 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
98 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
99 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
100 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
101 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
102 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
103 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
104 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
105 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
106 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
107 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
108 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
109 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
110 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
111 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
112 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
113 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
114 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
115 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
116 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
117 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
118 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
119 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
120 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
121 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
122 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
123 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
124 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
125 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
126 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
127 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
128 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
129 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
130 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
131 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
132 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
133 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
134 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
135 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
136 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
137 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
138 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
139 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
140 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
141 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
142 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
143 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
144 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
145 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
146 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
147 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
148 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
149 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
150 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
151 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
153 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
154 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
155 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
156 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
157 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
158 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
159 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
160 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
161 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
162 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
163 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
164 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
165 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
166 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
167 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
168 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
169 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
170 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
171 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
172 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
173 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
174 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
175 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
176 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
177 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
178 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
179 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
180 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
181 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
182 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
183 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
184 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
185 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
186 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
187 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
188 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
189 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
190 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
191 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
192 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
193 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
194 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
195 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
196 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
197 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
198 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
199 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
200 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
201 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
202 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
203 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
204 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
205 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
206 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
207 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
208 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
209 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
210 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
211 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
212 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
213 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
214 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
215 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
216 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
217 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
218 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
219 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
220 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
221 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
222 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
223 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
224 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
225 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
226 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
227 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
228 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
229 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
231 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
232 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
233 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
235 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
236 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
237 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
238 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
239 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
241 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
242 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
285 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
286 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
287 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
288 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
289 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
292 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
293 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
294 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
295 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
296 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
297 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
298 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
299 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
300 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
301 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
302 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
303 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
304 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
305 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
306 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
307 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
308 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
309 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
310 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
311 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
312 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
313 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
314 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
315 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
316 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
317 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
318 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
319 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
320 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
321 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
322 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
323 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
324 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
325 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
326 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
327 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
328 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
329 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
330 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
331 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
332 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
333 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
334 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
335 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
336 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
337 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
338 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
339 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
340 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
341 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
342 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
343 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
344 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
345 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
346 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
347 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
348 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
349 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
350 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
351 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
352 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
353 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
354 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
355 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
356 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
357 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
358 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
359 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
360 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
361 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
362 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
363 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
364 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
365 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
366 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
367 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
368 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
369 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
370 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
371 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
372 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
373 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
374 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
375 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
376 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
377 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
378 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
379 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
380 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
381 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
382 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
383 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
384 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
385 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
386 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
387 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
388 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
389 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
390 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
391 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
392 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
393 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
394 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
395 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
396 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
397 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
398 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
399 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
400 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
401 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
402 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
403 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
404 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
405 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
406 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
407 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
408 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
409 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
410 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
411 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
412 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
413 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
414 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
415 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
416 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
417 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
418 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
419 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
420 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
421 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
422 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
423 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
424 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
425 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
426 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
427 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
428 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
429 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
430 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
431 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
432 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
433 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
434 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
435 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
436 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
437 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
438 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
439 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
440 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
441 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
442 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
443 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
444 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
445 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
446 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
447 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
448 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
449 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
450 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
451 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
452 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
453 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
454 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
455 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
456 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
457 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
458 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
459 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
460 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
461 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
462 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
463 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
464 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
465 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
466 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
469 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
470 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
472 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
473 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
474 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
475 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
476 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
478 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
479 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
480 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
481 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
482 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
483 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
484 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
485 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
486 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
487 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
488 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
489 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
490 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
491 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
492 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
493 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
494 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
495 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
496 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
497 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
498 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
499 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
500 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
501 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
502 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
503 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
504 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
505 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
506 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
507 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
508 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
509 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
510 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
511 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
512 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
513 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
514 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
515 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
516 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
517 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
518 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
519 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
520 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
521 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
522 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
523 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
524 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
525 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
526 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
527 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
528 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
535 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
536 639633007 Azoarcus olearius BH72 Isolate Unclassified
537 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
538 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
539 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
540 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
541 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
542 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
543 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
544 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
545 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
546 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
547 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
548 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
549 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
550 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
551 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
552 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
553 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
554 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
555 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
556 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
557 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
558 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
559 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
560 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
561 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.36
Metatranscriptomes 0.71
Isolates 13.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.13
Nodule 10.13
Rhizoplane 3
Rhizosphere 68.81
Stem 0
Stem Tuber 0
Unclassified 7.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1011548 3300001904 Bacteria 1436
2 JGI24739J22299_10032889 3300001989 Bacteria 1780
3 JGI25152J39213_1005661 3300002773 Bacteria 3580
4 JGI25150J39212_1008153 3300002774 Bacteria 2066
5 JGI25159J45721_1006309 3300002987 Bacteria 3569
6 JGI25406J46586_10008891 3300003203 Bacteria 4520
7 JGI25153J46596_10000317 3300003215 Bacteria 35509
8 JGI25153J46596_10001194 3300003215 Bacteria 15699
9 JGI25153J46596_10013246 3300003215 Bacteria 3499
10 JGI25160J50197_1003899 3300003354 Bacteria 6538
11 JGI25160J50197_1006813 3300003354 Bacteria 4574
12 JGI25161J50226_1003500 3300003374 Bacteria 3571
13 Ga0055526_1002983 3300003771 Bacteria 11083
14 Ga0055537_1000060 3300003773 Bacteria 79376
15 Ga0055537_1001054 3300003773 Bacteria 12373
16 Ga0055537_1007510 3300003773 Bacteria 2620
17 Ga0055524_1002530 3300003775 Bacteria 9361
18 Ga0055524_1019046 3300003775 Bacteria 2360
19 Ga0055534_1000009 3300003784 Bacteria 210256
20 Ga0055528_1000012 3300003790 Bacteria 182704
21 Ga0055528_1004175 3300003790 Bacteria 7027
22 Ga0055530_10003244 3300003791 Bacteria 9487
23 Ga0055530_10038187 3300003791 Bacteria 1195
24 Ga0055530_10038230 3300003791 Bacteria 1195
25 Ga0055531_10001264 3300003794 Bacteria 19144
26 Ga0055531_10010136 3300003794 Bacteria 4726
27 Ga0055543_1001666 3300004625 Bacteria 8449
28 Ga0055543_1019207 3300004625 Bacteria 1266
29 Ga0058863_11848090 3300004799 Bacteria 1175
30 Ga0065165_1000747 3300005262 Bacteria 44635
31 Ga0065165_1002482 3300005262 Bacteria 15509
32 Ga0065165_1025464 3300005262 Bacteria 1966
33 Ga0070658_10001397 3300005327 Bacteria 20608
34 Ga0070658_10025143 3300005327 Bacteria 4773
35 Ga0070658_10030736 3300005327 Bacteria 4314
36 Ga0070658_10067706 3300005327 Bacteria 2918
37 Ga0070658_10224419 3300005327 Bacteria 1590
38 Ga0070683_100012136 3300005329 Bacteria 7477
39 Ga0070683_100032799 3300005329 Bacteria 4733
40 Ga0070683_100123913 3300005329 Bacteria 2442
41 Ga0070683_100181899 3300005329 Bacteria 1996
42 Ga0070680_100010478 3300005336 Bacteria 7148
43 Ga0070680_100044005 3300005336 Bacteria 3627
44 Ga0070680_100047519 3300005336 Bacteria 3495
45 Ga0070680_100053370 3300005336 Bacteria 3300
46 Ga0070680_100089888 3300005336 Bacteria 2541
47 Ga0070680_100094453 3300005336 Bacteria 2479
48 Ga0070680_100153962 3300005336 Bacteria 1931
49 Ga0070682_100064172 3300005337 Bacteria 2331
50 Ga0070660_100045025 3300005339 Bacteria 3376
51 Ga0070660_100045797 3300005339 Bacteria 3350
52 Ga0070660_100051183 3300005339 Bacteria 3180
53 Ga0070660_100190313 3300005339 Bacteria 1662
54 Ga0070661_100296889 3300005344 Bacteria 1257
55 Ga0070668_100108226 3300005347 Bacteria 2210
56 Ga0070675_100057810 3300005354 Bacteria 3198
57 Ga0070675_100335793 3300005354 Bacteria 1338
58 Ga0070671_100013367 3300005355 Bacteria 6617
59 Ga0070671_100174947 3300005355 Bacteria 1816
60 Ga0070667_100260189 3300005367 Bacteria 1553
61 Ga0070709_10133151 3300005434 Bacteria 1699
62 Ga0070714_100128201 3300005435 Bacteria 2265
63 Ga0070714_100148050 3300005435 Bacteria 2113
64 Ga0070714_100216521 3300005435 Bacteria 1758
65 Ga0070714_100488805 3300005435 Bacteria 1173
66 Ga0070713_100005837 3300005436 Bacteria 8465
67 Ga0070713_100091223 3300005436 Bacteria 2621
68 Ga0070711_100045043 3300005439 Bacteria 2997
69 Ga0070662_100146759 3300005457 Bacteria 1833
70 Ga0070662_100239491 3300005457 Bacteria 1455
71 Ga0070681_10028622 3300005458 Bacteria 5603
72 Ga0070681_10050528 3300005458 Bacteria 4148
73 Ga0070681_10086048 3300005458 Bacteria 3096
74 Ga0070681_10200397 3300005458 Bacteria 1914
75 Ga0070698_100167635 3300005471 Bacteria 2138
76 Ga0070679_100002598 3300005530 Bacteria 16417
77 Ga0070679_100014503 3300005530 Bacteria 7570
78 Ga0070679_100028319 3300005530 Bacteria 5523
79 Ga0070679_100045886 3300005530 Bacteria 4354
80 Ga0070679_100079343 3300005530 Bacteria 3272
81 Ga0070679_100121730 3300005530 Bacteria 2593
82 Ga0070679_100122180 3300005530 Bacteria 2588
83 Ga0070684_100007833 3300005535 Bacteria 8332
84 Ga0070684_100045711 3300005535 Bacteria 3791
85 Ga0070684_100113316 3300005535 Bacteria 2434
86 Ga0070684_100227807 3300005535 Bacteria 1701
87 Ga0070684_100346413 3300005535 Bacteria 1366
88 Ga0068853_100003330 3300005539 Bacteria 12297
89 Ga0068853_100052372 3300005539 Bacteria 3516
90 Ga0068853_100059781 3300005539 Bacteria 3293
91 Ga0068853_100087383 3300005539 Bacteria 2736
92 Ga0068853_100108425 3300005539 Bacteria 2464
93 Ga0068853_100177834 3300005539 Bacteria 1929
94 Ga0070665_100332707 3300005548 Bacteria 1523
95 Ga0068855_100007325 3300005563 Bacteria 13370
96 Ga0068855_100007560 3300005563 Bacteria 13147
97 Ga0068855_100020915 3300005563 Bacteria 7846
98 Ga0068855_100029706 3300005563 Bacteria 6535
99 Ga0068855_100068946 3300005563 Bacteria 4116
100 Ga0068855_100137439 3300005563 Bacteria 2787
101 Ga0068855_100249395 3300005563 Bacteria 1980
102 Ga0068855_100418301 3300005563 Bacteria 1466
103 Ga0070664_100076642 3300005564 Bacteria 2874
104 Ga0070664_100338256 3300005564 Bacteria 1367
105 Ga0068857_100022493 3300005577 Bacteria 5547
106 Ga0068857_100232158 3300005577 Bacteria 1687
107 Ga0068856_100011621 3300005614 Bacteria 8539
108 Ga0068856_100112906 3300005614 Bacteria 2715
109 Ga0068856_100166874 3300005614 Bacteria 2213
110 Ga0068856_100320277 3300005614 Bacteria 1568
111 Ga0068856_100344986 3300005614 Bacteria 1507
112 Ga0068852_100024216 3300005616 Bacteria 4903
113 Ga0068852_100105730 3300005616 Bacteria 2550
114 Ga0068864_100171265 3300005618 Bacteria 1980
115 Ga0068851_10092505 3300005834 Bacteria 1594
116 Ga0068863_100558210 3300005841 Bacteria 1131
117 Ga0068858_100209764 3300005842 Bacteria 1843
118 Ga0068860_100000360 3300005843 Bacteria 60297
119 Ga0081455_10000450 3300005937 Bacteria 54201
120 Ga0081540_1024723 3300005983 Bacteria 3478
121 Ga0081539_10003915 3300005985 Bacteria 17301
122 Ga0070717_10176454 3300006028 Bacteria 1861
123 Ga0070717_10307747 3300006028 Bacteria 1410
124 Ga0075365_10050969 3300006038 Bacteria 2732
125 Ga0075365_10061252 3300006038 Bacteria 2513
126 Ga0075365_10093400 3300006038 Bacteria 2052
127 Ga0075368_10003442 3300006042 Bacteria 5283
128 Ga0075363_100002993 3300006048 Bacteria 7061
129 Ga0075364_10182273 3300006051 Bacteria 1421
130 Ga0070712_100083071 3300006175 Bacteria 2325
131 Ga0070712_100115479 3300006175 Bacteria 2012
132 Ga0075362_10094680 3300006177 Bacteria 1390
133 Ga0075367_10022359 3300006178 Bacteria 3546
134 Ga0075367_10039355 3300006178 Bacteria 2756
135 Ga0075369_10016047 3300006186 Bacteria 3015
136 Ga0075369_10030120 3300006186 Bacteria 2284
137 Ga0075366_10008295 3300006195 Bacteria 5770
138 Ga0075370_10059614 3300006353 Bacteria 2173
139 Ga0075370_10098114 3300006353 Bacteria 1694
140 Ga0068871_100175008 3300006358 Bacteria 1842
141 Ga0075434_100130481 3300006871 Bacteria 2532
142 Ga0075436_100015432 3300006914 Bacteria 5230
143 Ga0099825_1028499 3300006941 Bacteria 2708
144 Ga0099823_1038175 3300006944 Bacteria 3595
145 Ga0099795_10077009 3300007788 Bacteria 1269
146 Ga0105240_10032923 3300009093 Bacteria 6703
147 Ga0105240_10045995 3300009093 Bacteria 5534
148 Ga0105240_10070916 3300009093 Bacteria 4309
149 Ga0105240_10259332 3300009093 Bacteria 2006
150 Ga0105245_10033391 3300009098 Bacteria 4561
151 Ga0105245_10109359 3300009098 Bacteria 2568
152 Ga0105247_10010254 3300009101 Bacteria 5672
153 Ga0105247_10048858 3300009101 Bacteria 2599
154 Ga0105247_10194734 3300009101 Bacteria 1359
155 Ga0105241_10012445 3300009174 Bacteria 6236
156 Ga0105241_10247364 3300009174 Bacteria 1510
157 Ga0105248_10176599 3300009177 Bacteria 2407
158 Ga0105237_10016707 3300009545 Bacteria 7619
159 Ga0105237_10047919 3300009545 Bacteria 4297
160 Ga0105237_10110583 3300009545 Bacteria 2740
161 Ga0105237_10127658 3300009545 Bacteria 2537
162 Ga0105237_10235386 3300009545 Bacteria 1833
163 Ga0105238_10008432 3300009551 Bacteria 10317
164 Ga0105238_10013324 3300009551 Bacteria 8296
165 Ga0105238_10013345 3300009551 Bacteria 8287
166 Ga0105238_10039582 3300009551 Bacteria 4780
167 Ga0105238_10046828 3300009551 Bacteria 4361
168 Ga0105238_10049374 3300009551 Bacteria 4238
169 Ga0105238_10242801 3300009551 Bacteria 1779
170 Ga0105238_10269677 3300009551 Bacteria 1682
171 Ga0105239_10044760 3300010375 Bacteria 4851
172 Ga0105239_10090504 3300010375 Bacteria 3376
173 Ga0105239_10159097 3300010375 Bacteria 2523
174 Ga0105246_10060931 3300011119 Bacteria 2623
175 Ga0105246_10349644 3300011119 Bacteria 1211
176 Ga0157373_10049551 3300013100 Bacteria 2993
177 Ga0157373_10061305 3300013100 Bacteria 2664
178 Ga0157371_10000001 3300013102 Bacteria 1162285
179 Ga0157371_10074032 3300013102 Bacteria 2412
180 Ga0157371_10095290 3300013102 Bacteria 2109
181 Ga0157370_10046415 3300013104 Bacteria 4165
182 Ga0157370_10116799 3300013104 Bacteria 2492
183 Ga0157370_10181897 3300013104 Bacteria 1953
184 Ga0157369_10006619 3300013105 Bacteria 13403
185 Ga0157369_10022801 3300013105 Bacteria 6981
186 Ga0157369_10043243 3300013105 Bacteria 4911
187 Ga0157369_10082359 3300013105 Bacteria 3442
188 Ga0157369_10094270 3300013105 Bacteria 3195
189 Ga0157369_10152332 3300013105 Bacteria 2444
190 Ga0157374_10009522 3300013296 Bacteria 8341
191 Ga0157378_10088393 3300013297 Bacteria 2812
192 Ga0157372_10001893 3300013307 Bacteria 22710
193 Ga0157372_10164772 3300013307 Bacteria 2563
194 Ga0157372_10166778 3300013307 Bacteria 2547
195 Ga0157372_10366895 3300013307 Bacteria 1678
196 Ga0157372_10428619 3300013307 Bacteria 1541
197 Ga0157375_10289012 3300013308 Bacteria 1802
198 Ga0157380_10382238 3300014326 Bacteria 1329
199 Ga0182006_1003394 3300015261 Bacteria 8158
200 Ga0182005_1000052 3300015265 Bacteria 113532
201 Ga0206356_11709197 3300020070 Bacteria 1836
202 Ga0213873_10026320 3300021358 Bacteria 1412
203 Ga0213876_10003579 3300021384 Bacteria 8838
204 Ga0213876_10032216 3300021384 Bacteria 2765
205 Ga0213876_10035613 3300021384 Bacteria 2625
206 Ga0209436_100782 3300025208 Bacteria 13164
207 Ga0207425_1000136 3300025245 Bacteria 65594
208 Ga0207425_1000533 3300025245 Bacteria 23036
209 Ga0209148_1000479 3300025254 Bacteria 42062
210 Ga0209129_1006263 3300025258 Bacteria 3918
211 Ga0209233_1007520 3300025261 Bacteria 3447
212 Ga0209565_1000015 3300025263 Bacteria 494091
213 Ga0209565_1000382 3300025263 Bacteria 37853
214 Ga0209565_1000431 3300025263 Bacteria 33753
215 Ga0209565_1006040 3300025263 Bacteria 3452
216 Ga0209565_1023890 3300025263 Bacteria 1251
217 Ga0209455_1000521 3300025272 Bacteria 27243
218 Ga0209455_1009982 3300025272 Bacteria 2449
219 Ga0209673_1000017 3300025273 Bacteria 492994
220 Ga0209673_1006907 3300025273 Bacteria 5372
221 Ga0209130_1000809 3300025284 Bacteria 26504
222 Ga0209130_1000987 3300025284 Bacteria 22203
223 Ga0209675_1000012 3300025291 Bacteria 494061
224 Ga0209675_1000410 3300025291 Bacteria 35247
225 Ga0209675_1003168 3300025291 Bacteria 7989
226 Ga0209564_1000016 3300025295 Bacteria 613131
227 Ga0209564_1000639 3300025295 Bacteria 53129
228 Ga0209564_1000888 3300025295 Bacteria 39497
229 Ga0209564_1011494 3300025295 Bacteria 3959
230 Ga0209758_1000011 3300025297 Bacteria 1049685
231 Ga0209758_1000120 3300025297 Bacteria 192212
232 Ga0209758_1002512 3300025297 Bacteria 18622
233 Ga0209758_1003647 3300025297 Bacteria 13738
234 Ga0209758_1005738 3300025297 Bacteria 9349
235 Ga0209050_1000469 3300025298 Bacteria 71511
236 Ga0209050_1035489 3300025298 Bacteria 1473
237 Ga0209256_1000346 3300025299 Bacteria 75456
238 Ga0209256_1001013 3300025299 Bacteria 33164
239 Ga0209256_1001470 3300025299 Bacteria 24150
240 Ga0209256_1001603 3300025299 Bacteria 22130
241 Ga0207426_1000458 3300025302 Bacteria 64019
242 Ga0207426_1001538 3300025302 Bacteria 18766
243 Ga0207426_1003487 3300025302 Bacteria 8493
244 Ga0207426_1027902 3300025302 Bacteria 1876
245 Ga0209257_1000010 3300025304 Bacteria 1158682
246 Ga0209257_1001101 3300025304 Bacteria 35153
247 Ga0207656_10028400 3300025321 Bacteria 2296
248 Ga0207692_10036417 3300025898 Bacteria 2399
249 Ga0207710_10055375 3300025900 Bacteria 1788
250 Ga0207688_10085737 3300025901 Bacteria 1804
251 Ga0207647_10027761 3300025904 Bacteria 3687
252 Ga0207705_10021350 3300025909 Bacteria 4620
253 Ga0207705_10040216 3300025909 Bacteria 3353
254 Ga0207705_10043137 3300025909 Bacteria 3240
255 Ga0207705_10104844 3300025909 Bacteria 2083
256 Ga0207705_10191005 3300025909 Bacteria 1549
257 Ga0207654_10105814 3300025911 Bacteria 1741
258 Ga0207654_10175475 3300025911 Bacteria 1395
259 Ga0207707_10000886 3300025912 Bacteria 29266
260 Ga0207707_10017231 3300025912 Bacteria 6296
261 Ga0207707_10031180 3300025912 Bacteria 4664
262 Ga0207707_10034974 3300025912 Bacteria 4394
263 Ga0207707_10036764 3300025912 Bacteria 4280
264 Ga0207707_10058004 3300025912 Bacteria 3370
265 Ga0207707_10132094 3300025912 Bacteria 2183
266 Ga0207695_10000008 3300025913 Bacteria 1058268
267 Ga0207695_10074097 3300025913 Bacteria 3466
268 Ga0207695_10088068 3300025913 Bacteria 3126
269 Ga0207671_10046154 3300025914 Bacteria 3223
270 Ga0207671_10081169 3300025914 Bacteria 2432
271 Ga0207671_10091341 3300025914 Bacteria 2294
272 Ga0207671_10092379 3300025914 Bacteria 2282
273 Ga0207671_10122549 3300025914 Bacteria 1988
274 Ga0207671_10147901 3300025914 Bacteria 1813
275 Ga0207693_10040763 3300025915 Bacteria 3657
276 Ga0207693_10091702 3300025915 Bacteria 2382
277 Ga0207693_10120033 3300025915 Bacteria 2065
278 Ga0207660_10016752 3300025917 Bacteria 4859
279 Ga0207660_10022591 3300025917 Bacteria 4239
280 Ga0207660_10032739 3300025917 Bacteria 3590
281 Ga0207660_10036903 3300025917 Bacteria 3400
282 Ga0207660_10059590 3300025917 Bacteria 2741
283 Ga0207660_10062691 3300025917 Bacteria 2679
284 Ga0207660_10148106 3300025917 Bacteria 1801
285 Ga0207660_10223862 3300025917 Bacteria 1477
286 Ga0207662_10051651 3300025918 Bacteria 2446
287 Ga0207657_10017806 3300025919 Bacteria 6801
288 Ga0207657_10042783 3300025919 Bacteria 3994
289 Ga0207657_10046726 3300025919 Bacteria 3791
290 Ga0207657_10156996 3300025919 Bacteria 1850
291 Ga0207657_10185556 3300025919 Bacteria 1680
292 Ga0207652_10013860 3300025921 Bacteria 6524
293 Ga0207652_10023347 3300025921 Bacteria 5123
294 Ga0207652_10028071 3300025921 Bacteria 4693
295 Ga0207652_10050428 3300025921 Bacteria 3566
296 Ga0207652_10057909 3300025921 Bacteria 3338
297 Ga0207652_10116685 3300025921 Bacteria 2372
298 Ga0207652_10180465 3300025921 Bacteria 1897
299 Ga0207646_10299647 3300025922 Bacteria 1452
300 Ga0207681_10054661 3300025923 Bacteria 2716
301 Ga0207694_10017635 3300025924 Bacteria 5397
302 Ga0207694_10034501 3300025924 Bacteria 3880
303 Ga0207694_10043194 3300025924 Bacteria 3479
304 Ga0207694_10078447 3300025924 Bacteria 2589
305 Ga0207694_10082785 3300025924 Bacteria 2523
306 Ga0207694_10102490 3300025924 Bacteria 2269
307 Ga0207694_10125907 3300025924 Bacteria 2050
308 Ga0207659_10089310 3300025926 Bacteria 2298
309 Ga0207687_10145014 3300025927 Bacteria 1805
310 Ga0207700_10049267 3300025928 Bacteria 3133
311 Ga0207664_10043443 3300025929 Bacteria 3515
312 Ga0207664_10115073 3300025929 Bacteria 2242
313 Ga0207664_10117664 3300025929 Bacteria 2219
314 Ga0207664_10218074 3300025929 Bacteria 1653
315 Ga0207664_10287721 3300025929 Bacteria 1443
316 Ga0207706_10032450 3300025933 Bacteria 4651
317 Ga0207706_10075564 3300025933 Bacteria 2963
318 Ga0207669_10033550 3300025937 Bacteria 2898
319 Ga0207665_10037925 3300025939 Bacteria 3207
320 Ga0207711_10137334 3300025941 Bacteria 2197
321 Ga0207689_10196048 3300025942 Bacteria 1667
322 Ga0207661_10002050 3300025944 Bacteria 13888
323 Ga0207661_10042121 3300025944 Bacteria 3599
324 Ga0207661_10051634 3300025944 Bacteria 3281
325 Ga0207667_10022102 3300025949 Bacteria 7037
326 Ga0207667_10045798 3300025949 Bacteria 4632
327 Ga0207667_10049144 3300025949 Bacteria 4458
328 Ga0207667_10075652 3300025949 Bacteria 3495
329 Ga0207667_10113009 3300025949 Bacteria 2800
330 Ga0207667_10129253 3300025949 Bacteria 2601
331 Ga0207667_10189378 3300025949 Bacteria 2111
332 Ga0207667_10196381 3300025949 Bacteria 2070
333 Ga0207651_10097333 3300025960 Bacteria 2173
334 Ga0207640_10299357 3300025981 Bacteria 1272
335 Ga0207658_10089254 3300025986 Bacteria 2386
336 Ga0207677_10312850 3300026023 Bacteria 1302
337 Ga0207703_10063992 3300026035 Bacteria 3017
338 Ga0207639_10082513 3300026041 Bacteria 2548
339 Ga0207639_10137309 3300026041 Bacteria 2032
340 Ga0207639_10251065 3300026041 Bacteria 1543
341 Ga0207678_10040509 3300026067 Bacteria 4040
342 Ga0207678_10119451 3300026067 Bacteria 2249
343 Ga0207702_10115161 3300026078 Bacteria 2397
344 Ga0207702_10171117 3300026078 Bacteria 1992
345 Ga0207702_10190054 3300026078 Bacteria 1897
346 Ga0207702_10258985 3300026078 Bacteria 1637
347 Ga0207648_10190549 3300026089 Bacteria 1817
348 Ga0207674_10013097 3300026116 Bacteria 9231
349 Ga0207674_10110344 3300026116 Bacteria 2726
350 Ga0207683_10030306 3300026121 Bacteria 4687
351 Ga0207698_10041733 3300026142 Bacteria 3422
352 Ga0207698_10084206 3300026142 Bacteria 2577
353 Ga0207698_10097884 3300026142 Bacteria 2422
354 Ga0209281_1010502 3300027111 Bacteria 2116
355 Ga0209389_1000043 3300027296 Bacteria 123224
356 Ga0209389_1000077 3300027296 Bacteria 91273
357 Ga0209589_1000047 3300027357 Bacteria 118659
358 Ga0209489_100075 3300027361 Bacteria 136991
359 Ga0209489_100251 3300027361 Bacteria 91273
360 Ga0209700_100271 3300027363 Bacteria 91215
361 Ga0268266_10077358 3300028379 Bacteria 2893
362 Ga0268264_10000030 3300028381 Bacteria 418542
363 Ga0265318_10010234 3300028577 Bacteria 4095
364 Ga0265318_10043687 3300028577 Bacteria 1697
365 Ga0265338_10044273 3300028800 Bacteria 4112
366 Ga0265338_10158511 3300028800 Bacteria 1750
367 Ga0307511_10097154 3300030521 Bacteria 1957
368 Ga0265330_10014071 3300031235 Bacteria 3716
369 Ga0265330_10015247 3300031235 Bacteria 3556
370 Ga0265330_10042865 3300031235 Bacteria 2004
371 Ga0265330_10060877 3300031235 Bacteria 1642
372 Ga0265332_10000013 3300031238 Bacteria 250095
373 Ga0265332_10032358 3300031238 Bacteria 2279
374 Ga0265320_10017857 3300031240 Bacteria 3923
375 Ga0265320_10028123 3300031240 Bacteria 2922
376 Ga0265325_10002805 3300031241 Bacteria 11625
377 Ga0265325_10004624 3300031241 Bacteria 8643
378 Ga0265325_10011615 3300031241 Bacteria 5058
379 Ga0265325_10106950 3300031241 Bacteria 1363
380 Ga0265325_10115173 3300031241 Bacteria 1302
381 Ga0265340_10013195 3300031247 Bacteria 4348
382 Ga0265340_10018160 3300031247 Bacteria 3632
383 Ga0265339_10003040 3300031249 Bacteria 11811
384 Ga0265339_10056439 3300031249 Bacteria 2127
385 Ga0265339_10105096 3300031249 Bacteria 1466
386 Ga0265331_10002514 3300031250 Bacteria 12369
387 Ga0265331_10053030 3300031250 Bacteria 1936
388 Ga0265316_10049511 3300031344 Bacteria 3310
389 Ga0307513_10007609 3300031456 Bacteria 13999
390 Ga0307509_10084524 3300031507 Bacteria 3268
391 Ga0307509_10161525 3300031507 Bacteria 2137
392 Ga0307509_10274924 3300031507 Bacteria 1449
393 Ga0307408_100000331 3300031548 Bacteria 45112
394 Ga0307408_100003776 3300031548 Bacteria 10316
395 Ga0307408_100008651 3300031548 Bacteria 6721
396 Ga0265313_10000305 3300031595 Bacteria 53305
397 Ga0265313_10002293 3300031595 Bacteria 16765
398 Ga0265313_10023841 3300031595 Bacteria 3286
399 Ga0265313_10057716 3300031595 Bacteria 1831
400 Ga0307508_10003532 3300031616 Bacteria 15752
401 Ga0307508_10076958 3300031616 Bacteria 2914
402 Ga0307508_10243830 3300031616 Bacteria 1394
403 Ga0265314_10006855 3300031711 Bacteria 9984
404 Ga0265314_10032816 3300031711 Bacteria 3815
405 Ga0265314_10049098 3300031711 Bacteria 2957
406 Ga0265314_10154517 3300031711 Bacteria 1403
407 Ga0265314_10232406 3300031711 Bacteria 1069
408 Ga0265342_10000715 3300031712 Bacteria 34304
409 Ga0265342_10018334 3300031712 Bacteria 4536
410 Ga0265342_10033179 3300031712 Bacteria 3176
411 Ga0307516_10018252 3300031730 Bacteria 7295
412 Ga0307507_10026861 3300033179 Bacteria 6192
413 Ga0307510_10017164 3300033180 Bacteria 8539
414 Ga0373923_0004076 3300035111 Bacteria 4801
415 Ga0373936_0007226 3300035113 Bacteria 4180
416 Ga0373936_0033719 3300035113 Bacteria 2031
417 Ga0373939_0001163 3300035114 Bacteria 6446
418 Ga0373941_0003567 3300035115 Bacteria 3538
419 Ga0373953_0000715 3300035117 Bacteria 9186
420 Ga0373954_0000084 3300035118 Bacteria 33354
421 Ga0373954_0014590 3300035118 Bacteria 3504
422 Ga0373954_0085911 3300035118 Bacteria 1507
423 Ga0373957_0011178 3300035120 Bacteria 2990
424 Ga0373955_0000301 3300035172 Bacteria 20395
425 Ga0373955_0002561 3300035172 Bacteria 7952
426 Ga0373924_0003265 3300035410 Bacteria 5550
427 Ga0373924_0010446 3300035410 Bacteria 3422
428 Ga0373924_0082253 3300035410 Bacteria 1371
429 Ga0373935_0158254 3300035692 Bacteria 1542
430 Ga0373927_0000141 3300035695 Bacteria 55933
431 Ga0373933_0000951 3300035724 Bacteria 17668
432 Ga0373933_0001848 3300035724 Bacteria 12244
433 Ga0373933_0018022 3300035724 Bacteria 3966
434 Ga0373947_0106219 3300035725 Bacteria 1769
435 Ga0373937_0060512 3300036401 Bacteria 3480
436 Ga0373937_0330528 3300036401 Bacteria 1443
437 Ga0373925_0052049 3300037068 Bacteria 3058
438 Ga0373925_0065962 3300037068 Bacteria 2728
439 Ga0395899_0002233 3300037312 Bacteria 15864
440 Ga0395899_0069985 3300037312 Bacteria 2568
441 Ga0395899_0119278 3300037312 Bacteria 1891
442 Ga0395899_0148750 3300037312 Bacteria 1661
443 Ga0395899_0178989 3300037312 Bacteria 1490
444 Ga0395899_0185599 3300037312 Bacteria 1457
445 Ga0395899_0207510 3300037312 Bacteria 1363
446 Ga0395900_0001310 3300037418 Bacteria 30209
447 Ga0395900_0001351 3300037418 Bacteria 29638
448 Ga0395900_0008575 3300037418 Bacteria 10508
449 Ga0395900_0011283 3300037418 Bacteria 9139
450 Ga0395900_0036422 3300037418 Bacteria 5073
451 Ga0395900_0054475 3300037418 Bacteria 4119
452 Ga0395900_0056976 3300037418 Bacteria 4022
453 Ga0395900_0078540 3300037418 Bacteria 3391
454 Ga0395900_0087306 3300037418 Bacteria 3206
455 Ga0395900_0183792 3300037418 Bacteria 2123
456 Ga0395898_0002484 3300037466 Bacteria 21688
457 Ga0395898_0012110 3300037466 Bacteria 8929
458 Ga0395898_0026473 3300037466 Bacteria 5835
459 Ga0395898_0035192 3300037466 Bacteria 4984
460 Ga0395898_0051684 3300037466 Bacteria 4018
461 Ga0395898_0074471 3300037466 Bacteria 3279
462 Ga0395898_0079851 3300037466 Bacteria 3155
463 Ga0395898_0109613 3300037466 Bacteria 2646
464 Ga0395898_0211320 3300037466 Bacteria 1851
465 Ga0395898_0301241 3300037466 Bacteria 1529
466 Ga0395905_0002041 3300037471 Bacteria 23069
467 Ga0395905_0013331 3300037471 Bacteria 7880
468 Ga0395905_0016323 3300037471 Bacteria 7056
469 Ga0395905_0018272 3300037471 Bacteria 6656
470 Ga0395905_0130402 3300037471 Bacteria 2364
471 Ga0395901_0027085 3300038443 Bacteria 5887
472 Ga0395901_0035187 3300038443 Bacteria 5175
473 Ga0395901_0047934 3300038443 Bacteria 4436
474 Ga0395901_0055382 3300038443 Bacteria 4124
475 Ga0395901_0081812 3300038443 Bacteria 3373
476 Ga0395901_0108548 3300038443 Bacteria 2913
477 Ga0395901_0117260 3300038443 Bacteria 2797
478 Ga0395901_0135936 3300038443 Bacteria 2584
479 Ga0395901_0153060 3300038443 Bacteria 2423
480 Ga0395901_0240294 3300038443 Bacteria 1889
481 Ga0436365_0618633 3300039437 Bacteria 2803
482 Ga0436365_1104948 3300039437 Bacteria 2785
483 Ga0436365_1236739 3300039437 Bacteria 30341
484 Ga0436362_0548217 3300039453 Bacteria 3819
485 Ga0451793_1911962 3300041452 Bacteria 1640
486 Ga0451841_1016410 3300041498 Bacteria 1832
487 Ga0466972_0000079 3300044658 Bacteria 90348
488 Ga0466972_0004424 3300044658 Bacteria 7026
489 Ga0466972_0024879 3300044658 Bacteria 2971
490 Ga0453683_0055804 3300044673 Bacteria 2472
491 Ga0453683_0092249 3300044673 Bacteria 1899
492 Ga0466966_0000191 3300044684 Bacteria 40906
493 Ga0466961_0000005 3300044693 Bacteria 173105
494 Ga0466961_0033127 3300044693 Bacteria 3321
495 Ga0466963_0042278 3300044694 Bacteria 2992
496 Ga0466964_0011528 3300044706 Bacteria 3341
497 Ga0466964_0057426 3300044706 Bacteria 1611
498 Ga0453684_0000292 3300044712 Bacteria 213050
499 Ga0453684_0011680 3300044712 Bacteria 14651
500 Ga0466971_0130019 3300044719 Bacteria 1168
501 Ga0466968_0090403 3300044735 Bacteria 1356
502 Ga0466970_0095902 3300044765 Bacteria 1613
503 Ga0466957_0058332 3300044842 Bacteria 2365
504 Ga0466957_0106405 3300044842 Bacteria 1774
505 Ga0466959_0000654 3300045049 Bacteria 20198
506 Ga0466959_0035355 3300045049 Bacteria 3696
507 Ga0466959_0130524 3300045049 Bacteria 1781
508 Ga0451576_0000444 3300045051 Bacteria 94213
509 Ga0451576_0001449 3300045051 Bacteria 40328
510 Ga0466958_0055154 3300045836 Bacteria 2411
511 Ga0466967_0043874 3300045976 Bacteria 3874
512 Ga0466967_0328124 3300045976 Bacteria 1477
513 Ga0495592_0016467 3300046454 Bacteria 5609
514 Ga0495590_0000049 3300046457 Bacteria 113002
515 Ga0495590_0003539 3300046457 Bacteria 6365
516 Ga0495590_0010523 3300046457 Bacteria 3475
517 Ga0495591_000456 3300046458 Bacteria 33134
518 Ga0495591_014144 3300046458 Bacteria 2883
519 Ga0495629_0003566 3300046459 Bacteria 11757
520 Ga0495629_0007325 3300046459 Bacteria 8133
521 Ga0495629_0010133 3300046459 Bacteria 6873
522 Ga0495629_0274045 3300046459 Bacteria 1159
523 Ga0495638_0002117 3300046460 Bacteria 16743
524 Ga0495638_0022925 3300046460 Bacteria 4092
525 Ga0495651_0031133 3300046462 Bacteria 4161
526 Ga0495651_0056071 3300046462 Bacteria 3027
527 Ga0495651_0296275 3300046462 Bacteria 1087
528 Ga0495653_0002541 3300046463 Bacteria 14539
529 Ga0495653_0195152 3300046463 Bacteria 1378
530 Ga0495650_0000051 3300046471 Bacteria 318297
531 Ga0495582_0016731 3300046473 Bacteria 4016
532 Ga0495582_0022194 3300046473 Bacteria 3474
533 Ga0495605_0016134 3300046474 Bacteria 4048
534 Ga0495605_0044793 3300046474 Bacteria 2185
535 Ga0495605_0057361 3300046474 Bacteria 1874
536 Ga0495605_0076287 3300046474 Bacteria 1574
537 Ga0495639_0017874 3300046475 Bacteria 3082
538 Ga0495664_0083961 3300046477 Bacteria 1911
539 Ga0495664_0095802 3300046477 Bacteria 1786
540 Ga0495584_0000189 3300046491 Bacteria 43548
541 Ga0495584_0006718 3300046491 Bacteria 6017
542 Ga0495584_0006868 3300046491 Bacteria 5950
543 Ga0495584_0051656 3300046491 Bacteria 2069
544 Ga0495584_0052578 3300046491 Bacteria 2050
545 Ga0495584_0056981 3300046491 Bacteria 1966
546 Ga0495585_0000148 3300046492 Bacteria 76376
547 Ga0495585_0001953 3300046492 Bacteria 15407
548 Ga0495585_0004258 3300046492 Bacteria 9322
549 Ga0495585_0012315 3300046492 Bacteria 5039
550 Ga0495585_0014402 3300046492 Bacteria 4608
551 Ga0495585_0024386 3300046492 Bacteria 3468
552 Ga0495585_0024688 3300046492 Bacteria 3445
553 Ga0495585_0060314 3300046492 Bacteria 2088
554 Ga0495585_0074672 3300046492 Bacteria 1844
555 Ga0495594_0031346 3300046499 Bacteria 2881
556 Ga0495594_0039208 3300046499 Bacteria 2589
557 Ga0495594_0139927 3300046499 Bacteria 1372
558 Ga0495594_0183708 3300046499 Bacteria 1190
559 Ga0495594_0242777 3300046499 Bacteria 1026
560 Ga0495596_0000778 3300046500 Bacteria 19414
561 Ga0495596_0009554 3300046500 Bacteria 4262
562 Ga0495596_0024661 3300046500 Bacteria 2434
563 Ga0495607_0008359 3300046501 Bacteria 7080
564 Ga0495607_0034756 3300046501 Bacteria 3055
565 Ga0495607_0072472 3300046501 Bacteria 1917
566 Ga0495607_0134923 3300046501 Bacteria 1279
567 Ga0495583_0009580 3300046506 Bacteria 5769
568 Ga0495583_0025908 3300046506 Bacteria 2919
569 Ga0495583_0030071 3300046506 Bacteria 2650
570 Ga0495583_0059659 3300046506 Bacteria 1709
571 Ga0495606_0030775 3300046507 Bacteria 3742
572 Ga0495606_0053543 3300046507 Bacteria 2618
573 Ga0495606_0060234 3300046507 Bacteria 2432
574 Ga0495608_0104505 3300046511 Bacteria 1824
575 Ga0495610_0000442 3300046512 Bacteria 42791
576 Ga0495616_0000817 3300046513 Bacteria 22704
577 Ga0495616_0042604 3300046513 Bacteria 2310
578 Ga0495616_0074991 3300046513 Bacteria 1628
579 Ga0495618_0008986 3300046514 Bacteria 6031
580 Ga0495628_0170744 3300046516 Bacteria 1649
581 Ga0495630_0113012 3300046517 Bacteria 2057
582 Ga0495630_0209280 3300046517 Bacteria 1488
583 Ga0495631_0003028 3300046518 Bacteria 9292
584 Ga0495631_0005160 3300046518 Bacteria 6880
585 Ga0495631_0005448 3300046518 Bacteria 6657
586 Ga0495631_0005904 3300046518 Bacteria 6375
587 Ga0495631_0021545 3300046518 Bacteria 3001
588 Ga0495632_0000946 3300046519 Bacteria 25368
589 Ga0495632_0012916 3300046519 Bacteria 4790
590 Ga0495637_0000014 3300046520 Bacteria 228956
591 Ga0495643_0013145 3300046522 Bacteria 4969
592 Ga0495643_0034612 3300046522 Bacteria 2786
593 Ga0495644_0003582 3300046523 Bacteria 6127
594 Ga0495644_0009706 3300046523 Bacteria 3704
595 Ga0495644_0023951 3300046523 Bacteria 2322
596 Ga0495648_0009209 3300046524 Bacteria 7682
597 Ga0495648_0022320 3300046524 Bacteria 4361
598 Ga0495648_0037552 3300046524 Bacteria 3110
599 Ga0495648_0063035 3300046524 Bacteria 2192
600 Ga0495648_0070253 3300046524 Bacteria 2035
601 Ga0495666_0005745 3300046526 Bacteria 6253
602 Ga0495642_0000657 3300046528 Bacteria 17307
603 Ga0495642_0137576 3300046528 Bacteria 1053
604 Ga0495652_0006590 3300046529 Bacteria 10786
605 Ga0495652_0017409 3300046529 Bacteria 6412
606 Ga0495652_0023496 3300046529 Bacteria 5465
607 Ga0495652_0061540 3300046529 Bacteria 3168
608 Ga0495654_0001281 3300046530 Bacteria 17634
609 Ga0495654_0005602 3300046530 Bacteria 7267
610 Ga0495654_0027985 3300046530 Bacteria 2885
611 Ga0495665_0007608 3300046531 Bacteria 5867
612 Ga0495665_0016281 3300046531 Bacteria 4006
613 Ga0495665_0063244 3300046531 Bacteria 1953
614 Ga0495640_0001058 3300046533 Bacteria 21427
615 Ga0495640_0012394 3300046533 Bacteria 6515
616 Ga0495640_0021531 3300046533 Bacteria 4730
617 Ga0495640_0030787 3300046533 Bacteria 3838
618 Ga0495640_0219817 3300046533 Bacteria 1198
619 Ga0495586_0006988 3300046535 Bacteria 6014
620 Ga0495586_0069205 3300046535 Bacteria 1926
621 Ga0495587_0008387 3300046536 Bacteria 6650
622 Ga0495587_0015923 3300046536 Bacteria 4682
623 Ga0495609_0000240 3300046538 Bacteria 52192
624 Ga0495609_0007832 3300046538 Bacteria 5285
625 Ga0495609_0009700 3300046538 Bacteria 4644
626 Ga0495609_0014487 3300046538 Bacteria 3704
627 Ga0495609_0021260 3300046538 Bacteria 2993
628 Ga0495609_0039463 3300046538 Bacteria 2125
629 Ga0495597_0001290 3300046542 Bacteria 18438
630 Ga0495597_0002422 3300046542 Bacteria 11860
631 Ga0495597_0013932 3300046542 Bacteria 3843
632 Ga0495645_0002913 3300046543 Bacteria 11620
633 Ga0495645_0021817 3300046543 Bacteria 4629
634 Ga0495645_0070850 3300046543 Bacteria 2515
635 Ga0495622_0006675 3300046557 Bacteria 5350
636 Ga0495622_0037023 3300046557 Bacteria 2273
637 Ga0495633_0004436 3300046558 Bacteria 8931
638 Ga0495633_0007848 3300046558 Bacteria 6091
639 Ga0495633_0018740 3300046558 Bacteria 3510
640 Ga0495633_0038856 3300046558 Bacteria 2272
641 Ga0495633_0046850 3300046558 Bacteria 2044
642 Ga0495667_0043103 3300046559 Bacteria 2991
643 Ga0495668_0000768 3300046616 Bacteria 37462
644 Ga0495668_0030938 3300046616 Bacteria 3017
645 Ga0495668_0090816 3300046616 Bacteria 1673
646 Ga0495634_0007709 3300046642 Bacteria 8058
647 Ga0495634_0012018 3300046642 Bacteria 6277
648 Ga0495634_0202820 3300046642 Bacteria 1231
649 Ga0495611_0000377 3300046648 Bacteria 28700
650 Ga0495611_0004255 3300046648 Bacteria 6228
651 Ga0495611_0018873 3300046648 Bacteria 2959
652 Ga0495611_0026855 3300046648 Bacteria 2513
653 Ga0495611_0036316 3300046648 Bacteria 2186
654 Ga0495611_0046008 3300046648 Bacteria 1955
655 Ga0495611_0067326 3300046648 Bacteria 1634
656 Ga0495611_0123237 3300046648 Bacteria 1208
657 Ga0495625_0009971 3300046660 Bacteria 7902
658 Ga0495625_0023747 3300046660 Bacteria 4680
659 Ga0495625_0032661 3300046660 Bacteria 3857
660 Ga0495635_0000374 3300046663 Bacteria 28331
661 Ga0495635_0002472 3300046663 Bacteria 12617
662 Ga0495635_0002810 3300046663 Bacteria 11943
663 Ga0495635_0084575 3300046663 Bacteria 2171
664 Ga0495659_0000009 3300046664 Bacteria 95820
665 Ga0495659_0009895 3300046664 Bacteria 3049
666 Ga0495661_0000932 3300046665 Bacteria 26643
667 Ga0495661_0001580 3300046665 Bacteria 18764
668 Ga0495661_0072635 3300046665 Bacteria 2007
669 Ga0495661_0078008 3300046665 Bacteria 1917
670 Ga0495661_0095201 3300046665 Bacteria 1686
671 Ga0495661_0109935 3300046665 Bacteria 1537
672 Ga0495661_0120953 3300046665 Bacteria 1446
673 Ga0495588_0017891 3300046674 Bacteria 3449
674 Ga0495588_0027605 3300046674 Bacteria 2837
675 Ga0495588_0081565 3300046674 Bacteria 1688
676 Ga0495657_0001354 3300046675 Bacteria 21307
677 Ga0495657_0004748 3300046675 Bacteria 10827
678 Ga0495657_0069693 3300046675 Bacteria 2300
679 Ga0495599_0017201 3300046678 Bacteria 4493
680 Ga0495623_0009572 3300046679 Bacteria 6294
681 Ga0495623_0099708 3300046679 Bacteria 1771
682 Ga0495646_0003632 3300046680 Bacteria 9626
683 Ga0495646_0111074 3300046680 Bacteria 1561
684 Ga0495646_0187806 3300046680 Bacteria 1131
685 Ga0495669_0000218 3300046684 Bacteria 34510
686 Ga0495669_0001840 3300046684 Bacteria 8688
687 Ga0495669_0009191 3300046684 Bacteria 4164
688 Ga0495613_0038210 3300046689 Bacteria 3558
689 Ga0495613_0071833 3300046689 Bacteria 2523
690 Ga0495613_0080959 3300046689 Bacteria 2360
691 Ga0495624_0008402 3300046690 Bacteria 7200
692 Ga0495624_0061057 3300046690 Bacteria 2362
693 Ga0495670_0001687 3300046691 Bacteria 10852
694 Ga0495670_0038658 3300046691 Bacteria 2379
695 Ga0495670_0054019 3300046691 Bacteria 2012
696 Ga0495670_0062797 3300046691 Bacteria 1869
697 Ga0495671_0000433 3300046692 Bacteria 33219
698 Ga0495671_0002478 3300046692 Bacteria 11643
699 Ga0495671_0013847 3300046692 Bacteria 4351
700 Ga0495671_0023340 3300046692 Bacteria 3231
701 Ga0495649_0000255 3300046694 Bacteria 47515
702 Ga0495649_0023067 3300046694 Bacteria 3476
703 Ga0495649_0053634 3300046694 Bacteria 2182
704 Ga0495589_0004718 3300046794 Bacteria 7234
705 Ga0495589_0046504 3300046794 Bacteria 2153
706 Ga0495589_0051364 3300046794 Bacteria 2038
707 Ga0495600_0002308 3300046809 Bacteria 10889
708 Ga0495600_0017907 3300046809 Bacteria 4509
709 Ga0495600_0113001 3300046809 Bacteria 1768
710 Ga0495660_0007159 3300046810 Bacteria 6571
711 Ga0495660_0015805 3300046810 Bacteria 4357
712 Ga0495660_0039856 3300046810 Bacteria 2606
713 Ga0495581_0004542 3300047315 Bacteria 8018
714 Ga0495581_0014176 3300047315 Bacteria 4620
715 Ga0495581_0065980 3300047315 Bacteria 2093
716 Ga0495604_0015004 3300047317 Bacteria 6180
717 Ga0495604_0029185 3300047317 Bacteria 4388
718 Ga0495604_0041035 3300047317 Bacteria 3631
719 Ga0495604_0299833 3300047317 Bacteria 1080
720 Ga0495636_0006057 3300047318 Bacteria 4747
721 Ga0495636_0063281 3300047318 Bacteria 1567
722 Ga0495674_0001881 3300047319 Bacteria 20669
723 Ga0495674_0003767 3300047319 Bacteria 14745
724 Ga0495674_0116875 3300047319 Bacteria 2256
725 Ga0495674_0377995 3300047319 Bacteria 1146
726 Ga0495672_0000102 3300047320 Bacteria 137373
727 Ga0495672_0000120 3300047320 Bacteria 121804
728 Ga0495676_0000034 3300047321 Bacteria 124977
729 Ga0495676_0028077 3300047321 Bacteria 4815
730 Ga0495676_0031801 3300047321 Bacteria 4459
731 Ga0495676_0051366 3300047321 Bacteria 3299
732 Ga0495680_0001664 3300047322 Bacteria 23637
733 Ga0495680_0003719 3300047322 Bacteria 14881
734 Ga0495680_0056162 3300047322 Bacteria 3049
735 Ga0495683_0000833 3300047323 Bacteria 21993
736 Ga0495683_0050857 3300047323 Bacteria 2073
737 Ga0495683_0080842 3300047323 Bacteria 1585
738 Ga0495687_000060 3300047443 Bacteria 179124
739 Ga0495687_000410 3300047443 Bacteria 53080
740 Ga0495687_002333 3300047443 Bacteria 15437
741 Ga0495687_030848 3300047443 Bacteria 2465
742 Ga0495687_041333 3300047443 Bacteria 2023
743 Ga0495675_0015513 3300047444 Bacteria 4818
744 Ga0495675_0106181 3300047444 Bacteria 1755
745 Ga0495675_0262683 3300047444 Bacteria 1034
746 Ga0495677_0004370 3300047445 Bacteria 5433
747 Ga0495677_0004862 3300047445 Bacteria 5124
748 Ga0495677_0015412 3300047445 Bacteria 2777
749 Ga0495677_0023348 3300047445 Bacteria 2245
750 Ga0495679_005605 3300047446 Bacteria 5536
751 Ga0495679_025051 3300047446 Bacteria 2000
752 Ga0495685_002470 3300047447 Bacteria 5792
753 Ga0495685_030715 3300047447 Bacteria 1847
754 Ga0495685_033833 3300047447 Bacteria 1756
755 Ga0495673_0000113 3300047469 Bacteria 163495
756 Ga0495673_0042181 3300047469 Bacteria 2050
757 Ga0495681_0001232 3300047470 Bacteria 19468
758 Ga0495681_0001235 3300047470 Bacteria 19424
759 Ga0495681_0005375 3300047470 Bacteria 8591
760 Ga0495681_0015138 3300047470 Bacteria 4375
761 Ga0495681_0023844 3300047470 Bacteria 3237
762 Ga0495681_0053345 3300047470 Bacteria 1893
763 Ga0495684_0000777 3300047471 Bacteria 25850
764 Ga0495684_0024894 3300047471 Bacteria 4603
765 Ga0495684_0114191 3300047471 Bacteria 2036
766 Ga0495686_0002274 3300047472 Bacteria 18494
767 Ga0495686_0140112 3300047472 Bacteria 1427
768 Ga0495593_0005870 3300047673 Bacteria 7235
769 Ga0495602_0068401 3300048088 Bacteria 3049
770 Ga0495602_0131981 3300048088 Bacteria 1990
771 Ga0495614_0006982 3300048089 Bacteria 5041
772 Ga0495614_0026037 3300048089 Bacteria 2521
773 Ga0495614_0028657 3300048089 Bacteria 2397
774 Ga0495626_0008646 3300048091 Bacteria 5563
775 Ga0495626_0013373 3300048091 Bacteria 4264
776 Ga0495626_0038467 3300048091 Bacteria 2268
777 Ga0495626_0043067 3300048091 Bacteria 2119
778 Ga0495626_0052738 3300048091 Bacteria 1873
779 Ga0495626_0096453 3300048091 Bacteria 1294
780 Ga0496100_0091272 3300048903 Bacteria 2078
781 Ga0496101_0001016 3300048904 Bacteria 16540
782 Ga0496102_0004447 3300048905 Bacteria 11835
783 Ga0496102_0049974 3300048905 Bacteria 3806
784 Ga0496103_0035127 3300048906 Bacteria 3068
785 Ga0496103_0059292 3300048906 Bacteria 2378
786 Ga0496104_0004370 3300048907 Bacteria 12305
787 Ga0496104_0110925 3300048907 Bacteria 2630
788 Ga0496105_0025293 3300048908 Bacteria 4831
789 Ga0496105_0074064 3300048908 Bacteria 2813
790 Ga0496106_0005519 3300048909 Bacteria 9359
791 Ga0496107_0001492 3300048910 Bacteria 14501
792 Ga0496108_0130245 3300048911 Bacteria 2162
793 Ga0496108_0169803 3300048911 Bacteria 1887
794 Ga0496109_0013082 3300048912 Bacteria 7178
795 Ga0496109_0206828 3300048912 Bacteria 1845
796 Ga0496110_0000719 3300048913 Bacteria 22855
797 Ga0496110_0008645 3300048913 Bacteria 8200
798 Ga0496110_0033809 3300048913 Bacteria 4425
799 Ga0496110_0056671 3300048913 Bacteria 3449
800 Ga0496111_0127989 3300048914 Bacteria 1878
801 Ga0496111_0132927 3300048914 Bacteria 1842
802 Ga0496112_0080592 3300048915 Bacteria 3219
803 Ga0496112_0086125 3300048915 Bacteria 3109
804 Ga0496112_0180517 3300048915 Bacteria 2075
805 Ga0496112_0533079 3300048915 Bacteria 1108
806 Ga0496113_0042756 3300048916 Bacteria 3349
807 Ga0496113_0095267 3300048916 Bacteria 2300
808 Ga0496113_0149244 3300048916 Bacteria 1843
809 Ga0496114_0105331 3300048917 Bacteria 2412
810 Ga0496115_0076188 3300048918 Bacteria 2726
811 Ga0496115_0222220 3300048918 Bacteria 1558
812 Ga0496116_0002360 3300048919 Bacteria 19968
813 Ga0496116_0022844 3300048919 Bacteria 4673
814 Ga0496117_0061358 3300048920 Bacteria 2585
815 Ga0496118_0006235 3300048921 Bacteria 13179
816 Ga0496118_0053711 3300048921 Bacteria 3059
817 Ga0496120_0029562 3300048923 Bacteria 3344
818 Ga0496121_0002635 3300048924 Bacteria 27038
819 Ga0496121_0041335 3300048924 Bacteria 4030
820 Ga0496122_0000337 3300048925 Bacteria 101830
821 Ga0496123_0000905 3300048926 Bacteria 46722
822 Ga0496124_0004890 3300048927 Bacteria 15418
823 Ga0496124_0096557 3300048927 Bacteria 2400
824 Ga0496124_0147613 3300048927 Bacteria 1849
825 Ga0496125_0017937 3300048928 Bacteria 6728
826 Ga0496125_0022086 3300048928 Bacteria 5916
827 Ga0496125_0125366 3300048928 Bacteria 1821
828 Ga0496126_0002122 3300048929 Bacteria 27701
829 Ga0496126_0029792 3300048929 Bacteria 5181
830 Ga0496126_0050325 3300048929 Bacteria 3798
831 Ga0496126_0085299 3300048929 Bacteria 2784
832 Ga0496126_0117772 3300048929 Bacteria 2307
833 Ga0495678_000150 3300049459 Bacteria 84562
834 Ga0495678_002016 3300049459 Bacteria 14566
835 Ga0495678_006504 3300049459 Bacteria 6206
836 Ga0495678_020859 3300049459 Bacteria 2893
837 Ga0495678_024482 3300049459 Bacteria 2606
838 Ga0495678_060558 3300049459 Bacteria 1423
839 Ga0495682_0006292 3300049460 Bacteria 4816
840 Ga0501031_0002180 3300049568 Bacteria 12363
841 Ga0501031_0042522 3300049568 Bacteria 2965
842 Ga0501032_0000136 3300049569 Bacteria 59896
843 Ga0501032_0041631 3300049569 Bacteria 3118
844 Ga0501033_0000202 3300049570 Bacteria 57109
845 Ga0501034_0000113 3300049571 Bacteria 149824
846 Ga0501034_0000593 3300049571 Bacteria 57233
847 Ga0501034_0013580 3300049571 Bacteria 8380
848 Ga0501034_0092457 3300049571 Bacteria 3022
849 Ga0501034_0131283 3300049571 Bacteria 2488
850 Ga0501036_0000059 3300049572 Bacteria 72347
851 Ga0501036_0001313 3300049572 Bacteria 19069
852 Ga0501037_0000214 3300049573 Bacteria 51638
853 Ga0501037_0010535 3300049573 Bacteria 6790
854 Ga0501037_0012851 3300049573 Bacteria 6171
855 Ga0501037_0073626 3300049573 Bacteria 2483
856 Ga0501038_0002810 3300049574 Bacteria 16214
857 Ga0501038_0008716 3300049574 Bacteria 9308
858 Ga0501039_0001981 3300049575 Bacteria 15182
859 Ga0501039_0091758 3300049575 Bacteria 2367
860 Ga0501043_0000017 3300049579 Bacteria 166630
861 Ga0501043_0005751 3300049579 Bacteria 9990
862 Ga0501046_0000174 3300049580 Bacteria 65566
863 Ga0501046_0015465 3300049580 Bacteria 6409
864 Ga0501046_0050186 3300049580 Bacteria 3297
865 Ga0501046_0109760 3300049580 Bacteria 2108
866 Ga0501047_0000044 3300049581 Bacteria 174789
867 Ga0501047_0010766 3300049581 Bacteria 8644
868 Ga0501047_0010806 3300049581 Bacteria 8630
869 Ga0501047_0019566 3300049581 Bacteria 6495
870 Ga0501047_0023099 3300049581 Bacteria 5970
871 Ga0501047_0063332 3300049581 Bacteria 3567
872 Ga0501047_0071784 3300049581 Bacteria 3332
873 Ga0501048_0000837 3300049582 Bacteria 22705
874 Ga0501048_0028437 3300049582 Bacteria 4057
875 Ga0501067_0011413 3300049583 Bacteria 4918
876 Ga0501067_0088303 3300049583 Bacteria 1720
877 Ga0501068_0000089 3300049584 Bacteria 38379
878 Ga0501068_0063885 3300049584 Bacteria 2239
879 Ga0501068_0147605 3300049584 Bacteria 1476
880 Ga0501069_0003092 3300049585 Bacteria 8526
881 Ga0501069_0005200 3300049585 Bacteria 6763
882 Ga0501070_0050654 3300049586 Bacteria 3446
883 Ga0501070_0059105 3300049586 Bacteria 3178
884 Ga0501070_0064316 3300049586 Bacteria 3038
885 Ga0501070_0181203 3300049586 Bacteria 1733
886 Ga0501071_0011718 3300049587 Bacteria 5917
887 Ga0501071_0069084 3300049587 Bacteria 2572
888 Ga0501072_0006568 3300049588 Bacteria 8855
889 Ga0501072_0236487 3300049588 Bacteria 1455
890 Ga0501073_0000069 3300049589 Bacteria 63198
891 Ga0501073_0018987 3300049589 Bacteria 4967
892 Ga0501073_0075846 3300049589 Bacteria 2340
893 Ga0501073_0077589 3300049589 Bacteria 2311
894 Ga0501073_0110966 3300049589 Bacteria 1902
895 Ga0501074_0000346 3300049590 Bacteria 27099
896 Ga0501074_0009969 3300049590 Bacteria 6901
897 Ga0501074_0085552 3300049590 Bacteria 2259
898 Ga0501074_0132433 3300049590 Bacteria 1783
899 Ga0501076_0102608 3300049592 Bacteria 2306
900 Ga0501077_0291584 3300049593 Bacteria 1039
901 Ga0501227_000835 3300049665 Bacteria 6716
902 Ga0501235_007556 3300049669 Bacteria 2367
903 Ga0501079_0026163 3300049741 Bacteria 4474
904 Ga0501079_0106531 3300049741 Bacteria 2175
905 Ga0501079_0108196 3300049741 Bacteria 2158
906 Ga0501080_0000613 3300049742 Bacteria 28256
907 Ga0501080_0000953 3300049742 Bacteria 23696
908 Ga0501080_0027894 3300049742 Bacteria 5250
909 Ga0501080_0076034 3300049742 Bacteria 3123
910 Ga0501080_0309967 3300049742 Bacteria 1430
911 Ga0501081_0136884 3300049743 Bacteria 1753
912 Ga0501083_0000838 3300049744 Bacteria 20228
913 Ga0501083_0026475 3300049744 Bacteria 4008
914 Ga0501083_0174389 3300049744 Bacteria 1405
915 Ga0501279_003025 3300049775 Bacteria 2184
916 Ga0501035_0000393 3300049822 Bacteria 49959
917 Ga0501035_0000745 3300049822 Bacteria 35086
918 Ga0501035_0020964 3300049822 Bacteria 6006
919 Ga0501035_0227837 3300049822 Bacteria 1589
920 Ga0501044_0000108 3300049823 Bacteria 100968
921 Ga0501044_0011892 3300049823 Bacteria 9431
922 Ga0501044_0016146 3300049823 Bacteria 8026
923 Ga0501044_0054927 3300049823 Bacteria 4091
924 Ga0501044_0064833 3300049823 Bacteria 3727
925 nmdc:mga00v17_156249_c1 3300050491 Bacteria 1467
926 nmdc:mga0yw44_127618_c1 3300050492 Bacteria 1644
927 nmdc:mga0yw44_45239_c1 3300050492 Bacteria 2638
928 nmdc:mga06z11_40124_c1 3300050494 Bacteria 2334
929 nmdc:mga06z11_63156_c1 3300050494 Bacteria 1937
930 nmdc:mga07m45_10168_c2 3300050496 Bacteria 2828
931 nmdc:mga07m45_35822_c1 3300050496 Bacteria 2761
932 nmdc:mga0rr50_223692_c1 3300050513 Bacteria 1555
933 nmdc:mga0rr50_367003_c1 3300050513 Bacteria 1212
934 nmdc:mga08x19_191215_c1 3300050514 Bacteria 1400
935 nmdc:mga08x19_7003_c1 3300050514 Bacteria 6694
936 nmdc:mga0sz30_17656_c2 3300050516 Bacteria 2103
937 nmdc:mga0sz30_28204_c1 3300050516 Bacteria 2309
938 Ga0495601_0006348 3300053077 Bacteria 6908
939 Ga0495601_0111816 3300053077 Bacteria 1769
940 Ga0495595_0008267 3300053084 Bacteria 4272
941 Ga0495595_0011989 3300053084 Bacteria 3635
942 Ga0495619_0000701 3300053085 Bacteria 21925
943 Ga0495619_0005001 3300053085 Bacteria 8418
944 Ga0495619_0025149 3300053085 Bacteria 3821
945 Ga0500578_0031052 3300053086 Bacteria 3433
946 Ga0500643_000373 3300053087 Bacteria 35007
947 Ga0500643_001348 3300053087 Bacteria 14291
948 Ga0500583_0014047 3300053092 Bacteria 3122
949 Ga0500583_0102412 3300053092 Bacteria 1404
950 Ga0500566_0000174 3300053094 Bacteria 32668
951 Ga0500641_0019723 3300053096 Bacteria 2552
952 Ga0500555_008923 3300053103 Bacteria 2863
953 Ga0500595_012280 3300053119 Bacteria 3319
954 Ga0500642_0000127 3300053130 Bacteria 34341
955 Ga0500642_0003598 3300053130 Bacteria 4713
956 Ga0500559_0028093 3300053136 Bacteria 2402
957 Ga0500568_0003938 3300053139 Bacteria 8082
958 Ga0500573_0161222 3300053140 Bacteria 1220
959 Ga0500577_0057053 3300053142 Bacteria 1489
960 Ga0500589_114894 3300053147 Bacteria 1149
961 Ga0500619_000012 3300053154 Bacteria 57280
962 Ga0500622_0008706 3300053156 Bacteria 5660
963 Ga0500636_0123011 3300053177 Bacteria 1453
964 Ga0500637_0085061 3300053178 Bacteria 1828
965 Ga0500599_008093 3300053736 Bacteria 1360
966 Ga0500601_001110 3300053737 Bacteria 3044
967 Ga0501084_0044602 3300054114 Bacteria 3712
968 Ga0500661_010631 3300055283 Bacteria 1674
969 Ga0587070_009800 3300059491 Bacteria 1394
970 Ga0587080_008331 3300059503 Bacteria 1482
971 Ga0587085_012784 3300059506 Bacteria 1157
972 Ga0587072_008134 3300059643 Bacteria 1653
973 Ga0587079_009696 3300059647 Bacteria 1507
974 Ga0587107_009226 3300059652 Bacteria 1159
975 Ga0501082_0000032 3300060353 Bacteria 99261
976 Ga0466962_0042722 3300061719 Bacteria 2170

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035410 Ga0373924_0082253 Ga0373924_0082253_14_916 300
2 3300015261 Ga0182006_1003394 Ga0182006_10033945 309
3 3300015265 Ga0182005_1000052 Ga0182005_100005234 309
4 3300027111 Ga0209281_1010502 Ga0209281_10105022 309
5 3300048918 Ga0496115_0222220 Ga0496115_0222220_30_1037 309
6 3300035118 Ga0373954_0000084 Ga0373954_0000084_32097_33098 311
7 3300046642 Ga0495634_0012018 Ga0495634_0012018_916_1917 311
8 3300047319 Ga0495674_0116875 Ga0495674_0116875_1118_2119 311
9 3300035111 Ga0373923_0004076 Ga0373923_0004076_1769_2770 312
10 3300035117 Ga0373953_0000715 Ga0373953_0000715_7812_8813 312
11 3300035120 Ga0373957_0011178 Ga0373957_0011178_1593_2594 312
12 3300035172 Ga0373955_0000301 Ga0373955_0000301_2324_3325 312
13 3300035410 Ga0373924_0003265 Ga0373924_0003265_2359_3360 312
14 3300035724 Ga0373933_0000951 Ga0373933_0000951_16411_17412 312
15 3300046454 Ga0495592_0016467 Ga0495592_0016467_2430_3431 312
16 3300046459 Ga0495629_0003566 Ga0495629_0003566_2194_3195 312
17 3300046463 Ga0495653_0002541 Ga0495653_0002541_3870_4871 312
18 3300046529 Ga0495652_0023496 Ga0495652_0023496_3742_4743 312
19 3300046533 Ga0495640_0021531 Ga0495640_0021531_2430_3431 312
20 3300046536 Ga0495587_0008387 Ga0495587_0008387_2313_3314 312
21 3300046543 Ga0495645_0002913 Ga0495645_0002913_1975_2976 312
22 3300046663 Ga0495635_0002810 Ga0495635_0002810_2286_3287 312
23 3300046675 Ga0495657_0001354 Ga0495657_0001354_8935_9936 312
24 3300046678 Ga0495599_0017201 Ga0495599_0017201_1214_2215 312
25 3300046679 Ga0495623_0009572 Ga0495623_0009572_113_1123 312
26 3300046680 Ga0495646_0003632 Ga0495646_0003632_2010_3011 312
27 3300047317 Ga0495604_0015004 Ga0495604_0015004_4457_5458 312
28 3300047471 Ga0495684_0000777 Ga0495684_0000777_2338_3339 312
29 3300047673 Ga0495593_0005870 Ga0495593_0005870_3966_4967 312
30 3300053084 Ga0495595_0011989 Ga0495595_0011989_1597_2598 312
31 3300053085 Ga0495619_0000701 Ga0495619_0000701_18668_19669 312
32 3300031235 Ga0265330_10015247 Ga0265330_100152473 313
33 3300031247 Ga0265340_10013195 Ga0265340_100131952 313
34 3300047469 Ga0495673_0042181 Ga0495673_0042181_514_1527 313
35 3300049588 Ga0501072_0006568 Ga0501072_0006568_6505_7500 313
36 3300005354 Ga0070675_100335793 Ga0070675_1003357932 314
37 3300005614 Ga0068856_100344986 Ga0068856_1003449861 314
38 3300009174 Ga0105241_10247364 Ga0105241_102473641 314
39 3300025911 Ga0207654_10105814 Ga0207654_101058142 314
40 3300026078 Ga0207702_10190054 Ga0207702_101900542 314
41 3300031548 Ga0307408_100000331 Ga0307408_1000003319 314
42 3300044658 Ga0466972_0000079 Ga0466972_0000079_84139_85140 314
43 3300046491 Ga0495584_0052578 Ga0495584_0052578_445_1392 314
44 3300031711 Ga0265314_10232406 Ga0265314_102324061 315
45 3300046459 Ga0495629_0010133 Ga0495629_0010133_2720_3727 315
46 3300046463 Ga0495653_0195152 Ga0495653_0195152_218_1225 315
47 3300046473 Ga0495582_0022194 Ga0495582_0022194_1496_2503 315
48 3300046477 Ga0495664_0083961 Ga0495664_0083961_39_1046 315
49 3300046511 Ga0495608_0104505 Ga0495608_0104505_380_1387 315
50 3300046514 Ga0495618_0008986 Ga0495618_0008986_2627_3634 315
51 3300046516 Ga0495628_0170744 Ga0495628_0170744_602_1609 315
52 3300046517 Ga0495630_0113012 Ga0495630_0113012_36_1043 315
53 3300046529 Ga0495652_0017409 Ga0495652_0017409_2222_3229 315
54 3300046533 Ga0495640_0001058 Ga0495640_0001058_13601_14608 315
55 3300046533 Ga0495640_0219817 Ga0495640_0219817_221_1168 315
56 3300046642 Ga0495634_0007709 Ga0495634_0007709_2705_3712 315
57 3300046642 Ga0495634_0202820 Ga0495634_0202820_231_1178 315
58 3300046689 Ga0495613_0080959 Ga0495613_0080959_416_1423 315
59 3300046809 Ga0495600_0017907 Ga0495600_0017907_2577_3584 315
60 3300047317 Ga0495604_0041035 Ga0495604_0041035_1226_2233 315
61 3300047319 Ga0495674_0001881 Ga0495674_0001881_13524_14531 315
62 3300047322 Ga0495680_0001664 Ga0495680_0001664_20035_21042 315
63 3300047471 Ga0495684_0024894 Ga0495684_0024894_2627_3634 315
64 3300048921 Ga0496118_0053711 Ga0496118_0053711_1088_2089 315
65 3300048923 Ga0496120_0029562 Ga0496120_0029562_1163_2164 315
66 3300053077 Ga0495601_0006348 Ga0495601_0006348_2627_3634 315
67 3300053084 Ga0495595_0008267 Ga0495595_0008267_3229_4236 315
68 3300053085 Ga0495619_0005001 Ga0495619_0005001_4137_5144 315
69 iso_pu_bacteria 2922368715 2922375911 315
70 3300037471 Ga0395905_0130402 Ga0395905_0130402_583_1584 316
71 3300044684 Ga0466966_0000191 Ga0466966_0000191_14721_15722 316
72 3300044693 Ga0466961_0000005 Ga0466961_0000005_54747_55748 316
73 3300045049 Ga0466959_0000654 Ga0466959_0000654_13425_14426 316
74 3300046457 Ga0495590_0010523 Ga0495590_0010523_1096_2094 316
75 3300046474 Ga0495605_0044793 Ga0495605_0044793_833_1834 317
76 3300046507 Ga0495606_0030775 Ga0495606_0030775_1152_2153 317
77 3300046524 Ga0495648_0063035 Ga0495648_0063035_1010_2011 317
78 3300059491 Ga0587070_009800 Ga0587070_009800_310_1311 317
79 3300059652 Ga0587107_009226 Ga0587107_009226_11_1012 317
80 3300046460 Ga0495638_0002117 Ga0495638_0002117_13991_14992 318
81 3300009101 Ga0105247_10194734 Ga0105247_101947341 319
82 3300025272 Ga0209455_1009982 Ga0209455_10099823 319
83 3300047444 Ga0495675_0262683 Ga0495675_0262683_59_1018 319
84 3300044735 Ga0466968_0090403 Ga0466968_0090403_383_1345 320
85 3300046680 Ga0495646_0187806 Ga0495646_0187806_151_1113 320
86 3300006353 Ga0075370_10059614 Ga0075370_100596142 321
87 3300050496 nmdc:mga07m45_35822_c1 nmdc:mga07m45_35822_c1_960_1961 321
88 3300060353 Ga0501082_0000032 Ga0501082_0000032_81105_82112 321
89 3300041452 Ga0451793_1911962 Ga0451793_1911962_364_1389 322
90 3300053094 Ga0500566_0000174 Ga0500566_0000174_3344_4357 322
91 3300044658 Ga0466972_0004424 Ga0466972_0004424_846_1847 323
92 3300045836 Ga0466958_0055154 Ga0466958_0055154_1253_2254 323
93 3300006175 Ga0070712_100115479 Ga0070712_1001154791 324
94 3300009093 Ga0105240_10259332 Ga0105240_102593322 324
95 3300025915 Ga0207693_10091702 Ga0207693_100917022 324
96 3300026067 Ga0207678_10119451 Ga0207678_101194512 324
97 3300031456 Ga0307513_10007609 Ga0307513_100076092 324
98 3300037418 Ga0395900_0054475 Ga0395900_0054475_2792_3799 324
99 3300038443 Ga0395901_0153060 Ga0395901_0153060_1193_2200 324
100 3300045049 Ga0466959_0130524 Ga0466959_0130524_65_1063 324
101 3300045976 Ga0466967_0328124 Ga0466967_0328124_336_1337 324
102 iso_pu_bacteria 2857604169 2857608038 324
103 3300005327 Ga0070658_10067706 Ga0070658_100677062 325
104 3300005329 Ga0070683_100123913 Ga0070683_1001239132 325
105 3300005336 Ga0070680_100094453 Ga0070680_1000944532 325
106 3300005339 Ga0070660_100045797 Ga0070660_1000457971 325
107 3300005539 Ga0068853_100003330 Ga0068853_1000033302 325
108 3300005563 Ga0068855_100418301 Ga0068855_1004183012 325
109 3300005577 Ga0068857_100022493 Ga0068857_1000224934 325
110 3300005616 Ga0068852_100024216 Ga0068852_1000242163 325
111 3300005834 Ga0068851_10092505 Ga0068851_100925052 325
112 3300009545 Ga0105237_10047919 Ga0105237_100479192 325
113 3300009551 Ga0105238_10008432 Ga0105238_1000843211 325
114 3300010375 Ga0105239_10044760 Ga0105239_100447603 325
115 3300013104 Ga0157370_10181897 Ga0157370_101818972 325
116 3300013105 Ga0157369_10022801 Ga0157369_100228015 325
117 3300025321 Ga0207656_10028400 Ga0207656_100284002 325
118 3300025912 Ga0207707_10132094 Ga0207707_101320941 325
119 3300025914 Ga0207671_10081169 Ga0207671_100811692 325
120 3300025917 Ga0207660_10022591 Ga0207660_100225912 325
121 3300025917 Ga0207660_10032739 Ga0207660_100327392 325
122 3300025919 Ga0207657_10017806 Ga0207657_100178064 325
123 3300025921 Ga0207652_10050428 Ga0207652_100504282 325
124 3300025924 Ga0207694_10017635 Ga0207694_100176354 325
125 3300025944 Ga0207661_10051634 Ga0207661_100516344 325
126 3300025949 Ga0207667_10022102 Ga0207667_100221025 325
127 3300026041 Ga0207639_10082513 Ga0207639_100825132 325
128 3300026116 Ga0207674_10013097 Ga0207674_100130976 325
129 3300037312 Ga0395899_0119278 Ga0395899_0119278_611_1612 325
130 3300037418 Ga0395900_0001310 Ga0395900_0001310_2519_3520 325
131 3300037466 Ga0395898_0074471 Ga0395898_0074471_668_1669 325
132 3300049593 Ga0501077_0291584 Ga0501077_0291584_20_1021 325
133 3300003215 JGI25153J46596_10000317 JGI25153J46596_1000031730 326
134 3300003354 JGI25160J50197_1006813 JGI25160J50197_10068134 326
135 3300006178 Ga0075367_10039355 Ga0075367_100393552 326
136 3300006186 Ga0075369_10016047 Ga0075369_100160472 326
137 3300009545 Ga0105237_10110583 Ga0105237_101105833 326
138 3300025297 Ga0209758_1000120 Ga0209758_100012016 326
139 3300025302 Ga0207426_1000458 Ga0207426_100045836 326
140 3300025914 Ga0207671_10091341 Ga0207671_100913412 326
141 3300046458 Ga0495591_000456 Ga0495591_000456_16165_17145 326
142 3300046474 Ga0495605_0016134 Ga0495605_0016134_1121_2101 326
143 3300046512 Ga0495610_0000442 Ga0495610_0000442_18411_19391 326
144 3300046519 Ga0495632_0012916 Ga0495632_0012916_2048_3028 326
145 3300046520 Ga0495637_0000014 Ga0495637_0000014_106324_107304 326
146 3300046523 Ga0495644_0009706 Ga0495644_0009706_1868_2848 326
147 3300046530 Ga0495654_0001281 Ga0495654_0001281_14909_15889 326
148 3300046538 Ga0495609_0009700 Ga0495609_0009700_1118_2098 326
149 3300046558 Ga0495633_0004436 Ga0495633_0004436_3404_4384 326
150 3300047320 Ga0495672_0000102 Ga0495672_0000102_29145_30125 326
151 3300047323 Ga0495683_0000833 Ga0495683_0000833_16253_17233 326
152 3300047445 Ga0495677_0004370 Ga0495677_0004370_3348_4328 326
153 3300047446 Ga0495679_025051 Ga0495679_025051_414_1394 326
154 3300048927 Ga0496124_0147613 Ga0496124_0147613_13_993 326
155 3300048928 Ga0496125_0017937 Ga0496125_0017937_2929_3930 326
156 3300050491 nmdc:mga00v17_156249_c1 nmdc:mga00v17_156249_c1_427_1428 326
157 3300050494 nmdc:mga06z11_40124_c1 nmdc:mga06z11_40124_c1_662_1663 326
158 3300050496 nmdc:mga07m45_10168_c2 nmdc:mga07m45_10168_c2_1124_2125 326
159 iso_pu_bacteria 2643221554 2643788590 326
160 iso_pu_bacteria 2643221638 2644213386 326
161 iso_pu_bacteria 2643221645 2644251999 326
162 iso_pu_bacteria 2643221664 2644360652 326
163 iso_pu_bacteria 2738541280 2738740293 326
164 iso_pu_bacteria 2738541300 2738843451 326
165 iso_pu_bacteria 2738543018 2739275475 326
166 iso_pu_bacteria 2738543030 2739344519 326
167 iso_pu_bacteria 2824704595 2824710657 326
168 iso_pu_bacteria 2824753945 2824762313 326
169 iso_pu_bacteria 2824763712 2824766538 326
170 iso_pu_bacteria 2904711408 2904711764 326
171 3300005614 Ga0068856_100320277 Ga0068856_1003202772 327
172 3300037312 Ga0395899_0178989 Ga0395899_0178989_263_1258 327
173 3300037312 Ga0395899_0207510 Ga0395899_0207510_56_1051 327
174 3300037418 Ga0395900_0056976 Ga0395900_0056976_2928_3923 327
175 3300037466 Ga0395898_0012110 Ga0395898_0012110_4963_5958 327
176 3300044673 Ga0453683_0055804 Ga0453683_0055804_598_1590 327
177 3300045051 Ga0451576_0000444 Ga0451576_0000444_91254_92246 327
178 3300046471 Ga0495650_0000051 Ga0495650_0000051_9225_10223 327
179 iso_pu_bacteria 2513237104 2513721498 327
180 iso_pu_bacteria 2643221547 2643757544 327
181 3300003203 JGI25406J46586_10008891 JGI25406J46586_100088912 328
182 3300005985 Ga0081539_10003915 Ga0081539_100039153 328
183 3300009098 Ga0105245_10033391 Ga0105245_100333913 328
184 3300009177 Ga0105248_10176599 Ga0105248_101765993 328
185 3300013102 Ga0157371_10095290 Ga0157371_100952901 328
186 3300013297 Ga0157378_10088393 Ga0157378_100883932 328
187 3300025901 Ga0207688_10085737 Ga0207688_100857371 328
188 3300025917 Ga0207660_10062691 Ga0207660_100626912 328
189 3300025918 Ga0207662_10051651 Ga0207662_100516512 328
190 3300025924 Ga0207694_10078447 Ga0207694_100784472 328
191 3300025941 Ga0207711_10137334 Ga0207711_101373343 328
192 3300026023 Ga0207677_10312850 Ga0207677_103128501 328
193 3300026041 Ga0207639_10137309 Ga0207639_101373092 328
194 3300031711 Ga0265314_10049098 Ga0265314_100490982 328
195 3300037418 Ga0395900_0036422 Ga0395900_0036422_361_1359 328
196 3300037466 Ga0395898_0301241 Ga0395898_0301241_422_1420 328
197 3300038443 Ga0395901_0081812 Ga0395901_0081812_524_1522 328
198 3300046535 Ga0495586_0069205 Ga0495586_0069205_539_1537 328
199 3300048912 Ga0496109_0013082 Ga0496109_0013082_2909_3901 328
200 3300048927 Ga0496124_0096557 Ga0496124_0096557_796_1794 328
201 iso_pu_bacteria 2547132512 2548849191 328
202 iso_pu_bacteria 2935984226 2935987223 328
203 iso_pu_bacteria 639633007 639786038 328
204 3300002773 JGI25152J39213_1005661 JGI25152J39213_10056614 329
205 3300002774 JGI25150J39212_1008153 JGI25150J39212_10081532 329
206 3300002987 JGI25159J45721_1006309 JGI25159J45721_10063092 329
207 3300003354 JGI25160J50197_1003899 JGI25160J50197_10038995 329
208 3300003374 JGI25161J50226_1003500 JGI25161J50226_10035005 329
209 3300003771 Ga0055526_1002983 Ga0055526_10029831 329
210 3300003773 Ga0055537_1000060 Ga0055537_100006056 329
211 3300003773 Ga0055537_1001054 Ga0055537_100105411 329
212 3300003773 Ga0055537_1007510 Ga0055537_10075101 329
213 3300003775 Ga0055524_1002530 Ga0055524_10025309 329
214 3300003775 Ga0055524_1019046 Ga0055524_10190462 329
215 3300003784 Ga0055534_1000009 Ga0055534_100000996 329
216 3300003790 Ga0055528_1000012 Ga0055528_100001284 329
217 3300003790 Ga0055528_1004175 Ga0055528_10041755 329
218 3300003791 Ga0055530_10003244 Ga0055530_100032449 329
219 3300003791 Ga0055530_10038187 Ga0055530_100381871 329
220 3300003791 Ga0055530_10038230 Ga0055530_100382301 329
221 3300003794 Ga0055531_10001264 Ga0055531_100012647 329
222 3300004625 Ga0055543_1019207 Ga0055543_10192071 329
223 3300005327 Ga0070658_10025143 Ga0070658_100251432 329
224 3300005336 Ga0070680_100153962 Ga0070680_1001539621 329
225 3300005339 Ga0070660_100045025 Ga0070660_1000450252 329
226 3300005435 Ga0070714_100148050 Ga0070714_1001480502 329
227 3300005530 Ga0070679_100028319 Ga0070679_1000283192 329
228 3300005563 Ga0068855_100020915 Ga0068855_1000209152 329
229 3300006038 Ga0075365_10061252 Ga0075365_100612522 329
230 3300009093 Ga0105240_10045995 Ga0105240_100459952 329
231 3300009551 Ga0105238_10039582 Ga0105238_100395822 329
232 3300013102 Ga0157371_10000001 Ga0157371_10000001831 329
233 3300025208 Ga0209436_100782 Ga0209436_1007825 329
234 3300025245 Ga0207425_1000136 Ga0207425_100013640 329
235 3300025245 Ga0207425_1000533 Ga0207425_10005339 329
236 3300025258 Ga0209129_1006263 Ga0209129_10062633 329
237 3300025263 Ga0209565_1000015 Ga0209565_1000015372 329
238 3300025263 Ga0209565_1000382 Ga0209565_100038216 329
239 3300025263 Ga0209565_1000431 Ga0209565_100043110 329
240 3300025263 Ga0209565_1006040 Ga0209565_10060402 329
241 3300025263 Ga0209565_1023890 Ga0209565_10238901 329
242 3300025273 Ga0209673_1000017 Ga0209673_1000017263 329
243 3300025273 Ga0209673_1006907 Ga0209673_10069075 329
244 3300025284 Ga0209130_1000809 Ga0209130_10008096 329
245 3300025284 Ga0209130_1000987 Ga0209130_10009875 329
246 3300025291 Ga0209675_1000012 Ga0209675_1000012110 329
247 3300025291 Ga0209675_1000410 Ga0209675_10004102 329
248 3300025291 Ga0209675_1003168 Ga0209675_10031688 329
249 3300025295 Ga0209564_1000016 Ga0209564_1000016223 329
250 3300025295 Ga0209564_1000639 Ga0209564_100063919 329
251 3300025295 Ga0209564_1000888 Ga0209564_100088818 329
252 3300025298 Ga0209050_1000469 Ga0209050_100046947 329
253 3300025298 Ga0209050_1035489 Ga0209050_10354891 329
254 3300025299 Ga0209256_1000346 Ga0209256_100034621 329
255 3300025299 Ga0209256_1001470 Ga0209256_100147016 329
256 3300025299 Ga0209256_1001603 Ga0209256_100160318 329
257 3300025302 Ga0207426_1001538 Ga0207426_10015382 329
258 3300025304 Ga0209257_1000010 Ga0209257_1000010692 329
259 3300025909 Ga0207705_10040216 Ga0207705_100402162 329
260 3300025919 Ga0207657_10042783 Ga0207657_100427832 329
261 3300025921 Ga0207652_10180465 Ga0207652_101804652 329
262 3300025924 Ga0207694_10102490 Ga0207694_101024902 329
263 3300025929 Ga0207664_10043443 Ga0207664_100434432 329
264 3300025949 Ga0207667_10196381 Ga0207667_101963812 329
265 3300026078 Ga0207702_10258985 Ga0207702_102589852 329
266 3300031548 Ga0307408_100003776 Ga0307408_1000037765 329
267 3300031548 Ga0307408_100008651 Ga0307408_1000086512 329
268 3300031595 Ga0265313_10057716 Ga0265313_100577162 329
269 3300035115 Ga0373941_0003567 Ga0373941_0003567_536_1543 329
270 3300035410 Ga0373924_0010446 Ga0373924_0010446_1633_2631 329
271 3300046491 Ga0495584_0051656 Ga0495584_0051656_1019_2020 329
272 3300046501 Ga0495607_0008359 Ga0495607_0008359_5406_6407 329
273 3300046506 Ga0495583_0025908 Ga0495583_0025908_517_1518 329
274 3300046513 Ga0495616_0042604 Ga0495616_0042604_212_1213 329
275 3300046530 Ga0495654_0027985 Ga0495654_0027985_46_1044 329
276 3300046538 Ga0495609_0000240 Ga0495609_0000240_2231_3232 329
277 3300046538 Ga0495609_0007832 Ga0495609_0007832_2405_3403 329
278 3300046542 Ga0495597_0001290 Ga0495597_0001290_12313_13311 329
279 3300046616 Ga0495668_0030938 Ga0495668_0030938_1890_2891 329
280 3300046660 Ga0495625_0009971 Ga0495625_0009971_2440_3438 329
281 3300046664 Ga0495659_0000009 Ga0495659_0000009_40951_41949 329
282 3300046664 Ga0495659_0009895 Ga0495659_0009895_264_1265 329
283 3300046665 Ga0495661_0072635 Ga0495661_0072635_120_1112 329
284 3300046692 Ga0495671_0000433 Ga0495671_0000433_25432_26430 329
285 3300046694 Ga0495649_0023067 Ga0495649_0023067_1800_2801 329
286 3300046810 Ga0495660_0007159 Ga0495660_0007159_2188_3186 329
287 3300047318 Ga0495636_0063281 Ga0495636_0063281_50_1051 329
288 3300047320 Ga0495672_0000120 Ga0495672_0000120_77116_78114 329
289 3300047443 Ga0495687_041333 Ga0495687_041333_517_1518 329
290 3300047447 Ga0495685_030715 Ga0495685_030715_634_1635 329
291 3300047470 Ga0495681_0005375 Ga0495681_0005375_1074_2075 329
292 3300048091 Ga0495626_0096453 Ga0495626_0096453_235_1227 329
293 3300048912 Ga0496109_0206828 Ga0496109_0206828_804_1796 329
294 3300048929 Ga0496126_0029792 Ga0496126_0029792_3726_4811 329
295 3300049459 Ga0495678_024482 Ga0495678_024482_538_1539 329
296 3300049575 Ga0501039_0091758 Ga0501039_0091758_808_1815 329
297 3300049581 Ga0501047_0023099 Ga0501047_0023099_1642_2649 329
298 3300049589 Ga0501073_0077589 Ga0501073_0077589_141_1148 329
299 3300049665 Ga0501227_000835 Ga0501227_000835_986_1978 329
300 3300049669 Ga0501235_007556 Ga0501235_007556_326_1324 329
301 3300049741 Ga0501079_0106531 Ga0501079_0106531_700_1707 329
302 3300049744 Ga0501083_0174389 Ga0501083_0174389_163_1170 329
303 3300049775 Ga0501279_003025 Ga0501279_003025_978_1970 329
304 3300049823 Ga0501044_0054927 Ga0501044_0054927_2263_3270 329
305 3300050492 nmdc:mga0yw44_45239_c1 nmdc:mga0yw44_45239_c1_356_1369 329
306 3300053092 Ga0500583_0102412 Ga0500583_0102412_355_1365 329
307 3300053096 Ga0500641_0019723 Ga0500641_0019723_838_1848 329
308 3300053154 Ga0500619_000012 Ga0500619_000012_37481_38479 329
309 iso_pu_bacteria 2508501042 2508692870 329
310 iso_pu_bacteria 2513237092 2513621681 329
311 iso_pu_bacteria 2513237094 2513636884 329
312 iso_pu_bacteria 2513237095 2513651170 329
313 iso_pu_bacteria 2513237161 2514011731 329
314 iso_pu_bacteria 2517093001 2517108203 329
315 iso_pu_bacteria 2524023205 2524436093 329
316 iso_pu_bacteria 2528768022 2528852851 329
317 iso_pu_bacteria 2617270735 2617352733 329
318 iso_pu_bacteria 2744054633 2745080952 329
319 iso_pu_bacteria 2816332527 2818236752 329
320 iso_pu_bacteria 2824617872 2824622048 329
321 iso_pu_bacteria 2824626560 2824629312 329
322 iso_pu_bacteria 2824635225 2824642656 329
323 iso_pu_bacteria 2824644064 2824650500 329
324 iso_pu_bacteria 2824661429 2824669168 329
325 iso_pu_bacteria 2824671348 2824672307 329
326 iso_pu_bacteria 2824679649 2824682286 329
327 iso_pu_bacteria 2824687955 2824688810 329
328 iso_pu_bacteria 2824714736 2824720369 329
329 iso_pu_bacteria 2824723954 2824729066 329
330 iso_pu_bacteria 2824773399 2824776661 329
331 iso_pu_bacteria 2838122688 2838127392 329
332 iso_pu_bacteria 2841941048 2841946410 329
333 iso_pu_bacteria 2841949485 2841957128 329
334 iso_pu_bacteria 2841957949 2841965650 329
335 iso_pu_bacteria 2841966195 2841972920 329
336 iso_pu_bacteria 2841974524 2841978408 329
337 iso_pu_bacteria 2841983080 2841987490 329
338 iso_pu_bacteria 2842038055 2842040841 329
339 iso_pu_bacteria 2842045827 2842046214 329
340 iso_pu_bacteria 2844315083 2844320204 329
341 iso_pu_bacteria 2847930680 2847937523 329
342 iso_pu_bacteria 2849076700 2849078207 329
343 iso_pu_bacteria 2874612657 2874616778 329
344 iso_pu_bacteria 2874620515 2874628270 329
345 iso_pu_bacteria 2874628541 2874630137 329
346 iso_pu_bacteria 2876761206 2876768281 329
347 iso_pu_bacteria 2879083081 2879084936 329
348 iso_pu_bacteria 2879099564 2879107904 329
349 iso_pu_bacteria 2881364244 2881370100 329
350 iso_pu_bacteria 2881665667 2881670102 329
351 iso_pu_bacteria 2885366525 2885370160 329
352 iso_pu_bacteria 2885409591 2885414352 329
353 iso_pu_bacteria 2888378607 2888385674 329
354 iso_pu_bacteria 2888388044 2888392593 329
355 iso_pu_bacteria 2903727486 2903731206 329
356 iso_pu_bacteria 2904666416 2904674111 329
357 iso_pu_bacteria 2906602504 2906610027 329
358 iso_pu_bacteria 2906626472 2906629345 329
359 iso_pu_bacteria 2906643746 2906645523 329
360 iso_pu_bacteria 2922393267 2922396878 329
361 iso_pu_bacteria 2932784394 2932785176 329
362 iso_pu_bacteria 2932794094 2932799625 329
363 iso_pu_bacteria 2932801729 2932808784 329
364 iso_pu_bacteria 2932809354 2932810203 329
365 iso_pu_bacteria 2932818245 2932821776 329
366 iso_pu_bacteria 2932828146 2932829012 329
367 iso_pu_bacteria 2935608549 2935610021 329
368 iso_pu_bacteria 2935616580 2935619568 329
369 iso_pu_bacteria 2935638405 2935638548 329
370 iso_pu_bacteria 2935648319 2935651950 329
371 iso_pu_bacteria 2935656913 2935660077 329
372 iso_pu_bacteria 2935665750 2935666600 329
373 iso_pu_bacteria 2935675223 2935682216 329
374 iso_pu_bacteria 2935684952 2935691128 329
375 iso_pu_bacteria 2935694250 2935694441 329
376 iso_pu_bacteria 2935703347 2935703554 329
377 iso_pu_bacteria 2935713505 2935718509 329
378 iso_pu_bacteria 2935722832 2935727511 329
379 iso_pu_bacteria 2935732158 2935736214 329
380 iso_pu_bacteria 2935741537 2935745594 329
381 iso_pu_bacteria 2935750917 2935755975 329
382 iso_pu_bacteria 2935760218 2935760763 329
383 iso_pu_bacteria 2935769743 2935776428 329
384 iso_pu_bacteria 2935777560 2935780829 329
385 iso_pu_bacteria 2935785616 2935792347 329
386 iso_pu_bacteria 2935793552 2935800478 329
387 iso_pu_bacteria 2935801545 2935801691 329
388 iso_pu_bacteria 2935810662 2935814893 329
389 iso_pu_bacteria 2935819856 2935823181 329
390 iso_pu_bacteria 2935827899 2935828042 329
391 iso_pu_bacteria 2935837841 2935842248 329
392 iso_pu_bacteria 2935847175 2935848763 329
393 iso_pu_bacteria 2935855204 2935858116 329
394 iso_pu_bacteria 2935864058 2935868021 329
395 iso_pu_bacteria 2935873716 2935873956 329
396 iso_pu_bacteria 2935883170 2935885714 329
397 iso_pu_bacteria 2935908558 2935909432 329
398 iso_pu_bacteria 2935916978 2935917155 329
399 iso_pu_bacteria 2935926038 2935926913 329
400 iso_pu_bacteria 2935934488 2935937243 329
401 iso_pu_bacteria 2935942939 2935944454 329
402 iso_pu_bacteria 2935951376 2935952891 329
403 iso_pu_bacteria 2935959822 2935962892 329
404 iso_pu_bacteria 2935967501 2935969731 329
405 iso_pu_bacteria 2935992306 2935993120 329
406 iso_pu_bacteria 2936002035 2936003057 329
407 iso_pu_bacteria 2936011229 2936014493 329
408 iso_pu_bacteria 2936019824 2936023667 329
409 iso_pu_bacteria 2936028420 2936031310 329
410 iso_pu_bacteria 2936037263 2936040464 329
411 iso_pu_bacteria 2936046547 2936049599 329
412 iso_pu_bacteria 2936055302 2936061185 329
413 iso_pu_bacteria 2940556831 2940562050 329
414 iso_pu_bacteria 2941531003 2941531369 329
415 iso_pu_bacteria 2941538514 2941542296 329
416 iso_pu_bacteria 3005483717 3005485592 329
417 iso_pu_bacteria 3005506211 3005508241 329
418 iso_pu_bacteria 3005587118 3005588254 329
419 iso_pu_bacteria 3005594810 3005600516 329
420 iso_pu_bacteria 3005710791 3005715989 329
421 iso_pu_bacteria 3005718088 3005723345 329
422 iso_pu_bacteria 8006926726 8006928629 329
423 iso_pu_bacteria 8016511872 8016520449 329
424 iso_pu_bacteria 8016522445 8016528511 329
425 iso_pu_bacteria 8016530956 8016533671 329
426 iso_pu_bacteria 8016539877 8016546894 329
427 iso_pu_bacteria 8016548790 8016555224 329
428 iso_pu_bacteria 8016557553 8016563588 329
429 iso_pu_bacteria 8016566248 8016572001 329
430 iso_pu_bacteria 8016575299 8016576206 329
431 iso_pu_bacteria 8016595262 8016601324 329
432 iso_pu_bacteria 8016603502 8016609105 329
433 iso_pu_bacteria 8016613128 8016615799 329
434 iso_pu_bacteria 8016622563 8016625435 329
435 iso_pu_bacteria 8016630954 8016638962 329
436 iso_pu_bacteria 8017057580 8017065126 329
437 iso_pu_bacteria 8019530166 8019533451 329
438 iso_pu_bacteria 8019538911 8019546227 329
439 iso_pu_bacteria 8019547302 8019552484 329
440 iso_pu_bacteria 8019576017 8019584516 329
441 iso_pu_bacteria 8019586578 8019592286 329
442 iso_pu_bacteria 8019597564 8019598998 329
443 iso_pu_bacteria 8019648815 8019649575 329
444 iso_pu_bacteria 8019687851 8019691275 329
445 iso_pu_bacteria 8056967851 8056974877 329
446 3300005262 Ga0065165_1002482 Ga0065165_100248211 330
447 3300005355 Ga0070671_100174947 Ga0070671_1001749472 330
448 3300005457 Ga0070662_100146759 Ga0070662_1001467592 330
449 3300005564 Ga0070664_100076642 Ga0070664_1000766422 330
450 3300005564 Ga0070664_100338256 Ga0070664_1003382562 330
451 3300006028 Ga0070717_10176454 Ga0070717_101764542 330
452 3300006914 Ga0075436_100015432 Ga0075436_1000154325 330
453 3300025929 Ga0207664_10287721 Ga0207664_102877211 330
454 3300025933 Ga0207706_10032450 Ga0207706_100324503 330
455 3300037312 Ga0395899_0148750 Ga0395899_0148750_47_1042 330
456 3300037418 Ga0395900_0183792 Ga0395900_0183792_501_1508 330
457 3300037471 Ga0395905_0013331 Ga0395905_0013331_45_1052 330
458 3300038443 Ga0395901_0240294 Ga0395901_0240294_830_1837 330
459 3300046457 Ga0495590_0000049 Ga0495590_0000049_27364_28359 330
460 3300046457 Ga0495590_0003539 Ga0495590_0003539_402_1397 330
461 3300046458 Ga0495591_014144 Ga0495591_014144_948_1943 330
462 3300046460 Ga0495638_0022925 Ga0495638_0022925_2894_3889 330
463 3300046474 Ga0495605_0057361 Ga0495605_0057361_598_1593 330
464 3300046474 Ga0495605_0076287 Ga0495605_0076287_282_1277 330
465 3300046491 Ga0495584_0000189 Ga0495584_0000189_14624_15619 330
466 3300046491 Ga0495584_0006718 Ga0495584_0006718_684_1679 330
467 3300046491 Ga0495584_0006868 Ga0495584_0006868_3423_4418 330
468 3300046491 Ga0495584_0056981 Ga0495584_0056981_101_1096 330
469 3300046492 Ga0495585_0000148 Ga0495585_0000148_70719_71714 330
470 3300046492 Ga0495585_0001953 Ga0495585_0001953_4558_5553 330
471 3300046492 Ga0495585_0004258 Ga0495585_0004258_3693_4688 330
472 3300046492 Ga0495585_0012315 Ga0495585_0012315_1087_2082 330
473 3300046492 Ga0495585_0014402 Ga0495585_0014402_2659_3762 330
474 3300046492 Ga0495585_0024386 Ga0495585_0024386_1868_2863 330
475 3300046492 Ga0495585_0024688 Ga0495585_0024688_488_1483 330
476 3300046492 Ga0495585_0060314 Ga0495585_0060314_785_1780 330
477 3300046492 Ga0495585_0074672 Ga0495585_0074672_414_1409 330
478 3300046499 Ga0495594_0031346 Ga0495594_0031346_1141_2244 330
479 3300046499 Ga0495594_0039208 Ga0495594_0039208_717_1712 330
480 3300046499 Ga0495594_0139927 Ga0495594_0139927_29_1024 330
481 3300046499 Ga0495594_0183708 Ga0495594_0183708_169_1164 330
482 3300046499 Ga0495594_0242777 Ga0495594_0242777_21_1016 330
483 3300046500 Ga0495596_0000778 Ga0495596_0000778_2947_3942 330
484 3300046500 Ga0495596_0009554 Ga0495596_0009554_3199_4194 330
485 3300046500 Ga0495596_0024661 Ga0495596_0024661_1340_2335 330
486 3300046501 Ga0495607_0034756 Ga0495607_0034756_924_1919 330
487 3300046501 Ga0495607_0072472 Ga0495607_0072472_325_1320 330
488 3300046501 Ga0495607_0134923 Ga0495607_0134923_86_1081 330
489 3300046506 Ga0495583_0009580 Ga0495583_0009580_1154_2149 330
490 3300046506 Ga0495583_0030071 Ga0495583_0030071_465_1460 330
491 3300046506 Ga0495583_0059659 Ga0495583_0059659_478_1473 330
492 3300046507 Ga0495606_0053543 Ga0495606_0053543_1452_2447 330
493 3300046507 Ga0495606_0060234 Ga0495606_0060234_488_1483 330
494 3300046513 Ga0495616_0000817 Ga0495616_0000817_15813_16808 330
495 3300046513 Ga0495616_0074991 Ga0495616_0074991_468_1463 330
496 3300046517 Ga0495630_0209280 Ga0495630_0209280_437_1429 330
497 3300046518 Ga0495631_0003028 Ga0495631_0003028_3325_4320 330
498 3300046518 Ga0495631_0005160 Ga0495631_0005160_3668_4663 330
499 3300046518 Ga0495631_0005448 Ga0495631_0005448_955_1950 330
500 3300046518 Ga0495631_0005904 Ga0495631_0005904_3985_4980 330
501 3300046518 Ga0495631_0021545 Ga0495631_0021545_1186_2181 330
502 3300046519 Ga0495632_0000946 Ga0495632_0000946_3777_4772 330
503 3300046522 Ga0495643_0013145 Ga0495643_0013145_3303_4298 330
504 3300046523 Ga0495644_0003582 Ga0495644_0003582_982_1977 330
505 3300046523 Ga0495644_0023951 Ga0495644_0023951_185_1180 330
506 3300046524 Ga0495648_0009209 Ga0495648_0009209_2783_3778 330
507 3300046524 Ga0495648_0037552 Ga0495648_0037552_1150_2145 330
508 3300046524 Ga0495648_0070253 Ga0495648_0070253_913_1908 330
509 3300046526 Ga0495666_0005745 Ga0495666_0005745_3922_4917 330
510 3300046528 Ga0495642_0000657 Ga0495642_0000657_1423_2418 330
511 3300046528 Ga0495642_0137576 Ga0495642_0137576_43_1038 330
512 3300046530 Ga0495654_0005602 Ga0495654_0005602_1150_2145 330
513 3300046531 Ga0495665_0007608 Ga0495665_0007608_2653_3648 330
514 3300046531 Ga0495665_0063244 Ga0495665_0063244_33_1028 330
515 3300046535 Ga0495586_0006988 Ga0495586_0006988_3793_4788 330
516 3300046538 Ga0495609_0014487 Ga0495609_0014487_818_1813 330
517 3300046538 Ga0495609_0021260 Ga0495609_0021260_1347_2342 330
518 3300046538 Ga0495609_0039463 Ga0495609_0039463_911_1906 330
519 3300046542 Ga0495597_0002422 Ga0495597_0002422_9879_10874 330
520 3300046542 Ga0495597_0013932 Ga0495597_0013932_1871_2866 330
521 3300046557 Ga0495622_0006675 Ga0495622_0006675_394_1389 330
522 3300046557 Ga0495622_0037023 Ga0495622_0037023_137_1132 330
523 3300046558 Ga0495633_0007848 Ga0495633_0007848_3891_4886 330
524 3300046558 Ga0495633_0018740 Ga0495633_0018740_1005_2000 330
525 3300046558 Ga0495633_0038856 Ga0495633_0038856_935_1930 330
526 3300046558 Ga0495633_0046850 Ga0495633_0046850_307_1302 330
527 3300046616 Ga0495668_0000768 Ga0495668_0000768_25676_26671 330
528 3300046616 Ga0495668_0090816 Ga0495668_0090816_581_1576 330
529 3300046648 Ga0495611_0000377 Ga0495611_0000377_5961_6956 330
530 3300046648 Ga0495611_0004255 Ga0495611_0004255_2130_3125 330
531 3300046648 Ga0495611_0018873 Ga0495611_0018873_1047_2042 330
532 3300046648 Ga0495611_0026855 Ga0495611_0026855_1154_2149 330
533 3300046648 Ga0495611_0036316 Ga0495611_0036316_178_1173 330
534 3300046648 Ga0495611_0046008 Ga0495611_0046008_349_1344 330
535 3300046648 Ga0495611_0067326 Ga0495611_0067326_543_1538 330
536 3300046648 Ga0495611_0123237 Ga0495611_0123237_199_1194 330
537 3300046660 Ga0495625_0023747 Ga0495625_0023747_2837_3832 330
538 3300046660 Ga0495625_0032661 Ga0495625_0032661_2155_3150 330
539 3300046663 Ga0495635_0000374 Ga0495635_0000374_18719_19714 330
540 3300046665 Ga0495661_0000932 Ga0495661_0000932_1402_2397 330
541 3300046665 Ga0495661_0001580 Ga0495661_0001580_13265_14260 330
542 3300046665 Ga0495661_0078008 Ga0495661_0078008_598_1593 330
543 3300046665 Ga0495661_0095201 Ga0495661_0095201_94_1089 330
544 3300046665 Ga0495661_0109935 Ga0495661_0109935_75_1070 330
545 3300046665 Ga0495661_0120953 Ga0495661_0120953_18_1013 330
546 3300046674 Ga0495588_0017891 Ga0495588_0017891_1417_2412 330
547 3300046674 Ga0495588_0027605 Ga0495588_0027605_1542_2537 330
548 3300046674 Ga0495588_0081565 Ga0495588_0081565_301_1296 330
549 3300046679 Ga0495623_0099708 Ga0495623_0099708_632_1627 330
550 3300046684 Ga0495669_0000218 Ga0495669_0000218_15917_16912 330
551 3300046684 Ga0495669_0001840 Ga0495669_0001840_1380_2375 330
552 3300046684 Ga0495669_0009191 Ga0495669_0009191_2410_3405 330
553 3300046689 Ga0495613_0038210 Ga0495613_0038210_1025_2020 330
554 3300046690 Ga0495624_0008402 Ga0495624_0008402_527_1522 330
555 3300046691 Ga0495670_0001687 Ga0495670_0001687_3061_4056 330
556 3300046691 Ga0495670_0038658 Ga0495670_0038658_309_1304 330
557 3300046691 Ga0495670_0054019 Ga0495670_0054019_755_1750 330
558 3300046691 Ga0495670_0062797 Ga0495670_0062797_798_1793 330
559 3300046692 Ga0495671_0002478 Ga0495671_0002478_8650_9645 330
560 3300046692 Ga0495671_0013847 Ga0495671_0013847_2521_3516 330
561 3300046692 Ga0495671_0023340 Ga0495671_0023340_1299_2294 330
562 3300046694 Ga0495649_0000255 Ga0495649_0000255_26014_27009 330
563 3300046694 Ga0495649_0053634 Ga0495649_0053634_841_1836 330
564 3300046794 Ga0495589_0004718 Ga0495589_0004718_2070_3065 330
565 3300046794 Ga0495589_0046504 Ga0495589_0046504_999_1994 330
566 3300046794 Ga0495589_0051364 Ga0495589_0051364_989_1984 330
567 3300046810 Ga0495660_0015805 Ga0495660_0015805_1709_2704 330
568 3300046810 Ga0495660_0039856 Ga0495660_0039856_1083_2078 330
569 3300047315 Ga0495581_0004542 Ga0495581_0004542_6625_7620 330
570 3300047315 Ga0495581_0065980 Ga0495581_0065980_668_1663 330
571 3300047317 Ga0495604_0029185 Ga0495604_0029185_1027_2022 330
572 3300047318 Ga0495636_0006057 Ga0495636_0006057_2308_3303 330
573 3300047321 Ga0495676_0000034 Ga0495676_0000034_26428_27423 330
574 3300047321 Ga0495676_0028077 Ga0495676_0028077_2686_3681 330
575 3300047321 Ga0495676_0051366 Ga0495676_0051366_675_1778 330
576 3300047322 Ga0495680_0003719 Ga0495680_0003719_6830_7825 330
577 3300047323 Ga0495683_0050857 Ga0495683_0050857_666_1661 330
578 3300047443 Ga0495687_000060 Ga0495687_000060_134319_135314 330
579 3300047443 Ga0495687_000410 Ga0495687_000410_25752_26747 330
580 3300047443 Ga0495687_002333 Ga0495687_002333_1393_2388 330
581 3300047444 Ga0495675_0015513 Ga0495675_0015513_253_1248 330
582 3300047445 Ga0495677_0004862 Ga0495677_0004862_1075_2070 330
583 3300047445 Ga0495677_0015412 Ga0495677_0015412_1060_2055 330
584 3300047445 Ga0495677_0023348 Ga0495677_0023348_744_1739 330
585 3300047446 Ga0495679_005605 Ga0495679_005605_3749_4744 330
586 3300047447 Ga0495685_002470 Ga0495685_002470_2606_3601 330
587 3300047447 Ga0495685_033833 Ga0495685_033833_429_1424 330
588 3300047470 Ga0495681_0001232 Ga0495681_0001232_4681_5676 330
589 3300047470 Ga0495681_0001235 Ga0495681_0001235_14409_15404 330
590 3300047470 Ga0495681_0015138 Ga0495681_0015138_3049_4044 330
591 3300047470 Ga0495681_0023844 Ga0495681_0023844_1808_2803 330
592 3300047470 Ga0495681_0053345 Ga0495681_0053345_495_1490 330
593 3300047472 Ga0495686_0002274 Ga0495686_0002274_12665_13660 330
594 3300047472 Ga0495686_0140112 Ga0495686_0140112_134_1129 330
595 3300048089 Ga0495614_0006982 Ga0495614_0006982_3195_4190 330
596 3300048089 Ga0495614_0028657 Ga0495614_0028657_115_1110 330
597 3300048091 Ga0495626_0008646 Ga0495626_0008646_981_1976 330
598 3300048091 Ga0495626_0013373 Ga0495626_0013373_1187_2182 330
599 3300048091 Ga0495626_0038467 Ga0495626_0038467_350_1345 330
600 3300048091 Ga0495626_0043067 Ga0495626_0043067_862_1857 330
601 3300048091 Ga0495626_0052738 Ga0495626_0052738_353_1348 330
602 3300048903 Ga0496100_0091272 Ga0496100_0091272_408_1403 330
603 3300048906 Ga0496103_0035127 Ga0496103_0035127_477_1472 330
604 3300048911 Ga0496108_0169803 Ga0496108_0169803_83_1078 330
605 3300048913 Ga0496110_0000719 Ga0496110_0000719_3833_4828 330
606 3300048913 Ga0496110_0033809 Ga0496110_0033809_2254_3327 330
607 3300048914 Ga0496111_0127989 Ga0496111_0127989_773_1846 330
608 3300048914 Ga0496111_0132927 Ga0496111_0132927_201_1196 330
609 3300048916 Ga0496113_0095267 Ga0496113_0095267_199_1194 330
610 3300048918 Ga0496115_0076188 Ga0496115_0076188_796_1791 330
611 3300048925 Ga0496122_0000337 Ga0496122_0000337_4194_5189 330
612 3300048926 Ga0496123_0000905 Ga0496123_0000905_20379_21374 330
613 3300048928 Ga0496125_0022086 Ga0496125_0022086_1086_2081 330
614 3300049459 Ga0495678_000150 Ga0495678_000150_4810_5805 330
615 3300049459 Ga0495678_002016 Ga0495678_002016_12459_13454 330
616 3300049459 Ga0495678_006504 Ga0495678_006504_3205_4200 330
617 3300049459 Ga0495678_020859 Ga0495678_020859_366_1361 330
618 3300049459 Ga0495678_060558 Ga0495678_060558_366_1361 330
619 3300049460 Ga0495682_0006292 Ga0495682_0006292_3214_4209 330
620 3300049584 Ga0501068_0147605 Ga0501068_0147605_449_1465 330
621 3300049585 Ga0501069_0003092 Ga0501069_0003092_7499_8515 330
622 3300049586 Ga0501070_0064316 Ga0501070_0064316_358_1353 330
623 3300049588 Ga0501072_0236487 Ga0501072_0236487_415_1407 330
624 3300050514 nmdc:mga08x19_7003_c1 nmdc:mga08x19_7003_c1_206_1210 330
625 3300005337 Ga0070682_100064172 Ga0070682_1000641722 331
626 3300005435 Ga0070714_100128201 Ga0070714_1001282013 331
627 3300005435 Ga0070714_100488805 Ga0070714_1004888051 331
628 3300005436 Ga0070713_100091223 Ga0070713_1000912232 331
629 3300005535 Ga0070684_100113316 Ga0070684_1001133161 331
630 3300005539 Ga0068853_100052372 Ga0068853_1000523722 331
631 3300005841 Ga0068863_100558210 Ga0068863_1005582102 331
632 3300006038 Ga0075365_10050969 Ga0075365_100509692 331
633 3300006186 Ga0075369_10030120 Ga0075369_100301202 331
634 3300006871 Ga0075434_100130481 Ga0075434_1001304812 331
635 3300007788 Ga0099795_10077009 Ga0099795_100770092 331
636 3300009545 Ga0105237_10127658 Ga0105237_101276583 331
637 3300013105 Ga0157369_10043243 Ga0157369_100432433 331
638 3300013105 Ga0157369_10094270 Ga0157369_100942702 331
639 3300013307 Ga0157372_10366895 Ga0157372_103668952 331
640 3300025295 Ga0209564_1011494 Ga0209564_10114942 331
641 3300025914 Ga0207671_10092379 Ga0207671_100923792 331
642 3300025939 Ga0207665_10037925 Ga0207665_100379252 331
643 3300025944 Ga0207661_10042121 Ga0207661_100421212 331
644 3300028577 Ga0265318_10010234 Ga0265318_100102343 331
645 3300028577 Ga0265318_10043687 Ga0265318_100436871 331
646 3300031235 Ga0265330_10014071 Ga0265330_100140714 331
647 3300031235 Ga0265330_10042865 Ga0265330_100428652 331
648 3300031238 Ga0265332_10000013 Ga0265332_10000013110 331
649 3300031238 Ga0265332_10032358 Ga0265332_100323582 331
650 3300031240 Ga0265320_10017857 Ga0265320_100178572 331
651 3300031240 Ga0265320_10028123 Ga0265320_100281233 331
652 3300031241 Ga0265325_10004624 Ga0265325_100046246 331
653 3300031241 Ga0265325_10106950 Ga0265325_101069502 331
654 3300031247 Ga0265340_10018160 Ga0265340_100181602 331
655 3300031249 Ga0265339_10056439 Ga0265339_100564392 331
656 3300031249 Ga0265339_10105096 Ga0265339_101050961 331
657 3300031250 Ga0265331_10002514 Ga0265331_100025144 331
658 3300031344 Ga0265316_10049511 Ga0265316_100495111 331
659 3300031595 Ga0265313_10000305 Ga0265313_1000030531 331
660 3300031595 Ga0265313_10023841 Ga0265313_100238411 331
661 3300031711 Ga0265314_10006855 Ga0265314_1000685511 331
662 3300031711 Ga0265314_10154517 Ga0265314_101545171 331
663 3300031712 Ga0265342_10033179 Ga0265342_100331792 331
664 3300035113 Ga0373936_0033719 Ga0373936_0033719_941_1948 331
665 3300037068 Ga0373925_0065962 Ga0373925_0065962_1080_2081 331
666 3300037312 Ga0395899_0002233 Ga0395899_0002233_4076_5071 331
667 3300037312 Ga0395899_0069985 Ga0395899_0069985_1036_2031 331
668 3300037312 Ga0395899_0185599 Ga0395899_0185599_441_1445 331
669 3300037418 Ga0395900_0001351 Ga0395900_0001351_10850_11845 331
670 3300037418 Ga0395900_0008575 Ga0395900_0008575_3371_4366 331
671 3300037418 Ga0395900_0087306 Ga0395900_0087306_306_1301 331
672 3300037466 Ga0395898_0002484 Ga0395898_0002484_17973_18968 331
673 3300037466 Ga0395898_0035192 Ga0395898_0035192_2089_3084 331
674 3300037466 Ga0395898_0079851 Ga0395898_0079851_928_1932 331
675 3300037466 Ga0395898_0109613 Ga0395898_0109613_468_1463 331
676 3300038443 Ga0395901_0047934 Ga0395901_0047934_1010_2005 331
677 3300038443 Ga0395901_0055382 Ga0395901_0055382_1439_2443 331
678 3300038443 Ga0395901_0108548 Ga0395901_0108548_1681_2685 331
679 3300038443 Ga0395901_0117260 Ga0395901_0117260_510_1505 331
680 3300039437 Ga0436365_0618633 Ga0436365_0618633_870_1889 331
681 3300041498 Ga0451841_1016410 Ga0451841_1016410_364_1377 331
682 3300044712 Ga0453684_0000292 Ga0453684_0000292_4782_5780 331
683 3300044712 Ga0453684_0011680 Ga0453684_0011680_9623_10627 331
684 3300045051 Ga0451576_0001449 Ga0451576_0001449_34556_35560 331
685 3300046524 Ga0495648_0022320 Ga0495648_0022320_331_1338 331
686 3300047317 Ga0495604_0299833 Ga0495604_0299833_26_1033 331
687 3300047469 Ga0495673_0000113 Ga0495673_0000113_107167_108174 331
688 3300048904 Ga0496101_0001016 Ga0496101_0001016_292_1296 331
689 3300048905 Ga0496102_0004447 Ga0496102_0004447_6499_7503 331
690 3300048906 Ga0496103_0059292 Ga0496103_0059292_1276_2280 331
691 3300048908 Ga0496105_0074064 Ga0496105_0074064_729_1733 331
692 3300048910 Ga0496107_0001492 Ga0496107_0001492_12575_13579 331
693 3300048913 Ga0496110_0008645 Ga0496110_0008645_6865_7869 331
694 3300048916 Ga0496113_0149244 Ga0496113_0149244_283_1287 331
695 3300048919 Ga0496116_0002360 Ga0496116_0002360_10340_11401 331
696 3300048929 Ga0496126_0050325 Ga0496126_0050325_242_1303 331
697 3300049571 Ga0501034_0092457 Ga0501034_0092457_280_1287 331
698 3300049586 Ga0501070_0181203 Ga0501070_0181203_249_1256 331
699 3300049589 Ga0501073_0075846 Ga0501073_0075846_353_1360 331
700 3300049822 Ga0501035_0000745 Ga0501035_0000745_19131_20144 331
701 3300050492 nmdc:mga0yw44_127618_c1 nmdc:mga0yw44_127618_c1_127_1140 331
702 3300050513 nmdc:mga0rr50_223692_c1 nmdc:mga0rr50_223692_c1_489_1496 331
703 3300050514 nmdc:mga08x19_191215_c1 nmdc:mga08x19_191215_c1_230_1237 331
704 3300050516 nmdc:mga0sz30_17656_c2 nmdc:mga0sz30_17656_c2_527_1540 331
705 3300053087 Ga0500643_000373 Ga0500643_000373_31028_32035 331
706 3300059503 Ga0587080_008331 Ga0587080_008331_309_1313 331
707 3300059647 Ga0587079_009696 Ga0587079_009696_170_1174 331
708 iso_pu_bacteria 2602042107 2603861254 331
709 3300003215 JGI25153J46596_10013246 JGI25153J46596_100132463 332
710 3300004799 Ga0058863_11848090 Ga0058863_118480901 332
711 3300005327 Ga0070658_10001397 Ga0070658_1000139713 332
712 3300005327 Ga0070658_10030736 Ga0070658_100307363 332
713 3300005327 Ga0070658_10224419 Ga0070658_102244192 332
714 3300005336 Ga0070680_100044005 Ga0070680_1000440052 332
715 3300005336 Ga0070680_100047519 Ga0070680_1000475192 332
716 3300005339 Ga0070660_100051183 Ga0070660_1000511831 332
717 3300005339 Ga0070660_100190313 Ga0070660_1001903132 332
718 3300005354 Ga0070675_100057810 Ga0070675_1000578101 332
719 3300005458 Ga0070681_10028622 Ga0070681_100286222 332
720 3300005471 Ga0070698_100167635 Ga0070698_1001676353 332
721 3300005530 Ga0070679_100002598 Ga0070679_10000259812 332
722 3300005530 Ga0070679_100122180 Ga0070679_1001221802 332
723 3300005539 Ga0068853_100059781 Ga0068853_1000597814 332
724 3300005563 Ga0068855_100007325 Ga0068855_1000073258 332
725 3300005563 Ga0068855_100029706 Ga0068855_1000297063 332
726 3300005563 Ga0068855_100068946 Ga0068855_1000689463 332
727 3300005563 Ga0068855_100137439 Ga0068855_1001374392 332
728 3300005614 Ga0068856_100166874 Ga0068856_1001668742 332
729 3300005616 Ga0068852_100105730 Ga0068852_1001057303 332
730 3300005937 Ga0081455_10000450 Ga0081455_1000045038 332
731 3300009093 Ga0105240_10032923 Ga0105240_100329232 332
732 3300009093 Ga0105240_10070916 Ga0105240_100709163 332
733 3300009551 Ga0105238_10013324 Ga0105238_100133244 332
734 3300009551 Ga0105238_10049374 Ga0105238_100493743 332
735 3300009551 Ga0105238_10242801 Ga0105238_102428012 332
736 3300011119 Ga0105246_10349644 Ga0105246_103496441 332
737 3300013102 Ga0157371_10074032 Ga0157371_100740322 332
738 3300013105 Ga0157369_10006619 Ga0157369_100066194 332
739 3300013105 Ga0157369_10152332 Ga0157369_101523322 332
740 3300013307 Ga0157372_10001893 Ga0157372_100018938 332
741 3300013307 Ga0157372_10164772 Ga0157372_101647723 332
742 3300014326 Ga0157380_10382238 Ga0157380_103822382 332
743 3300021384 Ga0213876_10035613 Ga0213876_100356133 332
744 3300025297 Ga0209758_1002512 Ga0209758_100251221 332
745 3300025909 Ga0207705_10021350 Ga0207705_100213503 332
746 3300025909 Ga0207705_10043137 Ga0207705_100431373 332
747 3300025909 Ga0207705_10104844 Ga0207705_101048442 332
748 3300025909 Ga0207705_10191005 Ga0207705_101910052 332
749 3300025912 Ga0207707_10017231 Ga0207707_100172312 332
750 3300025912 Ga0207707_10058004 Ga0207707_100580042 332
751 3300025913 Ga0207695_10074097 Ga0207695_100740972 332
752 3300025917 Ga0207660_10036903 Ga0207660_100369032 332
753 3300025917 Ga0207660_10059590 Ga0207660_100595903 332
754 3300025919 Ga0207657_10046726 Ga0207657_100467263 332
755 3300025919 Ga0207657_10156996 Ga0207657_101569961 332
756 3300025919 Ga0207657_10185556 Ga0207657_101855563 332
757 3300025921 Ga0207652_10013860 Ga0207652_100138606 332
758 3300025921 Ga0207652_10023347 Ga0207652_100233474 332
759 3300025921 Ga0207652_10116685 Ga0207652_101166853 332
760 3300025922 Ga0207646_10299647 Ga0207646_102996471 332
761 3300025924 Ga0207694_10043194 Ga0207694_100431943 332
762 3300025924 Ga0207694_10082785 Ga0207694_100827852 332
763 3300025926 Ga0207659_10089310 Ga0207659_100893103 332
764 3300025929 Ga0207664_10117664 Ga0207664_101176642 332
765 3300025929 Ga0207664_10218074 Ga0207664_102180742 332
766 3300025937 Ga0207669_10033550 Ga0207669_100335503 332
767 3300025949 Ga0207667_10045798 Ga0207667_100457983 332
768 3300025949 Ga0207667_10049144 Ga0207667_100491442 332
769 3300025960 Ga0207651_10097333 Ga0207651_100973332 332
770 3300026078 Ga0207702_10171117 Ga0207702_101711171 332
771 3300026116 Ga0207674_10110344 Ga0207674_101103442 332
772 3300026142 Ga0207698_10041733 Ga0207698_100417334 332
773 3300026142 Ga0207698_10084206 Ga0207698_100842063 332
774 3300028800 Ga0265338_10044273 Ga0265338_100442733 332
775 3300031235 Ga0265330_10060877 Ga0265330_100608772 332
776 3300031241 Ga0265325_10002805 Ga0265325_1000280510 332
777 3300031241 Ga0265325_10011615 Ga0265325_100116155 332
778 3300031249 Ga0265339_10003040 Ga0265339_100030402 332
779 3300031595 Ga0265313_10002293 Ga0265313_100022932 332
780 3300031711 Ga0265314_10032816 Ga0265314_100328163 332
781 3300031712 Ga0265342_10000715 Ga0265342_100007157 332
782 3300031712 Ga0265342_10018334 Ga0265342_100183342 332
783 3300035114 Ga0373939_0001163 Ga0373939_0001163_3183_4190 332
784 3300035692 Ga0373935_0158254 Ga0373935_0158254_467_1486 332
785 3300035695 Ga0373927_0000141 Ga0373927_0000141_40020_41039 332
786 3300036401 Ga0373937_0330528 Ga0373937_0330528_372_1373 332
787 3300037418 Ga0395900_0011283 Ga0395900_0011283_7780_8781 332
788 3300037418 Ga0395900_0078540 Ga0395900_0078540_60_1067 332
789 3300037466 Ga0395898_0026473 Ga0395898_0026473_447_1448 332
790 3300037471 Ga0395905_0018272 Ga0395905_0018272_3524_4525 332
791 3300038443 Ga0395901_0027085 Ga0395901_0027085_1506_2507 332
792 3300044842 Ga0466957_0106405 Ga0466957_0106405_175_1188 332
793 3300046689 Ga0495613_0071833 Ga0495613_0071833_1247_2248 332
794 3300049571 Ga0501034_0131283 Ga0501034_0131283_1343_2344 332
795 3300049581 Ga0501047_0063332 Ga0501047_0063332_1062_2060 332
796 3300049823 Ga0501044_0064833 Ga0501044_0064833_1433_2431 332
797 3300050513 nmdc:mga0rr50_367003_c1 nmdc:mga0rr50_367003_c1_103_1116 332
798 iso_pu_bacteria 2891633521 2891636311 332
799 iso_pu_bacteria 8054002106 8054007320 332
800 3300001904 JGI24736J21556_1011548 JGI24736J21556_10115482 333
801 3300001989 JGI24739J22299_10032889 JGI24739J22299_100328891 333
802 3300003215 JGI25153J46596_10001194 JGI25153J46596_1000119415 333
803 3300003794 Ga0055531_10010136 Ga0055531_100101363 333
804 3300004625 Ga0055543_1001666 Ga0055543_10016665 333
805 3300005262 Ga0065165_1000747 Ga0065165_100074736 333
806 3300005262 Ga0065165_1025464 Ga0065165_10254642 333
807 3300005329 Ga0070683_100012136 Ga0070683_1000121365 333
808 3300005329 Ga0070683_100032799 Ga0070683_1000327992 333
809 3300005329 Ga0070683_100181899 Ga0070683_1001818992 333
810 3300005336 Ga0070680_100010478 Ga0070680_1000104783 333
811 3300005336 Ga0070680_100053370 Ga0070680_1000533702 333
812 3300005336 Ga0070680_100089888 Ga0070680_1000898882 333
813 3300005344 Ga0070661_100296889 Ga0070661_1002968891 333
814 3300005347 Ga0070668_100108226 Ga0070668_1001082262 333
815 3300005355 Ga0070671_100013367 Ga0070671_1000133676 333
816 3300005367 Ga0070667_100260189 Ga0070667_1002601892 333
817 3300005434 Ga0070709_10133151 Ga0070709_101331512 333
818 3300005435 Ga0070714_100216521 Ga0070714_1002165212 333
819 3300005436 Ga0070713_100005837 Ga0070713_1000058378 333
820 3300005439 Ga0070711_100045043 Ga0070711_1000450432 333
821 3300005457 Ga0070662_100239491 Ga0070662_1002394911 333
822 3300005458 Ga0070681_10050528 Ga0070681_100505283 333
823 3300005458 Ga0070681_10086048 Ga0070681_100860482 333
824 3300005458 Ga0070681_10200397 Ga0070681_102003972 333
825 3300005530 Ga0070679_100014503 Ga0070679_1000145032 333
826 3300005530 Ga0070679_100045886 Ga0070679_1000458862 333
827 3300005530 Ga0070679_100079343 Ga0070679_1000793432 333
828 3300005530 Ga0070679_100121730 Ga0070679_1001217302 333
829 3300005535 Ga0070684_100007833 Ga0070684_1000078336 333
830 3300005535 Ga0070684_100045711 Ga0070684_1000457112 333
831 3300005535 Ga0070684_100227807 Ga0070684_1002278072 333
832 3300005535 Ga0070684_100346413 Ga0070684_1003464131 333
833 3300005539 Ga0068853_100087383 Ga0068853_1000873831 333
834 3300005539 Ga0068853_100108425 Ga0068853_1001084251 333
835 3300005539 Ga0068853_100177834 Ga0068853_1001778342 333
836 3300005548 Ga0070665_100332707 Ga0070665_1003327071 333
837 3300005563 Ga0068855_100007560 Ga0068855_1000075602 333
838 3300005563 Ga0068855_100249395 Ga0068855_1002493952 333
839 3300005577 Ga0068857_100232158 Ga0068857_1002321581 333
840 3300005614 Ga0068856_100011621 Ga0068856_1000116218 333
841 3300005614 Ga0068856_100112906 Ga0068856_1001129062 333
842 3300005618 Ga0068864_100171265 Ga0068864_1001712652 333
843 3300005842 Ga0068858_100209764 Ga0068858_1002097642 333
844 3300005843 Ga0068860_100000360 Ga0068860_10000036051 333
845 3300005983 Ga0081540_1024723 Ga0081540_10247233 333
846 3300006028 Ga0070717_10307747 Ga0070717_103077472 333
847 3300006038 Ga0075365_10093400 Ga0075365_100934002 333
848 3300006042 Ga0075368_10003442 Ga0075368_100034423 333
849 3300006048 Ga0075363_100002993 Ga0075363_1000029931 333
850 3300006051 Ga0075364_10182273 Ga0075364_101822732 333
851 3300006175 Ga0070712_100083071 Ga0070712_1000830712 333
852 3300006177 Ga0075362_10094680 Ga0075362_100946802 333
853 3300006178 Ga0075367_10022359 Ga0075367_100223592 333
854 3300006195 Ga0075366_10008295 Ga0075366_100082953 333
855 3300006353 Ga0075370_10098114 Ga0075370_100981142 333
856 3300006358 Ga0068871_100175008 Ga0068871_1001750081 333
857 3300006941 Ga0099825_1028499 Ga0099825_10284992 333
858 3300006944 Ga0099823_1038175 Ga0099823_10381753 333
859 3300009098 Ga0105245_10109359 Ga0105245_101093592 333
860 3300009101 Ga0105247_10010254 Ga0105247_100102542 333
861 3300009101 Ga0105247_10048858 Ga0105247_100488583 333
862 3300009174 Ga0105241_10012445 Ga0105241_100124456 333
863 3300009545 Ga0105237_10016707 Ga0105237_100167072 333
864 3300009545 Ga0105237_10235386 Ga0105237_102353862 333
865 3300009551 Ga0105238_10013345 Ga0105238_100133454 333
866 3300009551 Ga0105238_10046828 Ga0105238_100468282 333
867 3300009551 Ga0105238_10269677 Ga0105238_102696771 333
868 3300010375 Ga0105239_10090504 Ga0105239_100905043 333
869 3300010375 Ga0105239_10159097 Ga0105239_101590972 333
870 3300011119 Ga0105246_10060931 Ga0105246_100609313 333
871 3300013100 Ga0157373_10049551 Ga0157373_100495512 333
872 3300013100 Ga0157373_10061305 Ga0157373_100613053 333
873 3300013104 Ga0157370_10046415 Ga0157370_100464153 333
874 3300013104 Ga0157370_10116799 Ga0157370_101167992 333
875 3300013105 Ga0157369_10082359 Ga0157369_100823594 333
876 3300013296 Ga0157374_10009522 Ga0157374_100095222 333
877 3300013307 Ga0157372_10166778 Ga0157372_101667781 333
878 3300013307 Ga0157372_10428619 Ga0157372_104286191 333
879 3300013308 Ga0157375_10289012 Ga0157375_102890122 333
880 3300020070 Ga0206356_11709197 Ga0206356_117091972 333
881 3300021358 Ga0213873_10026320 Ga0213873_100263201 333
882 3300021384 Ga0213876_10003579 Ga0213876_100035798 333
883 3300021384 Ga0213876_10032216 Ga0213876_100322163 333
884 3300025254 Ga0209148_1000479 Ga0209148_100047925 333
885 3300025261 Ga0209233_1007520 Ga0209233_10075202 333
886 3300025272 Ga0209455_1000521 Ga0209455_100052113 333
887 3300025297 Ga0209758_1000011 Ga0209758_1000011517 333
888 3300025297 Ga0209758_1003647 Ga0209758_10036479 333
889 3300025297 Ga0209758_1005738 Ga0209758_10057384 333
890 3300025299 Ga0209256_1001013 Ga0209256_100101320 333
891 3300025302 Ga0207426_1003487 Ga0207426_10034873 333
892 3300025302 Ga0207426_1027902 Ga0207426_10279022 333
893 3300025304 Ga0209257_1001101 Ga0209257_100110129 333
894 3300025898 Ga0207692_10036417 Ga0207692_100364172 333
895 3300025900 Ga0207710_10055375 Ga0207710_100553752 333
896 3300025904 Ga0207647_10027761 Ga0207647_100277612 333
897 3300025911 Ga0207654_10175475 Ga0207654_101754751 333
898 3300025912 Ga0207707_10000886 Ga0207707_100008862 333
899 3300025912 Ga0207707_10031180 Ga0207707_100311805 333
900 3300025912 Ga0207707_10034974 Ga0207707_100349742 333
901 3300025912 Ga0207707_10036764 Ga0207707_100367642 333
902 3300025913 Ga0207695_10000008 Ga0207695_10000008982 333
903 3300025913 Ga0207695_10088068 Ga0207695_100880684 333
904 3300025914 Ga0207671_10046154 Ga0207671_100461543 333
905 3300025914 Ga0207671_10122549 Ga0207671_101225492 333
906 3300025914 Ga0207671_10147901 Ga0207671_101479012 333
907 3300025915 Ga0207693_10040763 Ga0207693_100407634 333
908 3300025915 Ga0207693_10120033 Ga0207693_101200332 333
909 3300025917 Ga0207660_10016752 Ga0207660_100167526 333
910 3300025917 Ga0207660_10148106 Ga0207660_101481062 333
911 3300025917 Ga0207660_10223862 Ga0207660_102238622 333
912 3300025921 Ga0207652_10028071 Ga0207652_100280712 333
913 3300025921 Ga0207652_10057909 Ga0207652_100579092 333
914 3300025923 Ga0207681_10054661 Ga0207681_100546612 333
915 3300025924 Ga0207694_10034501 Ga0207694_100345014 333
916 3300025924 Ga0207694_10125907 Ga0207694_101259072 333
917 3300025927 Ga0207687_10145014 Ga0207687_101450142 333
918 3300025928 Ga0207700_10049267 Ga0207700_100492673 333
919 3300025929 Ga0207664_10115073 Ga0207664_101150732 333
920 3300025933 Ga0207706_10075564 Ga0207706_100755641 333
921 3300025942 Ga0207689_10196048 Ga0207689_101960481 333
922 3300025944 Ga0207661_10002050 Ga0207661_1000205013 333
923 3300025949 Ga0207667_10075652 Ga0207667_100756522 333
924 3300025949 Ga0207667_10113009 Ga0207667_101130092 333
925 3300025949 Ga0207667_10129253 Ga0207667_101292532 333
926 3300025949 Ga0207667_10189378 Ga0207667_101893781 333
927 3300025981 Ga0207640_10299357 Ga0207640_102993571 333
928 3300025986 Ga0207658_10089254 Ga0207658_100892542 333
929 3300026035 Ga0207703_10063992 Ga0207703_100639922 333
930 3300026041 Ga0207639_10251065 Ga0207639_102510652 333
931 3300026067 Ga0207678_10040509 Ga0207678_100405093 333
932 3300026078 Ga0207702_10115161 Ga0207702_101151613 333
933 3300026089 Ga0207648_10190549 Ga0207648_101905492 333
934 3300026121 Ga0207683_10030306 Ga0207683_100303065 333
935 3300026142 Ga0207698_10097884 Ga0207698_100978842 333
936 3300027296 Ga0209389_1000043 Ga0209389_10000434 333
937 3300027296 Ga0209389_1000077 Ga0209389_100007770 333
938 3300027357 Ga0209589_1000047 Ga0209589_1000047107 333
939 3300027361 Ga0209489_100075 Ga0209489_100075139 333
940 3300027361 Ga0209489_100251 Ga0209489_10025170 333
941 3300027363 Ga0209700_100271 Ga0209700_10027170 333
942 3300028379 Ga0268266_10077358 Ga0268266_100773582 333
943 3300028381 Ga0268264_10000030 Ga0268264_10000030232 333
944 3300028800 Ga0265338_10158511 Ga0265338_101585112 333
945 3300030521 Ga0307511_10097154 Ga0307511_100971542 333
946 3300031241 Ga0265325_10115173 Ga0265325_101151732 333
947 3300031250 Ga0265331_10053030 Ga0265331_100530302 333
948 3300031507 Ga0307509_10084524 Ga0307509_100845241 333
949 3300031507 Ga0307509_10161525 Ga0307509_101615252 333
950 3300031507 Ga0307509_10274924 Ga0307509_102749242 333
951 3300031616 Ga0307508_10003532 Ga0307508_1000353214 333
952 3300031616 Ga0307508_10076958 Ga0307508_100769582 333
953 3300031616 Ga0307508_10243830 Ga0307508_102438301 333
954 3300031730 Ga0307516_10018252 Ga0307516_100182526 333
955 3300033179 Ga0307507_10026861 Ga0307507_100268612 333
956 3300033180 Ga0307510_10017164 Ga0307510_100171648 333
957 3300035113 Ga0373936_0007226 Ga0373936_0007226_1306_2307 333
958 3300035118 Ga0373954_0014590 Ga0373954_0014590_1914_2915 333
959 3300035118 Ga0373954_0085911 Ga0373954_0085911_119_1180 333
960 3300035172 Ga0373955_0002561 Ga0373955_0002561_126_1127 333
961 3300035724 Ga0373933_0001848 Ga0373933_0001848_666_1667 333
962 3300035724 Ga0373933_0018022 Ga0373933_0018022_206_1207 333
963 3300035725 Ga0373947_0106219 Ga0373947_0106219_597_1598 333
964 3300036401 Ga0373937_0060512 Ga0373937_0060512_2017_3087 333
965 3300037068 Ga0373925_0052049 Ga0373925_0052049_307_1308 333
966 3300037466 Ga0395898_0051684 Ga0395898_0051684_1237_2238 333
967 3300037466 Ga0395898_0211320 Ga0395898_0211320_17_1018 333
968 3300037471 Ga0395905_0002041 Ga0395905_0002041_15520_16530 333
969 3300037471 Ga0395905_0016323 Ga0395905_0016323_1727_2728 333
970 3300038443 Ga0395901_0035187 Ga0395901_0035187_992_1993 333
971 3300038443 Ga0395901_0135936 Ga0395901_0135936_345_1346 333
972 3300039437 Ga0436365_1104948 Ga0436365_1104948_1009_2019 333
973 3300039437 Ga0436365_1236739 Ga0436365_1236739_25908_26909 333
974 3300039453 Ga0436362_0548217 Ga0436362_0548217_285_1286 333
975 3300044658 Ga0466972_0024879 Ga0466972_0024879_260_1261 333
976 3300044673 Ga0453683_0092249 Ga0453683_0092249_461_1486 333
977 3300044693 Ga0466961_0033127 Ga0466961_0033127_355_1356 333
978 3300044694 Ga0466963_0042278 Ga0466963_0042278_1777_2778 333
979 3300044706 Ga0466964_0011528 Ga0466964_0011528_1984_2985 333
980 3300044706 Ga0466964_0057426 Ga0466964_0057426_220_1221 333
981 3300044719 Ga0466971_0130019 Ga0466971_0130019_118_1119 333
982 3300044765 Ga0466970_0095902 Ga0466970_0095902_156_1157 333
983 3300044842 Ga0466957_0058332 Ga0466957_0058332_866_1867 333
984 3300045049 Ga0466959_0035355 Ga0466959_0035355_1037_2038 333
985 3300045976 Ga0466967_0043874 Ga0466967_0043874_261_1310 333
986 3300046459 Ga0495629_0007325 Ga0495629_0007325_1839_2852 333
987 3300046459 Ga0495629_0274045 Ga0495629_0274045_104_1105 333
988 3300046462 Ga0495651_0031133 Ga0495651_0031133_599_1612 333
989 3300046462 Ga0495651_0056071 Ga0495651_0056071_1926_2939 333
990 3300046462 Ga0495651_0296275 Ga0495651_0296275_14_1015 333
991 3300046473 Ga0495582_0016731 Ga0495582_0016731_2142_3143 333
992 3300046475 Ga0495639_0017874 Ga0495639_0017874_196_1266 333
993 3300046477 Ga0495664_0095802 Ga0495664_0095802_230_1300 333
994 3300046522 Ga0495643_0034612 Ga0495643_0034612_183_1184 333
995 3300046529 Ga0495652_0006590 Ga0495652_0006590_2942_3955 333
996 3300046529 Ga0495652_0061540 Ga0495652_0061540_1041_2054 333
997 3300046531 Ga0495665_0016281 Ga0495665_0016281_248_1249 333
998 3300046533 Ga0495640_0012394 Ga0495640_0012394_635_1648 333
999 3300046533 Ga0495640_0030787 Ga0495640_0030787_389_1459 333
1000 3300046536 Ga0495587_0015923 Ga0495587_0015923_558_1571 333
1001 3300046543 Ga0495645_0021817 Ga0495645_0021817_2917_3987 333
1002 3300046543 Ga0495645_0070850 Ga0495645_0070850_66_1067 333
1003 3300046559 Ga0495667_0043103 Ga0495667_0043103_1803_2816 333
1004 3300046663 Ga0495635_0002472 Ga0495635_0002472_3680_4693 333
1005 3300046663 Ga0495635_0084575 Ga0495635_0084575_807_1820 333
1006 3300046675 Ga0495657_0004748 Ga0495657_0004748_9755_10768 333
1007 3300046675 Ga0495657_0069693 Ga0495657_0069693_677_1690 333
1008 3300046680 Ga0495646_0111074 Ga0495646_0111074_368_1381 333
1009 3300046690 Ga0495624_0061057 Ga0495624_0061057_162_1175 333
1010 3300046809 Ga0495600_0002308 Ga0495600_0002308_2214_3227 333
1011 3300046809 Ga0495600_0113001 Ga0495600_0113001_117_1130 333
1012 3300047315 Ga0495581_0014176 Ga0495581_0014176_1326_2327 333
1013 3300047319 Ga0495674_0003767 Ga0495674_0003767_12190_13203 333
1014 3300047319 Ga0495674_0377995 Ga0495674_0377995_90_1091 333
1015 3300047321 Ga0495676_0031801 Ga0495676_0031801_2421_3434 333
1016 3300047322 Ga0495680_0056162 Ga0495680_0056162_544_1557 333
1017 3300047323 Ga0495683_0080842 Ga0495683_0080842_493_1494 333
1018 3300047443 Ga0495687_030848 Ga0495687_030848_107_1108 333
1019 3300047444 Ga0495675_0106181 Ga0495675_0106181_181_1182 333
1020 3300047471 Ga0495684_0114191 Ga0495684_0114191_286_1287 333
1021 3300048088 Ga0495602_0068401 Ga0495602_0068401_771_1784 333
1022 3300048088 Ga0495602_0131981 Ga0495602_0131981_521_1534 333
1023 3300048089 Ga0495614_0026037 Ga0495614_0026037_1318_2331 333
1024 3300048905 Ga0496102_0049974 Ga0496102_0049974_1838_2839 333
1025 3300048907 Ga0496104_0004370 Ga0496104_0004370_3623_4636 333
1026 3300048907 Ga0496104_0110925 Ga0496104_0110925_396_1397 333
1027 3300048908 Ga0496105_0025293 Ga0496105_0025293_3405_4418 333
1028 3300048909 Ga0496106_0005519 Ga0496106_0005519_778_1785 333
1029 3300048911 Ga0496108_0130245 Ga0496108_0130245_611_1612 333
1030 3300048913 Ga0496110_0056671 Ga0496110_0056671_1687_2688 333
1031 3300048915 Ga0496112_0080592 Ga0496112_0080592_1683_2684 333
1032 3300048915 Ga0496112_0086125 Ga0496112_0086125_2008_3009 333
1033 3300048915 Ga0496112_0180517 Ga0496112_0180517_32_1033 333
1034 3300048915 Ga0496112_0533079 Ga0496112_0533079_64_1065 333
1035 3300048916 Ga0496113_0042756 Ga0496113_0042756_1253_2254 333
1036 3300048917 Ga0496114_0105331 Ga0496114_0105331_667_1668 333
1037 3300048919 Ga0496116_0022844 Ga0496116_0022844_1939_2940 333
1038 3300048920 Ga0496117_0061358 Ga0496117_0061358_753_1760 333
1039 3300048921 Ga0496118_0006235 Ga0496118_0006235_3747_4754 333
1040 3300048924 Ga0496121_0002635 Ga0496121_0002635_6272_7279 333
1041 3300048924 Ga0496121_0041335 Ga0496121_0041335_1088_2089 333
1042 3300048927 Ga0496124_0004890 Ga0496124_0004890_6482_7489 333
1043 3300048928 Ga0496125_0125366 Ga0496125_0125366_617_1618 333
1044 3300048929 Ga0496126_0002122 Ga0496126_0002122_13573_14580 333
1045 3300048929 Ga0496126_0085299 Ga0496126_0085299_200_1201 333
1046 3300048929 Ga0496126_0117772 Ga0496126_0117772_815_1822 333
1047 3300049568 Ga0501031_0002180 Ga0501031_0002180_6897_7898 333
1048 3300049568 Ga0501031_0042522 Ga0501031_0042522_431_1459 333
1049 3300049569 Ga0501032_0000136 Ga0501032_0000136_29089_30090 333
1050 3300049569 Ga0501032_0041631 Ga0501032_0041631_1711_2739 333
1051 3300049570 Ga0501033_0000202 Ga0501033_0000202_46661_47662 333
1052 3300049571 Ga0501034_0000113 Ga0501034_0000113_93611_94612 333
1053 3300049571 Ga0501034_0000593 Ga0501034_0000593_15671_16678 333
1054 3300049571 Ga0501034_0013580 Ga0501034_0013580_1854_2882 333
1055 3300049572 Ga0501036_0000059 Ga0501036_0000059_61899_62900 333
1056 3300049572 Ga0501036_0001313 Ga0501036_0001313_1514_2542 333
1057 3300049573 Ga0501037_0000214 Ga0501037_0000214_10410_11411 333
1058 3300049573 Ga0501037_0010535 Ga0501037_0010535_2589_3617 333
1059 3300049573 Ga0501037_0012851 Ga0501037_0012851_2055_3083 333
1060 3300049573 Ga0501037_0073626 Ga0501037_0073626_367_1395 333
1061 3300049574 Ga0501038_0002810 Ga0501038_0002810_1796_2797 333
1062 3300049574 Ga0501038_0008716 Ga0501038_0008716_5471_6499 333
1063 3300049575 Ga0501039_0001981 Ga0501039_0001981_3173_4174 333
1064 3300049579 Ga0501043_0000017 Ga0501043_0000017_2531_3532 333
1065 3300049579 Ga0501043_0005751 Ga0501043_0005751_3677_4705 333
1066 3300049580 Ga0501046_0000174 Ga0501046_0000174_33656_34657 333
1067 3300049580 Ga0501046_0015465 Ga0501046_0015465_4073_5101 333
1068 3300049580 Ga0501046_0050186 Ga0501046_0050186_154_1155 333
1069 3300049580 Ga0501046_0109760 Ga0501046_0109760_513_1541 333
1070 3300049581 Ga0501047_0000044 Ga0501047_0000044_158642_159643 333
1071 3300049581 Ga0501047_0010766 Ga0501047_0010766_4623_5651 333
1072 3300049581 Ga0501047_0010806 Ga0501047_0010806_6497_7498 333
1073 3300049581 Ga0501047_0019566 Ga0501047_0019566_2367_3395 333
1074 3300049581 Ga0501047_0071784 Ga0501047_0071784_1612_2640 333
1075 3300049582 Ga0501048_0000837 Ga0501048_0000837_11208_12209 333
1076 3300049582 Ga0501048_0028437 Ga0501048_0028437_2432_3460 333
1077 3300049583 Ga0501067_0011413 Ga0501067_0011413_3872_4873 333
1078 3300049583 Ga0501067_0088303 Ga0501067_0088303_549_1577 333
1079 3300049584 Ga0501068_0000089 Ga0501068_0000089_37293_38294 333
1080 3300049584 Ga0501068_0063885 Ga0501068_0063885_366_1394 333
1081 3300049585 Ga0501069_0005200 Ga0501069_0005200_5402_6403 333
1082 3300049586 Ga0501070_0050654 Ga0501070_0050654_1191_2219 333
1083 3300049586 Ga0501070_0059105 Ga0501070_0059105_560_1561 333
1084 3300049587 Ga0501071_0011718 Ga0501071_0011718_2209_3237 333
1085 3300049587 Ga0501071_0069084 Ga0501071_0069084_937_1938 333
1086 3300049589 Ga0501073_0000069 Ga0501073_0000069_20779_21780 333
1087 3300049589 Ga0501073_0018987 Ga0501073_0018987_556_1557 333
1088 3300049589 Ga0501073_0110966 Ga0501073_0110966_159_1187 333
1089 3300049590 Ga0501074_0000346 Ga0501074_0000346_367_1368 333
1090 3300049590 Ga0501074_0009969 Ga0501074_0009969_2213_3241 333
1091 3300049590 Ga0501074_0085552 Ga0501074_0085552_847_1875 333
1092 3300049590 Ga0501074_0132433 Ga0501074_0132433_689_1690 333
1093 3300049592 Ga0501076_0102608 Ga0501076_0102608_960_1988 333
1094 3300049741 Ga0501079_0026163 Ga0501079_0026163_367_1368 333
1095 3300049741 Ga0501079_0108196 Ga0501079_0108196_417_1445 333
1096 3300049742 Ga0501080_0000613 Ga0501080_0000613_13931_14932 333
1097 3300049742 Ga0501080_0000953 Ga0501080_0000953_4982_6010 333
1098 3300049742 Ga0501080_0027894 Ga0501080_0027894_3046_4074 333
1099 3300049742 Ga0501080_0076034 Ga0501080_0076034_775_1776 333
1100 3300049742 Ga0501080_0309967 Ga0501080_0309967_23_1051 333
1101 3300049743 Ga0501081_0136884 Ga0501081_0136884_465_1493 333
1102 3300049744 Ga0501083_0000838 Ga0501083_0000838_10716_11717 333
1103 3300049744 Ga0501083_0026475 Ga0501083_0026475_1317_2345 333
1104 3300049822 Ga0501035_0000393 Ga0501035_0000393_14503_15504 333
1105 3300049822 Ga0501035_0020964 Ga0501035_0020964_4132_5160 333
1106 3300049822 Ga0501035_0227837 Ga0501035_0227837_507_1535 333
1107 3300049823 Ga0501044_0000108 Ga0501044_0000108_91863_92864 333
1108 3300049823 Ga0501044_0011892 Ga0501044_0011892_380_1408 333
1109 3300049823 Ga0501044_0016146 Ga0501044_0016146_3953_4981 333
1110 3300050494 nmdc:mga06z11_63156_c1 nmdc:mga06z11_63156_c1_365_1366 333
1111 3300050516 nmdc:mga0sz30_28204_c1 nmdc:mga0sz30_28204_c1_221_1222 333
1112 3300053077 Ga0495601_0111816 Ga0495601_0111816_643_1713 333
1113 3300053085 Ga0495619_0025149 Ga0495619_0025149_162_1163 333
1114 3300053086 Ga0500578_0031052 Ga0500578_0031052_603_1616 333
1115 3300053087 Ga0500643_001348 Ga0500643_001348_6362_7417 333
1116 3300053092 Ga0500583_0014047 Ga0500583_0014047_71_1084 333
1117 3300053103 Ga0500555_008923 Ga0500555_008923_1760_2773 333
1118 3300053119 Ga0500595_012280 Ga0500595_012280_1032_2039 333
1119 3300053130 Ga0500642_0000127 Ga0500642_0000127_1464_2477 333
1120 3300053130 Ga0500642_0003598 Ga0500642_0003598_1121_2134 333
1121 3300053136 Ga0500559_0028093 Ga0500559_0028093_163_1176 333
1122 3300053139 Ga0500568_0003938 Ga0500568_0003938_5168_6181 333
1123 3300053140 Ga0500573_0161222 Ga0500573_0161222_42_1049 333
1124 3300053142 Ga0500577_0057053 Ga0500577_0057053_11_1024 333
1125 3300053147 Ga0500589_114894 Ga0500589_114894_91_1104 333
1126 3300053156 Ga0500622_0008706 Ga0500622_0008706_335_1336 333
1127 3300053177 Ga0500636_0123011 Ga0500636_0123011_150_1157 333
1128 3300053178 Ga0500637_0085061 Ga0500637_0085061_143_1150 333
1129 3300053736 Ga0500599_008093 Ga0500599_008093_73_1074 333
1130 3300053737 Ga0500601_001110 Ga0500601_001110_1978_2991 333
1131 3300054114 Ga0501084_0044602 Ga0501084_0044602_1453_2454 333
1132 3300055283 Ga0500661_010631 Ga0500661_010631_581_1594 333
1133 3300059506 Ga0587085_012784 Ga0587085_012784_75_1076 333
1134 3300059643 Ga0587072_008134 Ga0587072_008134_574_1575 333
1135 3300061719 Ga0466962_0042722 Ga0466962_0042722_694_1695 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

66

351

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4o7m-assembly3.cif.gz_C crystal structure of a trap periplasmic solute binding protein from shewanella loihica pv-4, target efi-510273, with bound l-malate 0.9772 24 307
4o7m-assembly3.cif.gz_C crystal structure of a trap periplasmic solute binding protein from shewanella loihica pv-4, target efi-510273, with bound l-malate 0.9738 24 307
4mx6-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from shewanella oneidensis (so_3134), target efi-510275, with bound succinate 0.9646 24 328
4oa4-assembly4.cif.gz_D crystal structure of a trap periplasmic solute binding protein from shewanella loihica pv-4 (shew_1446), target efi-510273, with bound succinate 0.9639 25 327
4nf0-assembly7.cif.gz_G crystal structure of a trap periplasmic solute binding protein from pseudomonas aeruginosa pao1 (pa4616), target efi-510182, with bound l-malate 0.9592 25 310
ID Description Score Start End Superfamily
4nf0G00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9592 25 310 3.40.190.170
4oa4B00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9592 24 328 3.40.190.170
4oa4B00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9529 24 328 3.40.190.170
4nf0G00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9496 25 310 3.40.190.170
4xeqD00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9388 27 327 3.40.190.170
ID Description Score Start End GO Terms
AF-A0A1F4Q9L9-F1-model_v4 C4-dicarboxylate ABC transporter 0.9682 15 324 GO:0030288
GO:0055085
AF-A0A1F4QAW1-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.9576 15 329 GO:0030288
GO:0055085
AF-A0A101LL59-F1-model_v4 C4-dicarboxylate ABC transporter 0.9565 15 327 GO:0015740
GO:0030288
GO:0055085
AF-A0A061N675-F1-model_v4 TRAP-type C4-dicarboxylate transport system, periplasmic component 0.9562 21 324 GO:0030288
GO:0055085
AF-A0A0A1HT62-F1-model_v4 TRAP-type C4-dicarboxylate transport system,periplasmic component 0.9561 15 331 GO:0015740
GO:0030288
GO:0055085

Feature Viewer

pLDDT pTM Quality
91.38 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map