F490620
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1135 | 561 | 976 | 332 |
Family's Representative Sequence
| Representative Sequence | 3300046492|Ga0495585_0014402|Ga0495585_0014402_2659_3762 |
| Length | 367 |
| Sequence | MKRGAAAALENDHRMPLRRRVRFNESRFTITIRRHRMKFKPMTAVLLAATLISGSAFAQGPIVIKFSHVVANDTPKGKGALKFKELAEKATNGRVKVEVYPNSTLYKDKEEMEALQMGSVQMLAPSLAKFGPLGVKEFEAFDMPFIFPDTKALTRVTEGPAGKWFFSKLEPKGIRGLAYWDNGFKDMTANKPLHTPADFRGLKMRIQSSKVLDAQFRALGANPQVLAFSESYQALQTGVVDGTENTPSNLYTQKMHEVQKHMTISDHGYIGYAVIVNKNFWDKLPADIRTELEGAMKEATVYTNKIAQEENEQALEGIKKAGKTTIYTLTPAERAQWRTAMAPVYKQMEGRVGKDALQQIEKAVAAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 2 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 3 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 4 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 5 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 6 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 7 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 8 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 9 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 10 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 11 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 12 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 13 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 14 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 15 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 16 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 17 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 18 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 19 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 20 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 21 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 22 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 23 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 24 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 25 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 26 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 27 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 28 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 29 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 30 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 31 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 32 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 33 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 34 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 35 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 36 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 37 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 38 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 39 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 40 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 41 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 42 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 43 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 44 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 45 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 46 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 47 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 48 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 49 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 50 | 2857604169 | Domibacillus sp. R-71921 | Isolate | Unclassified |
| 51 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 52 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 53 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 54 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 55 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 56 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 57 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 58 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 59 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 60 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 61 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 62 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 63 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 64 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 65 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 66 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 67 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 68 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 69 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 70 | 2922368715 | |||
| 71 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 72 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 73 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 74 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 75 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 76 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 77 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 78 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 79 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 80 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 81 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 82 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 83 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 84 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 85 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 86 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 87 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 88 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 89 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 90 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 91 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 92 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 93 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 94 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 95 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 96 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 97 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 98 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 99 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 100 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 101 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 102 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 103 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 104 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 105 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 106 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 107 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 108 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 109 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 110 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 111 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 112 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 113 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 114 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 115 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 116 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 117 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 118 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 119 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 120 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 121 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 122 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 123 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 124 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 125 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 126 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 127 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 128 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 129 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 130 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 131 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 132 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 133 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 134 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 135 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 136 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 137 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 138 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 139 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 140 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 141 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 142 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 143 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 144 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 145 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 146 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 147 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 148 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 149 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 150 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 151 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 153 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 155 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 156 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 157 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 164 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 166 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 169 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 170 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 171 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 172 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 173 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 175 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 177 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 178 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 179 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 180 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 181 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 182 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 183 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 184 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 185 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 186 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 187 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 189 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 190 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 191 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 192 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 193 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 194 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 195 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 196 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 197 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 198 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 199 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 200 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 201 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 202 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 203 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 204 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 205 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 207 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 212 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 213 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 219 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 220 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 221 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 223 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 224 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 225 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 226 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 227 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 229 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 231 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 233 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 235 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 237 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 238 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 241 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 285 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 286 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 287 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 288 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 289 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 292 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 293 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 294 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 295 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 296 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 297 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 298 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 299 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 300 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 301 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 302 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 303 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 304 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 305 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 306 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 307 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 308 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 309 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 310 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 311 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 312 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 313 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 314 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 315 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 316 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 317 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 318 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 319 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 320 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 321 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 322 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 323 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 324 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 325 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 326 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 327 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 328 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 329 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 330 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 331 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 332 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 333 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 334 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 335 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 336 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 337 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 338 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 339 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 340 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 341 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 342 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 343 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 344 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 345 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 346 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 347 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 348 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 349 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 350 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 351 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 439 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 440 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 441 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 442 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 443 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 444 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 445 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 446 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 447 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 448 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 449 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 450 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 451 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 452 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 453 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 454 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 455 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 456 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 457 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 458 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 459 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 460 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 461 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 462 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 463 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 464 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 474 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 482 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 489 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 490 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 492 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 495 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 496 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 498 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 499 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 500 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 501 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 504 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 508 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 509 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 510 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 511 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 512 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 513 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 514 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 515 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 516 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 517 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 518 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 519 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 520 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 521 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 522 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 523 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 524 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 525 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 526 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 527 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 528 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 531 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 535 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 536 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 537 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 538 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 539 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 540 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 541 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 542 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 543 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 544 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 545 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 546 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 547 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 548 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 549 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 550 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 551 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 552 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 553 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 554 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 555 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 556 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 557 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 558 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 559 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 560 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 561 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.36 |
| Metatranscriptomes | 0.71 |
| Isolates | 13.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.13 |
| Nodule | 10.13 |
| Rhizoplane | 3 |
| Rhizosphere | 68.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1011548 | 3300001904 | Bacteria | 1436 |
| 2 | JGI24739J22299_10032889 | 3300001989 | Bacteria | 1780 |
| 3 | JGI25152J39213_1005661 | 3300002773 | Bacteria | 3580 |
| 4 | JGI25150J39212_1008153 | 3300002774 | Bacteria | 2066 |
| 5 | JGI25159J45721_1006309 | 3300002987 | Bacteria | 3569 |
| 6 | JGI25406J46586_10008891 | 3300003203 | Bacteria | 4520 |
| 7 | JGI25153J46596_10000317 | 3300003215 | Bacteria | 35509 |
| 8 | JGI25153J46596_10001194 | 3300003215 | Bacteria | 15699 |
| 9 | JGI25153J46596_10013246 | 3300003215 | Bacteria | 3499 |
| 10 | JGI25160J50197_1003899 | 3300003354 | Bacteria | 6538 |
| 11 | JGI25160J50197_1006813 | 3300003354 | Bacteria | 4574 |
| 12 | JGI25161J50226_1003500 | 3300003374 | Bacteria | 3571 |
| 13 | Ga0055526_1002983 | 3300003771 | Bacteria | 11083 |
| 14 | Ga0055537_1000060 | 3300003773 | Bacteria | 79376 |
| 15 | Ga0055537_1001054 | 3300003773 | Bacteria | 12373 |
| 16 | Ga0055537_1007510 | 3300003773 | Bacteria | 2620 |
| 17 | Ga0055524_1002530 | 3300003775 | Bacteria | 9361 |
| 18 | Ga0055524_1019046 | 3300003775 | Bacteria | 2360 |
| 19 | Ga0055534_1000009 | 3300003784 | Bacteria | 210256 |
| 20 | Ga0055528_1000012 | 3300003790 | Bacteria | 182704 |
| 21 | Ga0055528_1004175 | 3300003790 | Bacteria | 7027 |
| 22 | Ga0055530_10003244 | 3300003791 | Bacteria | 9487 |
| 23 | Ga0055530_10038187 | 3300003791 | Bacteria | 1195 |
| 24 | Ga0055530_10038230 | 3300003791 | Bacteria | 1195 |
| 25 | Ga0055531_10001264 | 3300003794 | Bacteria | 19144 |
| 26 | Ga0055531_10010136 | 3300003794 | Bacteria | 4726 |
| 27 | Ga0055543_1001666 | 3300004625 | Bacteria | 8449 |
| 28 | Ga0055543_1019207 | 3300004625 | Bacteria | 1266 |
| 29 | Ga0058863_11848090 | 3300004799 | Bacteria | 1175 |
| 30 | Ga0065165_1000747 | 3300005262 | Bacteria | 44635 |
| 31 | Ga0065165_1002482 | 3300005262 | Bacteria | 15509 |
| 32 | Ga0065165_1025464 | 3300005262 | Bacteria | 1966 |
| 33 | Ga0070658_10001397 | 3300005327 | Bacteria | 20608 |
| 34 | Ga0070658_10025143 | 3300005327 | Bacteria | 4773 |
| 35 | Ga0070658_10030736 | 3300005327 | Bacteria | 4314 |
| 36 | Ga0070658_10067706 | 3300005327 | Bacteria | 2918 |
| 37 | Ga0070658_10224419 | 3300005327 | Bacteria | 1590 |
| 38 | Ga0070683_100012136 | 3300005329 | Bacteria | 7477 |
| 39 | Ga0070683_100032799 | 3300005329 | Bacteria | 4733 |
| 40 | Ga0070683_100123913 | 3300005329 | Bacteria | 2442 |
| 41 | Ga0070683_100181899 | 3300005329 | Bacteria | 1996 |
| 42 | Ga0070680_100010478 | 3300005336 | Bacteria | 7148 |
| 43 | Ga0070680_100044005 | 3300005336 | Bacteria | 3627 |
| 44 | Ga0070680_100047519 | 3300005336 | Bacteria | 3495 |
| 45 | Ga0070680_100053370 | 3300005336 | Bacteria | 3300 |
| 46 | Ga0070680_100089888 | 3300005336 | Bacteria | 2541 |
| 47 | Ga0070680_100094453 | 3300005336 | Bacteria | 2479 |
| 48 | Ga0070680_100153962 | 3300005336 | Bacteria | 1931 |
| 49 | Ga0070682_100064172 | 3300005337 | Bacteria | 2331 |
| 50 | Ga0070660_100045025 | 3300005339 | Bacteria | 3376 |
| 51 | Ga0070660_100045797 | 3300005339 | Bacteria | 3350 |
| 52 | Ga0070660_100051183 | 3300005339 | Bacteria | 3180 |
| 53 | Ga0070660_100190313 | 3300005339 | Bacteria | 1662 |
| 54 | Ga0070661_100296889 | 3300005344 | Bacteria | 1257 |
| 55 | Ga0070668_100108226 | 3300005347 | Bacteria | 2210 |
| 56 | Ga0070675_100057810 | 3300005354 | Bacteria | 3198 |
| 57 | Ga0070675_100335793 | 3300005354 | Bacteria | 1338 |
| 58 | Ga0070671_100013367 | 3300005355 | Bacteria | 6617 |
| 59 | Ga0070671_100174947 | 3300005355 | Bacteria | 1816 |
| 60 | Ga0070667_100260189 | 3300005367 | Bacteria | 1553 |
| 61 | Ga0070709_10133151 | 3300005434 | Bacteria | 1699 |
| 62 | Ga0070714_100128201 | 3300005435 | Bacteria | 2265 |
| 63 | Ga0070714_100148050 | 3300005435 | Bacteria | 2113 |
| 64 | Ga0070714_100216521 | 3300005435 | Bacteria | 1758 |
| 65 | Ga0070714_100488805 | 3300005435 | Bacteria | 1173 |
| 66 | Ga0070713_100005837 | 3300005436 | Bacteria | 8465 |
| 67 | Ga0070713_100091223 | 3300005436 | Bacteria | 2621 |
| 68 | Ga0070711_100045043 | 3300005439 | Bacteria | 2997 |
| 69 | Ga0070662_100146759 | 3300005457 | Bacteria | 1833 |
| 70 | Ga0070662_100239491 | 3300005457 | Bacteria | 1455 |
| 71 | Ga0070681_10028622 | 3300005458 | Bacteria | 5603 |
| 72 | Ga0070681_10050528 | 3300005458 | Bacteria | 4148 |
| 73 | Ga0070681_10086048 | 3300005458 | Bacteria | 3096 |
| 74 | Ga0070681_10200397 | 3300005458 | Bacteria | 1914 |
| 75 | Ga0070698_100167635 | 3300005471 | Bacteria | 2138 |
| 76 | Ga0070679_100002598 | 3300005530 | Bacteria | 16417 |
| 77 | Ga0070679_100014503 | 3300005530 | Bacteria | 7570 |
| 78 | Ga0070679_100028319 | 3300005530 | Bacteria | 5523 |
| 79 | Ga0070679_100045886 | 3300005530 | Bacteria | 4354 |
| 80 | Ga0070679_100079343 | 3300005530 | Bacteria | 3272 |
| 81 | Ga0070679_100121730 | 3300005530 | Bacteria | 2593 |
| 82 | Ga0070679_100122180 | 3300005530 | Bacteria | 2588 |
| 83 | Ga0070684_100007833 | 3300005535 | Bacteria | 8332 |
| 84 | Ga0070684_100045711 | 3300005535 | Bacteria | 3791 |
| 85 | Ga0070684_100113316 | 3300005535 | Bacteria | 2434 |
| 86 | Ga0070684_100227807 | 3300005535 | Bacteria | 1701 |
| 87 | Ga0070684_100346413 | 3300005535 | Bacteria | 1366 |
| 88 | Ga0068853_100003330 | 3300005539 | Bacteria | 12297 |
| 89 | Ga0068853_100052372 | 3300005539 | Bacteria | 3516 |
| 90 | Ga0068853_100059781 | 3300005539 | Bacteria | 3293 |
| 91 | Ga0068853_100087383 | 3300005539 | Bacteria | 2736 |
| 92 | Ga0068853_100108425 | 3300005539 | Bacteria | 2464 |
| 93 | Ga0068853_100177834 | 3300005539 | Bacteria | 1929 |
| 94 | Ga0070665_100332707 | 3300005548 | Bacteria | 1523 |
| 95 | Ga0068855_100007325 | 3300005563 | Bacteria | 13370 |
| 96 | Ga0068855_100007560 | 3300005563 | Bacteria | 13147 |
| 97 | Ga0068855_100020915 | 3300005563 | Bacteria | 7846 |
| 98 | Ga0068855_100029706 | 3300005563 | Bacteria | 6535 |
| 99 | Ga0068855_100068946 | 3300005563 | Bacteria | 4116 |
| 100 | Ga0068855_100137439 | 3300005563 | Bacteria | 2787 |
| 101 | Ga0068855_100249395 | 3300005563 | Bacteria | 1980 |
| 102 | Ga0068855_100418301 | 3300005563 | Bacteria | 1466 |
| 103 | Ga0070664_100076642 | 3300005564 | Bacteria | 2874 |
| 104 | Ga0070664_100338256 | 3300005564 | Bacteria | 1367 |
| 105 | Ga0068857_100022493 | 3300005577 | Bacteria | 5547 |
| 106 | Ga0068857_100232158 | 3300005577 | Bacteria | 1687 |
| 107 | Ga0068856_100011621 | 3300005614 | Bacteria | 8539 |
| 108 | Ga0068856_100112906 | 3300005614 | Bacteria | 2715 |
| 109 | Ga0068856_100166874 | 3300005614 | Bacteria | 2213 |
| 110 | Ga0068856_100320277 | 3300005614 | Bacteria | 1568 |
| 111 | Ga0068856_100344986 | 3300005614 | Bacteria | 1507 |
| 112 | Ga0068852_100024216 | 3300005616 | Bacteria | 4903 |
| 113 | Ga0068852_100105730 | 3300005616 | Bacteria | 2550 |
| 114 | Ga0068864_100171265 | 3300005618 | Bacteria | 1980 |
| 115 | Ga0068851_10092505 | 3300005834 | Bacteria | 1594 |
| 116 | Ga0068863_100558210 | 3300005841 | Bacteria | 1131 |
| 117 | Ga0068858_100209764 | 3300005842 | Bacteria | 1843 |
| 118 | Ga0068860_100000360 | 3300005843 | Bacteria | 60297 |
| 119 | Ga0081455_10000450 | 3300005937 | Bacteria | 54201 |
| 120 | Ga0081540_1024723 | 3300005983 | Bacteria | 3478 |
| 121 | Ga0081539_10003915 | 3300005985 | Bacteria | 17301 |
| 122 | Ga0070717_10176454 | 3300006028 | Bacteria | 1861 |
| 123 | Ga0070717_10307747 | 3300006028 | Bacteria | 1410 |
| 124 | Ga0075365_10050969 | 3300006038 | Bacteria | 2732 |
| 125 | Ga0075365_10061252 | 3300006038 | Bacteria | 2513 |
| 126 | Ga0075365_10093400 | 3300006038 | Bacteria | 2052 |
| 127 | Ga0075368_10003442 | 3300006042 | Bacteria | 5283 |
| 128 | Ga0075363_100002993 | 3300006048 | Bacteria | 7061 |
| 129 | Ga0075364_10182273 | 3300006051 | Bacteria | 1421 |
| 130 | Ga0070712_100083071 | 3300006175 | Bacteria | 2325 |
| 131 | Ga0070712_100115479 | 3300006175 | Bacteria | 2012 |
| 132 | Ga0075362_10094680 | 3300006177 | Bacteria | 1390 |
| 133 | Ga0075367_10022359 | 3300006178 | Bacteria | 3546 |
| 134 | Ga0075367_10039355 | 3300006178 | Bacteria | 2756 |
| 135 | Ga0075369_10016047 | 3300006186 | Bacteria | 3015 |
| 136 | Ga0075369_10030120 | 3300006186 | Bacteria | 2284 |
| 137 | Ga0075366_10008295 | 3300006195 | Bacteria | 5770 |
| 138 | Ga0075370_10059614 | 3300006353 | Bacteria | 2173 |
| 139 | Ga0075370_10098114 | 3300006353 | Bacteria | 1694 |
| 140 | Ga0068871_100175008 | 3300006358 | Bacteria | 1842 |
| 141 | Ga0075434_100130481 | 3300006871 | Bacteria | 2532 |
| 142 | Ga0075436_100015432 | 3300006914 | Bacteria | 5230 |
| 143 | Ga0099825_1028499 | 3300006941 | Bacteria | 2708 |
| 144 | Ga0099823_1038175 | 3300006944 | Bacteria | 3595 |
| 145 | Ga0099795_10077009 | 3300007788 | Bacteria | 1269 |
| 146 | Ga0105240_10032923 | 3300009093 | Bacteria | 6703 |
| 147 | Ga0105240_10045995 | 3300009093 | Bacteria | 5534 |
| 148 | Ga0105240_10070916 | 3300009093 | Bacteria | 4309 |
| 149 | Ga0105240_10259332 | 3300009093 | Bacteria | 2006 |
| 150 | Ga0105245_10033391 | 3300009098 | Bacteria | 4561 |
| 151 | Ga0105245_10109359 | 3300009098 | Bacteria | 2568 |
| 152 | Ga0105247_10010254 | 3300009101 | Bacteria | 5672 |
| 153 | Ga0105247_10048858 | 3300009101 | Bacteria | 2599 |
| 154 | Ga0105247_10194734 | 3300009101 | Bacteria | 1359 |
| 155 | Ga0105241_10012445 | 3300009174 | Bacteria | 6236 |
| 156 | Ga0105241_10247364 | 3300009174 | Bacteria | 1510 |
| 157 | Ga0105248_10176599 | 3300009177 | Bacteria | 2407 |
| 158 | Ga0105237_10016707 | 3300009545 | Bacteria | 7619 |
| 159 | Ga0105237_10047919 | 3300009545 | Bacteria | 4297 |
| 160 | Ga0105237_10110583 | 3300009545 | Bacteria | 2740 |
| 161 | Ga0105237_10127658 | 3300009545 | Bacteria | 2537 |
| 162 | Ga0105237_10235386 | 3300009545 | Bacteria | 1833 |
| 163 | Ga0105238_10008432 | 3300009551 | Bacteria | 10317 |
| 164 | Ga0105238_10013324 | 3300009551 | Bacteria | 8296 |
| 165 | Ga0105238_10013345 | 3300009551 | Bacteria | 8287 |
| 166 | Ga0105238_10039582 | 3300009551 | Bacteria | 4780 |
| 167 | Ga0105238_10046828 | 3300009551 | Bacteria | 4361 |
| 168 | Ga0105238_10049374 | 3300009551 | Bacteria | 4238 |
| 169 | Ga0105238_10242801 | 3300009551 | Bacteria | 1779 |
| 170 | Ga0105238_10269677 | 3300009551 | Bacteria | 1682 |
| 171 | Ga0105239_10044760 | 3300010375 | Bacteria | 4851 |
| 172 | Ga0105239_10090504 | 3300010375 | Bacteria | 3376 |
| 173 | Ga0105239_10159097 | 3300010375 | Bacteria | 2523 |
| 174 | Ga0105246_10060931 | 3300011119 | Bacteria | 2623 |
| 175 | Ga0105246_10349644 | 3300011119 | Bacteria | 1211 |
| 176 | Ga0157373_10049551 | 3300013100 | Bacteria | 2993 |
| 177 | Ga0157373_10061305 | 3300013100 | Bacteria | 2664 |
| 178 | Ga0157371_10000001 | 3300013102 | Bacteria | 1162285 |
| 179 | Ga0157371_10074032 | 3300013102 | Bacteria | 2412 |
| 180 | Ga0157371_10095290 | 3300013102 | Bacteria | 2109 |
| 181 | Ga0157370_10046415 | 3300013104 | Bacteria | 4165 |
| 182 | Ga0157370_10116799 | 3300013104 | Bacteria | 2492 |
| 183 | Ga0157370_10181897 | 3300013104 | Bacteria | 1953 |
| 184 | Ga0157369_10006619 | 3300013105 | Bacteria | 13403 |
| 185 | Ga0157369_10022801 | 3300013105 | Bacteria | 6981 |
| 186 | Ga0157369_10043243 | 3300013105 | Bacteria | 4911 |
| 187 | Ga0157369_10082359 | 3300013105 | Bacteria | 3442 |
| 188 | Ga0157369_10094270 | 3300013105 | Bacteria | 3195 |
| 189 | Ga0157369_10152332 | 3300013105 | Bacteria | 2444 |
| 190 | Ga0157374_10009522 | 3300013296 | Bacteria | 8341 |
| 191 | Ga0157378_10088393 | 3300013297 | Bacteria | 2812 |
| 192 | Ga0157372_10001893 | 3300013307 | Bacteria | 22710 |
| 193 | Ga0157372_10164772 | 3300013307 | Bacteria | 2563 |
| 194 | Ga0157372_10166778 | 3300013307 | Bacteria | 2547 |
| 195 | Ga0157372_10366895 | 3300013307 | Bacteria | 1678 |
| 196 | Ga0157372_10428619 | 3300013307 | Bacteria | 1541 |
| 197 | Ga0157375_10289012 | 3300013308 | Bacteria | 1802 |
| 198 | Ga0157380_10382238 | 3300014326 | Bacteria | 1329 |
| 199 | Ga0182006_1003394 | 3300015261 | Bacteria | 8158 |
| 200 | Ga0182005_1000052 | 3300015265 | Bacteria | 113532 |
| 201 | Ga0206356_11709197 | 3300020070 | Bacteria | 1836 |
| 202 | Ga0213873_10026320 | 3300021358 | Bacteria | 1412 |
| 203 | Ga0213876_10003579 | 3300021384 | Bacteria | 8838 |
| 204 | Ga0213876_10032216 | 3300021384 | Bacteria | 2765 |
| 205 | Ga0213876_10035613 | 3300021384 | Bacteria | 2625 |
| 206 | Ga0209436_100782 | 3300025208 | Bacteria | 13164 |
| 207 | Ga0207425_1000136 | 3300025245 | Bacteria | 65594 |
| 208 | Ga0207425_1000533 | 3300025245 | Bacteria | 23036 |
| 209 | Ga0209148_1000479 | 3300025254 | Bacteria | 42062 |
| 210 | Ga0209129_1006263 | 3300025258 | Bacteria | 3918 |
| 211 | Ga0209233_1007520 | 3300025261 | Bacteria | 3447 |
| 212 | Ga0209565_1000015 | 3300025263 | Bacteria | 494091 |
| 213 | Ga0209565_1000382 | 3300025263 | Bacteria | 37853 |
| 214 | Ga0209565_1000431 | 3300025263 | Bacteria | 33753 |
| 215 | Ga0209565_1006040 | 3300025263 | Bacteria | 3452 |
| 216 | Ga0209565_1023890 | 3300025263 | Bacteria | 1251 |
| 217 | Ga0209455_1000521 | 3300025272 | Bacteria | 27243 |
| 218 | Ga0209455_1009982 | 3300025272 | Bacteria | 2449 |
| 219 | Ga0209673_1000017 | 3300025273 | Bacteria | 492994 |
| 220 | Ga0209673_1006907 | 3300025273 | Bacteria | 5372 |
| 221 | Ga0209130_1000809 | 3300025284 | Bacteria | 26504 |
| 222 | Ga0209130_1000987 | 3300025284 | Bacteria | 22203 |
| 223 | Ga0209675_1000012 | 3300025291 | Bacteria | 494061 |
| 224 | Ga0209675_1000410 | 3300025291 | Bacteria | 35247 |
| 225 | Ga0209675_1003168 | 3300025291 | Bacteria | 7989 |
| 226 | Ga0209564_1000016 | 3300025295 | Bacteria | 613131 |
| 227 | Ga0209564_1000639 | 3300025295 | Bacteria | 53129 |
| 228 | Ga0209564_1000888 | 3300025295 | Bacteria | 39497 |
| 229 | Ga0209564_1011494 | 3300025295 | Bacteria | 3959 |
| 230 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 231 | Ga0209758_1000120 | 3300025297 | Bacteria | 192212 |
| 232 | Ga0209758_1002512 | 3300025297 | Bacteria | 18622 |
| 233 | Ga0209758_1003647 | 3300025297 | Bacteria | 13738 |
| 234 | Ga0209758_1005738 | 3300025297 | Bacteria | 9349 |
| 235 | Ga0209050_1000469 | 3300025298 | Bacteria | 71511 |
| 236 | Ga0209050_1035489 | 3300025298 | Bacteria | 1473 |
| 237 | Ga0209256_1000346 | 3300025299 | Bacteria | 75456 |
| 238 | Ga0209256_1001013 | 3300025299 | Bacteria | 33164 |
| 239 | Ga0209256_1001470 | 3300025299 | Bacteria | 24150 |
| 240 | Ga0209256_1001603 | 3300025299 | Bacteria | 22130 |
| 241 | Ga0207426_1000458 | 3300025302 | Bacteria | 64019 |
| 242 | Ga0207426_1001538 | 3300025302 | Bacteria | 18766 |
| 243 | Ga0207426_1003487 | 3300025302 | Bacteria | 8493 |
| 244 | Ga0207426_1027902 | 3300025302 | Bacteria | 1876 |
| 245 | Ga0209257_1000010 | 3300025304 | Bacteria | 1158682 |
| 246 | Ga0209257_1001101 | 3300025304 | Bacteria | 35153 |
| 247 | Ga0207656_10028400 | 3300025321 | Bacteria | 2296 |
| 248 | Ga0207692_10036417 | 3300025898 | Bacteria | 2399 |
| 249 | Ga0207710_10055375 | 3300025900 | Bacteria | 1788 |
| 250 | Ga0207688_10085737 | 3300025901 | Bacteria | 1804 |
| 251 | Ga0207647_10027761 | 3300025904 | Bacteria | 3687 |
| 252 | Ga0207705_10021350 | 3300025909 | Bacteria | 4620 |
| 253 | Ga0207705_10040216 | 3300025909 | Bacteria | 3353 |
| 254 | Ga0207705_10043137 | 3300025909 | Bacteria | 3240 |
| 255 | Ga0207705_10104844 | 3300025909 | Bacteria | 2083 |
| 256 | Ga0207705_10191005 | 3300025909 | Bacteria | 1549 |
| 257 | Ga0207654_10105814 | 3300025911 | Bacteria | 1741 |
| 258 | Ga0207654_10175475 | 3300025911 | Bacteria | 1395 |
| 259 | Ga0207707_10000886 | 3300025912 | Bacteria | 29266 |
| 260 | Ga0207707_10017231 | 3300025912 | Bacteria | 6296 |
| 261 | Ga0207707_10031180 | 3300025912 | Bacteria | 4664 |
| 262 | Ga0207707_10034974 | 3300025912 | Bacteria | 4394 |
| 263 | Ga0207707_10036764 | 3300025912 | Bacteria | 4280 |
| 264 | Ga0207707_10058004 | 3300025912 | Bacteria | 3370 |
| 265 | Ga0207707_10132094 | 3300025912 | Bacteria | 2183 |
| 266 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 267 | Ga0207695_10074097 | 3300025913 | Bacteria | 3466 |
| 268 | Ga0207695_10088068 | 3300025913 | Bacteria | 3126 |
| 269 | Ga0207671_10046154 | 3300025914 | Bacteria | 3223 |
| 270 | Ga0207671_10081169 | 3300025914 | Bacteria | 2432 |
| 271 | Ga0207671_10091341 | 3300025914 | Bacteria | 2294 |
| 272 | Ga0207671_10092379 | 3300025914 | Bacteria | 2282 |
| 273 | Ga0207671_10122549 | 3300025914 | Bacteria | 1988 |
| 274 | Ga0207671_10147901 | 3300025914 | Bacteria | 1813 |
| 275 | Ga0207693_10040763 | 3300025915 | Bacteria | 3657 |
| 276 | Ga0207693_10091702 | 3300025915 | Bacteria | 2382 |
| 277 | Ga0207693_10120033 | 3300025915 | Bacteria | 2065 |
| 278 | Ga0207660_10016752 | 3300025917 | Bacteria | 4859 |
| 279 | Ga0207660_10022591 | 3300025917 | Bacteria | 4239 |
| 280 | Ga0207660_10032739 | 3300025917 | Bacteria | 3590 |
| 281 | Ga0207660_10036903 | 3300025917 | Bacteria | 3400 |
| 282 | Ga0207660_10059590 | 3300025917 | Bacteria | 2741 |
| 283 | Ga0207660_10062691 | 3300025917 | Bacteria | 2679 |
| 284 | Ga0207660_10148106 | 3300025917 | Bacteria | 1801 |
| 285 | Ga0207660_10223862 | 3300025917 | Bacteria | 1477 |
| 286 | Ga0207662_10051651 | 3300025918 | Bacteria | 2446 |
| 287 | Ga0207657_10017806 | 3300025919 | Bacteria | 6801 |
| 288 | Ga0207657_10042783 | 3300025919 | Bacteria | 3994 |
| 289 | Ga0207657_10046726 | 3300025919 | Bacteria | 3791 |
| 290 | Ga0207657_10156996 | 3300025919 | Bacteria | 1850 |
| 291 | Ga0207657_10185556 | 3300025919 | Bacteria | 1680 |
| 292 | Ga0207652_10013860 | 3300025921 | Bacteria | 6524 |
| 293 | Ga0207652_10023347 | 3300025921 | Bacteria | 5123 |
| 294 | Ga0207652_10028071 | 3300025921 | Bacteria | 4693 |
| 295 | Ga0207652_10050428 | 3300025921 | Bacteria | 3566 |
| 296 | Ga0207652_10057909 | 3300025921 | Bacteria | 3338 |
| 297 | Ga0207652_10116685 | 3300025921 | Bacteria | 2372 |
| 298 | Ga0207652_10180465 | 3300025921 | Bacteria | 1897 |
| 299 | Ga0207646_10299647 | 3300025922 | Bacteria | 1452 |
| 300 | Ga0207681_10054661 | 3300025923 | Bacteria | 2716 |
| 301 | Ga0207694_10017635 | 3300025924 | Bacteria | 5397 |
| 302 | Ga0207694_10034501 | 3300025924 | Bacteria | 3880 |
| 303 | Ga0207694_10043194 | 3300025924 | Bacteria | 3479 |
| 304 | Ga0207694_10078447 | 3300025924 | Bacteria | 2589 |
| 305 | Ga0207694_10082785 | 3300025924 | Bacteria | 2523 |
| 306 | Ga0207694_10102490 | 3300025924 | Bacteria | 2269 |
| 307 | Ga0207694_10125907 | 3300025924 | Bacteria | 2050 |
| 308 | Ga0207659_10089310 | 3300025926 | Bacteria | 2298 |
| 309 | Ga0207687_10145014 | 3300025927 | Bacteria | 1805 |
| 310 | Ga0207700_10049267 | 3300025928 | Bacteria | 3133 |
| 311 | Ga0207664_10043443 | 3300025929 | Bacteria | 3515 |
| 312 | Ga0207664_10115073 | 3300025929 | Bacteria | 2242 |
| 313 | Ga0207664_10117664 | 3300025929 | Bacteria | 2219 |
| 314 | Ga0207664_10218074 | 3300025929 | Bacteria | 1653 |
| 315 | Ga0207664_10287721 | 3300025929 | Bacteria | 1443 |
| 316 | Ga0207706_10032450 | 3300025933 | Bacteria | 4651 |
| 317 | Ga0207706_10075564 | 3300025933 | Bacteria | 2963 |
| 318 | Ga0207669_10033550 | 3300025937 | Bacteria | 2898 |
| 319 | Ga0207665_10037925 | 3300025939 | Bacteria | 3207 |
| 320 | Ga0207711_10137334 | 3300025941 | Bacteria | 2197 |
| 321 | Ga0207689_10196048 | 3300025942 | Bacteria | 1667 |
| 322 | Ga0207661_10002050 | 3300025944 | Bacteria | 13888 |
| 323 | Ga0207661_10042121 | 3300025944 | Bacteria | 3599 |
| 324 | Ga0207661_10051634 | 3300025944 | Bacteria | 3281 |
| 325 | Ga0207667_10022102 | 3300025949 | Bacteria | 7037 |
| 326 | Ga0207667_10045798 | 3300025949 | Bacteria | 4632 |
| 327 | Ga0207667_10049144 | 3300025949 | Bacteria | 4458 |
| 328 | Ga0207667_10075652 | 3300025949 | Bacteria | 3495 |
| 329 | Ga0207667_10113009 | 3300025949 | Bacteria | 2800 |
| 330 | Ga0207667_10129253 | 3300025949 | Bacteria | 2601 |
| 331 | Ga0207667_10189378 | 3300025949 | Bacteria | 2111 |
| 332 | Ga0207667_10196381 | 3300025949 | Bacteria | 2070 |
| 333 | Ga0207651_10097333 | 3300025960 | Bacteria | 2173 |
| 334 | Ga0207640_10299357 | 3300025981 | Bacteria | 1272 |
| 335 | Ga0207658_10089254 | 3300025986 | Bacteria | 2386 |
| 336 | Ga0207677_10312850 | 3300026023 | Bacteria | 1302 |
| 337 | Ga0207703_10063992 | 3300026035 | Bacteria | 3017 |
| 338 | Ga0207639_10082513 | 3300026041 | Bacteria | 2548 |
| 339 | Ga0207639_10137309 | 3300026041 | Bacteria | 2032 |
| 340 | Ga0207639_10251065 | 3300026041 | Bacteria | 1543 |
| 341 | Ga0207678_10040509 | 3300026067 | Bacteria | 4040 |
| 342 | Ga0207678_10119451 | 3300026067 | Bacteria | 2249 |
| 343 | Ga0207702_10115161 | 3300026078 | Bacteria | 2397 |
| 344 | Ga0207702_10171117 | 3300026078 | Bacteria | 1992 |
| 345 | Ga0207702_10190054 | 3300026078 | Bacteria | 1897 |
| 346 | Ga0207702_10258985 | 3300026078 | Bacteria | 1637 |
| 347 | Ga0207648_10190549 | 3300026089 | Bacteria | 1817 |
| 348 | Ga0207674_10013097 | 3300026116 | Bacteria | 9231 |
| 349 | Ga0207674_10110344 | 3300026116 | Bacteria | 2726 |
| 350 | Ga0207683_10030306 | 3300026121 | Bacteria | 4687 |
| 351 | Ga0207698_10041733 | 3300026142 | Bacteria | 3422 |
| 352 | Ga0207698_10084206 | 3300026142 | Bacteria | 2577 |
| 353 | Ga0207698_10097884 | 3300026142 | Bacteria | 2422 |
| 354 | Ga0209281_1010502 | 3300027111 | Bacteria | 2116 |
| 355 | Ga0209389_1000043 | 3300027296 | Bacteria | 123224 |
| 356 | Ga0209389_1000077 | 3300027296 | Bacteria | 91273 |
| 357 | Ga0209589_1000047 | 3300027357 | Bacteria | 118659 |
| 358 | Ga0209489_100075 | 3300027361 | Bacteria | 136991 |
| 359 | Ga0209489_100251 | 3300027361 | Bacteria | 91273 |
| 360 | Ga0209700_100271 | 3300027363 | Bacteria | 91215 |
| 361 | Ga0268266_10077358 | 3300028379 | Bacteria | 2893 |
| 362 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 363 | Ga0265318_10010234 | 3300028577 | Bacteria | 4095 |
| 364 | Ga0265318_10043687 | 3300028577 | Bacteria | 1697 |
| 365 | Ga0265338_10044273 | 3300028800 | Bacteria | 4112 |
| 366 | Ga0265338_10158511 | 3300028800 | Bacteria | 1750 |
| 367 | Ga0307511_10097154 | 3300030521 | Bacteria | 1957 |
| 368 | Ga0265330_10014071 | 3300031235 | Bacteria | 3716 |
| 369 | Ga0265330_10015247 | 3300031235 | Bacteria | 3556 |
| 370 | Ga0265330_10042865 | 3300031235 | Bacteria | 2004 |
| 371 | Ga0265330_10060877 | 3300031235 | Bacteria | 1642 |
| 372 | Ga0265332_10000013 | 3300031238 | Bacteria | 250095 |
| 373 | Ga0265332_10032358 | 3300031238 | Bacteria | 2279 |
| 374 | Ga0265320_10017857 | 3300031240 | Bacteria | 3923 |
| 375 | Ga0265320_10028123 | 3300031240 | Bacteria | 2922 |
| 376 | Ga0265325_10002805 | 3300031241 | Bacteria | 11625 |
| 377 | Ga0265325_10004624 | 3300031241 | Bacteria | 8643 |
| 378 | Ga0265325_10011615 | 3300031241 | Bacteria | 5058 |
| 379 | Ga0265325_10106950 | 3300031241 | Bacteria | 1363 |
| 380 | Ga0265325_10115173 | 3300031241 | Bacteria | 1302 |
| 381 | Ga0265340_10013195 | 3300031247 | Bacteria | 4348 |
| 382 | Ga0265340_10018160 | 3300031247 | Bacteria | 3632 |
| 383 | Ga0265339_10003040 | 3300031249 | Bacteria | 11811 |
| 384 | Ga0265339_10056439 | 3300031249 | Bacteria | 2127 |
| 385 | Ga0265339_10105096 | 3300031249 | Bacteria | 1466 |
| 386 | Ga0265331_10002514 | 3300031250 | Bacteria | 12369 |
| 387 | Ga0265331_10053030 | 3300031250 | Bacteria | 1936 |
| 388 | Ga0265316_10049511 | 3300031344 | Bacteria | 3310 |
| 389 | Ga0307513_10007609 | 3300031456 | Bacteria | 13999 |
| 390 | Ga0307509_10084524 | 3300031507 | Bacteria | 3268 |
| 391 | Ga0307509_10161525 | 3300031507 | Bacteria | 2137 |
| 392 | Ga0307509_10274924 | 3300031507 | Bacteria | 1449 |
| 393 | Ga0307408_100000331 | 3300031548 | Bacteria | 45112 |
| 394 | Ga0307408_100003776 | 3300031548 | Bacteria | 10316 |
| 395 | Ga0307408_100008651 | 3300031548 | Bacteria | 6721 |
| 396 | Ga0265313_10000305 | 3300031595 | Bacteria | 53305 |
| 397 | Ga0265313_10002293 | 3300031595 | Bacteria | 16765 |
| 398 | Ga0265313_10023841 | 3300031595 | Bacteria | 3286 |
| 399 | Ga0265313_10057716 | 3300031595 | Bacteria | 1831 |
| 400 | Ga0307508_10003532 | 3300031616 | Bacteria | 15752 |
| 401 | Ga0307508_10076958 | 3300031616 | Bacteria | 2914 |
| 402 | Ga0307508_10243830 | 3300031616 | Bacteria | 1394 |
| 403 | Ga0265314_10006855 | 3300031711 | Bacteria | 9984 |
| 404 | Ga0265314_10032816 | 3300031711 | Bacteria | 3815 |
| 405 | Ga0265314_10049098 | 3300031711 | Bacteria | 2957 |
| 406 | Ga0265314_10154517 | 3300031711 | Bacteria | 1403 |
| 407 | Ga0265314_10232406 | 3300031711 | Bacteria | 1069 |
| 408 | Ga0265342_10000715 | 3300031712 | Bacteria | 34304 |
| 409 | Ga0265342_10018334 | 3300031712 | Bacteria | 4536 |
| 410 | Ga0265342_10033179 | 3300031712 | Bacteria | 3176 |
| 411 | Ga0307516_10018252 | 3300031730 | Bacteria | 7295 |
| 412 | Ga0307507_10026861 | 3300033179 | Bacteria | 6192 |
| 413 | Ga0307510_10017164 | 3300033180 | Bacteria | 8539 |
| 414 | Ga0373923_0004076 | 3300035111 | Bacteria | 4801 |
| 415 | Ga0373936_0007226 | 3300035113 | Bacteria | 4180 |
| 416 | Ga0373936_0033719 | 3300035113 | Bacteria | 2031 |
| 417 | Ga0373939_0001163 | 3300035114 | Bacteria | 6446 |
| 418 | Ga0373941_0003567 | 3300035115 | Bacteria | 3538 |
| 419 | Ga0373953_0000715 | 3300035117 | Bacteria | 9186 |
| 420 | Ga0373954_0000084 | 3300035118 | Bacteria | 33354 |
| 421 | Ga0373954_0014590 | 3300035118 | Bacteria | 3504 |
| 422 | Ga0373954_0085911 | 3300035118 | Bacteria | 1507 |
| 423 | Ga0373957_0011178 | 3300035120 | Bacteria | 2990 |
| 424 | Ga0373955_0000301 | 3300035172 | Bacteria | 20395 |
| 425 | Ga0373955_0002561 | 3300035172 | Bacteria | 7952 |
| 426 | Ga0373924_0003265 | 3300035410 | Bacteria | 5550 |
| 427 | Ga0373924_0010446 | 3300035410 | Bacteria | 3422 |
| 428 | Ga0373924_0082253 | 3300035410 | Bacteria | 1371 |
| 429 | Ga0373935_0158254 | 3300035692 | Bacteria | 1542 |
| 430 | Ga0373927_0000141 | 3300035695 | Bacteria | 55933 |
| 431 | Ga0373933_0000951 | 3300035724 | Bacteria | 17668 |
| 432 | Ga0373933_0001848 | 3300035724 | Bacteria | 12244 |
| 433 | Ga0373933_0018022 | 3300035724 | Bacteria | 3966 |
| 434 | Ga0373947_0106219 | 3300035725 | Bacteria | 1769 |
| 435 | Ga0373937_0060512 | 3300036401 | Bacteria | 3480 |
| 436 | Ga0373937_0330528 | 3300036401 | Bacteria | 1443 |
| 437 | Ga0373925_0052049 | 3300037068 | Bacteria | 3058 |
| 438 | Ga0373925_0065962 | 3300037068 | Bacteria | 2728 |
| 439 | Ga0395899_0002233 | 3300037312 | Bacteria | 15864 |
| 440 | Ga0395899_0069985 | 3300037312 | Bacteria | 2568 |
| 441 | Ga0395899_0119278 | 3300037312 | Bacteria | 1891 |
| 442 | Ga0395899_0148750 | 3300037312 | Bacteria | 1661 |
| 443 | Ga0395899_0178989 | 3300037312 | Bacteria | 1490 |
| 444 | Ga0395899_0185599 | 3300037312 | Bacteria | 1457 |
| 445 | Ga0395899_0207510 | 3300037312 | Bacteria | 1363 |
| 446 | Ga0395900_0001310 | 3300037418 | Bacteria | 30209 |
| 447 | Ga0395900_0001351 | 3300037418 | Bacteria | 29638 |
| 448 | Ga0395900_0008575 | 3300037418 | Bacteria | 10508 |
| 449 | Ga0395900_0011283 | 3300037418 | Bacteria | 9139 |
| 450 | Ga0395900_0036422 | 3300037418 | Bacteria | 5073 |
| 451 | Ga0395900_0054475 | 3300037418 | Bacteria | 4119 |
| 452 | Ga0395900_0056976 | 3300037418 | Bacteria | 4022 |
| 453 | Ga0395900_0078540 | 3300037418 | Bacteria | 3391 |
| 454 | Ga0395900_0087306 | 3300037418 | Bacteria | 3206 |
| 455 | Ga0395900_0183792 | 3300037418 | Bacteria | 2123 |
| 456 | Ga0395898_0002484 | 3300037466 | Bacteria | 21688 |
| 457 | Ga0395898_0012110 | 3300037466 | Bacteria | 8929 |
| 458 | Ga0395898_0026473 | 3300037466 | Bacteria | 5835 |
| 459 | Ga0395898_0035192 | 3300037466 | Bacteria | 4984 |
| 460 | Ga0395898_0051684 | 3300037466 | Bacteria | 4018 |
| 461 | Ga0395898_0074471 | 3300037466 | Bacteria | 3279 |
| 462 | Ga0395898_0079851 | 3300037466 | Bacteria | 3155 |
| 463 | Ga0395898_0109613 | 3300037466 | Bacteria | 2646 |
| 464 | Ga0395898_0211320 | 3300037466 | Bacteria | 1851 |
| 465 | Ga0395898_0301241 | 3300037466 | Bacteria | 1529 |
| 466 | Ga0395905_0002041 | 3300037471 | Bacteria | 23069 |
| 467 | Ga0395905_0013331 | 3300037471 | Bacteria | 7880 |
| 468 | Ga0395905_0016323 | 3300037471 | Bacteria | 7056 |
| 469 | Ga0395905_0018272 | 3300037471 | Bacteria | 6656 |
| 470 | Ga0395905_0130402 | 3300037471 | Bacteria | 2364 |
| 471 | Ga0395901_0027085 | 3300038443 | Bacteria | 5887 |
| 472 | Ga0395901_0035187 | 3300038443 | Bacteria | 5175 |
| 473 | Ga0395901_0047934 | 3300038443 | Bacteria | 4436 |
| 474 | Ga0395901_0055382 | 3300038443 | Bacteria | 4124 |
| 475 | Ga0395901_0081812 | 3300038443 | Bacteria | 3373 |
| 476 | Ga0395901_0108548 | 3300038443 | Bacteria | 2913 |
| 477 | Ga0395901_0117260 | 3300038443 | Bacteria | 2797 |
| 478 | Ga0395901_0135936 | 3300038443 | Bacteria | 2584 |
| 479 | Ga0395901_0153060 | 3300038443 | Bacteria | 2423 |
| 480 | Ga0395901_0240294 | 3300038443 | Bacteria | 1889 |
| 481 | Ga0436365_0618633 | 3300039437 | Bacteria | 2803 |
| 482 | Ga0436365_1104948 | 3300039437 | Bacteria | 2785 |
| 483 | Ga0436365_1236739 | 3300039437 | Bacteria | 30341 |
| 484 | Ga0436362_0548217 | 3300039453 | Bacteria | 3819 |
| 485 | Ga0451793_1911962 | 3300041452 | Bacteria | 1640 |
| 486 | Ga0451841_1016410 | 3300041498 | Bacteria | 1832 |
| 487 | Ga0466972_0000079 | 3300044658 | Bacteria | 90348 |
| 488 | Ga0466972_0004424 | 3300044658 | Bacteria | 7026 |
| 489 | Ga0466972_0024879 | 3300044658 | Bacteria | 2971 |
| 490 | Ga0453683_0055804 | 3300044673 | Bacteria | 2472 |
| 491 | Ga0453683_0092249 | 3300044673 | Bacteria | 1899 |
| 492 | Ga0466966_0000191 | 3300044684 | Bacteria | 40906 |
| 493 | Ga0466961_0000005 | 3300044693 | Bacteria | 173105 |
| 494 | Ga0466961_0033127 | 3300044693 | Bacteria | 3321 |
| 495 | Ga0466963_0042278 | 3300044694 | Bacteria | 2992 |
| 496 | Ga0466964_0011528 | 3300044706 | Bacteria | 3341 |
| 497 | Ga0466964_0057426 | 3300044706 | Bacteria | 1611 |
| 498 | Ga0453684_0000292 | 3300044712 | Bacteria | 213050 |
| 499 | Ga0453684_0011680 | 3300044712 | Bacteria | 14651 |
| 500 | Ga0466971_0130019 | 3300044719 | Bacteria | 1168 |
| 501 | Ga0466968_0090403 | 3300044735 | Bacteria | 1356 |
| 502 | Ga0466970_0095902 | 3300044765 | Bacteria | 1613 |
| 503 | Ga0466957_0058332 | 3300044842 | Bacteria | 2365 |
| 504 | Ga0466957_0106405 | 3300044842 | Bacteria | 1774 |
| 505 | Ga0466959_0000654 | 3300045049 | Bacteria | 20198 |
| 506 | Ga0466959_0035355 | 3300045049 | Bacteria | 3696 |
| 507 | Ga0466959_0130524 | 3300045049 | Bacteria | 1781 |
| 508 | Ga0451576_0000444 | 3300045051 | Bacteria | 94213 |
| 509 | Ga0451576_0001449 | 3300045051 | Bacteria | 40328 |
| 510 | Ga0466958_0055154 | 3300045836 | Bacteria | 2411 |
| 511 | Ga0466967_0043874 | 3300045976 | Bacteria | 3874 |
| 512 | Ga0466967_0328124 | 3300045976 | Bacteria | 1477 |
| 513 | Ga0495592_0016467 | 3300046454 | Bacteria | 5609 |
| 514 | Ga0495590_0000049 | 3300046457 | Bacteria | 113002 |
| 515 | Ga0495590_0003539 | 3300046457 | Bacteria | 6365 |
| 516 | Ga0495590_0010523 | 3300046457 | Bacteria | 3475 |
| 517 | Ga0495591_000456 | 3300046458 | Bacteria | 33134 |
| 518 | Ga0495591_014144 | 3300046458 | Bacteria | 2883 |
| 519 | Ga0495629_0003566 | 3300046459 | Bacteria | 11757 |
| 520 | Ga0495629_0007325 | 3300046459 | Bacteria | 8133 |
| 521 | Ga0495629_0010133 | 3300046459 | Bacteria | 6873 |
| 522 | Ga0495629_0274045 | 3300046459 | Bacteria | 1159 |
| 523 | Ga0495638_0002117 | 3300046460 | Bacteria | 16743 |
| 524 | Ga0495638_0022925 | 3300046460 | Bacteria | 4092 |
| 525 | Ga0495651_0031133 | 3300046462 | Bacteria | 4161 |
| 526 | Ga0495651_0056071 | 3300046462 | Bacteria | 3027 |
| 527 | Ga0495651_0296275 | 3300046462 | Bacteria | 1087 |
| 528 | Ga0495653_0002541 | 3300046463 | Bacteria | 14539 |
| 529 | Ga0495653_0195152 | 3300046463 | Bacteria | 1378 |
| 530 | Ga0495650_0000051 | 3300046471 | Bacteria | 318297 |
| 531 | Ga0495582_0016731 | 3300046473 | Bacteria | 4016 |
| 532 | Ga0495582_0022194 | 3300046473 | Bacteria | 3474 |
| 533 | Ga0495605_0016134 | 3300046474 | Bacteria | 4048 |
| 534 | Ga0495605_0044793 | 3300046474 | Bacteria | 2185 |
| 535 | Ga0495605_0057361 | 3300046474 | Bacteria | 1874 |
| 536 | Ga0495605_0076287 | 3300046474 | Bacteria | 1574 |
| 537 | Ga0495639_0017874 | 3300046475 | Bacteria | 3082 |
| 538 | Ga0495664_0083961 | 3300046477 | Bacteria | 1911 |
| 539 | Ga0495664_0095802 | 3300046477 | Bacteria | 1786 |
| 540 | Ga0495584_0000189 | 3300046491 | Bacteria | 43548 |
| 541 | Ga0495584_0006718 | 3300046491 | Bacteria | 6017 |
| 542 | Ga0495584_0006868 | 3300046491 | Bacteria | 5950 |
| 543 | Ga0495584_0051656 | 3300046491 | Bacteria | 2069 |
| 544 | Ga0495584_0052578 | 3300046491 | Bacteria | 2050 |
| 545 | Ga0495584_0056981 | 3300046491 | Bacteria | 1966 |
| 546 | Ga0495585_0000148 | 3300046492 | Bacteria | 76376 |
| 547 | Ga0495585_0001953 | 3300046492 | Bacteria | 15407 |
| 548 | Ga0495585_0004258 | 3300046492 | Bacteria | 9322 |
| 549 | Ga0495585_0012315 | 3300046492 | Bacteria | 5039 |
| 550 | Ga0495585_0014402 | 3300046492 | Bacteria | 4608 |
| 551 | Ga0495585_0024386 | 3300046492 | Bacteria | 3468 |
| 552 | Ga0495585_0024688 | 3300046492 | Bacteria | 3445 |
| 553 | Ga0495585_0060314 | 3300046492 | Bacteria | 2088 |
| 554 | Ga0495585_0074672 | 3300046492 | Bacteria | 1844 |
| 555 | Ga0495594_0031346 | 3300046499 | Bacteria | 2881 |
| 556 | Ga0495594_0039208 | 3300046499 | Bacteria | 2589 |
| 557 | Ga0495594_0139927 | 3300046499 | Bacteria | 1372 |
| 558 | Ga0495594_0183708 | 3300046499 | Bacteria | 1190 |
| 559 | Ga0495594_0242777 | 3300046499 | Bacteria | 1026 |
| 560 | Ga0495596_0000778 | 3300046500 | Bacteria | 19414 |
| 561 | Ga0495596_0009554 | 3300046500 | Bacteria | 4262 |
| 562 | Ga0495596_0024661 | 3300046500 | Bacteria | 2434 |
| 563 | Ga0495607_0008359 | 3300046501 | Bacteria | 7080 |
| 564 | Ga0495607_0034756 | 3300046501 | Bacteria | 3055 |
| 565 | Ga0495607_0072472 | 3300046501 | Bacteria | 1917 |
| 566 | Ga0495607_0134923 | 3300046501 | Bacteria | 1279 |
| 567 | Ga0495583_0009580 | 3300046506 | Bacteria | 5769 |
| 568 | Ga0495583_0025908 | 3300046506 | Bacteria | 2919 |
| 569 | Ga0495583_0030071 | 3300046506 | Bacteria | 2650 |
| 570 | Ga0495583_0059659 | 3300046506 | Bacteria | 1709 |
| 571 | Ga0495606_0030775 | 3300046507 | Bacteria | 3742 |
| 572 | Ga0495606_0053543 | 3300046507 | Bacteria | 2618 |
| 573 | Ga0495606_0060234 | 3300046507 | Bacteria | 2432 |
| 574 | Ga0495608_0104505 | 3300046511 | Bacteria | 1824 |
| 575 | Ga0495610_0000442 | 3300046512 | Bacteria | 42791 |
| 576 | Ga0495616_0000817 | 3300046513 | Bacteria | 22704 |
| 577 | Ga0495616_0042604 | 3300046513 | Bacteria | 2310 |
| 578 | Ga0495616_0074991 | 3300046513 | Bacteria | 1628 |
| 579 | Ga0495618_0008986 | 3300046514 | Bacteria | 6031 |
| 580 | Ga0495628_0170744 | 3300046516 | Bacteria | 1649 |
| 581 | Ga0495630_0113012 | 3300046517 | Bacteria | 2057 |
| 582 | Ga0495630_0209280 | 3300046517 | Bacteria | 1488 |
| 583 | Ga0495631_0003028 | 3300046518 | Bacteria | 9292 |
| 584 | Ga0495631_0005160 | 3300046518 | Bacteria | 6880 |
| 585 | Ga0495631_0005448 | 3300046518 | Bacteria | 6657 |
| 586 | Ga0495631_0005904 | 3300046518 | Bacteria | 6375 |
| 587 | Ga0495631_0021545 | 3300046518 | Bacteria | 3001 |
| 588 | Ga0495632_0000946 | 3300046519 | Bacteria | 25368 |
| 589 | Ga0495632_0012916 | 3300046519 | Bacteria | 4790 |
| 590 | Ga0495637_0000014 | 3300046520 | Bacteria | 228956 |
| 591 | Ga0495643_0013145 | 3300046522 | Bacteria | 4969 |
| 592 | Ga0495643_0034612 | 3300046522 | Bacteria | 2786 |
| 593 | Ga0495644_0003582 | 3300046523 | Bacteria | 6127 |
| 594 | Ga0495644_0009706 | 3300046523 | Bacteria | 3704 |
| 595 | Ga0495644_0023951 | 3300046523 | Bacteria | 2322 |
| 596 | Ga0495648_0009209 | 3300046524 | Bacteria | 7682 |
| 597 | Ga0495648_0022320 | 3300046524 | Bacteria | 4361 |
| 598 | Ga0495648_0037552 | 3300046524 | Bacteria | 3110 |
| 599 | Ga0495648_0063035 | 3300046524 | Bacteria | 2192 |
| 600 | Ga0495648_0070253 | 3300046524 | Bacteria | 2035 |
| 601 | Ga0495666_0005745 | 3300046526 | Bacteria | 6253 |
| 602 | Ga0495642_0000657 | 3300046528 | Bacteria | 17307 |
| 603 | Ga0495642_0137576 | 3300046528 | Bacteria | 1053 |
| 604 | Ga0495652_0006590 | 3300046529 | Bacteria | 10786 |
| 605 | Ga0495652_0017409 | 3300046529 | Bacteria | 6412 |
| 606 | Ga0495652_0023496 | 3300046529 | Bacteria | 5465 |
| 607 | Ga0495652_0061540 | 3300046529 | Bacteria | 3168 |
| 608 | Ga0495654_0001281 | 3300046530 | Bacteria | 17634 |
| 609 | Ga0495654_0005602 | 3300046530 | Bacteria | 7267 |
| 610 | Ga0495654_0027985 | 3300046530 | Bacteria | 2885 |
| 611 | Ga0495665_0007608 | 3300046531 | Bacteria | 5867 |
| 612 | Ga0495665_0016281 | 3300046531 | Bacteria | 4006 |
| 613 | Ga0495665_0063244 | 3300046531 | Bacteria | 1953 |
| 614 | Ga0495640_0001058 | 3300046533 | Bacteria | 21427 |
| 615 | Ga0495640_0012394 | 3300046533 | Bacteria | 6515 |
| 616 | Ga0495640_0021531 | 3300046533 | Bacteria | 4730 |
| 617 | Ga0495640_0030787 | 3300046533 | Bacteria | 3838 |
| 618 | Ga0495640_0219817 | 3300046533 | Bacteria | 1198 |
| 619 | Ga0495586_0006988 | 3300046535 | Bacteria | 6014 |
| 620 | Ga0495586_0069205 | 3300046535 | Bacteria | 1926 |
| 621 | Ga0495587_0008387 | 3300046536 | Bacteria | 6650 |
| 622 | Ga0495587_0015923 | 3300046536 | Bacteria | 4682 |
| 623 | Ga0495609_0000240 | 3300046538 | Bacteria | 52192 |
| 624 | Ga0495609_0007832 | 3300046538 | Bacteria | 5285 |
| 625 | Ga0495609_0009700 | 3300046538 | Bacteria | 4644 |
| 626 | Ga0495609_0014487 | 3300046538 | Bacteria | 3704 |
| 627 | Ga0495609_0021260 | 3300046538 | Bacteria | 2993 |
| 628 | Ga0495609_0039463 | 3300046538 | Bacteria | 2125 |
| 629 | Ga0495597_0001290 | 3300046542 | Bacteria | 18438 |
| 630 | Ga0495597_0002422 | 3300046542 | Bacteria | 11860 |
| 631 | Ga0495597_0013932 | 3300046542 | Bacteria | 3843 |
| 632 | Ga0495645_0002913 | 3300046543 | Bacteria | 11620 |
| 633 | Ga0495645_0021817 | 3300046543 | Bacteria | 4629 |
| 634 | Ga0495645_0070850 | 3300046543 | Bacteria | 2515 |
| 635 | Ga0495622_0006675 | 3300046557 | Bacteria | 5350 |
| 636 | Ga0495622_0037023 | 3300046557 | Bacteria | 2273 |
| 637 | Ga0495633_0004436 | 3300046558 | Bacteria | 8931 |
| 638 | Ga0495633_0007848 | 3300046558 | Bacteria | 6091 |
| 639 | Ga0495633_0018740 | 3300046558 | Bacteria | 3510 |
| 640 | Ga0495633_0038856 | 3300046558 | Bacteria | 2272 |
| 641 | Ga0495633_0046850 | 3300046558 | Bacteria | 2044 |
| 642 | Ga0495667_0043103 | 3300046559 | Bacteria | 2991 |
| 643 | Ga0495668_0000768 | 3300046616 | Bacteria | 37462 |
| 644 | Ga0495668_0030938 | 3300046616 | Bacteria | 3017 |
| 645 | Ga0495668_0090816 | 3300046616 | Bacteria | 1673 |
| 646 | Ga0495634_0007709 | 3300046642 | Bacteria | 8058 |
| 647 | Ga0495634_0012018 | 3300046642 | Bacteria | 6277 |
| 648 | Ga0495634_0202820 | 3300046642 | Bacteria | 1231 |
| 649 | Ga0495611_0000377 | 3300046648 | Bacteria | 28700 |
| 650 | Ga0495611_0004255 | 3300046648 | Bacteria | 6228 |
| 651 | Ga0495611_0018873 | 3300046648 | Bacteria | 2959 |
| 652 | Ga0495611_0026855 | 3300046648 | Bacteria | 2513 |
| 653 | Ga0495611_0036316 | 3300046648 | Bacteria | 2186 |
| 654 | Ga0495611_0046008 | 3300046648 | Bacteria | 1955 |
| 655 | Ga0495611_0067326 | 3300046648 | Bacteria | 1634 |
| 656 | Ga0495611_0123237 | 3300046648 | Bacteria | 1208 |
| 657 | Ga0495625_0009971 | 3300046660 | Bacteria | 7902 |
| 658 | Ga0495625_0023747 | 3300046660 | Bacteria | 4680 |
| 659 | Ga0495625_0032661 | 3300046660 | Bacteria | 3857 |
| 660 | Ga0495635_0000374 | 3300046663 | Bacteria | 28331 |
| 661 | Ga0495635_0002472 | 3300046663 | Bacteria | 12617 |
| 662 | Ga0495635_0002810 | 3300046663 | Bacteria | 11943 |
| 663 | Ga0495635_0084575 | 3300046663 | Bacteria | 2171 |
| 664 | Ga0495659_0000009 | 3300046664 | Bacteria | 95820 |
| 665 | Ga0495659_0009895 | 3300046664 | Bacteria | 3049 |
| 666 | Ga0495661_0000932 | 3300046665 | Bacteria | 26643 |
| 667 | Ga0495661_0001580 | 3300046665 | Bacteria | 18764 |
| 668 | Ga0495661_0072635 | 3300046665 | Bacteria | 2007 |
| 669 | Ga0495661_0078008 | 3300046665 | Bacteria | 1917 |
| 670 | Ga0495661_0095201 | 3300046665 | Bacteria | 1686 |
| 671 | Ga0495661_0109935 | 3300046665 | Bacteria | 1537 |
| 672 | Ga0495661_0120953 | 3300046665 | Bacteria | 1446 |
| 673 | Ga0495588_0017891 | 3300046674 | Bacteria | 3449 |
| 674 | Ga0495588_0027605 | 3300046674 | Bacteria | 2837 |
| 675 | Ga0495588_0081565 | 3300046674 | Bacteria | 1688 |
| 676 | Ga0495657_0001354 | 3300046675 | Bacteria | 21307 |
| 677 | Ga0495657_0004748 | 3300046675 | Bacteria | 10827 |
| 678 | Ga0495657_0069693 | 3300046675 | Bacteria | 2300 |
| 679 | Ga0495599_0017201 | 3300046678 | Bacteria | 4493 |
| 680 | Ga0495623_0009572 | 3300046679 | Bacteria | 6294 |
| 681 | Ga0495623_0099708 | 3300046679 | Bacteria | 1771 |
| 682 | Ga0495646_0003632 | 3300046680 | Bacteria | 9626 |
| 683 | Ga0495646_0111074 | 3300046680 | Bacteria | 1561 |
| 684 | Ga0495646_0187806 | 3300046680 | Bacteria | 1131 |
| 685 | Ga0495669_0000218 | 3300046684 | Bacteria | 34510 |
| 686 | Ga0495669_0001840 | 3300046684 | Bacteria | 8688 |
| 687 | Ga0495669_0009191 | 3300046684 | Bacteria | 4164 |
| 688 | Ga0495613_0038210 | 3300046689 | Bacteria | 3558 |
| 689 | Ga0495613_0071833 | 3300046689 | Bacteria | 2523 |
| 690 | Ga0495613_0080959 | 3300046689 | Bacteria | 2360 |
| 691 | Ga0495624_0008402 | 3300046690 | Bacteria | 7200 |
| 692 | Ga0495624_0061057 | 3300046690 | Bacteria | 2362 |
| 693 | Ga0495670_0001687 | 3300046691 | Bacteria | 10852 |
| 694 | Ga0495670_0038658 | 3300046691 | Bacteria | 2379 |
| 695 | Ga0495670_0054019 | 3300046691 | Bacteria | 2012 |
| 696 | Ga0495670_0062797 | 3300046691 | Bacteria | 1869 |
| 697 | Ga0495671_0000433 | 3300046692 | Bacteria | 33219 |
| 698 | Ga0495671_0002478 | 3300046692 | Bacteria | 11643 |
| 699 | Ga0495671_0013847 | 3300046692 | Bacteria | 4351 |
| 700 | Ga0495671_0023340 | 3300046692 | Bacteria | 3231 |
| 701 | Ga0495649_0000255 | 3300046694 | Bacteria | 47515 |
| 702 | Ga0495649_0023067 | 3300046694 | Bacteria | 3476 |
| 703 | Ga0495649_0053634 | 3300046694 | Bacteria | 2182 |
| 704 | Ga0495589_0004718 | 3300046794 | Bacteria | 7234 |
| 705 | Ga0495589_0046504 | 3300046794 | Bacteria | 2153 |
| 706 | Ga0495589_0051364 | 3300046794 | Bacteria | 2038 |
| 707 | Ga0495600_0002308 | 3300046809 | Bacteria | 10889 |
| 708 | Ga0495600_0017907 | 3300046809 | Bacteria | 4509 |
| 709 | Ga0495600_0113001 | 3300046809 | Bacteria | 1768 |
| 710 | Ga0495660_0007159 | 3300046810 | Bacteria | 6571 |
| 711 | Ga0495660_0015805 | 3300046810 | Bacteria | 4357 |
| 712 | Ga0495660_0039856 | 3300046810 | Bacteria | 2606 |
| 713 | Ga0495581_0004542 | 3300047315 | Bacteria | 8018 |
| 714 | Ga0495581_0014176 | 3300047315 | Bacteria | 4620 |
| 715 | Ga0495581_0065980 | 3300047315 | Bacteria | 2093 |
| 716 | Ga0495604_0015004 | 3300047317 | Bacteria | 6180 |
| 717 | Ga0495604_0029185 | 3300047317 | Bacteria | 4388 |
| 718 | Ga0495604_0041035 | 3300047317 | Bacteria | 3631 |
| 719 | Ga0495604_0299833 | 3300047317 | Bacteria | 1080 |
| 720 | Ga0495636_0006057 | 3300047318 | Bacteria | 4747 |
| 721 | Ga0495636_0063281 | 3300047318 | Bacteria | 1567 |
| 722 | Ga0495674_0001881 | 3300047319 | Bacteria | 20669 |
| 723 | Ga0495674_0003767 | 3300047319 | Bacteria | 14745 |
| 724 | Ga0495674_0116875 | 3300047319 | Bacteria | 2256 |
| 725 | Ga0495674_0377995 | 3300047319 | Bacteria | 1146 |
| 726 | Ga0495672_0000102 | 3300047320 | Bacteria | 137373 |
| 727 | Ga0495672_0000120 | 3300047320 | Bacteria | 121804 |
| 728 | Ga0495676_0000034 | 3300047321 | Bacteria | 124977 |
| 729 | Ga0495676_0028077 | 3300047321 | Bacteria | 4815 |
| 730 | Ga0495676_0031801 | 3300047321 | Bacteria | 4459 |
| 731 | Ga0495676_0051366 | 3300047321 | Bacteria | 3299 |
| 732 | Ga0495680_0001664 | 3300047322 | Bacteria | 23637 |
| 733 | Ga0495680_0003719 | 3300047322 | Bacteria | 14881 |
| 734 | Ga0495680_0056162 | 3300047322 | Bacteria | 3049 |
| 735 | Ga0495683_0000833 | 3300047323 | Bacteria | 21993 |
| 736 | Ga0495683_0050857 | 3300047323 | Bacteria | 2073 |
| 737 | Ga0495683_0080842 | 3300047323 | Bacteria | 1585 |
| 738 | Ga0495687_000060 | 3300047443 | Bacteria | 179124 |
| 739 | Ga0495687_000410 | 3300047443 | Bacteria | 53080 |
| 740 | Ga0495687_002333 | 3300047443 | Bacteria | 15437 |
| 741 | Ga0495687_030848 | 3300047443 | Bacteria | 2465 |
| 742 | Ga0495687_041333 | 3300047443 | Bacteria | 2023 |
| 743 | Ga0495675_0015513 | 3300047444 | Bacteria | 4818 |
| 744 | Ga0495675_0106181 | 3300047444 | Bacteria | 1755 |
| 745 | Ga0495675_0262683 | 3300047444 | Bacteria | 1034 |
| 746 | Ga0495677_0004370 | 3300047445 | Bacteria | 5433 |
| 747 | Ga0495677_0004862 | 3300047445 | Bacteria | 5124 |
| 748 | Ga0495677_0015412 | 3300047445 | Bacteria | 2777 |
| 749 | Ga0495677_0023348 | 3300047445 | Bacteria | 2245 |
| 750 | Ga0495679_005605 | 3300047446 | Bacteria | 5536 |
| 751 | Ga0495679_025051 | 3300047446 | Bacteria | 2000 |
| 752 | Ga0495685_002470 | 3300047447 | Bacteria | 5792 |
| 753 | Ga0495685_030715 | 3300047447 | Bacteria | 1847 |
| 754 | Ga0495685_033833 | 3300047447 | Bacteria | 1756 |
| 755 | Ga0495673_0000113 | 3300047469 | Bacteria | 163495 |
| 756 | Ga0495673_0042181 | 3300047469 | Bacteria | 2050 |
| 757 | Ga0495681_0001232 | 3300047470 | Bacteria | 19468 |
| 758 | Ga0495681_0001235 | 3300047470 | Bacteria | 19424 |
| 759 | Ga0495681_0005375 | 3300047470 | Bacteria | 8591 |
| 760 | Ga0495681_0015138 | 3300047470 | Bacteria | 4375 |
| 761 | Ga0495681_0023844 | 3300047470 | Bacteria | 3237 |
| 762 | Ga0495681_0053345 | 3300047470 | Bacteria | 1893 |
| 763 | Ga0495684_0000777 | 3300047471 | Bacteria | 25850 |
| 764 | Ga0495684_0024894 | 3300047471 | Bacteria | 4603 |
| 765 | Ga0495684_0114191 | 3300047471 | Bacteria | 2036 |
| 766 | Ga0495686_0002274 | 3300047472 | Bacteria | 18494 |
| 767 | Ga0495686_0140112 | 3300047472 | Bacteria | 1427 |
| 768 | Ga0495593_0005870 | 3300047673 | Bacteria | 7235 |
| 769 | Ga0495602_0068401 | 3300048088 | Bacteria | 3049 |
| 770 | Ga0495602_0131981 | 3300048088 | Bacteria | 1990 |
| 771 | Ga0495614_0006982 | 3300048089 | Bacteria | 5041 |
| 772 | Ga0495614_0026037 | 3300048089 | Bacteria | 2521 |
| 773 | Ga0495614_0028657 | 3300048089 | Bacteria | 2397 |
| 774 | Ga0495626_0008646 | 3300048091 | Bacteria | 5563 |
| 775 | Ga0495626_0013373 | 3300048091 | Bacteria | 4264 |
| 776 | Ga0495626_0038467 | 3300048091 | Bacteria | 2268 |
| 777 | Ga0495626_0043067 | 3300048091 | Bacteria | 2119 |
| 778 | Ga0495626_0052738 | 3300048091 | Bacteria | 1873 |
| 779 | Ga0495626_0096453 | 3300048091 | Bacteria | 1294 |
| 780 | Ga0496100_0091272 | 3300048903 | Bacteria | 2078 |
| 781 | Ga0496101_0001016 | 3300048904 | Bacteria | 16540 |
| 782 | Ga0496102_0004447 | 3300048905 | Bacteria | 11835 |
| 783 | Ga0496102_0049974 | 3300048905 | Bacteria | 3806 |
| 784 | Ga0496103_0035127 | 3300048906 | Bacteria | 3068 |
| 785 | Ga0496103_0059292 | 3300048906 | Bacteria | 2378 |
| 786 | Ga0496104_0004370 | 3300048907 | Bacteria | 12305 |
| 787 | Ga0496104_0110925 | 3300048907 | Bacteria | 2630 |
| 788 | Ga0496105_0025293 | 3300048908 | Bacteria | 4831 |
| 789 | Ga0496105_0074064 | 3300048908 | Bacteria | 2813 |
| 790 | Ga0496106_0005519 | 3300048909 | Bacteria | 9359 |
| 791 | Ga0496107_0001492 | 3300048910 | Bacteria | 14501 |
| 792 | Ga0496108_0130245 | 3300048911 | Bacteria | 2162 |
| 793 | Ga0496108_0169803 | 3300048911 | Bacteria | 1887 |
| 794 | Ga0496109_0013082 | 3300048912 | Bacteria | 7178 |
| 795 | Ga0496109_0206828 | 3300048912 | Bacteria | 1845 |
| 796 | Ga0496110_0000719 | 3300048913 | Bacteria | 22855 |
| 797 | Ga0496110_0008645 | 3300048913 | Bacteria | 8200 |
| 798 | Ga0496110_0033809 | 3300048913 | Bacteria | 4425 |
| 799 | Ga0496110_0056671 | 3300048913 | Bacteria | 3449 |
| 800 | Ga0496111_0127989 | 3300048914 | Bacteria | 1878 |
| 801 | Ga0496111_0132927 | 3300048914 | Bacteria | 1842 |
| 802 | Ga0496112_0080592 | 3300048915 | Bacteria | 3219 |
| 803 | Ga0496112_0086125 | 3300048915 | Bacteria | 3109 |
| 804 | Ga0496112_0180517 | 3300048915 | Bacteria | 2075 |
| 805 | Ga0496112_0533079 | 3300048915 | Bacteria | 1108 |
| 806 | Ga0496113_0042756 | 3300048916 | Bacteria | 3349 |
| 807 | Ga0496113_0095267 | 3300048916 | Bacteria | 2300 |
| 808 | Ga0496113_0149244 | 3300048916 | Bacteria | 1843 |
| 809 | Ga0496114_0105331 | 3300048917 | Bacteria | 2412 |
| 810 | Ga0496115_0076188 | 3300048918 | Bacteria | 2726 |
| 811 | Ga0496115_0222220 | 3300048918 | Bacteria | 1558 |
| 812 | Ga0496116_0002360 | 3300048919 | Bacteria | 19968 |
| 813 | Ga0496116_0022844 | 3300048919 | Bacteria | 4673 |
| 814 | Ga0496117_0061358 | 3300048920 | Bacteria | 2585 |
| 815 | Ga0496118_0006235 | 3300048921 | Bacteria | 13179 |
| 816 | Ga0496118_0053711 | 3300048921 | Bacteria | 3059 |
| 817 | Ga0496120_0029562 | 3300048923 | Bacteria | 3344 |
| 818 | Ga0496121_0002635 | 3300048924 | Bacteria | 27038 |
| 819 | Ga0496121_0041335 | 3300048924 | Bacteria | 4030 |
| 820 | Ga0496122_0000337 | 3300048925 | Bacteria | 101830 |
| 821 | Ga0496123_0000905 | 3300048926 | Bacteria | 46722 |
| 822 | Ga0496124_0004890 | 3300048927 | Bacteria | 15418 |
| 823 | Ga0496124_0096557 | 3300048927 | Bacteria | 2400 |
| 824 | Ga0496124_0147613 | 3300048927 | Bacteria | 1849 |
| 825 | Ga0496125_0017937 | 3300048928 | Bacteria | 6728 |
| 826 | Ga0496125_0022086 | 3300048928 | Bacteria | 5916 |
| 827 | Ga0496125_0125366 | 3300048928 | Bacteria | 1821 |
| 828 | Ga0496126_0002122 | 3300048929 | Bacteria | 27701 |
| 829 | Ga0496126_0029792 | 3300048929 | Bacteria | 5181 |
| 830 | Ga0496126_0050325 | 3300048929 | Bacteria | 3798 |
| 831 | Ga0496126_0085299 | 3300048929 | Bacteria | 2784 |
| 832 | Ga0496126_0117772 | 3300048929 | Bacteria | 2307 |
| 833 | Ga0495678_000150 | 3300049459 | Bacteria | 84562 |
| 834 | Ga0495678_002016 | 3300049459 | Bacteria | 14566 |
| 835 | Ga0495678_006504 | 3300049459 | Bacteria | 6206 |
| 836 | Ga0495678_020859 | 3300049459 | Bacteria | 2893 |
| 837 | Ga0495678_024482 | 3300049459 | Bacteria | 2606 |
| 838 | Ga0495678_060558 | 3300049459 | Bacteria | 1423 |
| 839 | Ga0495682_0006292 | 3300049460 | Bacteria | 4816 |
| 840 | Ga0501031_0002180 | 3300049568 | Bacteria | 12363 |
| 841 | Ga0501031_0042522 | 3300049568 | Bacteria | 2965 |
| 842 | Ga0501032_0000136 | 3300049569 | Bacteria | 59896 |
| 843 | Ga0501032_0041631 | 3300049569 | Bacteria | 3118 |
| 844 | Ga0501033_0000202 | 3300049570 | Bacteria | 57109 |
| 845 | Ga0501034_0000113 | 3300049571 | Bacteria | 149824 |
| 846 | Ga0501034_0000593 | 3300049571 | Bacteria | 57233 |
| 847 | Ga0501034_0013580 | 3300049571 | Bacteria | 8380 |
| 848 | Ga0501034_0092457 | 3300049571 | Bacteria | 3022 |
| 849 | Ga0501034_0131283 | 3300049571 | Bacteria | 2488 |
| 850 | Ga0501036_0000059 | 3300049572 | Bacteria | 72347 |
| 851 | Ga0501036_0001313 | 3300049572 | Bacteria | 19069 |
| 852 | Ga0501037_0000214 | 3300049573 | Bacteria | 51638 |
| 853 | Ga0501037_0010535 | 3300049573 | Bacteria | 6790 |
| 854 | Ga0501037_0012851 | 3300049573 | Bacteria | 6171 |
| 855 | Ga0501037_0073626 | 3300049573 | Bacteria | 2483 |
| 856 | Ga0501038_0002810 | 3300049574 | Bacteria | 16214 |
| 857 | Ga0501038_0008716 | 3300049574 | Bacteria | 9308 |
| 858 | Ga0501039_0001981 | 3300049575 | Bacteria | 15182 |
| 859 | Ga0501039_0091758 | 3300049575 | Bacteria | 2367 |
| 860 | Ga0501043_0000017 | 3300049579 | Bacteria | 166630 |
| 861 | Ga0501043_0005751 | 3300049579 | Bacteria | 9990 |
| 862 | Ga0501046_0000174 | 3300049580 | Bacteria | 65566 |
| 863 | Ga0501046_0015465 | 3300049580 | Bacteria | 6409 |
| 864 | Ga0501046_0050186 | 3300049580 | Bacteria | 3297 |
| 865 | Ga0501046_0109760 | 3300049580 | Bacteria | 2108 |
| 866 | Ga0501047_0000044 | 3300049581 | Bacteria | 174789 |
| 867 | Ga0501047_0010766 | 3300049581 | Bacteria | 8644 |
| 868 | Ga0501047_0010806 | 3300049581 | Bacteria | 8630 |
| 869 | Ga0501047_0019566 | 3300049581 | Bacteria | 6495 |
| 870 | Ga0501047_0023099 | 3300049581 | Bacteria | 5970 |
| 871 | Ga0501047_0063332 | 3300049581 | Bacteria | 3567 |
| 872 | Ga0501047_0071784 | 3300049581 | Bacteria | 3332 |
| 873 | Ga0501048_0000837 | 3300049582 | Bacteria | 22705 |
| 874 | Ga0501048_0028437 | 3300049582 | Bacteria | 4057 |
| 875 | Ga0501067_0011413 | 3300049583 | Bacteria | 4918 |
| 876 | Ga0501067_0088303 | 3300049583 | Bacteria | 1720 |
| 877 | Ga0501068_0000089 | 3300049584 | Bacteria | 38379 |
| 878 | Ga0501068_0063885 | 3300049584 | Bacteria | 2239 |
| 879 | Ga0501068_0147605 | 3300049584 | Bacteria | 1476 |
| 880 | Ga0501069_0003092 | 3300049585 | Bacteria | 8526 |
| 881 | Ga0501069_0005200 | 3300049585 | Bacteria | 6763 |
| 882 | Ga0501070_0050654 | 3300049586 | Bacteria | 3446 |
| 883 | Ga0501070_0059105 | 3300049586 | Bacteria | 3178 |
| 884 | Ga0501070_0064316 | 3300049586 | Bacteria | 3038 |
| 885 | Ga0501070_0181203 | 3300049586 | Bacteria | 1733 |
| 886 | Ga0501071_0011718 | 3300049587 | Bacteria | 5917 |
| 887 | Ga0501071_0069084 | 3300049587 | Bacteria | 2572 |
| 888 | Ga0501072_0006568 | 3300049588 | Bacteria | 8855 |
| 889 | Ga0501072_0236487 | 3300049588 | Bacteria | 1455 |
| 890 | Ga0501073_0000069 | 3300049589 | Bacteria | 63198 |
| 891 | Ga0501073_0018987 | 3300049589 | Bacteria | 4967 |
| 892 | Ga0501073_0075846 | 3300049589 | Bacteria | 2340 |
| 893 | Ga0501073_0077589 | 3300049589 | Bacteria | 2311 |
| 894 | Ga0501073_0110966 | 3300049589 | Bacteria | 1902 |
| 895 | Ga0501074_0000346 | 3300049590 | Bacteria | 27099 |
| 896 | Ga0501074_0009969 | 3300049590 | Bacteria | 6901 |
| 897 | Ga0501074_0085552 | 3300049590 | Bacteria | 2259 |
| 898 | Ga0501074_0132433 | 3300049590 | Bacteria | 1783 |
| 899 | Ga0501076_0102608 | 3300049592 | Bacteria | 2306 |
| 900 | Ga0501077_0291584 | 3300049593 | Bacteria | 1039 |
| 901 | Ga0501227_000835 | 3300049665 | Bacteria | 6716 |
| 902 | Ga0501235_007556 | 3300049669 | Bacteria | 2367 |
| 903 | Ga0501079_0026163 | 3300049741 | Bacteria | 4474 |
| 904 | Ga0501079_0106531 | 3300049741 | Bacteria | 2175 |
| 905 | Ga0501079_0108196 | 3300049741 | Bacteria | 2158 |
| 906 | Ga0501080_0000613 | 3300049742 | Bacteria | 28256 |
| 907 | Ga0501080_0000953 | 3300049742 | Bacteria | 23696 |
| 908 | Ga0501080_0027894 | 3300049742 | Bacteria | 5250 |
| 909 | Ga0501080_0076034 | 3300049742 | Bacteria | 3123 |
| 910 | Ga0501080_0309967 | 3300049742 | Bacteria | 1430 |
| 911 | Ga0501081_0136884 | 3300049743 | Bacteria | 1753 |
| 912 | Ga0501083_0000838 | 3300049744 | Bacteria | 20228 |
| 913 | Ga0501083_0026475 | 3300049744 | Bacteria | 4008 |
| 914 | Ga0501083_0174389 | 3300049744 | Bacteria | 1405 |
| 915 | Ga0501279_003025 | 3300049775 | Bacteria | 2184 |
| 916 | Ga0501035_0000393 | 3300049822 | Bacteria | 49959 |
| 917 | Ga0501035_0000745 | 3300049822 | Bacteria | 35086 |
| 918 | Ga0501035_0020964 | 3300049822 | Bacteria | 6006 |
| 919 | Ga0501035_0227837 | 3300049822 | Bacteria | 1589 |
| 920 | Ga0501044_0000108 | 3300049823 | Bacteria | 100968 |
| 921 | Ga0501044_0011892 | 3300049823 | Bacteria | 9431 |
| 922 | Ga0501044_0016146 | 3300049823 | Bacteria | 8026 |
| 923 | Ga0501044_0054927 | 3300049823 | Bacteria | 4091 |
| 924 | Ga0501044_0064833 | 3300049823 | Bacteria | 3727 |
| 925 | nmdc:mga00v17_156249_c1 | 3300050491 | Bacteria | 1467 |
| 926 | nmdc:mga0yw44_127618_c1 | 3300050492 | Bacteria | 1644 |
| 927 | nmdc:mga0yw44_45239_c1 | 3300050492 | Bacteria | 2638 |
| 928 | nmdc:mga06z11_40124_c1 | 3300050494 | Bacteria | 2334 |
| 929 | nmdc:mga06z11_63156_c1 | 3300050494 | Bacteria | 1937 |
| 930 | nmdc:mga07m45_10168_c2 | 3300050496 | Bacteria | 2828 |
| 931 | nmdc:mga07m45_35822_c1 | 3300050496 | Bacteria | 2761 |
| 932 | nmdc:mga0rr50_223692_c1 | 3300050513 | Bacteria | 1555 |
| 933 | nmdc:mga0rr50_367003_c1 | 3300050513 | Bacteria | 1212 |
| 934 | nmdc:mga08x19_191215_c1 | 3300050514 | Bacteria | 1400 |
| 935 | nmdc:mga08x19_7003_c1 | 3300050514 | Bacteria | 6694 |
| 936 | nmdc:mga0sz30_17656_c2 | 3300050516 | Bacteria | 2103 |
| 937 | nmdc:mga0sz30_28204_c1 | 3300050516 | Bacteria | 2309 |
| 938 | Ga0495601_0006348 | 3300053077 | Bacteria | 6908 |
| 939 | Ga0495601_0111816 | 3300053077 | Bacteria | 1769 |
| 940 | Ga0495595_0008267 | 3300053084 | Bacteria | 4272 |
| 941 | Ga0495595_0011989 | 3300053084 | Bacteria | 3635 |
| 942 | Ga0495619_0000701 | 3300053085 | Bacteria | 21925 |
| 943 | Ga0495619_0005001 | 3300053085 | Bacteria | 8418 |
| 944 | Ga0495619_0025149 | 3300053085 | Bacteria | 3821 |
| 945 | Ga0500578_0031052 | 3300053086 | Bacteria | 3433 |
| 946 | Ga0500643_000373 | 3300053087 | Bacteria | 35007 |
| 947 | Ga0500643_001348 | 3300053087 | Bacteria | 14291 |
| 948 | Ga0500583_0014047 | 3300053092 | Bacteria | 3122 |
| 949 | Ga0500583_0102412 | 3300053092 | Bacteria | 1404 |
| 950 | Ga0500566_0000174 | 3300053094 | Bacteria | 32668 |
| 951 | Ga0500641_0019723 | 3300053096 | Bacteria | 2552 |
| 952 | Ga0500555_008923 | 3300053103 | Bacteria | 2863 |
| 953 | Ga0500595_012280 | 3300053119 | Bacteria | 3319 |
| 954 | Ga0500642_0000127 | 3300053130 | Bacteria | 34341 |
| 955 | Ga0500642_0003598 | 3300053130 | Bacteria | 4713 |
| 956 | Ga0500559_0028093 | 3300053136 | Bacteria | 2402 |
| 957 | Ga0500568_0003938 | 3300053139 | Bacteria | 8082 |
| 958 | Ga0500573_0161222 | 3300053140 | Bacteria | 1220 |
| 959 | Ga0500577_0057053 | 3300053142 | Bacteria | 1489 |
| 960 | Ga0500589_114894 | 3300053147 | Bacteria | 1149 |
| 961 | Ga0500619_000012 | 3300053154 | Bacteria | 57280 |
| 962 | Ga0500622_0008706 | 3300053156 | Bacteria | 5660 |
| 963 | Ga0500636_0123011 | 3300053177 | Bacteria | 1453 |
| 964 | Ga0500637_0085061 | 3300053178 | Bacteria | 1828 |
| 965 | Ga0500599_008093 | 3300053736 | Bacteria | 1360 |
| 966 | Ga0500601_001110 | 3300053737 | Bacteria | 3044 |
| 967 | Ga0501084_0044602 | 3300054114 | Bacteria | 3712 |
| 968 | Ga0500661_010631 | 3300055283 | Bacteria | 1674 |
| 969 | Ga0587070_009800 | 3300059491 | Bacteria | 1394 |
| 970 | Ga0587080_008331 | 3300059503 | Bacteria | 1482 |
| 971 | Ga0587085_012784 | 3300059506 | Bacteria | 1157 |
| 972 | Ga0587072_008134 | 3300059643 | Bacteria | 1653 |
| 973 | Ga0587079_009696 | 3300059647 | Bacteria | 1507 |
| 974 | Ga0587107_009226 | 3300059652 | Bacteria | 1159 |
| 975 | Ga0501082_0000032 | 3300060353 | Bacteria | 99261 |
| 976 | Ga0466962_0042722 | 3300061719 | Bacteria | 2170 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035410 | Ga0373924_0082253 | Ga0373924_0082253_14_916 | 300 |
| 2 | 3300015261 | Ga0182006_1003394 | Ga0182006_10033945 | 309 |
| 3 | 3300015265 | Ga0182005_1000052 | Ga0182005_100005234 | 309 |
| 4 | 3300027111 | Ga0209281_1010502 | Ga0209281_10105022 | 309 |
| 5 | 3300048918 | Ga0496115_0222220 | Ga0496115_0222220_30_1037 | 309 |
| 6 | 3300035118 | Ga0373954_0000084 | Ga0373954_0000084_32097_33098 | 311 |
| 7 | 3300046642 | Ga0495634_0012018 | Ga0495634_0012018_916_1917 | 311 |
| 8 | 3300047319 | Ga0495674_0116875 | Ga0495674_0116875_1118_2119 | 311 |
| 9 | 3300035111 | Ga0373923_0004076 | Ga0373923_0004076_1769_2770 | 312 |
| 10 | 3300035117 | Ga0373953_0000715 | Ga0373953_0000715_7812_8813 | 312 |
| 11 | 3300035120 | Ga0373957_0011178 | Ga0373957_0011178_1593_2594 | 312 |
| 12 | 3300035172 | Ga0373955_0000301 | Ga0373955_0000301_2324_3325 | 312 |
| 13 | 3300035410 | Ga0373924_0003265 | Ga0373924_0003265_2359_3360 | 312 |
| 14 | 3300035724 | Ga0373933_0000951 | Ga0373933_0000951_16411_17412 | 312 |
| 15 | 3300046454 | Ga0495592_0016467 | Ga0495592_0016467_2430_3431 | 312 |
| 16 | 3300046459 | Ga0495629_0003566 | Ga0495629_0003566_2194_3195 | 312 |
| 17 | 3300046463 | Ga0495653_0002541 | Ga0495653_0002541_3870_4871 | 312 |
| 18 | 3300046529 | Ga0495652_0023496 | Ga0495652_0023496_3742_4743 | 312 |
| 19 | 3300046533 | Ga0495640_0021531 | Ga0495640_0021531_2430_3431 | 312 |
| 20 | 3300046536 | Ga0495587_0008387 | Ga0495587_0008387_2313_3314 | 312 |
| 21 | 3300046543 | Ga0495645_0002913 | Ga0495645_0002913_1975_2976 | 312 |
| 22 | 3300046663 | Ga0495635_0002810 | Ga0495635_0002810_2286_3287 | 312 |
| 23 | 3300046675 | Ga0495657_0001354 | Ga0495657_0001354_8935_9936 | 312 |
| 24 | 3300046678 | Ga0495599_0017201 | Ga0495599_0017201_1214_2215 | 312 |
| 25 | 3300046679 | Ga0495623_0009572 | Ga0495623_0009572_113_1123 | 312 |
| 26 | 3300046680 | Ga0495646_0003632 | Ga0495646_0003632_2010_3011 | 312 |
| 27 | 3300047317 | Ga0495604_0015004 | Ga0495604_0015004_4457_5458 | 312 |
| 28 | 3300047471 | Ga0495684_0000777 | Ga0495684_0000777_2338_3339 | 312 |
| 29 | 3300047673 | Ga0495593_0005870 | Ga0495593_0005870_3966_4967 | 312 |
| 30 | 3300053084 | Ga0495595_0011989 | Ga0495595_0011989_1597_2598 | 312 |
| 31 | 3300053085 | Ga0495619_0000701 | Ga0495619_0000701_18668_19669 | 312 |
| 32 | 3300031235 | Ga0265330_10015247 | Ga0265330_100152473 | 313 |
| 33 | 3300031247 | Ga0265340_10013195 | Ga0265340_100131952 | 313 |
| 34 | 3300047469 | Ga0495673_0042181 | Ga0495673_0042181_514_1527 | 313 |
| 35 | 3300049588 | Ga0501072_0006568 | Ga0501072_0006568_6505_7500 | 313 |
| 36 | 3300005354 | Ga0070675_100335793 | Ga0070675_1003357932 | 314 |
| 37 | 3300005614 | Ga0068856_100344986 | Ga0068856_1003449861 | 314 |
| 38 | 3300009174 | Ga0105241_10247364 | Ga0105241_102473641 | 314 |
| 39 | 3300025911 | Ga0207654_10105814 | Ga0207654_101058142 | 314 |
| 40 | 3300026078 | Ga0207702_10190054 | Ga0207702_101900542 | 314 |
| 41 | 3300031548 | Ga0307408_100000331 | Ga0307408_1000003319 | 314 |
| 42 | 3300044658 | Ga0466972_0000079 | Ga0466972_0000079_84139_85140 | 314 |
| 43 | 3300046491 | Ga0495584_0052578 | Ga0495584_0052578_445_1392 | 314 |
| 44 | 3300031711 | Ga0265314_10232406 | Ga0265314_102324061 | 315 |
| 45 | 3300046459 | Ga0495629_0010133 | Ga0495629_0010133_2720_3727 | 315 |
| 46 | 3300046463 | Ga0495653_0195152 | Ga0495653_0195152_218_1225 | 315 |
| 47 | 3300046473 | Ga0495582_0022194 | Ga0495582_0022194_1496_2503 | 315 |
| 48 | 3300046477 | Ga0495664_0083961 | Ga0495664_0083961_39_1046 | 315 |
| 49 | 3300046511 | Ga0495608_0104505 | Ga0495608_0104505_380_1387 | 315 |
| 50 | 3300046514 | Ga0495618_0008986 | Ga0495618_0008986_2627_3634 | 315 |
| 51 | 3300046516 | Ga0495628_0170744 | Ga0495628_0170744_602_1609 | 315 |
| 52 | 3300046517 | Ga0495630_0113012 | Ga0495630_0113012_36_1043 | 315 |
| 53 | 3300046529 | Ga0495652_0017409 | Ga0495652_0017409_2222_3229 | 315 |
| 54 | 3300046533 | Ga0495640_0001058 | Ga0495640_0001058_13601_14608 | 315 |
| 55 | 3300046533 | Ga0495640_0219817 | Ga0495640_0219817_221_1168 | 315 |
| 56 | 3300046642 | Ga0495634_0007709 | Ga0495634_0007709_2705_3712 | 315 |
| 57 | 3300046642 | Ga0495634_0202820 | Ga0495634_0202820_231_1178 | 315 |
| 58 | 3300046689 | Ga0495613_0080959 | Ga0495613_0080959_416_1423 | 315 |
| 59 | 3300046809 | Ga0495600_0017907 | Ga0495600_0017907_2577_3584 | 315 |
| 60 | 3300047317 | Ga0495604_0041035 | Ga0495604_0041035_1226_2233 | 315 |
| 61 | 3300047319 | Ga0495674_0001881 | Ga0495674_0001881_13524_14531 | 315 |
| 62 | 3300047322 | Ga0495680_0001664 | Ga0495680_0001664_20035_21042 | 315 |
| 63 | 3300047471 | Ga0495684_0024894 | Ga0495684_0024894_2627_3634 | 315 |
| 64 | 3300048921 | Ga0496118_0053711 | Ga0496118_0053711_1088_2089 | 315 |
| 65 | 3300048923 | Ga0496120_0029562 | Ga0496120_0029562_1163_2164 | 315 |
| 66 | 3300053077 | Ga0495601_0006348 | Ga0495601_0006348_2627_3634 | 315 |
| 67 | 3300053084 | Ga0495595_0008267 | Ga0495595_0008267_3229_4236 | 315 |
| 68 | 3300053085 | Ga0495619_0005001 | Ga0495619_0005001_4137_5144 | 315 |
| 69 | iso_pu_bacteria | 2922368715 | 2922375911 | 315 |
| 70 | 3300037471 | Ga0395905_0130402 | Ga0395905_0130402_583_1584 | 316 |
| 71 | 3300044684 | Ga0466966_0000191 | Ga0466966_0000191_14721_15722 | 316 |
| 72 | 3300044693 | Ga0466961_0000005 | Ga0466961_0000005_54747_55748 | 316 |
| 73 | 3300045049 | Ga0466959_0000654 | Ga0466959_0000654_13425_14426 | 316 |
| 74 | 3300046457 | Ga0495590_0010523 | Ga0495590_0010523_1096_2094 | 316 |
| 75 | 3300046474 | Ga0495605_0044793 | Ga0495605_0044793_833_1834 | 317 |
| 76 | 3300046507 | Ga0495606_0030775 | Ga0495606_0030775_1152_2153 | 317 |
| 77 | 3300046524 | Ga0495648_0063035 | Ga0495648_0063035_1010_2011 | 317 |
| 78 | 3300059491 | Ga0587070_009800 | Ga0587070_009800_310_1311 | 317 |
| 79 | 3300059652 | Ga0587107_009226 | Ga0587107_009226_11_1012 | 317 |
| 80 | 3300046460 | Ga0495638_0002117 | Ga0495638_0002117_13991_14992 | 318 |
| 81 | 3300009101 | Ga0105247_10194734 | Ga0105247_101947341 | 319 |
| 82 | 3300025272 | Ga0209455_1009982 | Ga0209455_10099823 | 319 |
| 83 | 3300047444 | Ga0495675_0262683 | Ga0495675_0262683_59_1018 | 319 |
| 84 | 3300044735 | Ga0466968_0090403 | Ga0466968_0090403_383_1345 | 320 |
| 85 | 3300046680 | Ga0495646_0187806 | Ga0495646_0187806_151_1113 | 320 |
| 86 | 3300006353 | Ga0075370_10059614 | Ga0075370_100596142 | 321 |
| 87 | 3300050496 | nmdc:mga07m45_35822_c1 | nmdc:mga07m45_35822_c1_960_1961 | 321 |
| 88 | 3300060353 | Ga0501082_0000032 | Ga0501082_0000032_81105_82112 | 321 |
| 89 | 3300041452 | Ga0451793_1911962 | Ga0451793_1911962_364_1389 | 322 |
| 90 | 3300053094 | Ga0500566_0000174 | Ga0500566_0000174_3344_4357 | 322 |
| 91 | 3300044658 | Ga0466972_0004424 | Ga0466972_0004424_846_1847 | 323 |
| 92 | 3300045836 | Ga0466958_0055154 | Ga0466958_0055154_1253_2254 | 323 |
| 93 | 3300006175 | Ga0070712_100115479 | Ga0070712_1001154791 | 324 |
| 94 | 3300009093 | Ga0105240_10259332 | Ga0105240_102593322 | 324 |
| 95 | 3300025915 | Ga0207693_10091702 | Ga0207693_100917022 | 324 |
| 96 | 3300026067 | Ga0207678_10119451 | Ga0207678_101194512 | 324 |
| 97 | 3300031456 | Ga0307513_10007609 | Ga0307513_100076092 | 324 |
| 98 | 3300037418 | Ga0395900_0054475 | Ga0395900_0054475_2792_3799 | 324 |
| 99 | 3300038443 | Ga0395901_0153060 | Ga0395901_0153060_1193_2200 | 324 |
| 100 | 3300045049 | Ga0466959_0130524 | Ga0466959_0130524_65_1063 | 324 |
| 101 | 3300045976 | Ga0466967_0328124 | Ga0466967_0328124_336_1337 | 324 |
| 102 | iso_pu_bacteria | 2857604169 | 2857608038 | 324 |
| 103 | 3300005327 | Ga0070658_10067706 | Ga0070658_100677062 | 325 |
| 104 | 3300005329 | Ga0070683_100123913 | Ga0070683_1001239132 | 325 |
| 105 | 3300005336 | Ga0070680_100094453 | Ga0070680_1000944532 | 325 |
| 106 | 3300005339 | Ga0070660_100045797 | Ga0070660_1000457971 | 325 |
| 107 | 3300005539 | Ga0068853_100003330 | Ga0068853_1000033302 | 325 |
| 108 | 3300005563 | Ga0068855_100418301 | Ga0068855_1004183012 | 325 |
| 109 | 3300005577 | Ga0068857_100022493 | Ga0068857_1000224934 | 325 |
| 110 | 3300005616 | Ga0068852_100024216 | Ga0068852_1000242163 | 325 |
| 111 | 3300005834 | Ga0068851_10092505 | Ga0068851_100925052 | 325 |
| 112 | 3300009545 | Ga0105237_10047919 | Ga0105237_100479192 | 325 |
| 113 | 3300009551 | Ga0105238_10008432 | Ga0105238_1000843211 | 325 |
| 114 | 3300010375 | Ga0105239_10044760 | Ga0105239_100447603 | 325 |
| 115 | 3300013104 | Ga0157370_10181897 | Ga0157370_101818972 | 325 |
| 116 | 3300013105 | Ga0157369_10022801 | Ga0157369_100228015 | 325 |
| 117 | 3300025321 | Ga0207656_10028400 | Ga0207656_100284002 | 325 |
| 118 | 3300025912 | Ga0207707_10132094 | Ga0207707_101320941 | 325 |
| 119 | 3300025914 | Ga0207671_10081169 | Ga0207671_100811692 | 325 |
| 120 | 3300025917 | Ga0207660_10022591 | Ga0207660_100225912 | 325 |
| 121 | 3300025917 | Ga0207660_10032739 | Ga0207660_100327392 | 325 |
| 122 | 3300025919 | Ga0207657_10017806 | Ga0207657_100178064 | 325 |
| 123 | 3300025921 | Ga0207652_10050428 | Ga0207652_100504282 | 325 |
| 124 | 3300025924 | Ga0207694_10017635 | Ga0207694_100176354 | 325 |
| 125 | 3300025944 | Ga0207661_10051634 | Ga0207661_100516344 | 325 |
| 126 | 3300025949 | Ga0207667_10022102 | Ga0207667_100221025 | 325 |
| 127 | 3300026041 | Ga0207639_10082513 | Ga0207639_100825132 | 325 |
| 128 | 3300026116 | Ga0207674_10013097 | Ga0207674_100130976 | 325 |
| 129 | 3300037312 | Ga0395899_0119278 | Ga0395899_0119278_611_1612 | 325 |
| 130 | 3300037418 | Ga0395900_0001310 | Ga0395900_0001310_2519_3520 | 325 |
| 131 | 3300037466 | Ga0395898_0074471 | Ga0395898_0074471_668_1669 | 325 |
| 132 | 3300049593 | Ga0501077_0291584 | Ga0501077_0291584_20_1021 | 325 |
| 133 | 3300003215 | JGI25153J46596_10000317 | JGI25153J46596_1000031730 | 326 |
| 134 | 3300003354 | JGI25160J50197_1006813 | JGI25160J50197_10068134 | 326 |
| 135 | 3300006178 | Ga0075367_10039355 | Ga0075367_100393552 | 326 |
| 136 | 3300006186 | Ga0075369_10016047 | Ga0075369_100160472 | 326 |
| 137 | 3300009545 | Ga0105237_10110583 | Ga0105237_101105833 | 326 |
| 138 | 3300025297 | Ga0209758_1000120 | Ga0209758_100012016 | 326 |
| 139 | 3300025302 | Ga0207426_1000458 | Ga0207426_100045836 | 326 |
| 140 | 3300025914 | Ga0207671_10091341 | Ga0207671_100913412 | 326 |
| 141 | 3300046458 | Ga0495591_000456 | Ga0495591_000456_16165_17145 | 326 |
| 142 | 3300046474 | Ga0495605_0016134 | Ga0495605_0016134_1121_2101 | 326 |
| 143 | 3300046512 | Ga0495610_0000442 | Ga0495610_0000442_18411_19391 | 326 |
| 144 | 3300046519 | Ga0495632_0012916 | Ga0495632_0012916_2048_3028 | 326 |
| 145 | 3300046520 | Ga0495637_0000014 | Ga0495637_0000014_106324_107304 | 326 |
| 146 | 3300046523 | Ga0495644_0009706 | Ga0495644_0009706_1868_2848 | 326 |
| 147 | 3300046530 | Ga0495654_0001281 | Ga0495654_0001281_14909_15889 | 326 |
| 148 | 3300046538 | Ga0495609_0009700 | Ga0495609_0009700_1118_2098 | 326 |
| 149 | 3300046558 | Ga0495633_0004436 | Ga0495633_0004436_3404_4384 | 326 |
| 150 | 3300047320 | Ga0495672_0000102 | Ga0495672_0000102_29145_30125 | 326 |
| 151 | 3300047323 | Ga0495683_0000833 | Ga0495683_0000833_16253_17233 | 326 |
| 152 | 3300047445 | Ga0495677_0004370 | Ga0495677_0004370_3348_4328 | 326 |
| 153 | 3300047446 | Ga0495679_025051 | Ga0495679_025051_414_1394 | 326 |
| 154 | 3300048927 | Ga0496124_0147613 | Ga0496124_0147613_13_993 | 326 |
| 155 | 3300048928 | Ga0496125_0017937 | Ga0496125_0017937_2929_3930 | 326 |
| 156 | 3300050491 | nmdc:mga00v17_156249_c1 | nmdc:mga00v17_156249_c1_427_1428 | 326 |
| 157 | 3300050494 | nmdc:mga06z11_40124_c1 | nmdc:mga06z11_40124_c1_662_1663 | 326 |
| 158 | 3300050496 | nmdc:mga07m45_10168_c2 | nmdc:mga07m45_10168_c2_1124_2125 | 326 |
| 159 | iso_pu_bacteria | 2643221554 | 2643788590 | 326 |
| 160 | iso_pu_bacteria | 2643221638 | 2644213386 | 326 |
| 161 | iso_pu_bacteria | 2643221645 | 2644251999 | 326 |
| 162 | iso_pu_bacteria | 2643221664 | 2644360652 | 326 |
| 163 | iso_pu_bacteria | 2738541280 | 2738740293 | 326 |
| 164 | iso_pu_bacteria | 2738541300 | 2738843451 | 326 |
| 165 | iso_pu_bacteria | 2738543018 | 2739275475 | 326 |
| 166 | iso_pu_bacteria | 2738543030 | 2739344519 | 326 |
| 167 | iso_pu_bacteria | 2824704595 | 2824710657 | 326 |
| 168 | iso_pu_bacteria | 2824753945 | 2824762313 | 326 |
| 169 | iso_pu_bacteria | 2824763712 | 2824766538 | 326 |
| 170 | iso_pu_bacteria | 2904711408 | 2904711764 | 326 |
| 171 | 3300005614 | Ga0068856_100320277 | Ga0068856_1003202772 | 327 |
| 172 | 3300037312 | Ga0395899_0178989 | Ga0395899_0178989_263_1258 | 327 |
| 173 | 3300037312 | Ga0395899_0207510 | Ga0395899_0207510_56_1051 | 327 |
| 174 | 3300037418 | Ga0395900_0056976 | Ga0395900_0056976_2928_3923 | 327 |
| 175 | 3300037466 | Ga0395898_0012110 | Ga0395898_0012110_4963_5958 | 327 |
| 176 | 3300044673 | Ga0453683_0055804 | Ga0453683_0055804_598_1590 | 327 |
| 177 | 3300045051 | Ga0451576_0000444 | Ga0451576_0000444_91254_92246 | 327 |
| 178 | 3300046471 | Ga0495650_0000051 | Ga0495650_0000051_9225_10223 | 327 |
| 179 | iso_pu_bacteria | 2513237104 | 2513721498 | 327 |
| 180 | iso_pu_bacteria | 2643221547 | 2643757544 | 327 |
| 181 | 3300003203 | JGI25406J46586_10008891 | JGI25406J46586_100088912 | 328 |
| 182 | 3300005985 | Ga0081539_10003915 | Ga0081539_100039153 | 328 |
| 183 | 3300009098 | Ga0105245_10033391 | Ga0105245_100333913 | 328 |
| 184 | 3300009177 | Ga0105248_10176599 | Ga0105248_101765993 | 328 |
| 185 | 3300013102 | Ga0157371_10095290 | Ga0157371_100952901 | 328 |
| 186 | 3300013297 | Ga0157378_10088393 | Ga0157378_100883932 | 328 |
| 187 | 3300025901 | Ga0207688_10085737 | Ga0207688_100857371 | 328 |
| 188 | 3300025917 | Ga0207660_10062691 | Ga0207660_100626912 | 328 |
| 189 | 3300025918 | Ga0207662_10051651 | Ga0207662_100516512 | 328 |
| 190 | 3300025924 | Ga0207694_10078447 | Ga0207694_100784472 | 328 |
| 191 | 3300025941 | Ga0207711_10137334 | Ga0207711_101373343 | 328 |
| 192 | 3300026023 | Ga0207677_10312850 | Ga0207677_103128501 | 328 |
| 193 | 3300026041 | Ga0207639_10137309 | Ga0207639_101373092 | 328 |
| 194 | 3300031711 | Ga0265314_10049098 | Ga0265314_100490982 | 328 |
| 195 | 3300037418 | Ga0395900_0036422 | Ga0395900_0036422_361_1359 | 328 |
| 196 | 3300037466 | Ga0395898_0301241 | Ga0395898_0301241_422_1420 | 328 |
| 197 | 3300038443 | Ga0395901_0081812 | Ga0395901_0081812_524_1522 | 328 |
| 198 | 3300046535 | Ga0495586_0069205 | Ga0495586_0069205_539_1537 | 328 |
| 199 | 3300048912 | Ga0496109_0013082 | Ga0496109_0013082_2909_3901 | 328 |
| 200 | 3300048927 | Ga0496124_0096557 | Ga0496124_0096557_796_1794 | 328 |
| 201 | iso_pu_bacteria | 2547132512 | 2548849191 | 328 |
| 202 | iso_pu_bacteria | 2935984226 | 2935987223 | 328 |
| 203 | iso_pu_bacteria | 639633007 | 639786038 | 328 |
| 204 | 3300002773 | JGI25152J39213_1005661 | JGI25152J39213_10056614 | 329 |
| 205 | 3300002774 | JGI25150J39212_1008153 | JGI25150J39212_10081532 | 329 |
| 206 | 3300002987 | JGI25159J45721_1006309 | JGI25159J45721_10063092 | 329 |
| 207 | 3300003354 | JGI25160J50197_1003899 | JGI25160J50197_10038995 | 329 |
| 208 | 3300003374 | JGI25161J50226_1003500 | JGI25161J50226_10035005 | 329 |
| 209 | 3300003771 | Ga0055526_1002983 | Ga0055526_10029831 | 329 |
| 210 | 3300003773 | Ga0055537_1000060 | Ga0055537_100006056 | 329 |
| 211 | 3300003773 | Ga0055537_1001054 | Ga0055537_100105411 | 329 |
| 212 | 3300003773 | Ga0055537_1007510 | Ga0055537_10075101 | 329 |
| 213 | 3300003775 | Ga0055524_1002530 | Ga0055524_10025309 | 329 |
| 214 | 3300003775 | Ga0055524_1019046 | Ga0055524_10190462 | 329 |
| 215 | 3300003784 | Ga0055534_1000009 | Ga0055534_100000996 | 329 |
| 216 | 3300003790 | Ga0055528_1000012 | Ga0055528_100001284 | 329 |
| 217 | 3300003790 | Ga0055528_1004175 | Ga0055528_10041755 | 329 |
| 218 | 3300003791 | Ga0055530_10003244 | Ga0055530_100032449 | 329 |
| 219 | 3300003791 | Ga0055530_10038187 | Ga0055530_100381871 | 329 |
| 220 | 3300003791 | Ga0055530_10038230 | Ga0055530_100382301 | 329 |
| 221 | 3300003794 | Ga0055531_10001264 | Ga0055531_100012647 | 329 |
| 222 | 3300004625 | Ga0055543_1019207 | Ga0055543_10192071 | 329 |
| 223 | 3300005327 | Ga0070658_10025143 | Ga0070658_100251432 | 329 |
| 224 | 3300005336 | Ga0070680_100153962 | Ga0070680_1001539621 | 329 |
| 225 | 3300005339 | Ga0070660_100045025 | Ga0070660_1000450252 | 329 |
| 226 | 3300005435 | Ga0070714_100148050 | Ga0070714_1001480502 | 329 |
| 227 | 3300005530 | Ga0070679_100028319 | Ga0070679_1000283192 | 329 |
| 228 | 3300005563 | Ga0068855_100020915 | Ga0068855_1000209152 | 329 |
| 229 | 3300006038 | Ga0075365_10061252 | Ga0075365_100612522 | 329 |
| 230 | 3300009093 | Ga0105240_10045995 | Ga0105240_100459952 | 329 |
| 231 | 3300009551 | Ga0105238_10039582 | Ga0105238_100395822 | 329 |
| 232 | 3300013102 | Ga0157371_10000001 | Ga0157371_10000001831 | 329 |
| 233 | 3300025208 | Ga0209436_100782 | Ga0209436_1007825 | 329 |
| 234 | 3300025245 | Ga0207425_1000136 | Ga0207425_100013640 | 329 |
| 235 | 3300025245 | Ga0207425_1000533 | Ga0207425_10005339 | 329 |
| 236 | 3300025258 | Ga0209129_1006263 | Ga0209129_10062633 | 329 |
| 237 | 3300025263 | Ga0209565_1000015 | Ga0209565_1000015372 | 329 |
| 238 | 3300025263 | Ga0209565_1000382 | Ga0209565_100038216 | 329 |
| 239 | 3300025263 | Ga0209565_1000431 | Ga0209565_100043110 | 329 |
| 240 | 3300025263 | Ga0209565_1006040 | Ga0209565_10060402 | 329 |
| 241 | 3300025263 | Ga0209565_1023890 | Ga0209565_10238901 | 329 |
| 242 | 3300025273 | Ga0209673_1000017 | Ga0209673_1000017263 | 329 |
| 243 | 3300025273 | Ga0209673_1006907 | Ga0209673_10069075 | 329 |
| 244 | 3300025284 | Ga0209130_1000809 | Ga0209130_10008096 | 329 |
| 245 | 3300025284 | Ga0209130_1000987 | Ga0209130_10009875 | 329 |
| 246 | 3300025291 | Ga0209675_1000012 | Ga0209675_1000012110 | 329 |
| 247 | 3300025291 | Ga0209675_1000410 | Ga0209675_10004102 | 329 |
| 248 | 3300025291 | Ga0209675_1003168 | Ga0209675_10031688 | 329 |
| 249 | 3300025295 | Ga0209564_1000016 | Ga0209564_1000016223 | 329 |
| 250 | 3300025295 | Ga0209564_1000639 | Ga0209564_100063919 | 329 |
| 251 | 3300025295 | Ga0209564_1000888 | Ga0209564_100088818 | 329 |
| 252 | 3300025298 | Ga0209050_1000469 | Ga0209050_100046947 | 329 |
| 253 | 3300025298 | Ga0209050_1035489 | Ga0209050_10354891 | 329 |
| 254 | 3300025299 | Ga0209256_1000346 | Ga0209256_100034621 | 329 |
| 255 | 3300025299 | Ga0209256_1001470 | Ga0209256_100147016 | 329 |
| 256 | 3300025299 | Ga0209256_1001603 | Ga0209256_100160318 | 329 |
| 257 | 3300025302 | Ga0207426_1001538 | Ga0207426_10015382 | 329 |
| 258 | 3300025304 | Ga0209257_1000010 | Ga0209257_1000010692 | 329 |
| 259 | 3300025909 | Ga0207705_10040216 | Ga0207705_100402162 | 329 |
| 260 | 3300025919 | Ga0207657_10042783 | Ga0207657_100427832 | 329 |
| 261 | 3300025921 | Ga0207652_10180465 | Ga0207652_101804652 | 329 |
| 262 | 3300025924 | Ga0207694_10102490 | Ga0207694_101024902 | 329 |
| 263 | 3300025929 | Ga0207664_10043443 | Ga0207664_100434432 | 329 |
| 264 | 3300025949 | Ga0207667_10196381 | Ga0207667_101963812 | 329 |
| 265 | 3300026078 | Ga0207702_10258985 | Ga0207702_102589852 | 329 |
| 266 | 3300031548 | Ga0307408_100003776 | Ga0307408_1000037765 | 329 |
| 267 | 3300031548 | Ga0307408_100008651 | Ga0307408_1000086512 | 329 |
| 268 | 3300031595 | Ga0265313_10057716 | Ga0265313_100577162 | 329 |
| 269 | 3300035115 | Ga0373941_0003567 | Ga0373941_0003567_536_1543 | 329 |
| 270 | 3300035410 | Ga0373924_0010446 | Ga0373924_0010446_1633_2631 | 329 |
| 271 | 3300046491 | Ga0495584_0051656 | Ga0495584_0051656_1019_2020 | 329 |
| 272 | 3300046501 | Ga0495607_0008359 | Ga0495607_0008359_5406_6407 | 329 |
| 273 | 3300046506 | Ga0495583_0025908 | Ga0495583_0025908_517_1518 | 329 |
| 274 | 3300046513 | Ga0495616_0042604 | Ga0495616_0042604_212_1213 | 329 |
| 275 | 3300046530 | Ga0495654_0027985 | Ga0495654_0027985_46_1044 | 329 |
| 276 | 3300046538 | Ga0495609_0000240 | Ga0495609_0000240_2231_3232 | 329 |
| 277 | 3300046538 | Ga0495609_0007832 | Ga0495609_0007832_2405_3403 | 329 |
| 278 | 3300046542 | Ga0495597_0001290 | Ga0495597_0001290_12313_13311 | 329 |
| 279 | 3300046616 | Ga0495668_0030938 | Ga0495668_0030938_1890_2891 | 329 |
| 280 | 3300046660 | Ga0495625_0009971 | Ga0495625_0009971_2440_3438 | 329 |
| 281 | 3300046664 | Ga0495659_0000009 | Ga0495659_0000009_40951_41949 | 329 |
| 282 | 3300046664 | Ga0495659_0009895 | Ga0495659_0009895_264_1265 | 329 |
| 283 | 3300046665 | Ga0495661_0072635 | Ga0495661_0072635_120_1112 | 329 |
| 284 | 3300046692 | Ga0495671_0000433 | Ga0495671_0000433_25432_26430 | 329 |
| 285 | 3300046694 | Ga0495649_0023067 | Ga0495649_0023067_1800_2801 | 329 |
| 286 | 3300046810 | Ga0495660_0007159 | Ga0495660_0007159_2188_3186 | 329 |
| 287 | 3300047318 | Ga0495636_0063281 | Ga0495636_0063281_50_1051 | 329 |
| 288 | 3300047320 | Ga0495672_0000120 | Ga0495672_0000120_77116_78114 | 329 |
| 289 | 3300047443 | Ga0495687_041333 | Ga0495687_041333_517_1518 | 329 |
| 290 | 3300047447 | Ga0495685_030715 | Ga0495685_030715_634_1635 | 329 |
| 291 | 3300047470 | Ga0495681_0005375 | Ga0495681_0005375_1074_2075 | 329 |
| 292 | 3300048091 | Ga0495626_0096453 | Ga0495626_0096453_235_1227 | 329 |
| 293 | 3300048912 | Ga0496109_0206828 | Ga0496109_0206828_804_1796 | 329 |
| 294 | 3300048929 | Ga0496126_0029792 | Ga0496126_0029792_3726_4811 | 329 |
| 295 | 3300049459 | Ga0495678_024482 | Ga0495678_024482_538_1539 | 329 |
| 296 | 3300049575 | Ga0501039_0091758 | Ga0501039_0091758_808_1815 | 329 |
| 297 | 3300049581 | Ga0501047_0023099 | Ga0501047_0023099_1642_2649 | 329 |
| 298 | 3300049589 | Ga0501073_0077589 | Ga0501073_0077589_141_1148 | 329 |
| 299 | 3300049665 | Ga0501227_000835 | Ga0501227_000835_986_1978 | 329 |
| 300 | 3300049669 | Ga0501235_007556 | Ga0501235_007556_326_1324 | 329 |
| 301 | 3300049741 | Ga0501079_0106531 | Ga0501079_0106531_700_1707 | 329 |
| 302 | 3300049744 | Ga0501083_0174389 | Ga0501083_0174389_163_1170 | 329 |
| 303 | 3300049775 | Ga0501279_003025 | Ga0501279_003025_978_1970 | 329 |
| 304 | 3300049823 | Ga0501044_0054927 | Ga0501044_0054927_2263_3270 | 329 |
| 305 | 3300050492 | nmdc:mga0yw44_45239_c1 | nmdc:mga0yw44_45239_c1_356_1369 | 329 |
| 306 | 3300053092 | Ga0500583_0102412 | Ga0500583_0102412_355_1365 | 329 |
| 307 | 3300053096 | Ga0500641_0019723 | Ga0500641_0019723_838_1848 | 329 |
| 308 | 3300053154 | Ga0500619_000012 | Ga0500619_000012_37481_38479 | 329 |
| 309 | iso_pu_bacteria | 2508501042 | 2508692870 | 329 |
| 310 | iso_pu_bacteria | 2513237092 | 2513621681 | 329 |
| 311 | iso_pu_bacteria | 2513237094 | 2513636884 | 329 |
| 312 | iso_pu_bacteria | 2513237095 | 2513651170 | 329 |
| 313 | iso_pu_bacteria | 2513237161 | 2514011731 | 329 |
| 314 | iso_pu_bacteria | 2517093001 | 2517108203 | 329 |
| 315 | iso_pu_bacteria | 2524023205 | 2524436093 | 329 |
| 316 | iso_pu_bacteria | 2528768022 | 2528852851 | 329 |
| 317 | iso_pu_bacteria | 2617270735 | 2617352733 | 329 |
| 318 | iso_pu_bacteria | 2744054633 | 2745080952 | 329 |
| 319 | iso_pu_bacteria | 2816332527 | 2818236752 | 329 |
| 320 | iso_pu_bacteria | 2824617872 | 2824622048 | 329 |
| 321 | iso_pu_bacteria | 2824626560 | 2824629312 | 329 |
| 322 | iso_pu_bacteria | 2824635225 | 2824642656 | 329 |
| 323 | iso_pu_bacteria | 2824644064 | 2824650500 | 329 |
| 324 | iso_pu_bacteria | 2824661429 | 2824669168 | 329 |
| 325 | iso_pu_bacteria | 2824671348 | 2824672307 | 329 |
| 326 | iso_pu_bacteria | 2824679649 | 2824682286 | 329 |
| 327 | iso_pu_bacteria | 2824687955 | 2824688810 | 329 |
| 328 | iso_pu_bacteria | 2824714736 | 2824720369 | 329 |
| 329 | iso_pu_bacteria | 2824723954 | 2824729066 | 329 |
| 330 | iso_pu_bacteria | 2824773399 | 2824776661 | 329 |
| 331 | iso_pu_bacteria | 2838122688 | 2838127392 | 329 |
| 332 | iso_pu_bacteria | 2841941048 | 2841946410 | 329 |
| 333 | iso_pu_bacteria | 2841949485 | 2841957128 | 329 |
| 334 | iso_pu_bacteria | 2841957949 | 2841965650 | 329 |
| 335 | iso_pu_bacteria | 2841966195 | 2841972920 | 329 |
| 336 | iso_pu_bacteria | 2841974524 | 2841978408 | 329 |
| 337 | iso_pu_bacteria | 2841983080 | 2841987490 | 329 |
| 338 | iso_pu_bacteria | 2842038055 | 2842040841 | 329 |
| 339 | iso_pu_bacteria | 2842045827 | 2842046214 | 329 |
| 340 | iso_pu_bacteria | 2844315083 | 2844320204 | 329 |
| 341 | iso_pu_bacteria | 2847930680 | 2847937523 | 329 |
| 342 | iso_pu_bacteria | 2849076700 | 2849078207 | 329 |
| 343 | iso_pu_bacteria | 2874612657 | 2874616778 | 329 |
| 344 | iso_pu_bacteria | 2874620515 | 2874628270 | 329 |
| 345 | iso_pu_bacteria | 2874628541 | 2874630137 | 329 |
| 346 | iso_pu_bacteria | 2876761206 | 2876768281 | 329 |
| 347 | iso_pu_bacteria | 2879083081 | 2879084936 | 329 |
| 348 | iso_pu_bacteria | 2879099564 | 2879107904 | 329 |
| 349 | iso_pu_bacteria | 2881364244 | 2881370100 | 329 |
| 350 | iso_pu_bacteria | 2881665667 | 2881670102 | 329 |
| 351 | iso_pu_bacteria | 2885366525 | 2885370160 | 329 |
| 352 | iso_pu_bacteria | 2885409591 | 2885414352 | 329 |
| 353 | iso_pu_bacteria | 2888378607 | 2888385674 | 329 |
| 354 | iso_pu_bacteria | 2888388044 | 2888392593 | 329 |
| 355 | iso_pu_bacteria | 2903727486 | 2903731206 | 329 |
| 356 | iso_pu_bacteria | 2904666416 | 2904674111 | 329 |
| 357 | iso_pu_bacteria | 2906602504 | 2906610027 | 329 |
| 358 | iso_pu_bacteria | 2906626472 | 2906629345 | 329 |
| 359 | iso_pu_bacteria | 2906643746 | 2906645523 | 329 |
| 360 | iso_pu_bacteria | 2922393267 | 2922396878 | 329 |
| 361 | iso_pu_bacteria | 2932784394 | 2932785176 | 329 |
| 362 | iso_pu_bacteria | 2932794094 | 2932799625 | 329 |
| 363 | iso_pu_bacteria | 2932801729 | 2932808784 | 329 |
| 364 | iso_pu_bacteria | 2932809354 | 2932810203 | 329 |
| 365 | iso_pu_bacteria | 2932818245 | 2932821776 | 329 |
| 366 | iso_pu_bacteria | 2932828146 | 2932829012 | 329 |
| 367 | iso_pu_bacteria | 2935608549 | 2935610021 | 329 |
| 368 | iso_pu_bacteria | 2935616580 | 2935619568 | 329 |
| 369 | iso_pu_bacteria | 2935638405 | 2935638548 | 329 |
| 370 | iso_pu_bacteria | 2935648319 | 2935651950 | 329 |
| 371 | iso_pu_bacteria | 2935656913 | 2935660077 | 329 |
| 372 | iso_pu_bacteria | 2935665750 | 2935666600 | 329 |
| 373 | iso_pu_bacteria | 2935675223 | 2935682216 | 329 |
| 374 | iso_pu_bacteria | 2935684952 | 2935691128 | 329 |
| 375 | iso_pu_bacteria | 2935694250 | 2935694441 | 329 |
| 376 | iso_pu_bacteria | 2935703347 | 2935703554 | 329 |
| 377 | iso_pu_bacteria | 2935713505 | 2935718509 | 329 |
| 378 | iso_pu_bacteria | 2935722832 | 2935727511 | 329 |
| 379 | iso_pu_bacteria | 2935732158 | 2935736214 | 329 |
| 380 | iso_pu_bacteria | 2935741537 | 2935745594 | 329 |
| 381 | iso_pu_bacteria | 2935750917 | 2935755975 | 329 |
| 382 | iso_pu_bacteria | 2935760218 | 2935760763 | 329 |
| 383 | iso_pu_bacteria | 2935769743 | 2935776428 | 329 |
| 384 | iso_pu_bacteria | 2935777560 | 2935780829 | 329 |
| 385 | iso_pu_bacteria | 2935785616 | 2935792347 | 329 |
| 386 | iso_pu_bacteria | 2935793552 | 2935800478 | 329 |
| 387 | iso_pu_bacteria | 2935801545 | 2935801691 | 329 |
| 388 | iso_pu_bacteria | 2935810662 | 2935814893 | 329 |
| 389 | iso_pu_bacteria | 2935819856 | 2935823181 | 329 |
| 390 | iso_pu_bacteria | 2935827899 | 2935828042 | 329 |
| 391 | iso_pu_bacteria | 2935837841 | 2935842248 | 329 |
| 392 | iso_pu_bacteria | 2935847175 | 2935848763 | 329 |
| 393 | iso_pu_bacteria | 2935855204 | 2935858116 | 329 |
| 394 | iso_pu_bacteria | 2935864058 | 2935868021 | 329 |
| 395 | iso_pu_bacteria | 2935873716 | 2935873956 | 329 |
| 396 | iso_pu_bacteria | 2935883170 | 2935885714 | 329 |
| 397 | iso_pu_bacteria | 2935908558 | 2935909432 | 329 |
| 398 | iso_pu_bacteria | 2935916978 | 2935917155 | 329 |
| 399 | iso_pu_bacteria | 2935926038 | 2935926913 | 329 |
| 400 | iso_pu_bacteria | 2935934488 | 2935937243 | 329 |
| 401 | iso_pu_bacteria | 2935942939 | 2935944454 | 329 |
| 402 | iso_pu_bacteria | 2935951376 | 2935952891 | 329 |
| 403 | iso_pu_bacteria | 2935959822 | 2935962892 | 329 |
| 404 | iso_pu_bacteria | 2935967501 | 2935969731 | 329 |
| 405 | iso_pu_bacteria | 2935992306 | 2935993120 | 329 |
| 406 | iso_pu_bacteria | 2936002035 | 2936003057 | 329 |
| 407 | iso_pu_bacteria | 2936011229 | 2936014493 | 329 |
| 408 | iso_pu_bacteria | 2936019824 | 2936023667 | 329 |
| 409 | iso_pu_bacteria | 2936028420 | 2936031310 | 329 |
| 410 | iso_pu_bacteria | 2936037263 | 2936040464 | 329 |
| 411 | iso_pu_bacteria | 2936046547 | 2936049599 | 329 |
| 412 | iso_pu_bacteria | 2936055302 | 2936061185 | 329 |
| 413 | iso_pu_bacteria | 2940556831 | 2940562050 | 329 |
| 414 | iso_pu_bacteria | 2941531003 | 2941531369 | 329 |
| 415 | iso_pu_bacteria | 2941538514 | 2941542296 | 329 |
| 416 | iso_pu_bacteria | 3005483717 | 3005485592 | 329 |
| 417 | iso_pu_bacteria | 3005506211 | 3005508241 | 329 |
| 418 | iso_pu_bacteria | 3005587118 | 3005588254 | 329 |
| 419 | iso_pu_bacteria | 3005594810 | 3005600516 | 329 |
| 420 | iso_pu_bacteria | 3005710791 | 3005715989 | 329 |
| 421 | iso_pu_bacteria | 3005718088 | 3005723345 | 329 |
| 422 | iso_pu_bacteria | 8006926726 | 8006928629 | 329 |
| 423 | iso_pu_bacteria | 8016511872 | 8016520449 | 329 |
| 424 | iso_pu_bacteria | 8016522445 | 8016528511 | 329 |
| 425 | iso_pu_bacteria | 8016530956 | 8016533671 | 329 |
| 426 | iso_pu_bacteria | 8016539877 | 8016546894 | 329 |
| 427 | iso_pu_bacteria | 8016548790 | 8016555224 | 329 |
| 428 | iso_pu_bacteria | 8016557553 | 8016563588 | 329 |
| 429 | iso_pu_bacteria | 8016566248 | 8016572001 | 329 |
| 430 | iso_pu_bacteria | 8016575299 | 8016576206 | 329 |
| 431 | iso_pu_bacteria | 8016595262 | 8016601324 | 329 |
| 432 | iso_pu_bacteria | 8016603502 | 8016609105 | 329 |
| 433 | iso_pu_bacteria | 8016613128 | 8016615799 | 329 |
| 434 | iso_pu_bacteria | 8016622563 | 8016625435 | 329 |
| 435 | iso_pu_bacteria | 8016630954 | 8016638962 | 329 |
| 436 | iso_pu_bacteria | 8017057580 | 8017065126 | 329 |
| 437 | iso_pu_bacteria | 8019530166 | 8019533451 | 329 |
| 438 | iso_pu_bacteria | 8019538911 | 8019546227 | 329 |
| 439 | iso_pu_bacteria | 8019547302 | 8019552484 | 329 |
| 440 | iso_pu_bacteria | 8019576017 | 8019584516 | 329 |
| 441 | iso_pu_bacteria | 8019586578 | 8019592286 | 329 |
| 442 | iso_pu_bacteria | 8019597564 | 8019598998 | 329 |
| 443 | iso_pu_bacteria | 8019648815 | 8019649575 | 329 |
| 444 | iso_pu_bacteria | 8019687851 | 8019691275 | 329 |
| 445 | iso_pu_bacteria | 8056967851 | 8056974877 | 329 |
| 446 | 3300005262 | Ga0065165_1002482 | Ga0065165_100248211 | 330 |
| 447 | 3300005355 | Ga0070671_100174947 | Ga0070671_1001749472 | 330 |
| 448 | 3300005457 | Ga0070662_100146759 | Ga0070662_1001467592 | 330 |
| 449 | 3300005564 | Ga0070664_100076642 | Ga0070664_1000766422 | 330 |
| 450 | 3300005564 | Ga0070664_100338256 | Ga0070664_1003382562 | 330 |
| 451 | 3300006028 | Ga0070717_10176454 | Ga0070717_101764542 | 330 |
| 452 | 3300006914 | Ga0075436_100015432 | Ga0075436_1000154325 | 330 |
| 453 | 3300025929 | Ga0207664_10287721 | Ga0207664_102877211 | 330 |
| 454 | 3300025933 | Ga0207706_10032450 | Ga0207706_100324503 | 330 |
| 455 | 3300037312 | Ga0395899_0148750 | Ga0395899_0148750_47_1042 | 330 |
| 456 | 3300037418 | Ga0395900_0183792 | Ga0395900_0183792_501_1508 | 330 |
| 457 | 3300037471 | Ga0395905_0013331 | Ga0395905_0013331_45_1052 | 330 |
| 458 | 3300038443 | Ga0395901_0240294 | Ga0395901_0240294_830_1837 | 330 |
| 459 | 3300046457 | Ga0495590_0000049 | Ga0495590_0000049_27364_28359 | 330 |
| 460 | 3300046457 | Ga0495590_0003539 | Ga0495590_0003539_402_1397 | 330 |
| 461 | 3300046458 | Ga0495591_014144 | Ga0495591_014144_948_1943 | 330 |
| 462 | 3300046460 | Ga0495638_0022925 | Ga0495638_0022925_2894_3889 | 330 |
| 463 | 3300046474 | Ga0495605_0057361 | Ga0495605_0057361_598_1593 | 330 |
| 464 | 3300046474 | Ga0495605_0076287 | Ga0495605_0076287_282_1277 | 330 |
| 465 | 3300046491 | Ga0495584_0000189 | Ga0495584_0000189_14624_15619 | 330 |
| 466 | 3300046491 | Ga0495584_0006718 | Ga0495584_0006718_684_1679 | 330 |
| 467 | 3300046491 | Ga0495584_0006868 | Ga0495584_0006868_3423_4418 | 330 |
| 468 | 3300046491 | Ga0495584_0056981 | Ga0495584_0056981_101_1096 | 330 |
| 469 | 3300046492 | Ga0495585_0000148 | Ga0495585_0000148_70719_71714 | 330 |
| 470 | 3300046492 | Ga0495585_0001953 | Ga0495585_0001953_4558_5553 | 330 |
| 471 | 3300046492 | Ga0495585_0004258 | Ga0495585_0004258_3693_4688 | 330 |
| 472 | 3300046492 | Ga0495585_0012315 | Ga0495585_0012315_1087_2082 | 330 |
| 473 | 3300046492 | Ga0495585_0014402 | Ga0495585_0014402_2659_3762 | 330 |
| 474 | 3300046492 | Ga0495585_0024386 | Ga0495585_0024386_1868_2863 | 330 |
| 475 | 3300046492 | Ga0495585_0024688 | Ga0495585_0024688_488_1483 | 330 |
| 476 | 3300046492 | Ga0495585_0060314 | Ga0495585_0060314_785_1780 | 330 |
| 477 | 3300046492 | Ga0495585_0074672 | Ga0495585_0074672_414_1409 | 330 |
| 478 | 3300046499 | Ga0495594_0031346 | Ga0495594_0031346_1141_2244 | 330 |
| 479 | 3300046499 | Ga0495594_0039208 | Ga0495594_0039208_717_1712 | 330 |
| 480 | 3300046499 | Ga0495594_0139927 | Ga0495594_0139927_29_1024 | 330 |
| 481 | 3300046499 | Ga0495594_0183708 | Ga0495594_0183708_169_1164 | 330 |
| 482 | 3300046499 | Ga0495594_0242777 | Ga0495594_0242777_21_1016 | 330 |
| 483 | 3300046500 | Ga0495596_0000778 | Ga0495596_0000778_2947_3942 | 330 |
| 484 | 3300046500 | Ga0495596_0009554 | Ga0495596_0009554_3199_4194 | 330 |
| 485 | 3300046500 | Ga0495596_0024661 | Ga0495596_0024661_1340_2335 | 330 |
| 486 | 3300046501 | Ga0495607_0034756 | Ga0495607_0034756_924_1919 | 330 |
| 487 | 3300046501 | Ga0495607_0072472 | Ga0495607_0072472_325_1320 | 330 |
| 488 | 3300046501 | Ga0495607_0134923 | Ga0495607_0134923_86_1081 | 330 |
| 489 | 3300046506 | Ga0495583_0009580 | Ga0495583_0009580_1154_2149 | 330 |
| 490 | 3300046506 | Ga0495583_0030071 | Ga0495583_0030071_465_1460 | 330 |
| 491 | 3300046506 | Ga0495583_0059659 | Ga0495583_0059659_478_1473 | 330 |
| 492 | 3300046507 | Ga0495606_0053543 | Ga0495606_0053543_1452_2447 | 330 |
| 493 | 3300046507 | Ga0495606_0060234 | Ga0495606_0060234_488_1483 | 330 |
| 494 | 3300046513 | Ga0495616_0000817 | Ga0495616_0000817_15813_16808 | 330 |
| 495 | 3300046513 | Ga0495616_0074991 | Ga0495616_0074991_468_1463 | 330 |
| 496 | 3300046517 | Ga0495630_0209280 | Ga0495630_0209280_437_1429 | 330 |
| 497 | 3300046518 | Ga0495631_0003028 | Ga0495631_0003028_3325_4320 | 330 |
| 498 | 3300046518 | Ga0495631_0005160 | Ga0495631_0005160_3668_4663 | 330 |
| 499 | 3300046518 | Ga0495631_0005448 | Ga0495631_0005448_955_1950 | 330 |
| 500 | 3300046518 | Ga0495631_0005904 | Ga0495631_0005904_3985_4980 | 330 |
| 501 | 3300046518 | Ga0495631_0021545 | Ga0495631_0021545_1186_2181 | 330 |
| 502 | 3300046519 | Ga0495632_0000946 | Ga0495632_0000946_3777_4772 | 330 |
| 503 | 3300046522 | Ga0495643_0013145 | Ga0495643_0013145_3303_4298 | 330 |
| 504 | 3300046523 | Ga0495644_0003582 | Ga0495644_0003582_982_1977 | 330 |
| 505 | 3300046523 | Ga0495644_0023951 | Ga0495644_0023951_185_1180 | 330 |
| 506 | 3300046524 | Ga0495648_0009209 | Ga0495648_0009209_2783_3778 | 330 |
| 507 | 3300046524 | Ga0495648_0037552 | Ga0495648_0037552_1150_2145 | 330 |
| 508 | 3300046524 | Ga0495648_0070253 | Ga0495648_0070253_913_1908 | 330 |
| 509 | 3300046526 | Ga0495666_0005745 | Ga0495666_0005745_3922_4917 | 330 |
| 510 | 3300046528 | Ga0495642_0000657 | Ga0495642_0000657_1423_2418 | 330 |
| 511 | 3300046528 | Ga0495642_0137576 | Ga0495642_0137576_43_1038 | 330 |
| 512 | 3300046530 | Ga0495654_0005602 | Ga0495654_0005602_1150_2145 | 330 |
| 513 | 3300046531 | Ga0495665_0007608 | Ga0495665_0007608_2653_3648 | 330 |
| 514 | 3300046531 | Ga0495665_0063244 | Ga0495665_0063244_33_1028 | 330 |
| 515 | 3300046535 | Ga0495586_0006988 | Ga0495586_0006988_3793_4788 | 330 |
| 516 | 3300046538 | Ga0495609_0014487 | Ga0495609_0014487_818_1813 | 330 |
| 517 | 3300046538 | Ga0495609_0021260 | Ga0495609_0021260_1347_2342 | 330 |
| 518 | 3300046538 | Ga0495609_0039463 | Ga0495609_0039463_911_1906 | 330 |
| 519 | 3300046542 | Ga0495597_0002422 | Ga0495597_0002422_9879_10874 | 330 |
| 520 | 3300046542 | Ga0495597_0013932 | Ga0495597_0013932_1871_2866 | 330 |
| 521 | 3300046557 | Ga0495622_0006675 | Ga0495622_0006675_394_1389 | 330 |
| 522 | 3300046557 | Ga0495622_0037023 | Ga0495622_0037023_137_1132 | 330 |
| 523 | 3300046558 | Ga0495633_0007848 | Ga0495633_0007848_3891_4886 | 330 |
| 524 | 3300046558 | Ga0495633_0018740 | Ga0495633_0018740_1005_2000 | 330 |
| 525 | 3300046558 | Ga0495633_0038856 | Ga0495633_0038856_935_1930 | 330 |
| 526 | 3300046558 | Ga0495633_0046850 | Ga0495633_0046850_307_1302 | 330 |
| 527 | 3300046616 | Ga0495668_0000768 | Ga0495668_0000768_25676_26671 | 330 |
| 528 | 3300046616 | Ga0495668_0090816 | Ga0495668_0090816_581_1576 | 330 |
| 529 | 3300046648 | Ga0495611_0000377 | Ga0495611_0000377_5961_6956 | 330 |
| 530 | 3300046648 | Ga0495611_0004255 | Ga0495611_0004255_2130_3125 | 330 |
| 531 | 3300046648 | Ga0495611_0018873 | Ga0495611_0018873_1047_2042 | 330 |
| 532 | 3300046648 | Ga0495611_0026855 | Ga0495611_0026855_1154_2149 | 330 |
| 533 | 3300046648 | Ga0495611_0036316 | Ga0495611_0036316_178_1173 | 330 |
| 534 | 3300046648 | Ga0495611_0046008 | Ga0495611_0046008_349_1344 | 330 |
| 535 | 3300046648 | Ga0495611_0067326 | Ga0495611_0067326_543_1538 | 330 |
| 536 | 3300046648 | Ga0495611_0123237 | Ga0495611_0123237_199_1194 | 330 |
| 537 | 3300046660 | Ga0495625_0023747 | Ga0495625_0023747_2837_3832 | 330 |
| 538 | 3300046660 | Ga0495625_0032661 | Ga0495625_0032661_2155_3150 | 330 |
| 539 | 3300046663 | Ga0495635_0000374 | Ga0495635_0000374_18719_19714 | 330 |
| 540 | 3300046665 | Ga0495661_0000932 | Ga0495661_0000932_1402_2397 | 330 |
| 541 | 3300046665 | Ga0495661_0001580 | Ga0495661_0001580_13265_14260 | 330 |
| 542 | 3300046665 | Ga0495661_0078008 | Ga0495661_0078008_598_1593 | 330 |
| 543 | 3300046665 | Ga0495661_0095201 | Ga0495661_0095201_94_1089 | 330 |
| 544 | 3300046665 | Ga0495661_0109935 | Ga0495661_0109935_75_1070 | 330 |
| 545 | 3300046665 | Ga0495661_0120953 | Ga0495661_0120953_18_1013 | 330 |
| 546 | 3300046674 | Ga0495588_0017891 | Ga0495588_0017891_1417_2412 | 330 |
| 547 | 3300046674 | Ga0495588_0027605 | Ga0495588_0027605_1542_2537 | 330 |
| 548 | 3300046674 | Ga0495588_0081565 | Ga0495588_0081565_301_1296 | 330 |
| 549 | 3300046679 | Ga0495623_0099708 | Ga0495623_0099708_632_1627 | 330 |
| 550 | 3300046684 | Ga0495669_0000218 | Ga0495669_0000218_15917_16912 | 330 |
| 551 | 3300046684 | Ga0495669_0001840 | Ga0495669_0001840_1380_2375 | 330 |
| 552 | 3300046684 | Ga0495669_0009191 | Ga0495669_0009191_2410_3405 | 330 |
| 553 | 3300046689 | Ga0495613_0038210 | Ga0495613_0038210_1025_2020 | 330 |
| 554 | 3300046690 | Ga0495624_0008402 | Ga0495624_0008402_527_1522 | 330 |
| 555 | 3300046691 | Ga0495670_0001687 | Ga0495670_0001687_3061_4056 | 330 |
| 556 | 3300046691 | Ga0495670_0038658 | Ga0495670_0038658_309_1304 | 330 |
| 557 | 3300046691 | Ga0495670_0054019 | Ga0495670_0054019_755_1750 | 330 |
| 558 | 3300046691 | Ga0495670_0062797 | Ga0495670_0062797_798_1793 | 330 |
| 559 | 3300046692 | Ga0495671_0002478 | Ga0495671_0002478_8650_9645 | 330 |
| 560 | 3300046692 | Ga0495671_0013847 | Ga0495671_0013847_2521_3516 | 330 |
| 561 | 3300046692 | Ga0495671_0023340 | Ga0495671_0023340_1299_2294 | 330 |
| 562 | 3300046694 | Ga0495649_0000255 | Ga0495649_0000255_26014_27009 | 330 |
| 563 | 3300046694 | Ga0495649_0053634 | Ga0495649_0053634_841_1836 | 330 |
| 564 | 3300046794 | Ga0495589_0004718 | Ga0495589_0004718_2070_3065 | 330 |
| 565 | 3300046794 | Ga0495589_0046504 | Ga0495589_0046504_999_1994 | 330 |
| 566 | 3300046794 | Ga0495589_0051364 | Ga0495589_0051364_989_1984 | 330 |
| 567 | 3300046810 | Ga0495660_0015805 | Ga0495660_0015805_1709_2704 | 330 |
| 568 | 3300046810 | Ga0495660_0039856 | Ga0495660_0039856_1083_2078 | 330 |
| 569 | 3300047315 | Ga0495581_0004542 | Ga0495581_0004542_6625_7620 | 330 |
| 570 | 3300047315 | Ga0495581_0065980 | Ga0495581_0065980_668_1663 | 330 |
| 571 | 3300047317 | Ga0495604_0029185 | Ga0495604_0029185_1027_2022 | 330 |
| 572 | 3300047318 | Ga0495636_0006057 | Ga0495636_0006057_2308_3303 | 330 |
| 573 | 3300047321 | Ga0495676_0000034 | Ga0495676_0000034_26428_27423 | 330 |
| 574 | 3300047321 | Ga0495676_0028077 | Ga0495676_0028077_2686_3681 | 330 |
| 575 | 3300047321 | Ga0495676_0051366 | Ga0495676_0051366_675_1778 | 330 |
| 576 | 3300047322 | Ga0495680_0003719 | Ga0495680_0003719_6830_7825 | 330 |
| 577 | 3300047323 | Ga0495683_0050857 | Ga0495683_0050857_666_1661 | 330 |
| 578 | 3300047443 | Ga0495687_000060 | Ga0495687_000060_134319_135314 | 330 |
| 579 | 3300047443 | Ga0495687_000410 | Ga0495687_000410_25752_26747 | 330 |
| 580 | 3300047443 | Ga0495687_002333 | Ga0495687_002333_1393_2388 | 330 |
| 581 | 3300047444 | Ga0495675_0015513 | Ga0495675_0015513_253_1248 | 330 |
| 582 | 3300047445 | Ga0495677_0004862 | Ga0495677_0004862_1075_2070 | 330 |
| 583 | 3300047445 | Ga0495677_0015412 | Ga0495677_0015412_1060_2055 | 330 |
| 584 | 3300047445 | Ga0495677_0023348 | Ga0495677_0023348_744_1739 | 330 |
| 585 | 3300047446 | Ga0495679_005605 | Ga0495679_005605_3749_4744 | 330 |
| 586 | 3300047447 | Ga0495685_002470 | Ga0495685_002470_2606_3601 | 330 |
| 587 | 3300047447 | Ga0495685_033833 | Ga0495685_033833_429_1424 | 330 |
| 588 | 3300047470 | Ga0495681_0001232 | Ga0495681_0001232_4681_5676 | 330 |
| 589 | 3300047470 | Ga0495681_0001235 | Ga0495681_0001235_14409_15404 | 330 |
| 590 | 3300047470 | Ga0495681_0015138 | Ga0495681_0015138_3049_4044 | 330 |
| 591 | 3300047470 | Ga0495681_0023844 | Ga0495681_0023844_1808_2803 | 330 |
| 592 | 3300047470 | Ga0495681_0053345 | Ga0495681_0053345_495_1490 | 330 |
| 593 | 3300047472 | Ga0495686_0002274 | Ga0495686_0002274_12665_13660 | 330 |
| 594 | 3300047472 | Ga0495686_0140112 | Ga0495686_0140112_134_1129 | 330 |
| 595 | 3300048089 | Ga0495614_0006982 | Ga0495614_0006982_3195_4190 | 330 |
| 596 | 3300048089 | Ga0495614_0028657 | Ga0495614_0028657_115_1110 | 330 |
| 597 | 3300048091 | Ga0495626_0008646 | Ga0495626_0008646_981_1976 | 330 |
| 598 | 3300048091 | Ga0495626_0013373 | Ga0495626_0013373_1187_2182 | 330 |
| 599 | 3300048091 | Ga0495626_0038467 | Ga0495626_0038467_350_1345 | 330 |
| 600 | 3300048091 | Ga0495626_0043067 | Ga0495626_0043067_862_1857 | 330 |
| 601 | 3300048091 | Ga0495626_0052738 | Ga0495626_0052738_353_1348 | 330 |
| 602 | 3300048903 | Ga0496100_0091272 | Ga0496100_0091272_408_1403 | 330 |
| 603 | 3300048906 | Ga0496103_0035127 | Ga0496103_0035127_477_1472 | 330 |
| 604 | 3300048911 | Ga0496108_0169803 | Ga0496108_0169803_83_1078 | 330 |
| 605 | 3300048913 | Ga0496110_0000719 | Ga0496110_0000719_3833_4828 | 330 |
| 606 | 3300048913 | Ga0496110_0033809 | Ga0496110_0033809_2254_3327 | 330 |
| 607 | 3300048914 | Ga0496111_0127989 | Ga0496111_0127989_773_1846 | 330 |
| 608 | 3300048914 | Ga0496111_0132927 | Ga0496111_0132927_201_1196 | 330 |
| 609 | 3300048916 | Ga0496113_0095267 | Ga0496113_0095267_199_1194 | 330 |
| 610 | 3300048918 | Ga0496115_0076188 | Ga0496115_0076188_796_1791 | 330 |
| 611 | 3300048925 | Ga0496122_0000337 | Ga0496122_0000337_4194_5189 | 330 |
| 612 | 3300048926 | Ga0496123_0000905 | Ga0496123_0000905_20379_21374 | 330 |
| 613 | 3300048928 | Ga0496125_0022086 | Ga0496125_0022086_1086_2081 | 330 |
| 614 | 3300049459 | Ga0495678_000150 | Ga0495678_000150_4810_5805 | 330 |
| 615 | 3300049459 | Ga0495678_002016 | Ga0495678_002016_12459_13454 | 330 |
| 616 | 3300049459 | Ga0495678_006504 | Ga0495678_006504_3205_4200 | 330 |
| 617 | 3300049459 | Ga0495678_020859 | Ga0495678_020859_366_1361 | 330 |
| 618 | 3300049459 | Ga0495678_060558 | Ga0495678_060558_366_1361 | 330 |
| 619 | 3300049460 | Ga0495682_0006292 | Ga0495682_0006292_3214_4209 | 330 |
| 620 | 3300049584 | Ga0501068_0147605 | Ga0501068_0147605_449_1465 | 330 |
| 621 | 3300049585 | Ga0501069_0003092 | Ga0501069_0003092_7499_8515 | 330 |
| 622 | 3300049586 | Ga0501070_0064316 | Ga0501070_0064316_358_1353 | 330 |
| 623 | 3300049588 | Ga0501072_0236487 | Ga0501072_0236487_415_1407 | 330 |
| 624 | 3300050514 | nmdc:mga08x19_7003_c1 | nmdc:mga08x19_7003_c1_206_1210 | 330 |
| 625 | 3300005337 | Ga0070682_100064172 | Ga0070682_1000641722 | 331 |
| 626 | 3300005435 | Ga0070714_100128201 | Ga0070714_1001282013 | 331 |
| 627 | 3300005435 | Ga0070714_100488805 | Ga0070714_1004888051 | 331 |
| 628 | 3300005436 | Ga0070713_100091223 | Ga0070713_1000912232 | 331 |
| 629 | 3300005535 | Ga0070684_100113316 | Ga0070684_1001133161 | 331 |
| 630 | 3300005539 | Ga0068853_100052372 | Ga0068853_1000523722 | 331 |
| 631 | 3300005841 | Ga0068863_100558210 | Ga0068863_1005582102 | 331 |
| 632 | 3300006038 | Ga0075365_10050969 | Ga0075365_100509692 | 331 |
| 633 | 3300006186 | Ga0075369_10030120 | Ga0075369_100301202 | 331 |
| 634 | 3300006871 | Ga0075434_100130481 | Ga0075434_1001304812 | 331 |
| 635 | 3300007788 | Ga0099795_10077009 | Ga0099795_100770092 | 331 |
| 636 | 3300009545 | Ga0105237_10127658 | Ga0105237_101276583 | 331 |
| 637 | 3300013105 | Ga0157369_10043243 | Ga0157369_100432433 | 331 |
| 638 | 3300013105 | Ga0157369_10094270 | Ga0157369_100942702 | 331 |
| 639 | 3300013307 | Ga0157372_10366895 | Ga0157372_103668952 | 331 |
| 640 | 3300025295 | Ga0209564_1011494 | Ga0209564_10114942 | 331 |
| 641 | 3300025914 | Ga0207671_10092379 | Ga0207671_100923792 | 331 |
| 642 | 3300025939 | Ga0207665_10037925 | Ga0207665_100379252 | 331 |
| 643 | 3300025944 | Ga0207661_10042121 | Ga0207661_100421212 | 331 |
| 644 | 3300028577 | Ga0265318_10010234 | Ga0265318_100102343 | 331 |
| 645 | 3300028577 | Ga0265318_10043687 | Ga0265318_100436871 | 331 |
| 646 | 3300031235 | Ga0265330_10014071 | Ga0265330_100140714 | 331 |
| 647 | 3300031235 | Ga0265330_10042865 | Ga0265330_100428652 | 331 |
| 648 | 3300031238 | Ga0265332_10000013 | Ga0265332_10000013110 | 331 |
| 649 | 3300031238 | Ga0265332_10032358 | Ga0265332_100323582 | 331 |
| 650 | 3300031240 | Ga0265320_10017857 | Ga0265320_100178572 | 331 |
| 651 | 3300031240 | Ga0265320_10028123 | Ga0265320_100281233 | 331 |
| 652 | 3300031241 | Ga0265325_10004624 | Ga0265325_100046246 | 331 |
| 653 | 3300031241 | Ga0265325_10106950 | Ga0265325_101069502 | 331 |
| 654 | 3300031247 | Ga0265340_10018160 | Ga0265340_100181602 | 331 |
| 655 | 3300031249 | Ga0265339_10056439 | Ga0265339_100564392 | 331 |
| 656 | 3300031249 | Ga0265339_10105096 | Ga0265339_101050961 | 331 |
| 657 | 3300031250 | Ga0265331_10002514 | Ga0265331_100025144 | 331 |
| 658 | 3300031344 | Ga0265316_10049511 | Ga0265316_100495111 | 331 |
| 659 | 3300031595 | Ga0265313_10000305 | Ga0265313_1000030531 | 331 |
| 660 | 3300031595 | Ga0265313_10023841 | Ga0265313_100238411 | 331 |
| 661 | 3300031711 | Ga0265314_10006855 | Ga0265314_1000685511 | 331 |
| 662 | 3300031711 | Ga0265314_10154517 | Ga0265314_101545171 | 331 |
| 663 | 3300031712 | Ga0265342_10033179 | Ga0265342_100331792 | 331 |
| 664 | 3300035113 | Ga0373936_0033719 | Ga0373936_0033719_941_1948 | 331 |
| 665 | 3300037068 | Ga0373925_0065962 | Ga0373925_0065962_1080_2081 | 331 |
| 666 | 3300037312 | Ga0395899_0002233 | Ga0395899_0002233_4076_5071 | 331 |
| 667 | 3300037312 | Ga0395899_0069985 | Ga0395899_0069985_1036_2031 | 331 |
| 668 | 3300037312 | Ga0395899_0185599 | Ga0395899_0185599_441_1445 | 331 |
| 669 | 3300037418 | Ga0395900_0001351 | Ga0395900_0001351_10850_11845 | 331 |
| 670 | 3300037418 | Ga0395900_0008575 | Ga0395900_0008575_3371_4366 | 331 |
| 671 | 3300037418 | Ga0395900_0087306 | Ga0395900_0087306_306_1301 | 331 |
| 672 | 3300037466 | Ga0395898_0002484 | Ga0395898_0002484_17973_18968 | 331 |
| 673 | 3300037466 | Ga0395898_0035192 | Ga0395898_0035192_2089_3084 | 331 |
| 674 | 3300037466 | Ga0395898_0079851 | Ga0395898_0079851_928_1932 | 331 |
| 675 | 3300037466 | Ga0395898_0109613 | Ga0395898_0109613_468_1463 | 331 |
| 676 | 3300038443 | Ga0395901_0047934 | Ga0395901_0047934_1010_2005 | 331 |
| 677 | 3300038443 | Ga0395901_0055382 | Ga0395901_0055382_1439_2443 | 331 |
| 678 | 3300038443 | Ga0395901_0108548 | Ga0395901_0108548_1681_2685 | 331 |
| 679 | 3300038443 | Ga0395901_0117260 | Ga0395901_0117260_510_1505 | 331 |
| 680 | 3300039437 | Ga0436365_0618633 | Ga0436365_0618633_870_1889 | 331 |
| 681 | 3300041498 | Ga0451841_1016410 | Ga0451841_1016410_364_1377 | 331 |
| 682 | 3300044712 | Ga0453684_0000292 | Ga0453684_0000292_4782_5780 | 331 |
| 683 | 3300044712 | Ga0453684_0011680 | Ga0453684_0011680_9623_10627 | 331 |
| 684 | 3300045051 | Ga0451576_0001449 | Ga0451576_0001449_34556_35560 | 331 |
| 685 | 3300046524 | Ga0495648_0022320 | Ga0495648_0022320_331_1338 | 331 |
| 686 | 3300047317 | Ga0495604_0299833 | Ga0495604_0299833_26_1033 | 331 |
| 687 | 3300047469 | Ga0495673_0000113 | Ga0495673_0000113_107167_108174 | 331 |
| 688 | 3300048904 | Ga0496101_0001016 | Ga0496101_0001016_292_1296 | 331 |
| 689 | 3300048905 | Ga0496102_0004447 | Ga0496102_0004447_6499_7503 | 331 |
| 690 | 3300048906 | Ga0496103_0059292 | Ga0496103_0059292_1276_2280 | 331 |
| 691 | 3300048908 | Ga0496105_0074064 | Ga0496105_0074064_729_1733 | 331 |
| 692 | 3300048910 | Ga0496107_0001492 | Ga0496107_0001492_12575_13579 | 331 |
| 693 | 3300048913 | Ga0496110_0008645 | Ga0496110_0008645_6865_7869 | 331 |
| 694 | 3300048916 | Ga0496113_0149244 | Ga0496113_0149244_283_1287 | 331 |
| 695 | 3300048919 | Ga0496116_0002360 | Ga0496116_0002360_10340_11401 | 331 |
| 696 | 3300048929 | Ga0496126_0050325 | Ga0496126_0050325_242_1303 | 331 |
| 697 | 3300049571 | Ga0501034_0092457 | Ga0501034_0092457_280_1287 | 331 |
| 698 | 3300049586 | Ga0501070_0181203 | Ga0501070_0181203_249_1256 | 331 |
| 699 | 3300049589 | Ga0501073_0075846 | Ga0501073_0075846_353_1360 | 331 |
| 700 | 3300049822 | Ga0501035_0000745 | Ga0501035_0000745_19131_20144 | 331 |
| 701 | 3300050492 | nmdc:mga0yw44_127618_c1 | nmdc:mga0yw44_127618_c1_127_1140 | 331 |
| 702 | 3300050513 | nmdc:mga0rr50_223692_c1 | nmdc:mga0rr50_223692_c1_489_1496 | 331 |
| 703 | 3300050514 | nmdc:mga08x19_191215_c1 | nmdc:mga08x19_191215_c1_230_1237 | 331 |
| 704 | 3300050516 | nmdc:mga0sz30_17656_c2 | nmdc:mga0sz30_17656_c2_527_1540 | 331 |
| 705 | 3300053087 | Ga0500643_000373 | Ga0500643_000373_31028_32035 | 331 |
| 706 | 3300059503 | Ga0587080_008331 | Ga0587080_008331_309_1313 | 331 |
| 707 | 3300059647 | Ga0587079_009696 | Ga0587079_009696_170_1174 | 331 |
| 708 | iso_pu_bacteria | 2602042107 | 2603861254 | 331 |
| 709 | 3300003215 | JGI25153J46596_10013246 | JGI25153J46596_100132463 | 332 |
| 710 | 3300004799 | Ga0058863_11848090 | Ga0058863_118480901 | 332 |
| 711 | 3300005327 | Ga0070658_10001397 | Ga0070658_1000139713 | 332 |
| 712 | 3300005327 | Ga0070658_10030736 | Ga0070658_100307363 | 332 |
| 713 | 3300005327 | Ga0070658_10224419 | Ga0070658_102244192 | 332 |
| 714 | 3300005336 | Ga0070680_100044005 | Ga0070680_1000440052 | 332 |
| 715 | 3300005336 | Ga0070680_100047519 | Ga0070680_1000475192 | 332 |
| 716 | 3300005339 | Ga0070660_100051183 | Ga0070660_1000511831 | 332 |
| 717 | 3300005339 | Ga0070660_100190313 | Ga0070660_1001903132 | 332 |
| 718 | 3300005354 | Ga0070675_100057810 | Ga0070675_1000578101 | 332 |
| 719 | 3300005458 | Ga0070681_10028622 | Ga0070681_100286222 | 332 |
| 720 | 3300005471 | Ga0070698_100167635 | Ga0070698_1001676353 | 332 |
| 721 | 3300005530 | Ga0070679_100002598 | Ga0070679_10000259812 | 332 |
| 722 | 3300005530 | Ga0070679_100122180 | Ga0070679_1001221802 | 332 |
| 723 | 3300005539 | Ga0068853_100059781 | Ga0068853_1000597814 | 332 |
| 724 | 3300005563 | Ga0068855_100007325 | Ga0068855_1000073258 | 332 |
| 725 | 3300005563 | Ga0068855_100029706 | Ga0068855_1000297063 | 332 |
| 726 | 3300005563 | Ga0068855_100068946 | Ga0068855_1000689463 | 332 |
| 727 | 3300005563 | Ga0068855_100137439 | Ga0068855_1001374392 | 332 |
| 728 | 3300005614 | Ga0068856_100166874 | Ga0068856_1001668742 | 332 |
| 729 | 3300005616 | Ga0068852_100105730 | Ga0068852_1001057303 | 332 |
| 730 | 3300005937 | Ga0081455_10000450 | Ga0081455_1000045038 | 332 |
| 731 | 3300009093 | Ga0105240_10032923 | Ga0105240_100329232 | 332 |
| 732 | 3300009093 | Ga0105240_10070916 | Ga0105240_100709163 | 332 |
| 733 | 3300009551 | Ga0105238_10013324 | Ga0105238_100133244 | 332 |
| 734 | 3300009551 | Ga0105238_10049374 | Ga0105238_100493743 | 332 |
| 735 | 3300009551 | Ga0105238_10242801 | Ga0105238_102428012 | 332 |
| 736 | 3300011119 | Ga0105246_10349644 | Ga0105246_103496441 | 332 |
| 737 | 3300013102 | Ga0157371_10074032 | Ga0157371_100740322 | 332 |
| 738 | 3300013105 | Ga0157369_10006619 | Ga0157369_100066194 | 332 |
| 739 | 3300013105 | Ga0157369_10152332 | Ga0157369_101523322 | 332 |
| 740 | 3300013307 | Ga0157372_10001893 | Ga0157372_100018938 | 332 |
| 741 | 3300013307 | Ga0157372_10164772 | Ga0157372_101647723 | 332 |
| 742 | 3300014326 | Ga0157380_10382238 | Ga0157380_103822382 | 332 |
| 743 | 3300021384 | Ga0213876_10035613 | Ga0213876_100356133 | 332 |
| 744 | 3300025297 | Ga0209758_1002512 | Ga0209758_100251221 | 332 |
| 745 | 3300025909 | Ga0207705_10021350 | Ga0207705_100213503 | 332 |
| 746 | 3300025909 | Ga0207705_10043137 | Ga0207705_100431373 | 332 |
| 747 | 3300025909 | Ga0207705_10104844 | Ga0207705_101048442 | 332 |
| 748 | 3300025909 | Ga0207705_10191005 | Ga0207705_101910052 | 332 |
| 749 | 3300025912 | Ga0207707_10017231 | Ga0207707_100172312 | 332 |
| 750 | 3300025912 | Ga0207707_10058004 | Ga0207707_100580042 | 332 |
| 751 | 3300025913 | Ga0207695_10074097 | Ga0207695_100740972 | 332 |
| 752 | 3300025917 | Ga0207660_10036903 | Ga0207660_100369032 | 332 |
| 753 | 3300025917 | Ga0207660_10059590 | Ga0207660_100595903 | 332 |
| 754 | 3300025919 | Ga0207657_10046726 | Ga0207657_100467263 | 332 |
| 755 | 3300025919 | Ga0207657_10156996 | Ga0207657_101569961 | 332 |
| 756 | 3300025919 | Ga0207657_10185556 | Ga0207657_101855563 | 332 |
| 757 | 3300025921 | Ga0207652_10013860 | Ga0207652_100138606 | 332 |
| 758 | 3300025921 | Ga0207652_10023347 | Ga0207652_100233474 | 332 |
| 759 | 3300025921 | Ga0207652_10116685 | Ga0207652_101166853 | 332 |
| 760 | 3300025922 | Ga0207646_10299647 | Ga0207646_102996471 | 332 |
| 761 | 3300025924 | Ga0207694_10043194 | Ga0207694_100431943 | 332 |
| 762 | 3300025924 | Ga0207694_10082785 | Ga0207694_100827852 | 332 |
| 763 | 3300025926 | Ga0207659_10089310 | Ga0207659_100893103 | 332 |
| 764 | 3300025929 | Ga0207664_10117664 | Ga0207664_101176642 | 332 |
| 765 | 3300025929 | Ga0207664_10218074 | Ga0207664_102180742 | 332 |
| 766 | 3300025937 | Ga0207669_10033550 | Ga0207669_100335503 | 332 |
| 767 | 3300025949 | Ga0207667_10045798 | Ga0207667_100457983 | 332 |
| 768 | 3300025949 | Ga0207667_10049144 | Ga0207667_100491442 | 332 |
| 769 | 3300025960 | Ga0207651_10097333 | Ga0207651_100973332 | 332 |
| 770 | 3300026078 | Ga0207702_10171117 | Ga0207702_101711171 | 332 |
| 771 | 3300026116 | Ga0207674_10110344 | Ga0207674_101103442 | 332 |
| 772 | 3300026142 | Ga0207698_10041733 | Ga0207698_100417334 | 332 |
| 773 | 3300026142 | Ga0207698_10084206 | Ga0207698_100842063 | 332 |
| 774 | 3300028800 | Ga0265338_10044273 | Ga0265338_100442733 | 332 |
| 775 | 3300031235 | Ga0265330_10060877 | Ga0265330_100608772 | 332 |
| 776 | 3300031241 | Ga0265325_10002805 | Ga0265325_1000280510 | 332 |
| 777 | 3300031241 | Ga0265325_10011615 | Ga0265325_100116155 | 332 |
| 778 | 3300031249 | Ga0265339_10003040 | Ga0265339_100030402 | 332 |
| 779 | 3300031595 | Ga0265313_10002293 | Ga0265313_100022932 | 332 |
| 780 | 3300031711 | Ga0265314_10032816 | Ga0265314_100328163 | 332 |
| 781 | 3300031712 | Ga0265342_10000715 | Ga0265342_100007157 | 332 |
| 782 | 3300031712 | Ga0265342_10018334 | Ga0265342_100183342 | 332 |
| 783 | 3300035114 | Ga0373939_0001163 | Ga0373939_0001163_3183_4190 | 332 |
| 784 | 3300035692 | Ga0373935_0158254 | Ga0373935_0158254_467_1486 | 332 |
| 785 | 3300035695 | Ga0373927_0000141 | Ga0373927_0000141_40020_41039 | 332 |
| 786 | 3300036401 | Ga0373937_0330528 | Ga0373937_0330528_372_1373 | 332 |
| 787 | 3300037418 | Ga0395900_0011283 | Ga0395900_0011283_7780_8781 | 332 |
| 788 | 3300037418 | Ga0395900_0078540 | Ga0395900_0078540_60_1067 | 332 |
| 789 | 3300037466 | Ga0395898_0026473 | Ga0395898_0026473_447_1448 | 332 |
| 790 | 3300037471 | Ga0395905_0018272 | Ga0395905_0018272_3524_4525 | 332 |
| 791 | 3300038443 | Ga0395901_0027085 | Ga0395901_0027085_1506_2507 | 332 |
| 792 | 3300044842 | Ga0466957_0106405 | Ga0466957_0106405_175_1188 | 332 |
| 793 | 3300046689 | Ga0495613_0071833 | Ga0495613_0071833_1247_2248 | 332 |
| 794 | 3300049571 | Ga0501034_0131283 | Ga0501034_0131283_1343_2344 | 332 |
| 795 | 3300049581 | Ga0501047_0063332 | Ga0501047_0063332_1062_2060 | 332 |
| 796 | 3300049823 | Ga0501044_0064833 | Ga0501044_0064833_1433_2431 | 332 |
| 797 | 3300050513 | nmdc:mga0rr50_367003_c1 | nmdc:mga0rr50_367003_c1_103_1116 | 332 |
| 798 | iso_pu_bacteria | 2891633521 | 2891636311 | 332 |
| 799 | iso_pu_bacteria | 8054002106 | 8054007320 | 332 |
| 800 | 3300001904 | JGI24736J21556_1011548 | JGI24736J21556_10115482 | 333 |
| 801 | 3300001989 | JGI24739J22299_10032889 | JGI24739J22299_100328891 | 333 |
| 802 | 3300003215 | JGI25153J46596_10001194 | JGI25153J46596_1000119415 | 333 |
| 803 | 3300003794 | Ga0055531_10010136 | Ga0055531_100101363 | 333 |
| 804 | 3300004625 | Ga0055543_1001666 | Ga0055543_10016665 | 333 |
| 805 | 3300005262 | Ga0065165_1000747 | Ga0065165_100074736 | 333 |
| 806 | 3300005262 | Ga0065165_1025464 | Ga0065165_10254642 | 333 |
| 807 | 3300005329 | Ga0070683_100012136 | Ga0070683_1000121365 | 333 |
| 808 | 3300005329 | Ga0070683_100032799 | Ga0070683_1000327992 | 333 |
| 809 | 3300005329 | Ga0070683_100181899 | Ga0070683_1001818992 | 333 |
| 810 | 3300005336 | Ga0070680_100010478 | Ga0070680_1000104783 | 333 |
| 811 | 3300005336 | Ga0070680_100053370 | Ga0070680_1000533702 | 333 |
| 812 | 3300005336 | Ga0070680_100089888 | Ga0070680_1000898882 | 333 |
| 813 | 3300005344 | Ga0070661_100296889 | Ga0070661_1002968891 | 333 |
| 814 | 3300005347 | Ga0070668_100108226 | Ga0070668_1001082262 | 333 |
| 815 | 3300005355 | Ga0070671_100013367 | Ga0070671_1000133676 | 333 |
| 816 | 3300005367 | Ga0070667_100260189 | Ga0070667_1002601892 | 333 |
| 817 | 3300005434 | Ga0070709_10133151 | Ga0070709_101331512 | 333 |
| 818 | 3300005435 | Ga0070714_100216521 | Ga0070714_1002165212 | 333 |
| 819 | 3300005436 | Ga0070713_100005837 | Ga0070713_1000058378 | 333 |
| 820 | 3300005439 | Ga0070711_100045043 | Ga0070711_1000450432 | 333 |
| 821 | 3300005457 | Ga0070662_100239491 | Ga0070662_1002394911 | 333 |
| 822 | 3300005458 | Ga0070681_10050528 | Ga0070681_100505283 | 333 |
| 823 | 3300005458 | Ga0070681_10086048 | Ga0070681_100860482 | 333 |
| 824 | 3300005458 | Ga0070681_10200397 | Ga0070681_102003972 | 333 |
| 825 | 3300005530 | Ga0070679_100014503 | Ga0070679_1000145032 | 333 |
| 826 | 3300005530 | Ga0070679_100045886 | Ga0070679_1000458862 | 333 |
| 827 | 3300005530 | Ga0070679_100079343 | Ga0070679_1000793432 | 333 |
| 828 | 3300005530 | Ga0070679_100121730 | Ga0070679_1001217302 | 333 |
| 829 | 3300005535 | Ga0070684_100007833 | Ga0070684_1000078336 | 333 |
| 830 | 3300005535 | Ga0070684_100045711 | Ga0070684_1000457112 | 333 |
| 831 | 3300005535 | Ga0070684_100227807 | Ga0070684_1002278072 | 333 |
| 832 | 3300005535 | Ga0070684_100346413 | Ga0070684_1003464131 | 333 |
| 833 | 3300005539 | Ga0068853_100087383 | Ga0068853_1000873831 | 333 |
| 834 | 3300005539 | Ga0068853_100108425 | Ga0068853_1001084251 | 333 |
| 835 | 3300005539 | Ga0068853_100177834 | Ga0068853_1001778342 | 333 |
| 836 | 3300005548 | Ga0070665_100332707 | Ga0070665_1003327071 | 333 |
| 837 | 3300005563 | Ga0068855_100007560 | Ga0068855_1000075602 | 333 |
| 838 | 3300005563 | Ga0068855_100249395 | Ga0068855_1002493952 | 333 |
| 839 | 3300005577 | Ga0068857_100232158 | Ga0068857_1002321581 | 333 |
| 840 | 3300005614 | Ga0068856_100011621 | Ga0068856_1000116218 | 333 |
| 841 | 3300005614 | Ga0068856_100112906 | Ga0068856_1001129062 | 333 |
| 842 | 3300005618 | Ga0068864_100171265 | Ga0068864_1001712652 | 333 |
| 843 | 3300005842 | Ga0068858_100209764 | Ga0068858_1002097642 | 333 |
| 844 | 3300005843 | Ga0068860_100000360 | Ga0068860_10000036051 | 333 |
| 845 | 3300005983 | Ga0081540_1024723 | Ga0081540_10247233 | 333 |
| 846 | 3300006028 | Ga0070717_10307747 | Ga0070717_103077472 | 333 |
| 847 | 3300006038 | Ga0075365_10093400 | Ga0075365_100934002 | 333 |
| 848 | 3300006042 | Ga0075368_10003442 | Ga0075368_100034423 | 333 |
| 849 | 3300006048 | Ga0075363_100002993 | Ga0075363_1000029931 | 333 |
| 850 | 3300006051 | Ga0075364_10182273 | Ga0075364_101822732 | 333 |
| 851 | 3300006175 | Ga0070712_100083071 | Ga0070712_1000830712 | 333 |
| 852 | 3300006177 | Ga0075362_10094680 | Ga0075362_100946802 | 333 |
| 853 | 3300006178 | Ga0075367_10022359 | Ga0075367_100223592 | 333 |
| 854 | 3300006195 | Ga0075366_10008295 | Ga0075366_100082953 | 333 |
| 855 | 3300006353 | Ga0075370_10098114 | Ga0075370_100981142 | 333 |
| 856 | 3300006358 | Ga0068871_100175008 | Ga0068871_1001750081 | 333 |
| 857 | 3300006941 | Ga0099825_1028499 | Ga0099825_10284992 | 333 |
| 858 | 3300006944 | Ga0099823_1038175 | Ga0099823_10381753 | 333 |
| 859 | 3300009098 | Ga0105245_10109359 | Ga0105245_101093592 | 333 |
| 860 | 3300009101 | Ga0105247_10010254 | Ga0105247_100102542 | 333 |
| 861 | 3300009101 | Ga0105247_10048858 | Ga0105247_100488583 | 333 |
| 862 | 3300009174 | Ga0105241_10012445 | Ga0105241_100124456 | 333 |
| 863 | 3300009545 | Ga0105237_10016707 | Ga0105237_100167072 | 333 |
| 864 | 3300009545 | Ga0105237_10235386 | Ga0105237_102353862 | 333 |
| 865 | 3300009551 | Ga0105238_10013345 | Ga0105238_100133454 | 333 |
| 866 | 3300009551 | Ga0105238_10046828 | Ga0105238_100468282 | 333 |
| 867 | 3300009551 | Ga0105238_10269677 | Ga0105238_102696771 | 333 |
| 868 | 3300010375 | Ga0105239_10090504 | Ga0105239_100905043 | 333 |
| 869 | 3300010375 | Ga0105239_10159097 | Ga0105239_101590972 | 333 |
| 870 | 3300011119 | Ga0105246_10060931 | Ga0105246_100609313 | 333 |
| 871 | 3300013100 | Ga0157373_10049551 | Ga0157373_100495512 | 333 |
| 872 | 3300013100 | Ga0157373_10061305 | Ga0157373_100613053 | 333 |
| 873 | 3300013104 | Ga0157370_10046415 | Ga0157370_100464153 | 333 |
| 874 | 3300013104 | Ga0157370_10116799 | Ga0157370_101167992 | 333 |
| 875 | 3300013105 | Ga0157369_10082359 | Ga0157369_100823594 | 333 |
| 876 | 3300013296 | Ga0157374_10009522 | Ga0157374_100095222 | 333 |
| 877 | 3300013307 | Ga0157372_10166778 | Ga0157372_101667781 | 333 |
| 878 | 3300013307 | Ga0157372_10428619 | Ga0157372_104286191 | 333 |
| 879 | 3300013308 | Ga0157375_10289012 | Ga0157375_102890122 | 333 |
| 880 | 3300020070 | Ga0206356_11709197 | Ga0206356_117091972 | 333 |
| 881 | 3300021358 | Ga0213873_10026320 | Ga0213873_100263201 | 333 |
| 882 | 3300021384 | Ga0213876_10003579 | Ga0213876_100035798 | 333 |
| 883 | 3300021384 | Ga0213876_10032216 | Ga0213876_100322163 | 333 |
| 884 | 3300025254 | Ga0209148_1000479 | Ga0209148_100047925 | 333 |
| 885 | 3300025261 | Ga0209233_1007520 | Ga0209233_10075202 | 333 |
| 886 | 3300025272 | Ga0209455_1000521 | Ga0209455_100052113 | 333 |
| 887 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011517 | 333 |
| 888 | 3300025297 | Ga0209758_1003647 | Ga0209758_10036479 | 333 |
| 889 | 3300025297 | Ga0209758_1005738 | Ga0209758_10057384 | 333 |
| 890 | 3300025299 | Ga0209256_1001013 | Ga0209256_100101320 | 333 |
| 891 | 3300025302 | Ga0207426_1003487 | Ga0207426_10034873 | 333 |
| 892 | 3300025302 | Ga0207426_1027902 | Ga0207426_10279022 | 333 |
| 893 | 3300025304 | Ga0209257_1001101 | Ga0209257_100110129 | 333 |
| 894 | 3300025898 | Ga0207692_10036417 | Ga0207692_100364172 | 333 |
| 895 | 3300025900 | Ga0207710_10055375 | Ga0207710_100553752 | 333 |
| 896 | 3300025904 | Ga0207647_10027761 | Ga0207647_100277612 | 333 |
| 897 | 3300025911 | Ga0207654_10175475 | Ga0207654_101754751 | 333 |
| 898 | 3300025912 | Ga0207707_10000886 | Ga0207707_100008862 | 333 |
| 899 | 3300025912 | Ga0207707_10031180 | Ga0207707_100311805 | 333 |
| 900 | 3300025912 | Ga0207707_10034974 | Ga0207707_100349742 | 333 |
| 901 | 3300025912 | Ga0207707_10036764 | Ga0207707_100367642 | 333 |
| 902 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008982 | 333 |
| 903 | 3300025913 | Ga0207695_10088068 | Ga0207695_100880684 | 333 |
| 904 | 3300025914 | Ga0207671_10046154 | Ga0207671_100461543 | 333 |
| 905 | 3300025914 | Ga0207671_10122549 | Ga0207671_101225492 | 333 |
| 906 | 3300025914 | Ga0207671_10147901 | Ga0207671_101479012 | 333 |
| 907 | 3300025915 | Ga0207693_10040763 | Ga0207693_100407634 | 333 |
| 908 | 3300025915 | Ga0207693_10120033 | Ga0207693_101200332 | 333 |
| 909 | 3300025917 | Ga0207660_10016752 | Ga0207660_100167526 | 333 |
| 910 | 3300025917 | Ga0207660_10148106 | Ga0207660_101481062 | 333 |
| 911 | 3300025917 | Ga0207660_10223862 | Ga0207660_102238622 | 333 |
| 912 | 3300025921 | Ga0207652_10028071 | Ga0207652_100280712 | 333 |
| 913 | 3300025921 | Ga0207652_10057909 | Ga0207652_100579092 | 333 |
| 914 | 3300025923 | Ga0207681_10054661 | Ga0207681_100546612 | 333 |
| 915 | 3300025924 | Ga0207694_10034501 | Ga0207694_100345014 | 333 |
| 916 | 3300025924 | Ga0207694_10125907 | Ga0207694_101259072 | 333 |
| 917 | 3300025927 | Ga0207687_10145014 | Ga0207687_101450142 | 333 |
| 918 | 3300025928 | Ga0207700_10049267 | Ga0207700_100492673 | 333 |
| 919 | 3300025929 | Ga0207664_10115073 | Ga0207664_101150732 | 333 |
| 920 | 3300025933 | Ga0207706_10075564 | Ga0207706_100755641 | 333 |
| 921 | 3300025942 | Ga0207689_10196048 | Ga0207689_101960481 | 333 |
| 922 | 3300025944 | Ga0207661_10002050 | Ga0207661_1000205013 | 333 |
| 923 | 3300025949 | Ga0207667_10075652 | Ga0207667_100756522 | 333 |
| 924 | 3300025949 | Ga0207667_10113009 | Ga0207667_101130092 | 333 |
| 925 | 3300025949 | Ga0207667_10129253 | Ga0207667_101292532 | 333 |
| 926 | 3300025949 | Ga0207667_10189378 | Ga0207667_101893781 | 333 |
| 927 | 3300025981 | Ga0207640_10299357 | Ga0207640_102993571 | 333 |
| 928 | 3300025986 | Ga0207658_10089254 | Ga0207658_100892542 | 333 |
| 929 | 3300026035 | Ga0207703_10063992 | Ga0207703_100639922 | 333 |
| 930 | 3300026041 | Ga0207639_10251065 | Ga0207639_102510652 | 333 |
| 931 | 3300026067 | Ga0207678_10040509 | Ga0207678_100405093 | 333 |
| 932 | 3300026078 | Ga0207702_10115161 | Ga0207702_101151613 | 333 |
| 933 | 3300026089 | Ga0207648_10190549 | Ga0207648_101905492 | 333 |
| 934 | 3300026121 | Ga0207683_10030306 | Ga0207683_100303065 | 333 |
| 935 | 3300026142 | Ga0207698_10097884 | Ga0207698_100978842 | 333 |
| 936 | 3300027296 | Ga0209389_1000043 | Ga0209389_10000434 | 333 |
| 937 | 3300027296 | Ga0209389_1000077 | Ga0209389_100007770 | 333 |
| 938 | 3300027357 | Ga0209589_1000047 | Ga0209589_1000047107 | 333 |
| 939 | 3300027361 | Ga0209489_100075 | Ga0209489_100075139 | 333 |
| 940 | 3300027361 | Ga0209489_100251 | Ga0209489_10025170 | 333 |
| 941 | 3300027363 | Ga0209700_100271 | Ga0209700_10027170 | 333 |
| 942 | 3300028379 | Ga0268266_10077358 | Ga0268266_100773582 | 333 |
| 943 | 3300028381 | Ga0268264_10000030 | Ga0268264_10000030232 | 333 |
| 944 | 3300028800 | Ga0265338_10158511 | Ga0265338_101585112 | 333 |
| 945 | 3300030521 | Ga0307511_10097154 | Ga0307511_100971542 | 333 |
| 946 | 3300031241 | Ga0265325_10115173 | Ga0265325_101151732 | 333 |
| 947 | 3300031250 | Ga0265331_10053030 | Ga0265331_100530302 | 333 |
| 948 | 3300031507 | Ga0307509_10084524 | Ga0307509_100845241 | 333 |
| 949 | 3300031507 | Ga0307509_10161525 | Ga0307509_101615252 | 333 |
| 950 | 3300031507 | Ga0307509_10274924 | Ga0307509_102749242 | 333 |
| 951 | 3300031616 | Ga0307508_10003532 | Ga0307508_1000353214 | 333 |
| 952 | 3300031616 | Ga0307508_10076958 | Ga0307508_100769582 | 333 |
| 953 | 3300031616 | Ga0307508_10243830 | Ga0307508_102438301 | 333 |
| 954 | 3300031730 | Ga0307516_10018252 | Ga0307516_100182526 | 333 |
| 955 | 3300033179 | Ga0307507_10026861 | Ga0307507_100268612 | 333 |
| 956 | 3300033180 | Ga0307510_10017164 | Ga0307510_100171648 | 333 |
| 957 | 3300035113 | Ga0373936_0007226 | Ga0373936_0007226_1306_2307 | 333 |
| 958 | 3300035118 | Ga0373954_0014590 | Ga0373954_0014590_1914_2915 | 333 |
| 959 | 3300035118 | Ga0373954_0085911 | Ga0373954_0085911_119_1180 | 333 |
| 960 | 3300035172 | Ga0373955_0002561 | Ga0373955_0002561_126_1127 | 333 |
| 961 | 3300035724 | Ga0373933_0001848 | Ga0373933_0001848_666_1667 | 333 |
| 962 | 3300035724 | Ga0373933_0018022 | Ga0373933_0018022_206_1207 | 333 |
| 963 | 3300035725 | Ga0373947_0106219 | Ga0373947_0106219_597_1598 | 333 |
| 964 | 3300036401 | Ga0373937_0060512 | Ga0373937_0060512_2017_3087 | 333 |
| 965 | 3300037068 | Ga0373925_0052049 | Ga0373925_0052049_307_1308 | 333 |
| 966 | 3300037466 | Ga0395898_0051684 | Ga0395898_0051684_1237_2238 | 333 |
| 967 | 3300037466 | Ga0395898_0211320 | Ga0395898_0211320_17_1018 | 333 |
| 968 | 3300037471 | Ga0395905_0002041 | Ga0395905_0002041_15520_16530 | 333 |
| 969 | 3300037471 | Ga0395905_0016323 | Ga0395905_0016323_1727_2728 | 333 |
| 970 | 3300038443 | Ga0395901_0035187 | Ga0395901_0035187_992_1993 | 333 |
| 971 | 3300038443 | Ga0395901_0135936 | Ga0395901_0135936_345_1346 | 333 |
| 972 | 3300039437 | Ga0436365_1104948 | Ga0436365_1104948_1009_2019 | 333 |
| 973 | 3300039437 | Ga0436365_1236739 | Ga0436365_1236739_25908_26909 | 333 |
| 974 | 3300039453 | Ga0436362_0548217 | Ga0436362_0548217_285_1286 | 333 |
| 975 | 3300044658 | Ga0466972_0024879 | Ga0466972_0024879_260_1261 | 333 |
| 976 | 3300044673 | Ga0453683_0092249 | Ga0453683_0092249_461_1486 | 333 |
| 977 | 3300044693 | Ga0466961_0033127 | Ga0466961_0033127_355_1356 | 333 |
| 978 | 3300044694 | Ga0466963_0042278 | Ga0466963_0042278_1777_2778 | 333 |
| 979 | 3300044706 | Ga0466964_0011528 | Ga0466964_0011528_1984_2985 | 333 |
| 980 | 3300044706 | Ga0466964_0057426 | Ga0466964_0057426_220_1221 | 333 |
| 981 | 3300044719 | Ga0466971_0130019 | Ga0466971_0130019_118_1119 | 333 |
| 982 | 3300044765 | Ga0466970_0095902 | Ga0466970_0095902_156_1157 | 333 |
| 983 | 3300044842 | Ga0466957_0058332 | Ga0466957_0058332_866_1867 | 333 |
| 984 | 3300045049 | Ga0466959_0035355 | Ga0466959_0035355_1037_2038 | 333 |
| 985 | 3300045976 | Ga0466967_0043874 | Ga0466967_0043874_261_1310 | 333 |
| 986 | 3300046459 | Ga0495629_0007325 | Ga0495629_0007325_1839_2852 | 333 |
| 987 | 3300046459 | Ga0495629_0274045 | Ga0495629_0274045_104_1105 | 333 |
| 988 | 3300046462 | Ga0495651_0031133 | Ga0495651_0031133_599_1612 | 333 |
| 989 | 3300046462 | Ga0495651_0056071 | Ga0495651_0056071_1926_2939 | 333 |
| 990 | 3300046462 | Ga0495651_0296275 | Ga0495651_0296275_14_1015 | 333 |
| 991 | 3300046473 | Ga0495582_0016731 | Ga0495582_0016731_2142_3143 | 333 |
| 992 | 3300046475 | Ga0495639_0017874 | Ga0495639_0017874_196_1266 | 333 |
| 993 | 3300046477 | Ga0495664_0095802 | Ga0495664_0095802_230_1300 | 333 |
| 994 | 3300046522 | Ga0495643_0034612 | Ga0495643_0034612_183_1184 | 333 |
| 995 | 3300046529 | Ga0495652_0006590 | Ga0495652_0006590_2942_3955 | 333 |
| 996 | 3300046529 | Ga0495652_0061540 | Ga0495652_0061540_1041_2054 | 333 |
| 997 | 3300046531 | Ga0495665_0016281 | Ga0495665_0016281_248_1249 | 333 |
| 998 | 3300046533 | Ga0495640_0012394 | Ga0495640_0012394_635_1648 | 333 |
| 999 | 3300046533 | Ga0495640_0030787 | Ga0495640_0030787_389_1459 | 333 |
| 1000 | 3300046536 | Ga0495587_0015923 | Ga0495587_0015923_558_1571 | 333 |
| 1001 | 3300046543 | Ga0495645_0021817 | Ga0495645_0021817_2917_3987 | 333 |
| 1002 | 3300046543 | Ga0495645_0070850 | Ga0495645_0070850_66_1067 | 333 |
| 1003 | 3300046559 | Ga0495667_0043103 | Ga0495667_0043103_1803_2816 | 333 |
| 1004 | 3300046663 | Ga0495635_0002472 | Ga0495635_0002472_3680_4693 | 333 |
| 1005 | 3300046663 | Ga0495635_0084575 | Ga0495635_0084575_807_1820 | 333 |
| 1006 | 3300046675 | Ga0495657_0004748 | Ga0495657_0004748_9755_10768 | 333 |
| 1007 | 3300046675 | Ga0495657_0069693 | Ga0495657_0069693_677_1690 | 333 |
| 1008 | 3300046680 | Ga0495646_0111074 | Ga0495646_0111074_368_1381 | 333 |
| 1009 | 3300046690 | Ga0495624_0061057 | Ga0495624_0061057_162_1175 | 333 |
| 1010 | 3300046809 | Ga0495600_0002308 | Ga0495600_0002308_2214_3227 | 333 |
| 1011 | 3300046809 | Ga0495600_0113001 | Ga0495600_0113001_117_1130 | 333 |
| 1012 | 3300047315 | Ga0495581_0014176 | Ga0495581_0014176_1326_2327 | 333 |
| 1013 | 3300047319 | Ga0495674_0003767 | Ga0495674_0003767_12190_13203 | 333 |
| 1014 | 3300047319 | Ga0495674_0377995 | Ga0495674_0377995_90_1091 | 333 |
| 1015 | 3300047321 | Ga0495676_0031801 | Ga0495676_0031801_2421_3434 | 333 |
| 1016 | 3300047322 | Ga0495680_0056162 | Ga0495680_0056162_544_1557 | 333 |
| 1017 | 3300047323 | Ga0495683_0080842 | Ga0495683_0080842_493_1494 | 333 |
| 1018 | 3300047443 | Ga0495687_030848 | Ga0495687_030848_107_1108 | 333 |
| 1019 | 3300047444 | Ga0495675_0106181 | Ga0495675_0106181_181_1182 | 333 |
| 1020 | 3300047471 | Ga0495684_0114191 | Ga0495684_0114191_286_1287 | 333 |
| 1021 | 3300048088 | Ga0495602_0068401 | Ga0495602_0068401_771_1784 | 333 |
| 1022 | 3300048088 | Ga0495602_0131981 | Ga0495602_0131981_521_1534 | 333 |
| 1023 | 3300048089 | Ga0495614_0026037 | Ga0495614_0026037_1318_2331 | 333 |
| 1024 | 3300048905 | Ga0496102_0049974 | Ga0496102_0049974_1838_2839 | 333 |
| 1025 | 3300048907 | Ga0496104_0004370 | Ga0496104_0004370_3623_4636 | 333 |
| 1026 | 3300048907 | Ga0496104_0110925 | Ga0496104_0110925_396_1397 | 333 |
| 1027 | 3300048908 | Ga0496105_0025293 | Ga0496105_0025293_3405_4418 | 333 |
| 1028 | 3300048909 | Ga0496106_0005519 | Ga0496106_0005519_778_1785 | 333 |
| 1029 | 3300048911 | Ga0496108_0130245 | Ga0496108_0130245_611_1612 | 333 |
| 1030 | 3300048913 | Ga0496110_0056671 | Ga0496110_0056671_1687_2688 | 333 |
| 1031 | 3300048915 | Ga0496112_0080592 | Ga0496112_0080592_1683_2684 | 333 |
| 1032 | 3300048915 | Ga0496112_0086125 | Ga0496112_0086125_2008_3009 | 333 |
| 1033 | 3300048915 | Ga0496112_0180517 | Ga0496112_0180517_32_1033 | 333 |
| 1034 | 3300048915 | Ga0496112_0533079 | Ga0496112_0533079_64_1065 | 333 |
| 1035 | 3300048916 | Ga0496113_0042756 | Ga0496113_0042756_1253_2254 | 333 |
| 1036 | 3300048917 | Ga0496114_0105331 | Ga0496114_0105331_667_1668 | 333 |
| 1037 | 3300048919 | Ga0496116_0022844 | Ga0496116_0022844_1939_2940 | 333 |
| 1038 | 3300048920 | Ga0496117_0061358 | Ga0496117_0061358_753_1760 | 333 |
| 1039 | 3300048921 | Ga0496118_0006235 | Ga0496118_0006235_3747_4754 | 333 |
| 1040 | 3300048924 | Ga0496121_0002635 | Ga0496121_0002635_6272_7279 | 333 |
| 1041 | 3300048924 | Ga0496121_0041335 | Ga0496121_0041335_1088_2089 | 333 |
| 1042 | 3300048927 | Ga0496124_0004890 | Ga0496124_0004890_6482_7489 | 333 |
| 1043 | 3300048928 | Ga0496125_0125366 | Ga0496125_0125366_617_1618 | 333 |
| 1044 | 3300048929 | Ga0496126_0002122 | Ga0496126_0002122_13573_14580 | 333 |
| 1045 | 3300048929 | Ga0496126_0085299 | Ga0496126_0085299_200_1201 | 333 |
| 1046 | 3300048929 | Ga0496126_0117772 | Ga0496126_0117772_815_1822 | 333 |
| 1047 | 3300049568 | Ga0501031_0002180 | Ga0501031_0002180_6897_7898 | 333 |
| 1048 | 3300049568 | Ga0501031_0042522 | Ga0501031_0042522_431_1459 | 333 |
| 1049 | 3300049569 | Ga0501032_0000136 | Ga0501032_0000136_29089_30090 | 333 |
| 1050 | 3300049569 | Ga0501032_0041631 | Ga0501032_0041631_1711_2739 | 333 |
| 1051 | 3300049570 | Ga0501033_0000202 | Ga0501033_0000202_46661_47662 | 333 |
| 1052 | 3300049571 | Ga0501034_0000113 | Ga0501034_0000113_93611_94612 | 333 |
| 1053 | 3300049571 | Ga0501034_0000593 | Ga0501034_0000593_15671_16678 | 333 |
| 1054 | 3300049571 | Ga0501034_0013580 | Ga0501034_0013580_1854_2882 | 333 |
| 1055 | 3300049572 | Ga0501036_0000059 | Ga0501036_0000059_61899_62900 | 333 |
| 1056 | 3300049572 | Ga0501036_0001313 | Ga0501036_0001313_1514_2542 | 333 |
| 1057 | 3300049573 | Ga0501037_0000214 | Ga0501037_0000214_10410_11411 | 333 |
| 1058 | 3300049573 | Ga0501037_0010535 | Ga0501037_0010535_2589_3617 | 333 |
| 1059 | 3300049573 | Ga0501037_0012851 | Ga0501037_0012851_2055_3083 | 333 |
| 1060 | 3300049573 | Ga0501037_0073626 | Ga0501037_0073626_367_1395 | 333 |
| 1061 | 3300049574 | Ga0501038_0002810 | Ga0501038_0002810_1796_2797 | 333 |
| 1062 | 3300049574 | Ga0501038_0008716 | Ga0501038_0008716_5471_6499 | 333 |
| 1063 | 3300049575 | Ga0501039_0001981 | Ga0501039_0001981_3173_4174 | 333 |
| 1064 | 3300049579 | Ga0501043_0000017 | Ga0501043_0000017_2531_3532 | 333 |
| 1065 | 3300049579 | Ga0501043_0005751 | Ga0501043_0005751_3677_4705 | 333 |
| 1066 | 3300049580 | Ga0501046_0000174 | Ga0501046_0000174_33656_34657 | 333 |
| 1067 | 3300049580 | Ga0501046_0015465 | Ga0501046_0015465_4073_5101 | 333 |
| 1068 | 3300049580 | Ga0501046_0050186 | Ga0501046_0050186_154_1155 | 333 |
| 1069 | 3300049580 | Ga0501046_0109760 | Ga0501046_0109760_513_1541 | 333 |
| 1070 | 3300049581 | Ga0501047_0000044 | Ga0501047_0000044_158642_159643 | 333 |
| 1071 | 3300049581 | Ga0501047_0010766 | Ga0501047_0010766_4623_5651 | 333 |
| 1072 | 3300049581 | Ga0501047_0010806 | Ga0501047_0010806_6497_7498 | 333 |
| 1073 | 3300049581 | Ga0501047_0019566 | Ga0501047_0019566_2367_3395 | 333 |
| 1074 | 3300049581 | Ga0501047_0071784 | Ga0501047_0071784_1612_2640 | 333 |
| 1075 | 3300049582 | Ga0501048_0000837 | Ga0501048_0000837_11208_12209 | 333 |
| 1076 | 3300049582 | Ga0501048_0028437 | Ga0501048_0028437_2432_3460 | 333 |
| 1077 | 3300049583 | Ga0501067_0011413 | Ga0501067_0011413_3872_4873 | 333 |
| 1078 | 3300049583 | Ga0501067_0088303 | Ga0501067_0088303_549_1577 | 333 |
| 1079 | 3300049584 | Ga0501068_0000089 | Ga0501068_0000089_37293_38294 | 333 |
| 1080 | 3300049584 | Ga0501068_0063885 | Ga0501068_0063885_366_1394 | 333 |
| 1081 | 3300049585 | Ga0501069_0005200 | Ga0501069_0005200_5402_6403 | 333 |
| 1082 | 3300049586 | Ga0501070_0050654 | Ga0501070_0050654_1191_2219 | 333 |
| 1083 | 3300049586 | Ga0501070_0059105 | Ga0501070_0059105_560_1561 | 333 |
| 1084 | 3300049587 | Ga0501071_0011718 | Ga0501071_0011718_2209_3237 | 333 |
| 1085 | 3300049587 | Ga0501071_0069084 | Ga0501071_0069084_937_1938 | 333 |
| 1086 | 3300049589 | Ga0501073_0000069 | Ga0501073_0000069_20779_21780 | 333 |
| 1087 | 3300049589 | Ga0501073_0018987 | Ga0501073_0018987_556_1557 | 333 |
| 1088 | 3300049589 | Ga0501073_0110966 | Ga0501073_0110966_159_1187 | 333 |
| 1089 | 3300049590 | Ga0501074_0000346 | Ga0501074_0000346_367_1368 | 333 |
| 1090 | 3300049590 | Ga0501074_0009969 | Ga0501074_0009969_2213_3241 | 333 |
| 1091 | 3300049590 | Ga0501074_0085552 | Ga0501074_0085552_847_1875 | 333 |
| 1092 | 3300049590 | Ga0501074_0132433 | Ga0501074_0132433_689_1690 | 333 |
| 1093 | 3300049592 | Ga0501076_0102608 | Ga0501076_0102608_960_1988 | 333 |
| 1094 | 3300049741 | Ga0501079_0026163 | Ga0501079_0026163_367_1368 | 333 |
| 1095 | 3300049741 | Ga0501079_0108196 | Ga0501079_0108196_417_1445 | 333 |
| 1096 | 3300049742 | Ga0501080_0000613 | Ga0501080_0000613_13931_14932 | 333 |
| 1097 | 3300049742 | Ga0501080_0000953 | Ga0501080_0000953_4982_6010 | 333 |
| 1098 | 3300049742 | Ga0501080_0027894 | Ga0501080_0027894_3046_4074 | 333 |
| 1099 | 3300049742 | Ga0501080_0076034 | Ga0501080_0076034_775_1776 | 333 |
| 1100 | 3300049742 | Ga0501080_0309967 | Ga0501080_0309967_23_1051 | 333 |
| 1101 | 3300049743 | Ga0501081_0136884 | Ga0501081_0136884_465_1493 | 333 |
| 1102 | 3300049744 | Ga0501083_0000838 | Ga0501083_0000838_10716_11717 | 333 |
| 1103 | 3300049744 | Ga0501083_0026475 | Ga0501083_0026475_1317_2345 | 333 |
| 1104 | 3300049822 | Ga0501035_0000393 | Ga0501035_0000393_14503_15504 | 333 |
| 1105 | 3300049822 | Ga0501035_0020964 | Ga0501035_0020964_4132_5160 | 333 |
| 1106 | 3300049822 | Ga0501035_0227837 | Ga0501035_0227837_507_1535 | 333 |
| 1107 | 3300049823 | Ga0501044_0000108 | Ga0501044_0000108_91863_92864 | 333 |
| 1108 | 3300049823 | Ga0501044_0011892 | Ga0501044_0011892_380_1408 | 333 |
| 1109 | 3300049823 | Ga0501044_0016146 | Ga0501044_0016146_3953_4981 | 333 |
| 1110 | 3300050494 | nmdc:mga06z11_63156_c1 | nmdc:mga06z11_63156_c1_365_1366 | 333 |
| 1111 | 3300050516 | nmdc:mga0sz30_28204_c1 | nmdc:mga0sz30_28204_c1_221_1222 | 333 |
| 1112 | 3300053077 | Ga0495601_0111816 | Ga0495601_0111816_643_1713 | 333 |
| 1113 | 3300053085 | Ga0495619_0025149 | Ga0495619_0025149_162_1163 | 333 |
| 1114 | 3300053086 | Ga0500578_0031052 | Ga0500578_0031052_603_1616 | 333 |
| 1115 | 3300053087 | Ga0500643_001348 | Ga0500643_001348_6362_7417 | 333 |
| 1116 | 3300053092 | Ga0500583_0014047 | Ga0500583_0014047_71_1084 | 333 |
| 1117 | 3300053103 | Ga0500555_008923 | Ga0500555_008923_1760_2773 | 333 |
| 1118 | 3300053119 | Ga0500595_012280 | Ga0500595_012280_1032_2039 | 333 |
| 1119 | 3300053130 | Ga0500642_0000127 | Ga0500642_0000127_1464_2477 | 333 |
| 1120 | 3300053130 | Ga0500642_0003598 | Ga0500642_0003598_1121_2134 | 333 |
| 1121 | 3300053136 | Ga0500559_0028093 | Ga0500559_0028093_163_1176 | 333 |
| 1122 | 3300053139 | Ga0500568_0003938 | Ga0500568_0003938_5168_6181 | 333 |
| 1123 | 3300053140 | Ga0500573_0161222 | Ga0500573_0161222_42_1049 | 333 |
| 1124 | 3300053142 | Ga0500577_0057053 | Ga0500577_0057053_11_1024 | 333 |
| 1125 | 3300053147 | Ga0500589_114894 | Ga0500589_114894_91_1104 | 333 |
| 1126 | 3300053156 | Ga0500622_0008706 | Ga0500622_0008706_335_1336 | 333 |
| 1127 | 3300053177 | Ga0500636_0123011 | Ga0500636_0123011_150_1157 | 333 |
| 1128 | 3300053178 | Ga0500637_0085061 | Ga0500637_0085061_143_1150 | 333 |
| 1129 | 3300053736 | Ga0500599_008093 | Ga0500599_008093_73_1074 | 333 |
| 1130 | 3300053737 | Ga0500601_001110 | Ga0500601_001110_1978_2991 | 333 |
| 1131 | 3300054114 | Ga0501084_0044602 | Ga0501084_0044602_1453_2454 | 333 |
| 1132 | 3300055283 | Ga0500661_010631 | Ga0500661_010631_581_1594 | 333 |
| 1133 | 3300059506 | Ga0587085_012784 | Ga0587085_012784_75_1076 | 333 |
| 1134 | 3300059643 | Ga0587072_008134 | Ga0587072_008134_574_1575 | 333 |
| 1135 | 3300061719 | Ga0466962_0042722 | Ga0466962_0042722_694_1695 | 333 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4o7m-assembly3.cif.gz_C | crystal structure of a trap periplasmic solute binding protein from shewanella loihica pv-4, target efi-510273, with bound l-malate | 0.9772 | 24 | 307 |
| 4o7m-assembly3.cif.gz_C | crystal structure of a trap periplasmic solute binding protein from shewanella loihica pv-4, target efi-510273, with bound l-malate | 0.9738 | 24 | 307 |
| 4mx6-assembly1.cif.gz_A | crystal structure of a trap periplasmic solute binding protein from shewanella oneidensis (so_3134), target efi-510275, with bound succinate | 0.9646 | 24 | 328 |
| 4oa4-assembly4.cif.gz_D | crystal structure of a trap periplasmic solute binding protein from shewanella loihica pv-4 (shew_1446), target efi-510273, with bound succinate | 0.9639 | 25 | 327 |
| 4nf0-assembly7.cif.gz_G | crystal structure of a trap periplasmic solute binding protein from pseudomonas aeruginosa pao1 (pa4616), target efi-510182, with bound l-malate | 0.9592 | 25 | 310 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4nf0G00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9592 | 25 | 310 | 3.40.190.170 |
| 4oa4B00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9592 | 24 | 328 | 3.40.190.170 |
| 4oa4B00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9529 | 24 | 328 | 3.40.190.170 |
| 4nf0G00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9496 | 25 | 310 | 3.40.190.170 |
| 4xeqD00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9388 | 27 | 327 | 3.40.190.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F4Q9L9-F1-model_v4 | C4-dicarboxylate ABC transporter | 0.9682 | 15 | 324 |
GO:0030288
GO:0055085 |
| AF-A0A1F4QAW1-F1-model_v4 | C4-dicarboxylate ABC transporter substrate-binding protein | 0.9576 | 15 | 329 |
GO:0030288
GO:0055085 |
| AF-A0A101LL59-F1-model_v4 | C4-dicarboxylate ABC transporter | 0.9565 | 15 | 327 |
GO:0015740
GO:0030288 GO:0055085 |
| AF-A0A061N675-F1-model_v4 | TRAP-type C4-dicarboxylate transport system, periplasmic component | 0.9562 | 21 | 324 |
GO:0030288
GO:0055085 |
| AF-A0A0A1HT62-F1-model_v4 | TRAP-type C4-dicarboxylate transport system,periplasmic component | 0.9561 | 15 | 331 |
GO:0015740
GO:0030288 GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar