F490594
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1134 | 404 | 2268 | 196 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10000079|Ga0157372_100000799 |
| Length | 230 |
| Sequence | VSIEWAASAAGGRARSESGDERSREEPGEFVSRTGRIERQTAETKVLVAIDLDGSGRTDVDTGVGFFDHMLTSFGKHGLFDLTVAVEGDLHIDAHHSVEDAAIALGQAFAEAVGDKAGLRRFGDAMIPMDEALVVAAVDLSGRPYLVHTEPDGAPPYLLGRDVPYATTLTRHVFESFTQHARLALHVTVQAGRDWHHITEAQYKAVARALRAACEPDPRQSGVPSTKGVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 112 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 113 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 136 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 137 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 138 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 140 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 207 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 211 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 215 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 216 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 217 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 218 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 219 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 222 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 223 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 224 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 228 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 229 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 230 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 231 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 232 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 233 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 234 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 235 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 236 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 237 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 238 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 244 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 246 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 247 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 250 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 253 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 254 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 256 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 259 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 260 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 261 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 264 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 265 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 266 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 268 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 269 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 271 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 272 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 273 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 274 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 275 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 276 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 277 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 278 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 279 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 280 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 281 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 282 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 283 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 284 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 285 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 286 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 287 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 288 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 289 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 290 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 291 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 292 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 293 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 294 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 295 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 296 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 297 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 298 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 299 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 300 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 301 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 350 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 351 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 352 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 353 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 354 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 355 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 358 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 359 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 360 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 361 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 362 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 363 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 364 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 365 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 366 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 367 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 389 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 399 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 400 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 401 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 402 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 403 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 404 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.44 |
| Metatranscriptomes | 2.2 |
| Isolates | 0.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.26 |
| Nodule | 0.35 |
| Rhizoplane | 4.76 |
| Rhizosphere | 91.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157372_10000079 | 3300013307 | Bacteria | 100687 |
| 2 | JGI24752J21851_1006611 | 3300001976 | Bacteria | 1516 |
| 3 | JGI24740J21852_10041227 | 3300001979 | Bacteria | 1393 |
| 4 | JGI24735J21928_10016508 | 3300002067 | Bacteria | 2289 |
| 5 | JGI24735J21928_10060750 | 3300002067 | Bacteria | 1086 |
| 6 | JGI24735J21928_10130548 | 3300002067 | Bacteria | 724 |
| 7 | JGI24738J21930_10030090 | 3300002075 | Bacteria | 1109 |
| 8 | JGI24751J29686_10026360 | 3300002459 | Bacteria | 1206 |
| 9 | JGI25404J52841_10001653 | 3300003659 | Bacteria | 4000 |
| 10 | JGI25405J52794_10071817 | 3300003911 | Bacteria | 755 |
| 11 | Ga0070658_10000487 | 3300005327 | Bacteria | 34469 |
| 12 | Ga0070658_10028327 | 3300005327 | Bacteria | 4496 |
| 13 | Ga0070658_10114212 | 3300005327 | Bacteria | 2239 |
| 14 | Ga0070658_10133914 | 3300005327 | Bacteria | 2067 |
| 15 | Ga0070658_10532635 | 3300005327 | Bacteria | 1016 |
| 16 | Ga0070683_100011055 | 3300005329 | Bacteria | 7781 |
| 17 | Ga0070683_100059197 | 3300005329 | Bacteria | 3558 |
| 18 | Ga0070690_100223130 | 3300005330 | Bacteria | 1321 |
| 19 | Ga0070670_100090582 | 3300005331 | Bacteria | 2628 |
| 20 | Ga0070670_101208269 | 3300005331 | Bacteria | 691 |
| 21 | Ga0068869_100008036 | 3300005334 | Bacteria | 6776 |
| 22 | Ga0070666_10014264 | 3300005335 | Bacteria | 5058 |
| 23 | Ga0070666_10288133 | 3300005335 | Bacteria | 1168 |
| 24 | Ga0070666_10330473 | 3300005335 | Bacteria | 1088 |
| 25 | Ga0070680_100001431 | 3300005336 | Bacteria | 17274 |
| 26 | Ga0070680_100044515 | 3300005336 | Bacteria | 3606 |
| 27 | Ga0070680_100044868 | 3300005336 | Bacteria | 3592 |
| 28 | Ga0070680_100091216 | 3300005336 | Bacteria | 2522 |
| 29 | Ga0070682_100015871 | 3300005337 | Bacteria | 4372 |
| 30 | Ga0070682_100035284 | 3300005337 | Bacteria | 3052 |
| 31 | Ga0068868_100036194 | 3300005338 | Bacteria | 3819 |
| 32 | Ga0070660_100037332 | 3300005339 | Bacteria | 3683 |
| 33 | Ga0070660_100059907 | 3300005339 | Bacteria | 2953 |
| 34 | Ga0070660_100122987 | 3300005339 | Bacteria | 2072 |
| 35 | Ga0070660_100204200 | 3300005339 | Bacteria | 1603 |
| 36 | Ga0070660_100286244 | 3300005339 | Bacteria | 1349 |
| 37 | Ga0070660_100307793 | 3300005339 | Bacteria | 1300 |
| 38 | Ga0070660_100477491 | 3300005339 | Bacteria | 1036 |
| 39 | Ga0070689_100170343 | 3300005340 | Bacteria | 1764 |
| 40 | Ga0070689_100222819 | 3300005340 | Bacteria | 1548 |
| 41 | Ga0070691_10038273 | 3300005341 | Bacteria | 2264 |
| 42 | Ga0070687_100013219 | 3300005343 | Bacteria | 3671 |
| 43 | Ga0070661_100078528 | 3300005344 | Bacteria | 2435 |
| 44 | Ga0070661_100126123 | 3300005344 | Bacteria | 1920 |
| 45 | Ga0070692_10016924 | 3300005345 | Bacteria | 3475 |
| 46 | Ga0070669_100064695 | 3300005353 | Bacteria | 2694 |
| 47 | Ga0070669_100496605 | 3300005353 | Bacteria | 1012 |
| 48 | Ga0070675_100027728 | 3300005354 | Bacteria | 4554 |
| 49 | Ga0070675_100058546 | 3300005354 | Bacteria | 3178 |
| 50 | Ga0070671_100105064 | 3300005355 | Bacteria | 2370 |
| 51 | Ga0070671_100655653 | 3300005355 | Bacteria | 909 |
| 52 | Ga0070674_100709616 | 3300005356 | Bacteria | 860 |
| 53 | Ga0070673_100014767 | 3300005364 | Bacteria | 5458 |
| 54 | Ga0070673_100176885 | 3300005364 | Bacteria | 1824 |
| 55 | Ga0070688_100051412 | 3300005365 | Bacteria | 2571 |
| 56 | Ga0070659_100018870 | 3300005366 | Bacteria | 5210 |
| 57 | Ga0070659_100060032 | 3300005366 | Bacteria | 3003 |
| 58 | Ga0070659_100282308 | 3300005366 | Bacteria | 1381 |
| 59 | Ga0070667_100010113 | 3300005367 | Bacteria | 7805 |
| 60 | Ga0070667_100174356 | 3300005367 | Bacteria | 1900 |
| 61 | Ga0070667_100507605 | 3300005367 | Bacteria | 1106 |
| 62 | Ga0070709_10000736 | 3300005434 | Bacteria | 18505 |
| 63 | Ga0070709_10017800 | 3300005434 | Bacteria | 4083 |
| 64 | Ga0070709_10018247 | 3300005434 | Bacteria | 4037 |
| 65 | Ga0070709_10032043 | 3300005434 | Bacteria | 3167 |
| 66 | Ga0070709_10049966 | 3300005434 | Bacteria | 2617 |
| 67 | Ga0070709_10054344 | 3300005434 | Bacteria | 2524 |
| 68 | Ga0070709_10163538 | 3300005434 | Bacteria | 1549 |
| 69 | Ga0070709_10264710 | 3300005434 | Bacteria | 1243 |
| 70 | Ga0070709_10341849 | 3300005434 | Bacteria | 1103 |
| 71 | Ga0070714_100000077 | 3300005435 | Bacteria | 84205 |
| 72 | Ga0070714_100002661 | 3300005435 | Bacteria | 13164 |
| 73 | Ga0070714_100015129 | 3300005435 | Bacteria | 6203 |
| 74 | Ga0070714_100042187 | 3300005435 | Bacteria | 3853 |
| 75 | Ga0070714_100063180 | 3300005435 | Bacteria | 3183 |
| 76 | Ga0070714_100063595 | 3300005435 | Bacteria | 3174 |
| 77 | Ga0070714_100082211 | 3300005435 | Bacteria | 2806 |
| 78 | Ga0070714_100147849 | 3300005435 | Bacteria | 2115 |
| 79 | Ga0070714_100690399 | 3300005435 | Bacteria | 984 |
| 80 | Ga0070713_100014067 | 3300005436 | Bacteria | 5926 |
| 81 | Ga0070713_100047355 | 3300005436 | Bacteria | 3533 |
| 82 | Ga0070713_100152748 | 3300005436 | Bacteria | 2055 |
| 83 | Ga0070713_100363629 | 3300005436 | Bacteria | 1345 |
| 84 | Ga0070713_100398893 | 3300005436 | Bacteria | 1284 |
| 85 | Ga0070710_10000278 | 3300005437 | Bacteria | 24249 |
| 86 | Ga0070710_10006014 | 3300005437 | Bacteria | 5796 |
| 87 | Ga0070710_10062633 | 3300005437 | Bacteria | 2122 |
| 88 | Ga0070710_10107133 | 3300005437 | Bacteria | 1673 |
| 89 | Ga0070710_10340173 | 3300005437 | Bacteria | 990 |
| 90 | Ga0070710_10346218 | 3300005437 | Bacteria | 982 |
| 91 | Ga0070710_10417615 | 3300005437 | Bacteria | 903 |
| 92 | Ga0070701_10471456 | 3300005438 | Bacteria | 810 |
| 93 | Ga0070711_100007809 | 3300005439 | Bacteria | 6517 |
| 94 | Ga0070711_100015296 | 3300005439 | Bacteria | 4857 |
| 95 | Ga0070711_100017937 | 3300005439 | Bacteria | 4512 |
| 96 | Ga0070711_100073692 | 3300005439 | Bacteria | 2413 |
| 97 | Ga0070711_100087060 | 3300005439 | Bacteria | 2242 |
| 98 | Ga0070711_100464958 | 3300005439 | Bacteria | 1037 |
| 99 | Ga0070705_100020896 | 3300005440 | Bacteria | 3474 |
| 100 | Ga0070705_100113260 | 3300005440 | Bacteria | 1737 |
| 101 | Ga0070705_100376366 | 3300005440 | Bacteria | 1044 |
| 102 | Ga0070700_100000007 | 3300005441 | Bacteria | 198866 |
| 103 | Ga0070700_100020294 | 3300005441 | Bacteria | 3847 |
| 104 | Ga0070694_100014480 | 3300005444 | Bacteria | 4938 |
| 105 | Ga0070694_100253878 | 3300005444 | Bacteria | 1331 |
| 106 | Ga0070694_100649153 | 3300005444 | Bacteria | 854 |
| 107 | Ga0070708_100217625 | 3300005445 | Bacteria | 1790 |
| 108 | Ga0070708_100503207 | 3300005445 | Bacteria | 1143 |
| 109 | Ga0070708_100628616 | 3300005445 | Bacteria | 1012 |
| 110 | Ga0070663_100008289 | 3300005455 | Bacteria | 6384 |
| 111 | Ga0070663_100017694 | 3300005455 | Bacteria | 4656 |
| 112 | Ga0070663_100491511 | 3300005455 | Bacteria | 1017 |
| 113 | Ga0070663_100664640 | 3300005455 | Bacteria | 882 |
| 114 | Ga0070678_100002598 | 3300005456 | Bacteria | 9929 |
| 115 | Ga0070678_100014415 | 3300005456 | Bacteria | 4988 |
| 116 | Ga0070662_100023778 | 3300005457 | Bacteria | 4213 |
| 117 | Ga0070681_10003941 | 3300005458 | Bacteria | 13986 |
| 118 | Ga0070681_10023035 | 3300005458 | Bacteria | 6262 |
| 119 | Ga0070681_10094866 | 3300005458 | Bacteria | 2932 |
| 120 | Ga0070681_10104492 | 3300005458 | Bacteria | 2775 |
| 121 | Ga0070681_10119980 | 3300005458 | Bacteria | 2565 |
| 122 | Ga0070681_10809706 | 3300005458 | Bacteria | 854 |
| 123 | Ga0070685_10005782 | 3300005466 | Bacteria | 6286 |
| 124 | Ga0070685_10092329 | 3300005466 | Bacteria | 1834 |
| 125 | Ga0070685_10108820 | 3300005466 | Bacteria | 1704 |
| 126 | Ga0070706_100006076 | 3300005467 | Bacteria | 11412 |
| 127 | Ga0070706_100007201 | 3300005467 | Bacteria | 10452 |
| 128 | Ga0070706_100038519 | 3300005467 | Bacteria | 4412 |
| 129 | Ga0070706_100730511 | 3300005467 | Bacteria | 918 |
| 130 | Ga0070707_100002446 | 3300005468 | Bacteria | 17685 |
| 131 | Ga0070707_100072910 | 3300005468 | Bacteria | 3310 |
| 132 | Ga0070707_100181838 | 3300005468 | Bacteria | 2050 |
| 133 | Ga0070707_100611832 | 3300005468 | Bacteria | 1052 |
| 134 | Ga0070698_100002581 | 3300005471 | Bacteria | 19946 |
| 135 | Ga0070698_100016157 | 3300005471 | Bacteria | 7881 |
| 136 | Ga0070698_100019764 | 3300005471 | Bacteria | 7065 |
| 137 | Ga0070698_100060163 | 3300005471 | Bacteria | 3833 |
| 138 | Ga0070698_100182440 | 3300005471 | Bacteria | 2037 |
| 139 | Ga0070698_100473790 | 3300005471 | Bacteria | 1188 |
| 140 | Ga0070699_100001377 | 3300005518 | Bacteria | 22335 |
| 141 | Ga0070699_100240524 | 3300005518 | Bacteria | 1616 |
| 142 | Ga0070679_100002183 | 3300005530 | Bacteria | 17662 |
| 143 | Ga0070679_100007399 | 3300005530 | Bacteria | 10261 |
| 144 | Ga0070679_100043471 | 3300005530 | Bacteria | 4475 |
| 145 | Ga0070679_100138297 | 3300005530 | Bacteria | 2416 |
| 146 | Ga0070679_100171055 | 3300005530 | Bacteria | 2145 |
| 147 | Ga0070679_100245444 | 3300005530 | Bacteria | 1747 |
| 148 | Ga0070684_100034118 | 3300005535 | Bacteria | 4348 |
| 149 | Ga0070684_100156880 | 3300005535 | Bacteria | 2064 |
| 150 | Ga0070684_100175973 | 3300005535 | Bacteria | 1945 |
| 151 | Ga0070684_100284619 | 3300005535 | Bacteria | 1515 |
| 152 | Ga0070697_100017039 | 3300005536 | Bacteria | 5714 |
| 153 | Ga0068853_100016620 | 3300005539 | Bacteria | 6059 |
| 154 | Ga0070672_100044936 | 3300005543 | Bacteria | 3414 |
| 155 | Ga0070672_100188986 | 3300005543 | Bacteria | 1719 |
| 156 | Ga0070686_100011934 | 3300005544 | Bacteria | 4939 |
| 157 | Ga0070686_100024998 | 3300005544 | Bacteria | 3586 |
| 158 | Ga0070695_100015524 | 3300005545 | Bacteria | 4600 |
| 159 | Ga0070695_100030111 | 3300005545 | Bacteria | 3377 |
| 160 | Ga0070695_100166454 | 3300005545 | Bacteria | 1552 |
| 161 | Ga0070695_100233435 | 3300005545 | Bacteria | 1331 |
| 162 | Ga0070696_100004714 | 3300005546 | Bacteria | 9116 |
| 163 | Ga0070696_100011867 | 3300005546 | Bacteria | 5840 |
| 164 | Ga0070693_100007302 | 3300005547 | Bacteria | 5397 |
| 165 | Ga0070665_100020284 | 3300005548 | Bacteria | 6674 |
| 166 | Ga0070665_100021995 | 3300005548 | Bacteria | 6415 |
| 167 | Ga0070665_100120644 | 3300005548 | Bacteria | 2623 |
| 168 | Ga0070665_100746818 | 3300005548 | Bacteria | 991 |
| 169 | Ga0070665_100838011 | 3300005548 | Bacteria | 933 |
| 170 | Ga0070665_101492105 | 3300005548 | Bacteria | 685 |
| 171 | Ga0070704_100081921 | 3300005549 | Bacteria | 2378 |
| 172 | Ga0070704_100104634 | 3300005549 | Bacteria | 2141 |
| 173 | Ga0070704_100119712 | 3300005549 | Bacteria | 2020 |
| 174 | Ga0070704_100242806 | 3300005549 | Bacteria | 1475 |
| 175 | Ga0068855_100014121 | 3300005563 | Bacteria | 9623 |
| 176 | Ga0068855_100115406 | 3300005563 | Bacteria | 3079 |
| 177 | Ga0068855_100217998 | 3300005563 | Bacteria | 2141 |
| 178 | Ga0068855_100563104 | 3300005563 | Bacteria | 1233 |
| 179 | Ga0070664_100445830 | 3300005564 | Bacteria | 1188 |
| 180 | Ga0068857_100004112 | 3300005577 | Bacteria | 12263 |
| 181 | Ga0068857_100091530 | 3300005577 | Bacteria | 2723 |
| 182 | Ga0068857_100106823 | 3300005577 | Bacteria | 2514 |
| 183 | Ga0068857_100338837 | 3300005577 | Bacteria | 1391 |
| 184 | Ga0068854_100022934 | 3300005578 | Bacteria | 4259 |
| 185 | Ga0068854_100452566 | 3300005578 | Bacteria | 1072 |
| 186 | Ga0068854_100687592 | 3300005578 | Bacteria | 882 |
| 187 | Ga0068856_100016071 | 3300005614 | Bacteria | 7234 |
| 188 | Ga0068856_100050080 | 3300005614 | Bacteria | 4117 |
| 189 | Ga0068856_100100517 | 3300005614 | Bacteria | 2884 |
| 190 | Ga0068856_100191083 | 3300005614 | Bacteria | 2061 |
| 191 | Ga0070702_100025199 | 3300005615 | Bacteria | 3184 |
| 192 | Ga0068852_100008211 | 3300005616 | Bacteria | 7671 |
| 193 | Ga0068852_100078358 | 3300005616 | Bacteria | 2923 |
| 194 | Ga0068852_100939775 | 3300005616 | Bacteria | 882 |
| 195 | Ga0068859_100000203 | 3300005617 | Bacteria | 58452 |
| 196 | Ga0068859_100001419 | 3300005617 | Bacteria | 24315 |
| 197 | Ga0068864_100118384 | 3300005618 | Bacteria | 2365 |
| 198 | Ga0068864_100265483 | 3300005618 | Bacteria | 1598 |
| 199 | Ga0068864_100386983 | 3300005618 | Bacteria | 1327 |
| 200 | Ga0068866_10016303 | 3300005718 | Bacteria | 3320 |
| 201 | Ga0068866_10059520 | 3300005718 | Bacteria | 1977 |
| 202 | Ga0068861_100035313 | 3300005719 | Bacteria | 3702 |
| 203 | Ga0068851_10069220 | 3300005834 | Bacteria | 1823 |
| 204 | Ga0068870_10018076 | 3300005840 | Bacteria | 3398 |
| 205 | Ga0068870_10177292 | 3300005840 | Bacteria | 1276 |
| 206 | Ga0068863_100001103 | 3300005841 | Bacteria | 26991 |
| 207 | Ga0068863_100001958 | 3300005841 | Bacteria | 20461 |
| 208 | Ga0068863_100139739 | 3300005841 | Bacteria | 2314 |
| 209 | Ga0068858_100022912 | 3300005842 | Bacteria | 5825 |
| 210 | Ga0068858_100030488 | 3300005842 | Bacteria | 5007 |
| 211 | Ga0068858_100095244 | 3300005842 | Bacteria | 2774 |
| 212 | Ga0068860_100000043 | 3300005843 | Bacteria | 225862 |
| 213 | Ga0068860_100107067 | 3300005843 | Bacteria | 2671 |
| 214 | Ga0081455_10004075 | 3300005937 | Bacteria | 16549 |
| 215 | Ga0081455_10009726 | 3300005937 | Bacteria | 9856 |
| 216 | Ga0081455_10275048 | 3300005937 | Bacteria | 1219 |
| 217 | Ga0081455_10342023 | 3300005937 | Bacteria | 1058 |
| 218 | Ga0081540_1000322 | 3300005983 | Bacteria | 49507 |
| 219 | Ga0081540_1035641 | 3300005983 | Bacteria | 2665 |
| 220 | Ga0081539_10012474 | 3300005985 | Bacteria | 6548 |
| 221 | Ga0081539_10057082 | 3300005985 | Bacteria | 2163 |
| 222 | Ga0081539_10318427 | 3300005985 | Bacteria | 662 |
| 223 | Ga0070717_10003162 | 3300006028 | Bacteria | 11760 |
| 224 | Ga0070717_10003332 | 3300006028 | Bacteria | 11468 |
| 225 | Ga0070717_10037777 | 3300006028 | Bacteria | 3922 |
| 226 | Ga0070717_10041626 | 3300006028 | Bacteria | 3745 |
| 227 | Ga0070717_10095582 | 3300006028 | Bacteria | 2515 |
| 228 | Ga0070717_10128700 | 3300006028 | Bacteria | 2176 |
| 229 | Ga0070717_10130826 | 3300006028 | Bacteria | 2158 |
| 230 | Ga0070717_10331379 | 3300006028 | Bacteria | 1358 |
| 231 | Ga0075432_10133056 | 3300006058 | Bacteria | 943 |
| 232 | Ga0070715_10014221 | 3300006163 | Bacteria | 2942 |
| 233 | Ga0070715_10095170 | 3300006163 | Bacteria | 1379 |
| 234 | Ga0070715_10126916 | 3300006163 | Bacteria | 1223 |
| 235 | Ga0070715_10143352 | 3300006163 | Bacteria | 1163 |
| 236 | Ga0070715_10319413 | 3300006163 | Bacteria | 837 |
| 237 | Ga0070716_100000365 | 3300006173 | Bacteria | 18621 |
| 238 | Ga0070716_100020382 | 3300006173 | Bacteria | 3480 |
| 239 | Ga0070716_100062075 | 3300006173 | Bacteria | 2165 |
| 240 | Ga0070716_100099483 | 3300006173 | Bacteria | 1779 |
| 241 | Ga0070712_100000642 | 3300006175 | Bacteria | 20552 |
| 242 | Ga0070712_100023144 | 3300006175 | Bacteria | 4100 |
| 243 | Ga0070712_100038812 | 3300006175 | Bacteria | 3256 |
| 244 | Ga0070712_100072753 | 3300006175 | Bacteria | 2463 |
| 245 | Ga0070712_100292254 | 3300006175 | Bacteria | 1316 |
| 246 | Ga0070712_100301094 | 3300006175 | Bacteria | 1298 |
| 247 | Ga0097621_100024019 | 3300006237 | Bacteria | 4754 |
| 248 | Ga0097621_100123085 | 3300006237 | Bacteria | 2202 |
| 249 | Ga0075370_10412438 | 3300006353 | Bacteria | 811 |
| 250 | Ga0068871_100019439 | 3300006358 | Bacteria | 5186 |
| 251 | Ga0068871_100060728 | 3300006358 | Bacteria | 3084 |
| 252 | Ga0068871_100098944 | 3300006358 | Bacteria | 2441 |
| 253 | Ga0075433_10052568 | 3300006852 | Bacteria | 3550 |
| 254 | Ga0075433_10057185 | 3300006852 | Bacteria | 3409 |
| 255 | Ga0075434_100002616 | 3300006871 | Bacteria | 15875 |
| 256 | Ga0075434_100017533 | 3300006871 | Bacteria | 6902 |
| 257 | Ga0075434_100041537 | 3300006871 | Bacteria | 4556 |
| 258 | Ga0075429_100098329 | 3300006880 | Bacteria | 2553 |
| 259 | Ga0068865_100107307 | 3300006881 | Bacteria | 2054 |
| 260 | Ga0075436_100020706 | 3300006914 | Bacteria | 4513 |
| 261 | Ga0075436_100083730 | 3300006914 | Bacteria | 2213 |
| 262 | Ga0075436_100479139 | 3300006914 | Bacteria | 908 |
| 263 | Ga0097620_100001419 | 3300006931 | Bacteria | 24315 |
| 264 | Ga0075435_100012275 | 3300007076 | Bacteria | 6336 |
| 265 | Ga0075435_100058844 | 3300007076 | Bacteria | 3113 |
| 266 | Ga0075435_100372104 | 3300007076 | Bacteria | 1227 |
| 267 | Ga0075435_100444654 | 3300007076 | Bacteria | 1118 |
| 268 | Ga0075435_100826979 | 3300007076 | Bacteria | 807 |
| 269 | Ga0105251_10066405 | 3300009011 | Bacteria | 1686 |
| 270 | Ga0105240_10071915 | 3300009093 | Bacteria | 4276 |
| 271 | Ga0105240_10209091 | 3300009093 | Bacteria | 2281 |
| 272 | Ga0111539_10083082 | 3300009094 | Bacteria | 3767 |
| 273 | Ga0105245_10033626 | 3300009098 | Bacteria | 4545 |
| 274 | Ga0105245_10040561 | 3300009098 | Bacteria | 4148 |
| 275 | Ga0105245_10070166 | 3300009098 | Bacteria | 3179 |
| 276 | Ga0105245_10105778 | 3300009098 | Bacteria | 2610 |
| 277 | Ga0105245_10250030 | 3300009098 | Bacteria | 1722 |
| 278 | Ga0105245_10539028 | 3300009098 | Bacteria | 1188 |
| 279 | Ga0105247_10001304 | 3300009101 | Bacteria | 18324 |
| 280 | Ga0105247_10114718 | 3300009101 | Bacteria | 1738 |
| 281 | Ga0105247_10131584 | 3300009101 | Bacteria | 1631 |
| 282 | Ga0114129_10011936 | 3300009147 | Bacteria | 12356 |
| 283 | Ga0114129_10210971 | 3300009147 | Bacteria | 2625 |
| 284 | Ga0105243_10070233 | 3300009148 | Bacteria | 2827 |
| 285 | Ga0105243_10164428 | 3300009148 | Bacteria | 1916 |
| 286 | Ga0105243_11017443 | 3300009148 | Bacteria | 832 |
| 287 | Ga0105241_10028011 | 3300009174 | Bacteria | 4196 |
| 288 | Ga0105241_10044860 | 3300009174 | Bacteria | 3351 |
| 289 | Ga0105241_10059247 | 3300009174 | Bacteria | 2943 |
| 290 | Ga0105241_10173150 | 3300009174 | Bacteria | 1784 |
| 291 | Ga0105242_10042685 | 3300009176 | Bacteria | 3664 |
| 292 | Ga0105242_10527530 | 3300009176 | Bacteria | 1128 |
| 293 | Ga0105248_10000776 | 3300009177 | Bacteria | 35865 |
| 294 | Ga0105248_10018376 | 3300009177 | Bacteria | 7723 |
| 295 | Ga0105248_10362585 | 3300009177 | Bacteria | 1632 |
| 296 | Ga0105237_10025512 | 3300009545 | Bacteria | 6045 |
| 297 | Ga0105237_10063161 | 3300009545 | Bacteria | 3701 |
| 298 | Ga0105237_10101314 | 3300009545 | Bacteria | 2872 |
| 299 | Ga0105237_10436231 | 3300009545 | Bacteria | 1315 |
| 300 | Ga0105237_10444378 | 3300009545 | Bacteria | 1302 |
| 301 | Ga0105238_10104948 | 3300009551 | Bacteria | 2807 |
| 302 | Ga0105238_10155972 | 3300009551 | Bacteria | 2258 |
| 303 | Ga0105238_10476942 | 3300009551 | Bacteria | 1246 |
| 304 | Ga0105238_10571693 | 3300009551 | Bacteria | 1136 |
| 305 | Ga0105238_10849647 | 3300009551 | Bacteria | 930 |
| 306 | Ga0105249_10007381 | 3300009553 | Bacteria | 9589 |
| 307 | Ga0105249_10181662 | 3300009553 | Bacteria | 2047 |
| 308 | Ga0105249_10644980 | 3300009553 | Bacteria | 1116 |
| 309 | Ga0105239_10005021 | 3300010375 | Bacteria | 15620 |
| 310 | Ga0105239_10082433 | 3300010375 | Bacteria | 3542 |
| 311 | Ga0105239_10301241 | 3300010375 | Bacteria | 1805 |
| 312 | Ga0105239_10370147 | 3300010375 | Bacteria | 1619 |
| 313 | Ga0105239_11654629 | 3300010375 | Bacteria | 741 |
| 314 | Ga0105246_10007956 | 3300011119 | Bacteria | 6507 |
| 315 | Ga0105246_10017501 | 3300011119 | Bacteria | 4556 |
| 316 | Ga0157335_1001512 | 3300012492 | Bacteria | 1287 |
| 317 | Ga0157341_1005866 | 3300012494 | Bacteria | 934 |
| 318 | Ga0157342_1019544 | 3300012507 | Bacteria | 776 |
| 319 | Ga0157373_10075447 | 3300013100 | Bacteria | 2379 |
| 320 | Ga0157373_10329947 | 3300013100 | Bacteria | 1086 |
| 321 | Ga0157371_10012338 | 3300013102 | Bacteria | 6538 |
| 322 | Ga0157371_10043034 | 3300013102 | Bacteria | 3218 |
| 323 | Ga0157371_10150309 | 3300013102 | Bacteria | 1661 |
| 324 | Ga0157370_10054703 | 3300013104 | Bacteria | 3804 |
| 325 | Ga0157370_10191459 | 3300013104 | Bacteria | 1898 |
| 326 | Ga0157370_10218545 | 3300013104 | Bacteria | 1765 |
| 327 | Ga0157370_10228795 | 3300013104 | Bacteria | 1721 |
| 328 | Ga0157370_10246608 | 3300013104 | Bacteria | 1652 |
| 329 | Ga0157369_10048309 | 3300013105 | Bacteria | 4618 |
| 330 | Ga0157369_10093617 | 3300013105 | Bacteria | 3207 |
| 331 | Ga0157369_10124385 | 3300013105 | Bacteria | 2735 |
| 332 | Ga0157369_10129588 | 3300013105 | Bacteria | 2674 |
| 333 | Ga0157369_10605096 | 3300013105 | Bacteria | 1131 |
| 334 | Ga0157369_11114399 | 3300013105 | Bacteria | 807 |
| 335 | Ga0157374_10076077 | 3300013296 | Bacteria | 3173 |
| 336 | Ga0157374_10099261 | 3300013296 | Bacteria | 2789 |
| 337 | Ga0157378_10043419 | 3300013297 | Bacteria | 3991 |
| 338 | Ga0157378_10488777 | 3300013297 | Bacteria | 1228 |
| 339 | Ga0157378_10510368 | 3300013297 | Bacteria | 1202 |
| 340 | Ga0157378_10794631 | 3300013297 | Bacteria | 972 |
| 341 | Ga0163162_10053545 | 3300013306 | Bacteria | 4056 |
| 342 | Ga0163162_10103430 | 3300013306 | Bacteria | 2942 |
| 343 | Ga0157372_10362093 | 3300013307 | Bacteria | 1690 |
| 344 | Ga0157372_10623791 | 3300013307 | Bacteria | 1256 |
| 345 | Ga0157375_10008112 | 3300013308 | Bacteria | 9189 |
| 346 | Ga0157375_10146421 | 3300013308 | Bacteria | 2493 |
| 347 | Ga0157375_10229513 | 3300013308 | Bacteria | 2015 |
| 348 | Ga0157375_11227749 | 3300013308 | Bacteria | 880 |
| 349 | Ga0163163_10103543 | 3300014325 | Bacteria | 2871 |
| 350 | Ga0163163_10137524 | 3300014325 | Bacteria | 2484 |
| 351 | Ga0163163_10414108 | 3300014325 | Bacteria | 1406 |
| 352 | Ga0163163_10724694 | 3300014325 | Bacteria | 1058 |
| 353 | Ga0163163_10982437 | 3300014325 | Bacteria | 907 |
| 354 | Ga0157380_10093579 | 3300014326 | Bacteria | 2485 |
| 355 | Ga0157380_11089009 | 3300014326 | Bacteria | 837 |
| 356 | Ga0182008_10030398 | 3300014497 | Bacteria | 2723 |
| 357 | Ga0157377_10016384 | 3300014745 | Bacteria | 3812 |
| 358 | Ga0157377_10040683 | 3300014745 | Bacteria | 2575 |
| 359 | Ga0157377_10102640 | 3300014745 | Bacteria | 1707 |
| 360 | Ga0157379_10044210 | 3300014968 | Bacteria | 3975 |
| 361 | Ga0157379_10119341 | 3300014968 | Bacteria | 2372 |
| 362 | Ga0157376_10007984 | 3300014969 | Bacteria | 7596 |
| 363 | Ga0163161_10003537 | 3300017792 | Bacteria | 10928 |
| 364 | Ga0163161_10092272 | 3300017792 | Bacteria | 2242 |
| 365 | Ga0206356_10133492 | 3300020070 | Bacteria | 1116 |
| 366 | Ga0206356_10403435 | 3300020070 | Bacteria | 1044 |
| 367 | Ga0206356_11766969 | 3300020070 | Bacteria | 2291 |
| 368 | Ga0206349_1934169 | 3300020075 | Bacteria | 1007 |
| 369 | Ga0206351_10532516 | 3300020077 | Bacteria | 1069 |
| 370 | Ga0206351_10691055 | 3300020077 | Bacteria | 937 |
| 371 | Ga0206350_10135956 | 3300020080 | Bacteria | 1028 |
| 372 | Ga0206350_10407140 | 3300020080 | Bacteria | 1094 |
| 373 | Ga0206354_10448385 | 3300020081 | Bacteria | 1155 |
| 374 | Ga0206354_10501093 | 3300020081 | Bacteria | 3017 |
| 375 | Ga0206354_10558071 | 3300020081 | Bacteria | 746 |
| 376 | Ga0206354_11113439 | 3300020081 | Bacteria | 1195 |
| 377 | Ga0206354_11522812 | 3300020081 | Bacteria | 1379 |
| 378 | Ga0206353_10579089 | 3300020082 | Bacteria | 2895 |
| 379 | Ga0206353_10580619 | 3300020082 | Bacteria | 10814 |
| 380 | Ga0206353_10661638 | 3300020082 | Bacteria | 773 |
| 381 | Ga0206353_10877206 | 3300020082 | Bacteria | 1480 |
| 382 | Ga0206353_11498470 | 3300020082 | Bacteria | 2504 |
| 383 | Ga0206353_11662522 | 3300020082 | Bacteria | 1309 |
| 384 | Ga0206353_11872344 | 3300020082 | Bacteria | 4659 |
| 385 | Ga0206353_11944787 | 3300020082 | Bacteria | 987 |
| 386 | Ga0206353_11954408 | 3300020082 | Bacteria | 1296 |
| 387 | Ga0213872_10000601 | 3300021361 | Bacteria | 27442 |
| 388 | Ga0213872_10001084 | 3300021361 | Bacteria | 18723 |
| 389 | Ga0213872_10007351 | 3300021361 | Bacteria | 5433 |
| 390 | Ga0213872_10011214 | 3300021361 | Bacteria | 4245 |
| 391 | Ga0213872_10015813 | 3300021361 | Bacteria | 3505 |
| 392 | Ga0213872_10100654 | 3300021361 | Bacteria | 1289 |
| 393 | Ga0213876_10079945 | 3300021384 | Bacteria | 1728 |
| 394 | Ga0213875_10000758 | 3300021388 | Bacteria | 24340 |
| 395 | Ga0213875_10000907 | 3300021388 | Bacteria | 21486 |
| 396 | Ga0213875_10026616 | 3300021388 | Bacteria | 2751 |
| 397 | Ga0213875_10027587 | 3300021388 | Bacteria | 2702 |
| 398 | Ga0224712_10007667 | 3300022467 | Bacteria | 3155 |
| 399 | Ga0224712_10026058 | 3300022467 | Bacteria | 2062 |
| 400 | Ga0224572_1013330 | 3300024225 | Bacteria | 1568 |
| 401 | Ga0207656_10031400 | 3300025321 | Bacteria | 2201 |
| 402 | Ga0207653_10009329 | 3300025885 | Bacteria | 3055 |
| 403 | Ga0207692_10001168 | 3300025898 | Bacteria | 9707 |
| 404 | Ga0207692_10019279 | 3300025898 | Bacteria | 3080 |
| 405 | Ga0207692_10023441 | 3300025898 | Bacteria | 2854 |
| 406 | Ga0207692_10497132 | 3300025898 | Bacteria | 773 |
| 407 | Ga0207642_10007684 | 3300025899 | Bacteria | 3651 |
| 408 | Ga0207688_10009564 | 3300025901 | Bacteria | 5277 |
| 409 | Ga0207688_10183607 | 3300025901 | Bacteria | 1248 |
| 410 | Ga0207680_10079582 | 3300025903 | Bacteria | 2056 |
| 411 | Ga0207647_10045470 | 3300025904 | Bacteria | 2739 |
| 412 | Ga0207647_10076359 | 3300025904 | Bacteria | 2015 |
| 413 | Ga0207647_10425879 | 3300025904 | Bacteria | 746 |
| 414 | Ga0207685_10002152 | 3300025905 | Bacteria | 4433 |
| 415 | Ga0207685_10067406 | 3300025905 | Bacteria | 1439 |
| 416 | Ga0207685_10180718 | 3300025905 | Bacteria | 978 |
| 417 | Ga0207685_10260274 | 3300025905 | Bacteria | 843 |
| 418 | Ga0207699_10000446 | 3300025906 | Bacteria | 21144 |
| 419 | Ga0207699_10001789 | 3300025906 | Bacteria | 10111 |
| 420 | Ga0207699_10003210 | 3300025906 | Bacteria | 7783 |
| 421 | Ga0207699_10004496 | 3300025906 | Bacteria | 6661 |
| 422 | Ga0207699_10018869 | 3300025906 | Bacteria | 3663 |
| 423 | Ga0207699_10089591 | 3300025906 | Bacteria | 1928 |
| 424 | Ga0207699_10182241 | 3300025906 | Bacteria | 1412 |
| 425 | Ga0207645_10030943 | 3300025907 | Bacteria | 3447 |
| 426 | Ga0207643_10000094 | 3300025908 | Bacteria | 60399 |
| 427 | Ga0207643_10017566 | 3300025908 | Bacteria | 3913 |
| 428 | Ga0207705_10004857 | 3300025909 | Bacteria | 10091 |
| 429 | Ga0207705_10024402 | 3300025909 | Bacteria | 4315 |
| 430 | Ga0207705_10067195 | 3300025909 | Bacteria | 2594 |
| 431 | Ga0207705_10068283 | 3300025909 | Bacteria | 2574 |
| 432 | Ga0207705_10474320 | 3300025909 | Bacteria | 971 |
| 433 | Ga0207684_10006720 | 3300025910 | Bacteria | 10445 |
| 434 | Ga0207684_10127196 | 3300025910 | Bacteria | 2187 |
| 435 | Ga0207684_10179774 | 3300025910 | Bacteria | 1824 |
| 436 | Ga0207654_10073942 | 3300025911 | Bacteria | 2033 |
| 437 | Ga0207654_10453745 | 3300025911 | Bacteria | 899 |
| 438 | Ga0207707_10001838 | 3300025912 | Bacteria | 19451 |
| 439 | Ga0207707_10019126 | 3300025912 | Bacteria | 5977 |
| 440 | Ga0207707_10025581 | 3300025912 | Bacteria | 5163 |
| 441 | Ga0207707_10069975 | 3300025912 | Bacteria | 3058 |
| 442 | Ga0207707_10576455 | 3300025912 | Bacteria | 954 |
| 443 | Ga0207707_10588095 | 3300025912 | Bacteria | 943 |
| 444 | Ga0207695_10066912 | 3300025913 | Bacteria | 3687 |
| 445 | Ga0207695_10535524 | 3300025913 | Bacteria | 1053 |
| 446 | Ga0207671_10012605 | 3300025914 | Bacteria | 6790 |
| 447 | Ga0207671_10020055 | 3300025914 | Bacteria | 5099 |
| 448 | Ga0207671_10073613 | 3300025914 | Bacteria | 2552 |
| 449 | Ga0207693_10005838 | 3300025915 | Bacteria | 10215 |
| 450 | Ga0207693_10005948 | 3300025915 | Bacteria | 10126 |
| 451 | Ga0207693_10030474 | 3300025915 | Bacteria | 4261 |
| 452 | Ga0207693_10043383 | 3300025915 | Bacteria | 3539 |
| 453 | Ga0207693_10074688 | 3300025915 | Bacteria | 2655 |
| 454 | Ga0207693_10084997 | 3300025915 | Bacteria | 2479 |
| 455 | Ga0207693_10128361 | 3300025915 | Bacteria | 1993 |
| 456 | Ga0207663_10034154 | 3300025916 | Bacteria | 3038 |
| 457 | Ga0207663_10063620 | 3300025916 | Bacteria | 2350 |
| 458 | Ga0207663_10119574 | 3300025916 | Bacteria | 1801 |
| 459 | Ga0207663_10151914 | 3300025916 | Bacteria | 1625 |
| 460 | Ga0207663_10286150 | 3300025916 | Bacteria | 1226 |
| 461 | Ga0207663_10539680 | 3300025916 | Bacteria | 910 |
| 462 | Ga0207660_10000619 | 3300025917 | Bacteria | 23952 |
| 463 | Ga0207660_10153879 | 3300025917 | Bacteria | 1769 |
| 464 | Ga0207660_10189358 | 3300025917 | Bacteria | 1601 |
| 465 | Ga0207660_10264744 | 3300025917 | Bacteria | 1360 |
| 466 | Ga0207662_10001797 | 3300025918 | Bacteria | 10524 |
| 467 | Ga0207662_10036196 | 3300025918 | Bacteria | 2884 |
| 468 | Ga0207657_10010275 | 3300025919 | Bacteria | 9344 |
| 469 | Ga0207657_10019194 | 3300025919 | Bacteria | 6500 |
| 470 | Ga0207657_10036519 | 3300025919 | Bacteria | 4397 |
| 471 | Ga0207657_10142202 | 3300025919 | Bacteria | 1960 |
| 472 | Ga0207657_10256273 | 3300025919 | Bacteria | 1393 |
| 473 | Ga0207657_10519521 | 3300025919 | Bacteria | 932 |
| 474 | Ga0207649_10030683 | 3300025920 | Bacteria | 3187 |
| 475 | Ga0207649_10104830 | 3300025920 | Bacteria | 1878 |
| 476 | Ga0207649_10266202 | 3300025920 | Bacteria | 1240 |
| 477 | Ga0207652_10003015 | 3300025921 | Bacteria | 14060 |
| 478 | Ga0207652_10061823 | 3300025921 | Bacteria | 3235 |
| 479 | Ga0207652_10062453 | 3300025921 | Bacteria | 3219 |
| 480 | Ga0207652_10114766 | 3300025921 | Bacteria | 2392 |
| 481 | Ga0207652_10473546 | 3300025921 | Bacteria | 1128 |
| 482 | Ga0207652_10769478 | 3300025921 | Bacteria | 856 |
| 483 | Ga0207646_10006537 | 3300025922 | Bacteria | 12030 |
| 484 | Ga0207646_10019331 | 3300025922 | Bacteria | 6333 |
| 485 | Ga0207646_10378452 | 3300025922 | Bacteria | 1279 |
| 486 | Ga0207646_10522086 | 3300025922 | Bacteria | 1069 |
| 487 | Ga0207646_10584878 | 3300025922 | Bacteria | 1003 |
| 488 | Ga0207681_10140870 | 3300025923 | Bacteria | 1796 |
| 489 | Ga0207694_10075114 | 3300025924 | Bacteria | 2645 |
| 490 | Ga0207694_10276014 | 3300025924 | Bacteria | 1380 |
| 491 | Ga0207694_10393757 | 3300025924 | Bacteria | 1151 |
| 492 | Ga0207694_10571783 | 3300025924 | Bacteria | 949 |
| 493 | Ga0207659_10115126 | 3300025926 | Bacteria | 2050 |
| 494 | Ga0207687_10020870 | 3300025927 | Bacteria | 4347 |
| 495 | Ga0207687_10031614 | 3300025927 | Bacteria | 3578 |
| 496 | Ga0207687_10112203 | 3300025927 | Bacteria | 2026 |
| 497 | Ga0207687_10331241 | 3300025927 | Bacteria | 1235 |
| 498 | Ga0207700_10001064 | 3300025928 | Bacteria | 15797 |
| 499 | Ga0207700_10002230 | 3300025928 | Bacteria | 11131 |
| 500 | Ga0207700_10011474 | 3300025928 | Bacteria | 5650 |
| 501 | Ga0207700_10037670 | 3300025928 | Bacteria | 3504 |
| 502 | Ga0207700_10049575 | 3300025928 | Bacteria | 3124 |
| 503 | Ga0207700_10075305 | 3300025928 | Bacteria | 2615 |
| 504 | Ga0207700_10121191 | 3300025928 | Bacteria | 2121 |
| 505 | Ga0207700_10153140 | 3300025928 | Bacteria | 1907 |
| 506 | Ga0207700_10190463 | 3300025928 | Bacteria | 1723 |
| 507 | Ga0207700_10197504 | 3300025928 | Bacteria | 1693 |
| 508 | Ga0207700_10210575 | 3300025928 | Bacteria | 1643 |
| 509 | Ga0207700_10360547 | 3300025928 | Bacteria | 1267 |
| 510 | Ga0207664_10000091 | 3300025929 | Bacteria | 84244 |
| 511 | Ga0207664_10003245 | 3300025929 | Bacteria | 10798 |
| 512 | Ga0207664_10004273 | 3300025929 | Bacteria | 9668 |
| 513 | Ga0207664_10013915 | 3300025929 | Bacteria | 5797 |
| 514 | Ga0207664_10024940 | 3300025929 | Bacteria | 4497 |
| 515 | Ga0207664_10034866 | 3300025929 | Bacteria | 3878 |
| 516 | Ga0207664_10038717 | 3300025929 | Bacteria | 3698 |
| 517 | Ga0207664_10090291 | 3300025929 | Bacteria | 2510 |
| 518 | Ga0207664_10119731 | 3300025929 | Bacteria | 2201 |
| 519 | Ga0207664_10595297 | 3300025929 | Bacteria | 993 |
| 520 | Ga0207664_10909418 | 3300025929 | Bacteria | 790 |
| 521 | Ga0207644_10051487 | 3300025931 | Bacteria | 2956 |
| 522 | Ga0207690_10195762 | 3300025932 | Bacteria | 1532 |
| 523 | Ga0207690_10348048 | 3300025932 | Bacteria | 1171 |
| 524 | Ga0207690_10451515 | 3300025932 | Bacteria | 1033 |
| 525 | Ga0207706_10004309 | 3300025933 | Bacteria | 13371 |
| 526 | Ga0207706_10017078 | 3300025933 | Bacteria | 6545 |
| 527 | Ga0207706_10048116 | 3300025933 | Bacteria | 3772 |
| 528 | Ga0207709_10118099 | 3300025935 | Bacteria | 1786 |
| 529 | Ga0207709_10925347 | 3300025935 | Bacteria | 710 |
| 530 | Ga0207670_10031624 | 3300025936 | Bacteria | 3394 |
| 531 | Ga0207670_10035070 | 3300025936 | Bacteria | 3250 |
| 532 | Ga0207669_10280888 | 3300025937 | Bacteria | 1256 |
| 533 | Ga0207669_10572656 | 3300025937 | Bacteria | 914 |
| 534 | Ga0207665_10000207 | 3300025939 | Bacteria | 39551 |
| 535 | Ga0207665_10000352 | 3300025939 | Bacteria | 31877 |
| 536 | Ga0207665_10001973 | 3300025939 | Bacteria | 13823 |
| 537 | Ga0207665_10002007 | 3300025939 | Bacteria | 13718 |
| 538 | Ga0207665_10007495 | 3300025939 | Bacteria | 7210 |
| 539 | Ga0207665_10060528 | 3300025939 | Bacteria | 2564 |
| 540 | Ga0207665_10061885 | 3300025939 | Bacteria | 2539 |
| 541 | Ga0207665_10092160 | 3300025939 | Bacteria | 2102 |
| 542 | Ga0207665_10149671 | 3300025939 | Bacteria | 1671 |
| 543 | Ga0207691_10104557 | 3300025940 | Bacteria | 2524 |
| 544 | Ga0207711_10000110 | 3300025941 | Bacteria | 85801 |
| 545 | Ga0207711_10132889 | 3300025941 | Bacteria | 2233 |
| 546 | Ga0207711_10136019 | 3300025941 | Bacteria | 2207 |
| 547 | Ga0207711_10136533 | 3300025941 | Bacteria | 2203 |
| 548 | Ga0207711_10206968 | 3300025941 | Bacteria | 1791 |
| 549 | Ga0207689_10001041 | 3300025942 | Bacteria | 26632 |
| 550 | Ga0207689_10004620 | 3300025942 | Bacteria | 12454 |
| 551 | Ga0207689_10024307 | 3300025942 | Bacteria | 5084 |
| 552 | Ga0207661_10062115 | 3300025944 | Bacteria | 3021 |
| 553 | Ga0207661_10162485 | 3300025944 | Bacteria | 1938 |
| 554 | Ga0207661_10316840 | 3300025944 | Bacteria | 1401 |
| 555 | Ga0207679_10059918 | 3300025945 | Bacteria | 2826 |
| 556 | Ga0207679_10511245 | 3300025945 | Bacteria | 1073 |
| 557 | Ga0207679_10630406 | 3300025945 | Bacteria | 968 |
| 558 | Ga0207667_10241809 | 3300025949 | Bacteria | 1847 |
| 559 | Ga0207712_10072455 | 3300025961 | Bacteria | 2481 |
| 560 | Ga0207712_10176220 | 3300025961 | Bacteria | 1676 |
| 561 | Ga0207668_10009134 | 3300025972 | Bacteria | 5927 |
| 562 | Ga0207668_10097070 | 3300025972 | Bacteria | 2180 |
| 563 | Ga0207640_10167982 | 3300025981 | Bacteria | 1631 |
| 564 | Ga0207640_10396808 | 3300025981 | Bacteria | 1122 |
| 565 | Ga0207658_10002264 | 3300025986 | Bacteria | 14243 |
| 566 | Ga0207658_10186906 | 3300025986 | Bacteria | 1719 |
| 567 | Ga0207658_10466750 | 3300025986 | Bacteria | 1120 |
| 568 | Ga0207658_10709079 | 3300025986 | Bacteria | 910 |
| 569 | Ga0207677_10018564 | 3300026023 | Bacteria | 4176 |
| 570 | Ga0207677_10080349 | 3300026023 | Bacteria | 2336 |
| 571 | Ga0207703_10151025 | 3300026035 | Bacteria | 2026 |
| 572 | Ga0207703_10904077 | 3300026035 | Bacteria | 845 |
| 573 | Ga0207703_11362963 | 3300026035 | Bacteria | 682 |
| 574 | Ga0207639_10051325 | 3300026041 | Bacteria | 3137 |
| 575 | Ga0207639_10279224 | 3300026041 | Bacteria | 1468 |
| 576 | Ga0207639_10804025 | 3300026041 | Bacteria | 876 |
| 577 | Ga0207678_10001648 | 3300026067 | Bacteria | 20470 |
| 578 | Ga0207678_10012052 | 3300026067 | Bacteria | 7593 |
| 579 | Ga0207678_10012661 | 3300026067 | Bacteria | 7412 |
| 580 | Ga0207678_10035491 | 3300026067 | Bacteria | 4341 |
| 581 | Ga0207678_10066051 | 3300026067 | Bacteria | 3106 |
| 582 | Ga0207708_10000006 | 3300026075 | Bacteria | 266916 |
| 583 | Ga0207708_10018835 | 3300026075 | Bacteria | 5200 |
| 584 | Ga0207702_10002824 | 3300026078 | Bacteria | 16246 |
| 585 | Ga0207702_10005443 | 3300026078 | Bacteria | 11141 |
| 586 | Ga0207702_10138190 | 3300026078 | Bacteria | 2201 |
| 587 | Ga0207702_10279070 | 3300026078 | Bacteria | 1579 |
| 588 | Ga0207702_10546524 | 3300026078 | Bacteria | 1133 |
| 589 | Ga0207702_11057593 | 3300026078 | Bacteria | 805 |
| 590 | Ga0207641_10002291 | 3300026088 | Bacteria | 17820 |
| 591 | Ga0207641_10010850 | 3300026088 | Bacteria | 7464 |
| 592 | Ga0207641_10010889 | 3300026088 | Bacteria | 7451 |
| 593 | Ga0207641_10122793 | 3300026088 | Bacteria | 2320 |
| 594 | Ga0207641_10185784 | 3300026088 | Bacteria | 1907 |
| 595 | Ga0207641_10248583 | 3300026088 | Bacteria | 1660 |
| 596 | Ga0207648_10220077 | 3300026089 | Bacteria | 1687 |
| 597 | Ga0207648_10453726 | 3300026089 | Bacteria | 1168 |
| 598 | Ga0207676_10182342 | 3300026095 | Bacteria | 1839 |
| 599 | Ga0207676_10184767 | 3300026095 | Bacteria | 1828 |
| 600 | Ga0207674_10005313 | 3300026116 | Bacteria | 15320 |
| 601 | Ga0207674_10170180 | 3300026116 | Bacteria | 2132 |
| 602 | Ga0207674_10377841 | 3300026116 | Bacteria | 1370 |
| 603 | Ga0207674_10392901 | 3300026116 | Bacteria | 1341 |
| 604 | Ga0207675_100009835 | 3300026118 | Bacteria | 8948 |
| 605 | Ga0207675_100010387 | 3300026118 | Bacteria | 8724 |
| 606 | Ga0207675_100815714 | 3300026118 | Bacteria | 947 |
| 607 | Ga0207675_100931209 | 3300026118 | Bacteria | 886 |
| 608 | Ga0207675_101130529 | 3300026118 | Bacteria | 803 |
| 609 | Ga0207683_10006035 | 3300026121 | Bacteria | 10370 |
| 610 | Ga0207683_10007232 | 3300026121 | Bacteria | 9516 |
| 611 | Ga0207683_10010376 | 3300026121 | Bacteria | 7947 |
| 612 | Ga0207698_10006675 | 3300026142 | Bacteria | 7211 |
| 613 | Ga0207698_10014615 | 3300026142 | Bacteria | 5226 |
| 614 | Ga0207698_10488316 | 3300026142 | Bacteria | 1196 |
| 615 | Ga0207698_10643341 | 3300026142 | Bacteria | 1050 |
| 616 | Ga0207428_10270484 | 3300027907 | Bacteria | 1263 |
| 617 | Ga0268266_10001099 | 3300028379 | Bacteria | 33884 |
| 618 | Ga0268266_10209170 | 3300028379 | Bacteria | 1788 |
| 619 | Ga0268266_10479718 | 3300028379 | Bacteria | 1185 |
| 620 | Ga0268265_10085071 | 3300028380 | Bacteria | 2509 |
| 621 | Ga0268265_10096263 | 3300028380 | Bacteria | 2379 |
| 622 | Ga0268264_10000027 | 3300028381 | Bacteria | 440852 |
| 623 | Ga0268264_10386541 | 3300028381 | Bacteria | 1341 |
| 624 | Ga0265337_1000052 | 3300028556 | Bacteria | 52251 |
| 625 | Ga0265319_1002287 | 3300028563 | Bacteria | 10569 |
| 626 | Ga0265334_10000162 | 3300028573 | Bacteria | 40960 |
| 627 | Ga0265336_10006354 | 3300028666 | Bacteria | 4265 |
| 628 | Ga0265338_10000986 | 3300028800 | Bacteria | 47980 |
| 629 | Ga0265338_10003673 | 3300028800 | Bacteria | 21387 |
| 630 | Ga0265338_10005536 | 3300028800 | Bacteria | 16440 |
| 631 | Ga0265324_10004189 | 3300029957 | Bacteria | 6600 |
| 632 | Ga0265324_10045591 | 3300029957 | Bacteria | 1510 |
| 633 | Ga0265760_10140160 | 3300031090 | Bacteria | 787 |
| 634 | Ga0265332_10005314 | 3300031238 | Bacteria | 5951 |
| 635 | Ga0265320_10005127 | 3300031240 | Bacteria | 8459 |
| 636 | Ga0265325_10011209 | 3300031241 | Bacteria | 5157 |
| 637 | Ga0265316_10016390 | 3300031344 | Bacteria | 6429 |
| 638 | Ga0307508_10406252 | 3300031616 | Bacteria | 953 |
| 639 | Ga0316575_10012981 | 3300031665 | Bacteria | 3108 |
| 640 | Ga0316579_10034396 | 3300031691 | Bacteria | 2331 |
| 641 | Ga0316579_10191004 | 3300031691 | Bacteria | 990 |
| 642 | Ga0265314_10008105 | 3300031711 | Bacteria | 9041 |
| 643 | Ga0265342_10002806 | 3300031712 | Bacteria | 14749 |
| 644 | Ga0316576_10000880 | 3300031727 | Bacteria | 15240 |
| 645 | Ga0316576_10020558 | 3300031727 | Bacteria | 4548 |
| 646 | Ga0316576_10031253 | 3300031727 | Bacteria | 3777 |
| 647 | Ga0316577_10158033 | 3300031733 | Bacteria | 1278 |
| 648 | Ga0307406_10093287 | 3300031901 | Bacteria | 2032 |
| 649 | Ga0307412_10133759 | 3300031911 | Bacteria | 1806 |
| 650 | Ga0307416_100337040 | 3300032002 | Bacteria | 1519 |
| 651 | Ga0307411_10224681 | 3300032005 | Bacteria | 1459 |
| 652 | Ga0316583_10014727 | 3300032133 | Bacteria | 2816 |
| 653 | Ga0316585_10004713 | 3300032137 | Bacteria | 3818 |
| 654 | Ga0316580_10025297 | 3300032139 | Bacteria | 1835 |
| 655 | Ga0316580_10039072 | 3300032139 | Bacteria | 1467 |
| 656 | Ga0316214_1009449 | 3300033545 | Bacteria | 1316 |
| 657 | Ga0373930_0003956 | 3300034816 | Bacteria | 2383 |
| 658 | Ga0373948_0005514 | 3300034817 | Bacteria | 2056 |
| 659 | Ga0373948_0107981 | 3300034817 | Bacteria | 662 |
| 660 | Ga0373958_0064226 | 3300034819 | Bacteria | 802 |
| 661 | Ga0373938_0034486 | 3300034957 | Bacteria | 1100 |
| 662 | Ga0373926_0002539 | 3300035083 | Bacteria | 5798 |
| 663 | Ga0373926_0003223 | 3300035083 | Bacteria | 5242 |
| 664 | Ga0373926_0070533 | 3300035083 | Bacteria | 1283 |
| 665 | Ga0373928_0013809 | 3300035084 | Bacteria | 1625 |
| 666 | Ga0373929_0070799 | 3300035085 | Bacteria | 833 |
| 667 | Ga0373934_0198101 | 3300035086 | Bacteria | 826 |
| 668 | Ga0373940_0041392 | 3300035088 | Bacteria | 1267 |
| 669 | Ga0373944_0001493 | 3300035089 | Bacteria | 5916 |
| 670 | Ga0373944_0002001 | 3300035089 | Bacteria | 5167 |
| 671 | Ga0373944_0083248 | 3300035089 | Bacteria | 1060 |
| 672 | Ga0373949_0007293 | 3300035090 | Bacteria | 2421 |
| 673 | Ga0373949_0020934 | 3300035090 | Bacteria | 1500 |
| 674 | Ga0373951_0008800 | 3300035091 | Bacteria | 2276 |
| 675 | Ga0373952_0009453 | 3300035092 | Bacteria | 1867 |
| 676 | Ga0373952_0157602 | 3300035092 | Bacteria | 641 |
| 677 | Ga0373923_0003408 | 3300035111 | Bacteria | 5091 |
| 678 | Ga0373923_0009413 | 3300035111 | Bacteria | 3525 |
| 679 | Ga0373923_0029851 | 3300035111 | Bacteria | 2189 |
| 680 | Ga0373923_0132432 | 3300035111 | Bacteria | 1121 |
| 681 | Ga0373936_0001359 | 3300035113 | Bacteria | 8867 |
| 682 | Ga0373936_0010006 | 3300035113 | Bacteria | 3579 |
| 683 | Ga0373936_0015931 | 3300035113 | Bacteria | 2885 |
| 684 | Ga0373936_0080593 | 3300035113 | Bacteria | 1354 |
| 685 | Ga0373936_0180644 | 3300035113 | Bacteria | 925 |
| 686 | Ga0373936_0249560 | 3300035113 | Bacteria | 792 |
| 687 | Ga0373939_0040470 | 3300035114 | Bacteria | 1400 |
| 688 | Ga0373941_0062080 | 3300035115 | Bacteria | 1219 |
| 689 | Ga0373945_0000297 | 3300035116 | Bacteria | 14137 |
| 690 | Ga0373945_0011275 | 3300035116 | Bacteria | 2955 |
| 691 | Ga0373945_0036865 | 3300035116 | Bacteria | 1753 |
| 692 | Ga0373953_0029316 | 3300035117 | Bacteria | 2127 |
| 693 | Ga0373953_0067774 | 3300035117 | Bacteria | 1468 |
| 694 | Ga0373954_0034272 | 3300035118 | Bacteria | 2351 |
| 695 | Ga0373954_0041217 | 3300035118 | Bacteria | 2152 |
| 696 | Ga0373954_0058890 | 3300035118 | Bacteria | 1810 |
| 697 | Ga0373956_0015530 | 3300035119 | Bacteria | 3189 |
| 698 | Ga0373956_0016531 | 3300035119 | Bacteria | 3100 |
| 699 | Ga0373956_0143791 | 3300035119 | Bacteria | 1120 |
| 700 | Ga0373956_0151405 | 3300035119 | Bacteria | 1092 |
| 701 | Ga0373956_0157788 | 3300035119 | Bacteria | 1068 |
| 702 | Ga0373957_0009188 | 3300035120 | Bacteria | 3227 |
| 703 | Ga0373957_0010297 | 3300035120 | Bacteria | 3086 |
| 704 | Ga0373957_0075418 | 3300035120 | Bacteria | 1325 |
| 705 | Ga0373957_0099964 | 3300035120 | Bacteria | 1160 |
| 706 | Ga0373957_0119129 | 3300035120 | Bacteria | 1067 |
| 707 | Ga0373957_0131598 | 3300035120 | Bacteria | 1018 |
| 708 | Ga0373943_0000586 | 3300035170 | Bacteria | 15773 |
| 709 | Ga0373943_0024891 | 3300035170 | Bacteria | 2794 |
| 710 | Ga0373943_0041647 | 3300035170 | Bacteria | 2222 |
| 711 | Ga0373943_0055482 | 3300035170 | Bacteria | 1963 |
| 712 | Ga0373943_0330387 | 3300035170 | Bacteria | 870 |
| 713 | Ga0373946_0000057 | 3300035171 | Bacteria | 29670 |
| 714 | Ga0373946_0001085 | 3300035171 | Bacteria | 9378 |
| 715 | Ga0373946_0222630 | 3300035171 | Bacteria | 911 |
| 716 | Ga0373955_0033814 | 3300035172 | Bacteria | 2694 |
| 717 | Ga0373955_0054523 | 3300035172 | Bacteria | 2186 |
| 718 | Ga0373955_0247270 | 3300035172 | Bacteria | 1069 |
| 719 | Ga0373942_0067104 | 3300035207 | Bacteria | 1040 |
| 720 | Ga0373961_0006331 | 3300035241 | Bacteria | 2846 |
| 721 | Ga0373962_0007765 | 3300035242 | Bacteria | 2633 |
| 722 | Ga0316574_0042351 | 3300035398 | Bacteria | 2809 |
| 723 | Ga0316574_0110048 | 3300035398 | Bacteria | 1765 |
| 724 | Ga0373924_0008137 | 3300035410 | Bacteria | 3799 |
| 725 | Ga0373924_0079678 | 3300035410 | Bacteria | 1391 |
| 726 | Ga0373931_0136292 | 3300035691 | Bacteria | 1418 |
| 727 | Ga0373935_0001547 | 3300035692 | Bacteria | 12811 |
| 728 | Ga0373935_0007043 | 3300035692 | Bacteria | 6711 |
| 729 | Ga0373935_0075463 | 3300035692 | Bacteria | 2181 |
| 730 | Ga0373935_0163014 | 3300035692 | Bacteria | 1520 |
| 731 | Ga0373935_0392627 | 3300035692 | Bacteria | 995 |
| 732 | Ga0373927_0000281 | 3300035695 | Bacteria | 40043 |
| 733 | Ga0373927_0003517 | 3300035695 | Bacteria | 11206 |
| 734 | Ga0373927_0070712 | 3300035695 | Bacteria | 2259 |
| 735 | Ga0373927_0372474 | 3300035695 | Bacteria | 941 |
| 736 | Ga0373933_0005243 | 3300035724 | Bacteria | 7067 |
| 737 | Ga0373933_0013625 | 3300035724 | Bacteria | 4508 |
| 738 | Ga0373933_0168883 | 3300035724 | Bacteria | 1391 |
| 739 | Ga0373947_0000793 | 3300035725 | Bacteria | 19007 |
| 740 | Ga0373947_0107820 | 3300035725 | Bacteria | 1756 |
| 741 | Ga0373937_0021710 | 3300036401 | Bacteria | 5762 |
| 742 | Ga0373937_0041110 | 3300036401 | Bacteria | 4217 |
| 743 | Ga0373937_0067476 | 3300036401 | Bacteria | 3295 |
| 744 | Ga0373937_0090054 | 3300036401 | Bacteria | 2841 |
| 745 | Ga0373937_0111267 | 3300036401 | Bacteria | 2547 |
| 746 | Ga0373937_0133296 | 3300036401 | Bacteria | 2321 |
| 747 | Ga0316582_0077263 | 3300036647 | Bacteria | 2166 |
| 748 | Ga0316584_0028637 | 3300036712 | Bacteria | 4109 |
| 749 | Ga0316584_0434984 | 3300036712 | Bacteria | 930 |
| 750 | Ga0373925_0000010 | 3300037068 | Bacteria | 229059 |
| 751 | Ga0373925_0002499 | 3300037068 | Bacteria | 14689 |
| 752 | Ga0373925_0004092 | 3300037068 | Bacteria | 11068 |
| 753 | Ga0373925_0111049 | 3300037068 | Bacteria | 2118 |
| 754 | Ga0373925_0438788 | 3300037068 | Bacteria | 1068 |
| 755 | Ga0373925_0575413 | 3300037068 | Bacteria | 927 |
| 756 | Ga0395899_0012802 | 3300037312 | Bacteria | 6428 |
| 757 | Ga0395898_0107973 | 3300037466 | Bacteria | 2669 |
| 758 | Ga0316581_0003200 | 3300037588 | Bacteria | 4048 |
| 759 | Ga0436364_0086889 | 3300037853 | Bacteria | 54583 |
| 760 | Ga0436364_0126636 | 3300037853 | Bacteria | 3310 |
| 761 | Ga0436364_0185475 | 3300037853 | Bacteria | 22963 |
| 762 | Ga0436364_0619793 | 3300037853 | Bacteria | 961 |
| 763 | Ga0436364_0808550 | 3300037853 | Bacteria | 1822 |
| 764 | Ga0436364_0856071 | 3300037853 | Bacteria | 4467 |
| 765 | Ga0436364_1062657 | 3300037853 | Bacteria | 1230 |
| 766 | Ga0436364_1454182 | 3300037853 | Bacteria | 2522 |
| 767 | Ga0436364_1532341 | 3300037853 | Bacteria | 1221 |
| 768 | Ga0436364_1551954 | 3300037853 | Bacteria | 6411 |
| 769 | Ga0395901_0349544 | 3300038443 | Bacteria | 1526 |
| 770 | Ga0436365_0416357 | 3300039437 | Bacteria | 1347 |
| 771 | Ga0436365_1735070 | 3300039437 | Bacteria | 3242 |
| 772 | Ga0436365_1876546 | 3300039437 | Bacteria | 1163 |
| 773 | Ga0436360_0268015 | 3300039438 | Bacteria | 1019 |
| 774 | Ga0436360_0523160 | 3300039438 | Bacteria | 840 |
| 775 | Ga0436361_0093002 | 3300039447 | Bacteria | 5954 |
| 776 | Ga0436361_0243554 | 3300039447 | Bacteria | 21209 |
| 777 | Ga0436361_0252460 | 3300039447 | Bacteria | 41857 |
| 778 | Ga0436361_0544822 | 3300039447 | Bacteria | 3133 |
| 779 | Ga0436361_0713206 | 3300039447 | Bacteria | 50586 |
| 780 | Ga0436361_1214844 | 3300039447 | Bacteria | 1546 |
| 781 | Ga0436363_0240533 | 3300039450 | Bacteria | 934 |
| 782 | Ga0436363_0317507 | 3300039450 | Bacteria | 1531 |
| 783 | Ga0436363_0335771 | 3300039450 | Bacteria | 848 |
| 784 | Ga0436363_0346977 | 3300039450 | Bacteria | 3312 |
| 785 | Ga0436363_0898809 | 3300039450 | Bacteria | 701 |
| 786 | Ga0436362_0235271 | 3300039453 | Bacteria | 629 |
| 787 | Ga0436362_0259253 | 3300039453 | Bacteria | 1403 |
| 788 | Ga0436362_0763677 | 3300039453 | Bacteria | 1593 |
| 789 | Ga0439465_0184107 | 3300041413 | Bacteria | 757 |
| 790 | Ga0451793_0234405 | 3300041452 | Bacteria | 681 |
| 791 | Ga0439448_0005040 | 3300042005 | Bacteria | 3752 |
| 792 | Ga0439463_008572 | 3300042016 | Bacteria | 2519 |
| 793 | Ga0439459_0005483 | 3300042438 | Bacteria | 2087 |
| 794 | Ga0439464_0023355 | 3300042439 | Bacteria | 1707 |
| 795 | Ga0451577_0511143 | 3300042876 | Bacteria | 1091 |
| 796 | Ga0466969_0358801 | 3300044656 | Bacteria | 660 |
| 797 | Ga0466965_0084437 | 3300044683 | Bacteria | 1608 |
| 798 | Ga0466966_0026836 | 3300044684 | Bacteria | 3758 |
| 799 | Ga0466966_0233662 | 3300044684 | Bacteria | 1109 |
| 800 | Ga0466966_0436822 | 3300044684 | Bacteria | 787 |
| 801 | Ga0466961_0198648 | 3300044693 | Bacteria | 1241 |
| 802 | Ga0466963_0014068 | 3300044694 | Bacteria | 4930 |
| 803 | Ga0466963_0036396 | 3300044694 | Bacteria | 3210 |
| 804 | Ga0466963_0070588 | 3300044694 | Bacteria | 2350 |
| 805 | Ga0466963_0218557 | 3300044694 | Bacteria | 1334 |
| 806 | Ga0466963_0251220 | 3300044694 | Bacteria | 1241 |
| 807 | Ga0466963_0260855 | 3300044694 | Bacteria | 1217 |
| 808 | Ga0466963_0351984 | 3300044694 | Bacteria | 1037 |
| 809 | Ga0466963_0384390 | 3300044694 | Bacteria | 989 |
| 810 | Ga0466963_0786460 | 3300044694 | Bacteria | 671 |
| 811 | Ga0466964_0010074 | 3300044706 | Bacteria | 3562 |
| 812 | Ga0466971_0019885 | 3300044719 | Bacteria | 2983 |
| 813 | Ga0466968_0098215 | 3300044735 | Bacteria | 1305 |
| 814 | Ga0466970_0028223 | 3300044765 | Bacteria | 2948 |
| 815 | Ga0466957_0029563 | 3300044842 | Bacteria | 3268 |
| 816 | Ga0466957_0200466 | 3300044842 | Bacteria | 1311 |
| 817 | Ga0466957_0238925 | 3300044842 | Bacteria | 1205 |
| 818 | Ga0466957_0600153 | 3300044842 | Bacteria | 771 |
| 819 | Ga0466959_0343740 | 3300045049 | Bacteria | 1018 |
| 820 | Ga0466959_0772027 | 3300045049 | Bacteria | 643 |
| 821 | Ga0451576_0032011 | 3300045051 | Bacteria | 5605 |
| 822 | Ga0451576_0046228 | 3300045051 | Bacteria | 4584 |
| 823 | Ga0451576_0075340 | 3300045051 | Bacteria | 3511 |
| 824 | Ga0451576_0967594 | 3300045051 | Bacteria | 892 |
| 825 | Ga0466958_0009996 | 3300045836 | Bacteria | 5300 |
| 826 | Ga0466958_0299276 | 3300045836 | Bacteria | 1033 |
| 827 | Ga0466958_0418585 | 3300045836 | Bacteria | 866 |
| 828 | Ga0466967_0030521 | 3300045976 | Bacteria | 4525 |
| 829 | Ga0466967_0032541 | 3300045976 | Bacteria | 4404 |
| 830 | Ga0466967_0038983 | 3300045976 | Bacteria | 4080 |
| 831 | Ga0466967_0053580 | 3300045976 | Bacteria | 3546 |
| 832 | Ga0466967_0115842 | 3300045976 | Bacteria | 2468 |
| 833 | Ga0466967_0129438 | 3300045976 | Bacteria | 2341 |
| 834 | Ga0466967_0151922 | 3300045976 | Bacteria | 2165 |
| 835 | Ga0466967_0172715 | 3300045976 | Bacteria | 2034 |
| 836 | Ga0466967_0283298 | 3300045976 | Bacteria | 1590 |
| 837 | Ga0466967_0362362 | 3300045976 | Bacteria | 1405 |
| 838 | Ga0466967_0607829 | 3300045976 | Bacteria | 1079 |
| 839 | Ga0495592_0011211 | 3300046454 | Bacteria | 6775 |
| 840 | Ga0495592_0014634 | 3300046454 | Bacteria | 5955 |
| 841 | Ga0495592_0026981 | 3300046454 | Bacteria | 4354 |
| 842 | Ga0495592_0097562 | 3300046454 | Bacteria | 2098 |
| 843 | Ga0495592_0628200 | 3300046454 | Bacteria | 653 |
| 844 | Ga0495603_0001542 | 3300046455 | Bacteria | 13475 |
| 845 | Ga0495603_0319260 | 3300046455 | Bacteria | 892 |
| 846 | Ga0495629_0066774 | 3300046459 | Bacteria | 2510 |
| 847 | Ga0495641_0009648 | 3300046461 | Bacteria | 5709 |
| 848 | Ga0495641_0015388 | 3300046461 | Bacteria | 4087 |
| 849 | Ga0495641_0028856 | 3300046461 | Bacteria | 2680 |
| 850 | Ga0495651_0000988 | 3300046462 | Bacteria | 22080 |
| 851 | Ga0495651_0030191 | 3300046462 | Bacteria | 4226 |
| 852 | Ga0495651_0040334 | 3300046462 | Bacteria | 3631 |
| 853 | Ga0495651_0058122 | 3300046462 | Bacteria | 2967 |
| 854 | Ga0495651_0267878 | 3300046462 | Bacteria | 1159 |
| 855 | Ga0495653_0009692 | 3300046463 | Bacteria | 7875 |
| 856 | Ga0495653_0017917 | 3300046463 | Bacteria | 5758 |
| 857 | Ga0495653_0018553 | 3300046463 | Bacteria | 5647 |
| 858 | Ga0495653_0029872 | 3300046463 | Bacteria | 4344 |
| 859 | Ga0495653_0118413 | 3300046463 | Bacteria | 1891 |
| 860 | Ga0495653_0222626 | 3300046463 | Bacteria | 1268 |
| 861 | Ga0495653_0334798 | 3300046463 | Bacteria | 977 |
| 862 | Ga0495580_0006434 | 3300046472 | Bacteria | 9563 |
| 863 | Ga0495582_0033962 | 3300046473 | Bacteria | 2804 |
| 864 | Ga0495582_0094148 | 3300046473 | Bacteria | 1672 |
| 865 | Ga0495639_0001019 | 3300046475 | Bacteria | 12672 |
| 866 | Ga0495639_0032417 | 3300046475 | Bacteria | 2330 |
| 867 | Ga0495662_0001001 | 3300046476 | Bacteria | 13829 |
| 868 | Ga0495662_0014145 | 3300046476 | Bacteria | 3883 |
| 869 | Ga0495664_0001381 | 3300046477 | Bacteria | 12822 |
| 870 | Ga0495664_0021958 | 3300046477 | Bacteria | 3691 |
| 871 | Ga0495664_0056139 | 3300046477 | Bacteria | 2342 |
| 872 | Ga0495664_0109830 | 3300046477 | Bacteria | 1664 |
| 873 | Ga0495664_0149578 | 3300046477 | Bacteria | 1416 |
| 874 | Ga0495664_0398954 | 3300046477 | Bacteria | 826 |
| 875 | Ga0495594_0107515 | 3300046499 | Bacteria | 1571 |
| 876 | Ga0495608_0008266 | 3300046511 | Bacteria | 7305 |
| 877 | Ga0495608_0016336 | 3300046511 | Bacteria | 5135 |
| 878 | Ga0495608_0017916 | 3300046511 | Bacteria | 4895 |
| 879 | Ga0495608_0050684 | 3300046511 | Bacteria | 2753 |
| 880 | Ga0495608_0094606 | 3300046511 | Bacteria | 1930 |
| 881 | Ga0495608_0110387 | 3300046511 | Bacteria | 1768 |
| 882 | Ga0495618_0020849 | 3300046514 | Bacteria | 4034 |
| 883 | Ga0495618_0032056 | 3300046514 | Bacteria | 3291 |
| 884 | Ga0495618_0063487 | 3300046514 | Bacteria | 2345 |
| 885 | Ga0495628_0043331 | 3300046516 | Bacteria | 3585 |
| 886 | Ga0495628_0066740 | 3300046516 | Bacteria | 2812 |
| 887 | Ga0495628_0072123 | 3300046516 | Bacteria | 2691 |
| 888 | Ga0495628_0100645 | 3300046516 | Bacteria | 2231 |
| 889 | Ga0495628_0172342 | 3300046516 | Bacteria | 1640 |
| 890 | Ga0495630_0001525 | 3300046517 | Bacteria | 16047 |
| 891 | Ga0495630_0079311 | 3300046517 | Bacteria | 2477 |
| 892 | Ga0495630_0098520 | 3300046517 | Bacteria | 2211 |
| 893 | Ga0495630_0736346 | 3300046517 | Bacteria | 754 |
| 894 | Ga0495666_0005147 | 3300046526 | Bacteria | 6608 |
| 895 | Ga0495652_0002356 | 3300046529 | Bacteria | 19600 |
| 896 | Ga0495652_0052444 | 3300046529 | Bacteria | 3479 |
| 897 | Ga0495652_0161445 | 3300046529 | Bacteria | 1739 |
| 898 | Ga0495665_0003599 | 3300046531 | Bacteria | 8410 |
| 899 | Ga0495665_0024404 | 3300046531 | Bacteria | 3248 |
| 900 | Ga0495665_0059679 | 3300046531 | Bacteria | 2014 |
| 901 | Ga0495665_0145671 | 3300046531 | Bacteria | 1237 |
| 902 | Ga0495640_0015485 | 3300046533 | Bacteria | 5737 |
| 903 | Ga0495640_0020693 | 3300046533 | Bacteria | 4839 |
| 904 | Ga0495640_0076610 | 3300046533 | Bacteria | 2231 |
| 905 | Ga0495640_0086195 | 3300046533 | Bacteria | 2080 |
| 906 | Ga0495640_0109391 | 3300046533 | Bacteria | 1807 |
| 907 | Ga0495640_0181418 | 3300046533 | Bacteria | 1341 |
| 908 | Ga0495586_0024803 | 3300046535 | Bacteria | 3206 |
| 909 | Ga0495586_0120672 | 3300046535 | Bacteria | 1464 |
| 910 | Ga0495587_0002976 | 3300046536 | Bacteria | 11324 |
| 911 | Ga0495587_0013878 | 3300046536 | Bacteria | 5058 |
| 912 | Ga0495587_0043414 | 3300046536 | Bacteria | 2677 |
| 913 | Ga0495587_0059442 | 3300046536 | Bacteria | 2243 |
| 914 | Ga0495645_0004607 | 3300046543 | Bacteria | 9411 |
| 915 | Ga0495645_0029669 | 3300046543 | Bacteria | 3979 |
| 916 | Ga0495645_0037957 | 3300046543 | Bacteria | 3512 |
| 917 | Ga0495645_0049793 | 3300046543 | Bacteria | 3050 |
| 918 | Ga0495645_0088315 | 3300046543 | Bacteria | 2217 |
| 919 | Ga0495645_0112913 | 3300046543 | Bacteria | 1921 |
| 920 | Ga0495622_0091930 | 3300046557 | Bacteria | 1394 |
| 921 | Ga0495667_0000281 | 3300046559 | Bacteria | 33057 |
| 922 | Ga0495667_0014235 | 3300046559 | Bacteria | 5372 |
| 923 | Ga0495667_0019494 | 3300046559 | Bacteria | 4577 |
| 924 | Ga0495667_0039509 | 3300046559 | Bacteria | 3137 |
| 925 | Ga0495667_0070214 | 3300046559 | Bacteria | 2285 |
| 926 | Ga0495667_0080633 | 3300046559 | Bacteria | 2115 |
| 927 | Ga0495634_0014957 | 3300046642 | Bacteria | 5579 |
| 928 | Ga0495634_0109734 | 3300046642 | Bacteria | 1775 |
| 929 | Ga0495634_0117995 | 3300046642 | Bacteria | 1701 |
| 930 | Ga0495635_0001647 | 3300046663 | Bacteria | 15061 |
| 931 | Ga0495635_0008531 | 3300046663 | Bacteria | 7158 |
| 932 | Ga0495635_0011143 | 3300046663 | Bacteria | 6303 |
| 933 | Ga0495635_0047497 | 3300046663 | Bacteria | 2960 |
| 934 | Ga0495635_0130039 | 3300046663 | Bacteria | 1716 |
| 935 | Ga0495635_0598376 | 3300046663 | Bacteria | 720 |
| 936 | Ga0495588_0187629 | 3300046674 | Bacteria | 1092 |
| 937 | Ga0495657_0000699 | 3300046675 | Bacteria | 30085 |
| 938 | Ga0495657_0011552 | 3300046675 | Bacteria | 6599 |
| 939 | Ga0495657_0034780 | 3300046675 | Bacteria | 3497 |
| 940 | Ga0495657_0059801 | 3300046675 | Bacteria | 2526 |
| 941 | Ga0495657_0122012 | 3300046675 | Bacteria | 1640 |
| 942 | Ga0495599_0017239 | 3300046678 | Bacteria | 4489 |
| 943 | Ga0495599_0064954 | 3300046678 | Bacteria | 2280 |
| 944 | Ga0495599_0066985 | 3300046678 | Bacteria | 2243 |
| 945 | Ga0495599_0465465 | 3300046678 | Bacteria | 747 |
| 946 | Ga0495623_0006098 | 3300046679 | Bacteria | 7840 |
| 947 | Ga0495623_0331807 | 3300046679 | Bacteria | 833 |
| 948 | Ga0495646_0019122 | 3300046680 | Bacteria | 4337 |
| 949 | Ga0495646_0081931 | 3300046680 | Bacteria | 1878 |
| 950 | Ga0495646_0191063 | 3300046680 | Bacteria | 1119 |
| 951 | Ga0495647_0006394 | 3300046681 | Bacteria | 3898 |
| 952 | Ga0495658_0001135 | 3300046683 | Bacteria | 14067 |
| 953 | Ga0495613_0039267 | 3300046689 | Bacteria | 3509 |
| 954 | Ga0495613_0047507 | 3300046689 | Bacteria | 3171 |
| 955 | Ga0495624_0010905 | 3300046690 | Bacteria | 6265 |
| 956 | Ga0495624_0019973 | 3300046690 | Bacteria | 4464 |
| 957 | Ga0495624_0120801 | 3300046690 | Bacteria | 1609 |
| 958 | Ga0495624_0167960 | 3300046690 | Bacteria | 1339 |
| 959 | Ga0495624_0358751 | 3300046690 | Bacteria | 876 |
| 960 | Ga0495600_0003393 | 3300046809 | Bacteria | 9373 |
| 961 | Ga0495600_0004762 | 3300046809 | Bacteria | 8140 |
| 962 | Ga0495600_0019972 | 3300046809 | Bacteria | 4282 |
| 963 | Ga0495600_0061635 | 3300046809 | Bacteria | 2450 |
| 964 | Ga0495600_0076617 | 3300046809 | Bacteria | 2184 |
| 965 | Ga0495600_0102794 | 3300046809 | Bacteria | 1862 |
| 966 | Ga0495600_0119663 | 3300046809 | Bacteria | 1713 |
| 967 | Ga0495581_0000621 | 3300047315 | Bacteria | 18604 |
| 968 | Ga0495581_0044797 | 3300047315 | Bacteria | 2558 |
| 969 | Ga0495581_0180173 | 3300047315 | Bacteria | 1235 |
| 970 | Ga0495604_0007650 | 3300047317 | Bacteria | 8557 |
| 971 | Ga0495604_0014318 | 3300047317 | Bacteria | 6324 |
| 972 | Ga0495604_0067564 | 3300047317 | Bacteria | 2715 |
| 973 | Ga0495604_0235785 | 3300047317 | Bacteria | 1253 |
| 974 | Ga0495604_0372161 | 3300047317 | Bacteria | 945 |
| 975 | Ga0495674_0001430 | 3300047319 | Bacteria | 23388 |
| 976 | Ga0495674_0010716 | 3300047319 | Bacteria | 8671 |
| 977 | Ga0495674_0029043 | 3300047319 | Bacteria | 5037 |
| 978 | Ga0495674_0044503 | 3300047319 | Bacteria | 3946 |
| 979 | Ga0495674_0158802 | 3300047319 | Bacteria | 1892 |
| 980 | Ga0495676_0001791 | 3300047321 | Bacteria | 18771 |
| 981 | Ga0495676_0047778 | 3300047321 | Bacteria | 3456 |
| 982 | Ga0495676_0145110 | 3300047321 | Bacteria | 1696 |
| 983 | Ga0495676_0334576 | 3300047321 | Bacteria | 1015 |
| 984 | Ga0495680_0012668 | 3300047322 | Bacteria | 7405 |
| 985 | Ga0495680_0043195 | 3300047322 | Bacteria | 3570 |
| 986 | Ga0495680_0045877 | 3300047322 | Bacteria | 3448 |
| 987 | Ga0495680_0069396 | 3300047322 | Bacteria | 2689 |
| 988 | Ga0495680_0126836 | 3300047322 | Bacteria | 1878 |
| 989 | Ga0495680_0415956 | 3300047322 | Bacteria | 926 |
| 990 | Ga0495675_0034315 | 3300047444 | Bacteria | 3239 |
| 991 | Ga0495675_0043942 | 3300047444 | Bacteria | 2846 |
| 992 | Ga0495675_0069792 | 3300047444 | Bacteria | 2218 |
| 993 | Ga0495684_0004466 | 3300047471 | Bacteria | 10934 |
| 994 | Ga0495684_0019054 | 3300047471 | Bacteria | 5283 |
| 995 | Ga0495684_0023722 | 3300047471 | Bacteria | 4717 |
| 996 | Ga0495684_0031990 | 3300047471 | Bacteria | 4038 |
| 997 | Ga0495684_0036530 | 3300047471 | Bacteria | 3765 |
| 998 | Ga0495684_0079380 | 3300047471 | Bacteria | 2491 |
| 999 | Ga0495684_0098749 | 3300047471 | Bacteria | 2207 |
| 1000 | Ga0495593_0004888 | 3300047673 | Bacteria | 7952 |
| 1001 | Ga0495593_0070890 | 3300047673 | Bacteria | 1810 |
| 1002 | Ga0495593_0170629 | 3300047673 | Bacteria | 1097 |
| 1003 | Ga0495593_0271397 | 3300047673 | Bacteria | 849 |
| 1004 | Ga0495602_0032207 | 3300048088 | Bacteria | 4940 |
| 1005 | Ga0495602_0040638 | 3300048088 | Bacteria | 4260 |
| 1006 | Ga0495602_0095720 | 3300048088 | Bacteria | 2450 |
| 1007 | Ga0495602_0168960 | 3300048088 | Bacteria | 1699 |
| 1008 | Ga0495602_0226456 | 3300048088 | Bacteria | 1407 |
| 1009 | Ga0495602_0242236 | 3300048088 | Bacteria | 1348 |
| 1010 | Ga0495614_0131512 | 3300048089 | Bacteria | 1108 |
| 1011 | Ga0496101_0030719 | 3300048904 | Bacteria | 3770 |
| 1012 | Ga0496101_0622115 | 3300048904 | Bacteria | 853 |
| 1013 | Ga0496102_0001790 | 3300048905 | Bacteria | 18631 |
| 1014 | Ga0496102_0051731 | 3300048905 | Bacteria | 3742 |
| 1015 | Ga0496102_0225854 | 3300048905 | Bacteria | 1765 |
| 1016 | Ga0496102_0317064 | 3300048905 | Bacteria | 1469 |
| 1017 | Ga0496102_0425991 | 3300048905 | Bacteria | 1246 |
| 1018 | Ga0496102_0464116 | 3300048905 | Bacteria | 1187 |
| 1019 | Ga0496102_0541798 | 3300048905 | Bacteria | 1086 |
| 1020 | Ga0496102_1258848 | 3300048905 | Bacteria | 659 |
| 1021 | Ga0496103_0011682 | 3300048906 | Bacteria | 5209 |
| 1022 | Ga0496103_0137352 | 3300048906 | Bacteria | 1562 |
| 1023 | Ga0496103_0625719 | 3300048906 | Bacteria | 685 |
| 1024 | Ga0496104_0039664 | 3300048907 | Bacteria | 4409 |
| 1025 | Ga0496104_0201968 | 3300048907 | Bacteria | 1900 |
| 1026 | Ga0496104_0269906 | 3300048907 | Bacteria | 1614 |
| 1027 | Ga0496105_0008133 | 3300048908 | Bacteria | 8156 |
| 1028 | Ga0496105_0032462 | 3300048908 | Bacteria | 4284 |
| 1029 | Ga0496105_0128409 | 3300048908 | Bacteria | 2090 |
| 1030 | Ga0496106_0251586 | 3300048909 | Bacteria | 1413 |
| 1031 | Ga0496107_0215010 | 3300048910 | Bacteria | 1430 |
| 1032 | Ga0496107_0269747 | 3300048910 | Bacteria | 1266 |
| 1033 | Ga0496107_0276674 | 3300048910 | Bacteria | 1249 |
| 1034 | Ga0496107_0404873 | 3300048910 | Bacteria | 1014 |
| 1035 | Ga0496108_0051442 | 3300048911 | Bacteria | 3451 |
| 1036 | Ga0496108_0225042 | 3300048911 | Bacteria | 1630 |
| 1037 | Ga0496109_0005843 | 3300048912 | Bacteria | 10321 |
| 1038 | Ga0496109_0005860 | 3300048912 | Bacteria | 10301 |
| 1039 | Ga0496109_0013452 | 3300048912 | Bacteria | 7098 |
| 1040 | Ga0496109_0117097 | 3300048912 | Bacteria | 2480 |
| 1041 | Ga0496109_0284445 | 3300048912 | Bacteria | 1559 |
| 1042 | Ga0496109_0655338 | 3300048912 | Bacteria | 987 |
| 1043 | Ga0496110_0057883 | 3300048913 | Bacteria | 3413 |
| 1044 | Ga0496110_0118043 | 3300048913 | Bacteria | 2389 |
| 1045 | Ga0496110_0226602 | 3300048913 | Bacteria | 1699 |
| 1046 | Ga0496110_0230982 | 3300048913 | Bacteria | 1683 |
| 1047 | Ga0496110_0277317 | 3300048913 | Bacteria | 1526 |
| 1048 | Ga0496110_0299314 | 3300048913 | Bacteria | 1465 |
| 1049 | Ga0496110_0404083 | 3300048913 | Bacteria | 1245 |
| 1050 | Ga0496111_0033994 | 3300048914 | Bacteria | 3638 |
| 1051 | Ga0496111_0206959 | 3300048914 | Bacteria | 1458 |
| 1052 | Ga0496111_0457945 | 3300048914 | Bacteria | 941 |
| 1053 | Ga0496112_0055476 | 3300048915 | Bacteria | 3896 |
| 1054 | Ga0496112_0069559 | 3300048915 | Bacteria | 3477 |
| 1055 | Ga0496112_0635941 | 3300048915 | Unclassified | 997 |
| 1056 | Ga0496113_0054854 | 3300048916 | Bacteria | 2985 |
| 1057 | Ga0496113_0062106 | 3300048916 | Bacteria | 2821 |
| 1058 | Ga0496113_0225592 | 3300048916 | Bacteria | 1493 |
| 1059 | Ga0496113_0483026 | 3300048916 | Bacteria | 995 |
| 1060 | Ga0496114_0015245 | 3300048917 | Bacteria | 6178 |
| 1061 | Ga0496114_0158246 | 3300048917 | Bacteria | 1968 |
| 1062 | Ga0496114_0336321 | 3300048917 | Bacteria | 1335 |
| 1063 | Ga0496115_0038198 | 3300048918 | Bacteria | 3808 |
| 1064 | Ga0496117_0046447 | 3300048920 | Bacteria | 3123 |
| 1065 | Ga0496118_0002074 | 3300048921 | Bacteria | 28208 |
| 1066 | Ga0496118_0046283 | 3300048921 | Bacteria | 3387 |
| 1067 | Ga0496121_0018108 | 3300048924 | Bacteria | 7127 |
| 1068 | Ga0496126_0000006 | 3300048929 | Bacteria | 798804 |
| 1069 | Ga0496126_0032512 | 3300048929 | Bacteria | 4914 |
| 1070 | Ga0496126_0087547 | 3300048929 | Bacteria | 2744 |
| 1071 | Ga0501032_0002413 | 3300049569 | Bacteria | 14579 |
| 1072 | Ga0501034_0106793 | 3300049571 | Bacteria | 2792 |
| 1073 | Ga0501034_0814480 | 3300049571 | Bacteria | 826 |
| 1074 | Ga0501036_0008211 | 3300049572 | Bacteria | 8559 |
| 1075 | Ga0501037_0001399 | 3300049573 | Bacteria | 17692 |
| 1076 | Ga0501038_0017389 | 3300049574 | Bacteria | 6499 |
| 1077 | Ga0501039_0084890 | 3300049575 | Bacteria | 2466 |
| 1078 | Ga0501040_0248097 | 3300049576 | Bacteria | 1270 |
| 1079 | Ga0501040_0401884 | 3300049576 | Bacteria | 984 |
| 1080 | Ga0501042_0012475 | 3300049578 | Bacteria | 5759 |
| 1081 | Ga0501042_0039968 | 3300049578 | Bacteria | 3335 |
| 1082 | Ga0501043_0028533 | 3300049579 | Bacteria | 4381 |
| 1083 | Ga0501046_0002036 | 3300049580 | Bacteria | 19203 |
| 1084 | Ga0501047_0326284 | 3300049581 | Bacteria | 1374 |
| 1085 | Ga0501048_0027539 | 3300049582 | Bacteria | 4129 |
| 1086 | Ga0501067_0092376 | 3300049583 | Bacteria | 1680 |
| 1087 | Ga0501069_0184213 | 3300049585 | Bacteria | 1207 |
| 1088 | Ga0501069_0265471 | 3300049585 | Bacteria | 1003 |
| 1089 | Ga0501070_0014917 | 3300049586 | Bacteria | 6535 |
| 1090 | Ga0501070_0025886 | 3300049586 | Bacteria | 4922 |
| 1091 | Ga0501070_0182125 | 3300049586 | Bacteria | 1729 |
| 1092 | Ga0501070_0201323 | 3300049586 | Bacteria | 1635 |
| 1093 | Ga0501070_0244155 | 3300049586 | Bacteria | 1470 |
| 1094 | Ga0501073_0126280 | 3300049589 | Bacteria | 1773 |
| 1095 | Ga0501074_0670541 | 3300049590 | Bacteria | 732 |
| 1096 | Ga0501076_0304547 | 3300049592 | Bacteria | 1307 |
| 1097 | Ga0501080_0016540 | 3300049742 | Bacteria | 6815 |
| 1098 | Ga0501080_0286657 | 3300049742 | Bacteria | 1496 |
| 1099 | Ga0501035_0066662 | 3300049822 | Bacteria | 3195 |
| 1100 | Ga0501044_0106860 | 3300049823 | Bacteria | 2810 |
| 1101 | Ga0501044_0224766 | 3300049823 | Bacteria | 1827 |
| 1102 | Ga0501212_039101 | 3300049851 | Bacteria | 781 |
| 1103 | nmdc:mga05p37_8499_c1 | 3300050507 | Bacteria | 12134 |
| 1104 | nmdc:mga0n895_1059271_c1 | 3300050512 | Bacteria | 790 |
| 1105 | nmdc:mga0n895_430831_c1 | 3300050512 | Bacteria | 1333 |
| 1106 | nmdc:mga0n895_70282_c1 | 3300050512 | Bacteria | 3470 |
| 1107 | nmdc:mga0rr50_163833_c1 | 3300050513 | Bacteria | 1806 |
| 1108 | nmdc:mga0rr50_229511_c1 | 3300050513 | Bacteria | 1535 |
| 1109 | nmdc:mga0rr50_289741_c1 | 3300050513 | Bacteria | 1368 |
| 1110 | nmdc:mga0rr50_39290_c1 | 3300050513 | Bacteria | 3431 |
| 1111 | nmdc:mga08x19_103235_c1 | 3300050514 | Bacteria | 1894 |
| 1112 | nmdc:mga08x19_272291_c1 | 3300050514 | Bacteria | 1172 |
| 1113 | nmdc:mga08x19_427776_c1 | 3300050514 | Bacteria | 930 |
| 1114 | nmdc:mga0a205_34897_c1 | 3300050515 | Bacteria | 4828 |
| 1115 | nmdc:mga0a205_45595_c1 | 3300050515 | Bacteria | 4228 |
| 1116 | nmdc:mga0a205_8628_c1 | 3300050515 | Bacteria | 9273 |
| 1117 | Ga0495601_0028210 | 3300053077 | Bacteria | 3475 |
| 1118 | Ga0495601_0047384 | 3300053077 | Bacteria | 2706 |
| 1119 | Ga0495601_0070549 | 3300053077 | Bacteria | 2230 |
| 1120 | Ga0495612_0041563 | 3300053078 | Bacteria | 1875 |
| 1121 | Ga0495612_0387637 | 3300053078 | Bacteria | 634 |
| 1122 | Ga0495595_0026070 | 3300053084 | Bacteria | 2594 |
| 1123 | Ga0495595_0171667 | 3300053084 | Bacteria | 1073 |
| 1124 | Ga0495595_0457617 | 3300053084 | Bacteria | 649 |
| 1125 | Ga0495619_0022384 | 3300053085 | Bacteria | 4044 |
| 1126 | Ga0495619_0080226 | 3300053085 | Bacteria | 2196 |
| 1127 | Ga0500643_000249 | 3300053087 | Bacteria | 49554 |
| 1128 | Ga0500559_0378215 | 3300053136 | Bacteria | 660 |
| 1129 | Ga0466962_0039503 | 3300061719 | Bacteria | 2260 |
| 1130 | Ga0466962_0076422 | 3300061719 | Bacteria | 1600 |
| 1131 | 2508677875 | 2508501039 | Bacteria | 9978592 |
| 1132 | 2676203405 | 2675902999 | Bacteria | 9438463 |
| 1133 | 2774847981 | 2773857921 | Bacteria | 9435764 |
| 1134 | 8002780693 | 8002775197 | Bacteria | 10728764 |
| 1135 | Ga0157372_10000079 | |||
| 1136 | JGI24752J21851_1006611 | |||
| 1137 | JGI24740J21852_10041227 | |||
| 1138 | JGI24735J21928_10016508 | |||
| 1139 | JGI24735J21928_10060750 | |||
| 1140 | JGI24735J21928_10130548 | |||
| 1141 | JGI24738J21930_10030090 | |||
| 1142 | JGI24751J29686_10026360 | |||
| 1143 | JGI25404J52841_10001653 | |||
| 1144 | JGI25405J52794_10071817 | |||
| 1145 | Ga0070658_10000487 | |||
| 1146 | Ga0070658_10028327 | |||
| 1147 | Ga0070658_10114212 | |||
| 1148 | Ga0070658_10133914 | |||
| 1149 | Ga0070658_10532635 | |||
| 1150 | Ga0070683_100011055 | |||
| 1151 | Ga0070683_100059197 | |||
| 1152 | Ga0070690_100223130 | |||
| 1153 | Ga0070670_100090582 | |||
| 1154 | Ga0070670_101208269 | |||
| 1155 | Ga0068869_100008036 | |||
| 1156 | Ga0070666_10014264 | |||
| 1157 | Ga0070666_10288133 | |||
| 1158 | Ga0070666_10330473 | |||
| 1159 | Ga0070680_100001431 | |||
| 1160 | Ga0070680_100044515 | |||
| 1161 | Ga0070680_100044868 | |||
| 1162 | Ga0070680_100091216 | |||
| 1163 | Ga0070682_100015871 | |||
| 1164 | Ga0070682_100035284 | |||
| 1165 | Ga0068868_100036194 | |||
| 1166 | Ga0070660_100037332 | |||
| 1167 | Ga0070660_100059907 | |||
| 1168 | Ga0070660_100122987 | |||
| 1169 | Ga0070660_100204200 | |||
| 1170 | Ga0070660_100286244 | |||
| 1171 | Ga0070660_100307793 | |||
| 1172 | Ga0070660_100477491 | |||
| 1173 | Ga0070689_100170343 | |||
| 1174 | Ga0070689_100222819 | |||
| 1175 | Ga0070691_10038273 | |||
| 1176 | Ga0070687_100013219 | |||
| 1177 | Ga0070661_100078528 | |||
| 1178 | Ga0070661_100126123 | |||
| 1179 | Ga0070692_10016924 | |||
| 1180 | Ga0070669_100064695 | |||
| 1181 | Ga0070669_100496605 | |||
| 1182 | Ga0070675_100027728 | |||
| 1183 | Ga0070675_100058546 | |||
| 1184 | Ga0070671_100105064 | |||
| 1185 | Ga0070671_100655653 | |||
| 1186 | Ga0070674_100709616 | |||
| 1187 | Ga0070673_100014767 | |||
| 1188 | Ga0070673_100176885 | |||
| 1189 | Ga0070688_100051412 | |||
| 1190 | Ga0070659_100018870 | |||
| 1191 | Ga0070659_100060032 | |||
| 1192 | Ga0070659_100282308 | |||
| 1193 | Ga0070667_100010113 | |||
| 1194 | Ga0070667_100174356 | |||
| 1195 | Ga0070667_100507605 | |||
| 1196 | Ga0070709_10000736 | |||
| 1197 | Ga0070709_10017800 | |||
| 1198 | Ga0070709_10018247 | |||
| 1199 | Ga0070709_10032043 | |||
| 1200 | Ga0070709_10049966 | |||
| 1201 | Ga0070709_10054344 | |||
| 1202 | Ga0070709_10163538 | |||
| 1203 | Ga0070709_10264710 | |||
| 1204 | Ga0070709_10341849 | |||
| 1205 | Ga0070714_100000077 | |||
| 1206 | Ga0070714_100002661 | |||
| 1207 | Ga0070714_100015129 | |||
| 1208 | Ga0070714_100042187 | |||
| 1209 | Ga0070714_100063180 | |||
| 1210 | Ga0070714_100063595 | |||
| 1211 | Ga0070714_100082211 | |||
| 1212 | Ga0070714_100147849 | |||
| 1213 | Ga0070714_100690399 | |||
| 1214 | Ga0070713_100014067 | |||
| 1215 | Ga0070713_100047355 | |||
| 1216 | Ga0070713_100152748 | |||
| 1217 | Ga0070713_100363629 | |||
| 1218 | Ga0070713_100398893 | |||
| 1219 | Ga0070710_10000278 | |||
| 1220 | Ga0070710_10006014 | |||
| 1221 | Ga0070710_10062633 | |||
| 1222 | Ga0070710_10107133 | |||
| 1223 | Ga0070710_10340173 | |||
| 1224 | Ga0070710_10346218 | |||
| 1225 | Ga0070710_10417615 | |||
| 1226 | Ga0070701_10471456 | |||
| 1227 | Ga0070711_100007809 | |||
| 1228 | Ga0070711_100015296 | |||
| 1229 | Ga0070711_100017937 | |||
| 1230 | Ga0070711_100073692 | |||
| 1231 | Ga0070711_100087060 | |||
| 1232 | Ga0070711_100464958 | |||
| 1233 | Ga0070705_100020896 | |||
| 1234 | Ga0070705_100113260 | |||
| 1235 | Ga0070705_100376366 | |||
| 1236 | Ga0070700_100000007 | |||
| 1237 | Ga0070700_100020294 | |||
| 1238 | Ga0070694_100014480 | |||
| 1239 | Ga0070694_100253878 | |||
| 1240 | Ga0070694_100649153 | |||
| 1241 | Ga0070708_100217625 | |||
| 1242 | Ga0070708_100503207 | |||
| 1243 | Ga0070708_100628616 | |||
| 1244 | Ga0070663_100008289 | |||
| 1245 | Ga0070663_100017694 | |||
| 1246 | Ga0070663_100491511 | |||
| 1247 | Ga0070663_100664640 | |||
| 1248 | Ga0070678_100002598 | |||
| 1249 | Ga0070678_100014415 | |||
| 1250 | Ga0070662_100023778 | |||
| 1251 | Ga0070681_10003941 | |||
| 1252 | Ga0070681_10023035 | |||
| 1253 | Ga0070681_10094866 | |||
| 1254 | Ga0070681_10104492 | |||
| 1255 | Ga0070681_10119980 | |||
| 1256 | Ga0070681_10809706 | |||
| 1257 | Ga0070685_10005782 | |||
| 1258 | Ga0070685_10092329 | |||
| 1259 | Ga0070685_10108820 | |||
| 1260 | Ga0070706_100006076 | |||
| 1261 | Ga0070706_100007201 | |||
| 1262 | Ga0070706_100038519 | |||
| 1263 | Ga0070706_100730511 | |||
| 1264 | Ga0070707_100002446 | |||
| 1265 | Ga0070707_100072910 | |||
| 1266 | Ga0070707_100181838 | |||
| 1267 | Ga0070707_100611832 | |||
| 1268 | Ga0070698_100002581 | |||
| 1269 | Ga0070698_100016157 | |||
| 1270 | Ga0070698_100019764 | |||
| 1271 | Ga0070698_100060163 | |||
| 1272 | Ga0070698_100182440 | |||
| 1273 | Ga0070698_100473790 | |||
| 1274 | Ga0070699_100001377 | |||
| 1275 | Ga0070699_100240524 | |||
| 1276 | Ga0070679_100002183 | |||
| 1277 | Ga0070679_100007399 | |||
| 1278 | Ga0070679_100043471 | |||
| 1279 | Ga0070679_100138297 | |||
| 1280 | Ga0070679_100171055 | |||
| 1281 | Ga0070679_100245444 | |||
| 1282 | Ga0070684_100034118 | |||
| 1283 | Ga0070684_100156880 | |||
| 1284 | Ga0070684_100175973 | |||
| 1285 | Ga0070684_100284619 | |||
| 1286 | Ga0070697_100017039 | |||
| 1287 | Ga0068853_100016620 | |||
| 1288 | Ga0070672_100044936 | |||
| 1289 | Ga0070672_100188986 | |||
| 1290 | Ga0070686_100011934 | |||
| 1291 | Ga0070686_100024998 | |||
| 1292 | Ga0070695_100015524 | |||
| 1293 | Ga0070695_100030111 | |||
| 1294 | Ga0070695_100166454 | |||
| 1295 | Ga0070695_100233435 | |||
| 1296 | Ga0070696_100004714 | |||
| 1297 | Ga0070696_100011867 | |||
| 1298 | Ga0070693_100007302 | |||
| 1299 | Ga0070665_100020284 | |||
| 1300 | Ga0070665_100021995 | |||
| 1301 | Ga0070665_100120644 | |||
| 1302 | Ga0070665_100746818 | |||
| 1303 | Ga0070665_100838011 | |||
| 1304 | Ga0070665_101492105 | |||
| 1305 | Ga0070704_100081921 | |||
| 1306 | Ga0070704_100104634 | |||
| 1307 | Ga0070704_100119712 | |||
| 1308 | Ga0070704_100242806 | |||
| 1309 | Ga0068855_100014121 | |||
| 1310 | Ga0068855_100115406 | |||
| 1311 | Ga0068855_100217998 | |||
| 1312 | Ga0068855_100563104 | |||
| 1313 | Ga0070664_100445830 | |||
| 1314 | Ga0068857_100004112 | |||
| 1315 | Ga0068857_100091530 | |||
| 1316 | Ga0068857_100106823 | |||
| 1317 | Ga0068857_100338837 | |||
| 1318 | Ga0068854_100022934 | |||
| 1319 | Ga0068854_100452566 | |||
| 1320 | Ga0068854_100687592 | |||
| 1321 | Ga0068856_100016071 | |||
| 1322 | Ga0068856_100050080 | |||
| 1323 | Ga0068856_100100517 | |||
| 1324 | Ga0068856_100191083 | |||
| 1325 | Ga0070702_100025199 | |||
| 1326 | Ga0068852_100008211 | |||
| 1327 | Ga0068852_100078358 | |||
| 1328 | Ga0068852_100939775 | |||
| 1329 | Ga0068859_100000203 | |||
| 1330 | Ga0068859_100001419 | |||
| 1331 | Ga0068864_100118384 | |||
| 1332 | Ga0068864_100265483 | |||
| 1333 | Ga0068864_100386983 | |||
| 1334 | Ga0068866_10016303 | |||
| 1335 | Ga0068866_10059520 | |||
| 1336 | Ga0068861_100035313 | |||
| 1337 | Ga0068851_10069220 | |||
| 1338 | Ga0068870_10018076 | |||
| 1339 | Ga0068870_10177292 | |||
| 1340 | Ga0068863_100001103 | |||
| 1341 | Ga0068863_100001958 | |||
| 1342 | Ga0068863_100139739 | |||
| 1343 | Ga0068858_100022912 | |||
| 1344 | Ga0068858_100030488 | |||
| 1345 | Ga0068858_100095244 | |||
| 1346 | Ga0068860_100000043 | |||
| 1347 | Ga0068860_100107067 | |||
| 1348 | Ga0081455_10004075 | |||
| 1349 | Ga0081455_10009726 | |||
| 1350 | Ga0081455_10275048 | |||
| 1351 | Ga0081455_10342023 | |||
| 1352 | Ga0081540_1000322 | |||
| 1353 | Ga0081540_1035641 | |||
| 1354 | Ga0081539_10012474 | |||
| 1355 | Ga0081539_10057082 | |||
| 1356 | Ga0081539_10318427 | |||
| 1357 | Ga0070717_10003162 | |||
| 1358 | Ga0070717_10003332 | |||
| 1359 | Ga0070717_10037777 | |||
| 1360 | Ga0070717_10041626 | |||
| 1361 | Ga0070717_10095582 | |||
| 1362 | Ga0070717_10128700 | |||
| 1363 | Ga0070717_10130826 | |||
| 1364 | Ga0070717_10331379 | |||
| 1365 | Ga0075432_10133056 | |||
| 1366 | Ga0070715_10014221 | |||
| 1367 | Ga0070715_10095170 | |||
| 1368 | Ga0070715_10126916 | |||
| 1369 | Ga0070715_10143352 | |||
| 1370 | Ga0070715_10319413 | |||
| 1371 | Ga0070716_100000365 | |||
| 1372 | Ga0070716_100020382 | |||
| 1373 | Ga0070716_100062075 | |||
| 1374 | Ga0070716_100099483 | |||
| 1375 | Ga0070712_100000642 | |||
| 1376 | Ga0070712_100023144 | |||
| 1377 | Ga0070712_100038812 | |||
| 1378 | Ga0070712_100072753 | |||
| 1379 | Ga0070712_100292254 | |||
| 1380 | Ga0070712_100301094 | |||
| 1381 | Ga0097621_100024019 | |||
| 1382 | Ga0097621_100123085 | |||
| 1383 | Ga0075370_10412438 | |||
| 1384 | Ga0068871_100019439 | |||
| 1385 | Ga0068871_100060728 | |||
| 1386 | Ga0068871_100098944 | |||
| 1387 | Ga0075433_10052568 | |||
| 1388 | Ga0075433_10057185 | |||
| 1389 | Ga0075434_100002616 | |||
| 1390 | Ga0075434_100017533 | |||
| 1391 | Ga0075434_100041537 | |||
| 1392 | Ga0075429_100098329 | |||
| 1393 | Ga0068865_100107307 | |||
| 1394 | Ga0075436_100020706 | |||
| 1395 | Ga0075436_100083730 | |||
| 1396 | Ga0075436_100479139 | |||
| 1397 | Ga0097620_100001419 | |||
| 1398 | Ga0075435_100012275 | |||
| 1399 | Ga0075435_100058844 | |||
| 1400 | Ga0075435_100372104 | |||
| 1401 | Ga0075435_100444654 | |||
| 1402 | Ga0075435_100826979 | |||
| 1403 | Ga0105251_10066405 | |||
| 1404 | Ga0105240_10071915 | |||
| 1405 | Ga0105240_10209091 | |||
| 1406 | Ga0111539_10083082 | |||
| 1407 | Ga0105245_10033626 | |||
| 1408 | Ga0105245_10040561 | |||
| 1409 | Ga0105245_10070166 | |||
| 1410 | Ga0105245_10105778 | |||
| 1411 | Ga0105245_10250030 | |||
| 1412 | Ga0105245_10539028 | |||
| 1413 | Ga0105247_10001304 | |||
| 1414 | Ga0105247_10114718 | |||
| 1415 | Ga0105247_10131584 | |||
| 1416 | Ga0114129_10011936 | |||
| 1417 | Ga0114129_10210971 | |||
| 1418 | Ga0105243_10070233 | |||
| 1419 | Ga0105243_10164428 | |||
| 1420 | Ga0105243_11017443 | |||
| 1421 | Ga0105241_10028011 | |||
| 1422 | Ga0105241_10044860 | |||
| 1423 | Ga0105241_10059247 | |||
| 1424 | Ga0105241_10173150 | |||
| 1425 | Ga0105242_10042685 | |||
| 1426 | Ga0105242_10527530 | |||
| 1427 | Ga0105248_10000776 | |||
| 1428 | Ga0105248_10018376 | |||
| 1429 | Ga0105248_10362585 | |||
| 1430 | Ga0105237_10025512 | |||
| 1431 | Ga0105237_10063161 | |||
| 1432 | Ga0105237_10101314 | |||
| 1433 | Ga0105237_10436231 | |||
| 1434 | Ga0105237_10444378 | |||
| 1435 | Ga0105238_10104948 | |||
| 1436 | Ga0105238_10155972 | |||
| 1437 | Ga0105238_10476942 | |||
| 1438 | Ga0105238_10571693 | |||
| 1439 | Ga0105238_10849647 | |||
| 1440 | Ga0105249_10007381 | |||
| 1441 | Ga0105249_10181662 | |||
| 1442 | Ga0105249_10644980 | |||
| 1443 | Ga0105239_10005021 | |||
| 1444 | Ga0105239_10082433 | |||
| 1445 | Ga0105239_10301241 | |||
| 1446 | Ga0105239_10370147 | |||
| 1447 | Ga0105239_11654629 | |||
| 1448 | Ga0105246_10007956 | |||
| 1449 | Ga0105246_10017501 | |||
| 1450 | Ga0157335_1001512 | |||
| 1451 | Ga0157341_1005866 | |||
| 1452 | Ga0157342_1019544 | |||
| 1453 | Ga0157373_10075447 | |||
| 1454 | Ga0157373_10329947 | |||
| 1455 | Ga0157371_10012338 | |||
| 1456 | Ga0157371_10043034 | |||
| 1457 | Ga0157371_10150309 | |||
| 1458 | Ga0157370_10054703 | |||
| 1459 | Ga0157370_10191459 | |||
| 1460 | Ga0157370_10218545 | |||
| 1461 | Ga0157370_10228795 | |||
| 1462 | Ga0157370_10246608 | |||
| 1463 | Ga0157369_10048309 | |||
| 1464 | Ga0157369_10093617 | |||
| 1465 | Ga0157369_10124385 | |||
| 1466 | Ga0157369_10129588 | |||
| 1467 | Ga0157369_10605096 | |||
| 1468 | Ga0157369_11114399 | |||
| 1469 | Ga0157374_10076077 | |||
| 1470 | Ga0157374_10099261 | |||
| 1471 | Ga0157378_10043419 | |||
| 1472 | Ga0157378_10488777 | |||
| 1473 | Ga0157378_10510368 | |||
| 1474 | Ga0157378_10794631 | |||
| 1475 | Ga0163162_10053545 | |||
| 1476 | Ga0163162_10103430 | |||
| 1477 | Ga0157372_10362093 | |||
| 1478 | Ga0157372_10623791 | |||
| 1479 | Ga0157375_10008112 | |||
| 1480 | Ga0157375_10146421 | |||
| 1481 | Ga0157375_10229513 | |||
| 1482 | Ga0157375_11227749 | |||
| 1483 | Ga0163163_10103543 | |||
| 1484 | Ga0163163_10137524 | |||
| 1485 | Ga0163163_10414108 | |||
| 1486 | Ga0163163_10724694 | |||
| 1487 | Ga0163163_10982437 | |||
| 1488 | Ga0157380_10093579 | |||
| 1489 | Ga0157380_11089009 | |||
| 1490 | Ga0182008_10030398 | |||
| 1491 | Ga0157377_10016384 | |||
| 1492 | Ga0157377_10040683 | |||
| 1493 | Ga0157377_10102640 | |||
| 1494 | Ga0157379_10044210 | |||
| 1495 | Ga0157379_10119341 | |||
| 1496 | Ga0157376_10007984 | |||
| 1497 | Ga0163161_10003537 | |||
| 1498 | Ga0163161_10092272 | |||
| 1499 | Ga0206356_10133492 | |||
| 1500 | Ga0206356_10403435 | |||
| 1501 | Ga0206356_11766969 | |||
| 1502 | Ga0206349_1934169 | |||
| 1503 | Ga0206351_10532516 | |||
| 1504 | Ga0206351_10691055 | |||
| 1505 | Ga0206350_10135956 | |||
| 1506 | Ga0206350_10407140 | |||
| 1507 | Ga0206354_10448385 | |||
| 1508 | Ga0206354_10501093 | |||
| 1509 | Ga0206354_10558071 | |||
| 1510 | Ga0206354_11113439 | |||
| 1511 | Ga0206354_11522812 | |||
| 1512 | Ga0206353_10579089 | |||
| 1513 | Ga0206353_10580619 | |||
| 1514 | Ga0206353_10661638 | |||
| 1515 | Ga0206353_10877206 | |||
| 1516 | Ga0206353_11498470 | |||
| 1517 | Ga0206353_11662522 | |||
| 1518 | Ga0206353_11872344 | |||
| 1519 | Ga0206353_11944787 | |||
| 1520 | Ga0206353_11954408 | |||
| 1521 | Ga0213872_10000601 | |||
| 1522 | Ga0213872_10001084 | |||
| 1523 | Ga0213872_10007351 | |||
| 1524 | Ga0213872_10011214 | |||
| 1525 | Ga0213872_10015813 | |||
| 1526 | Ga0213872_10100654 | |||
| 1527 | Ga0213876_10079945 | |||
| 1528 | Ga0213875_10000758 | |||
| 1529 | Ga0213875_10000907 | |||
| 1530 | Ga0213875_10026616 | |||
| 1531 | Ga0213875_10027587 | |||
| 1532 | Ga0224712_10007667 | |||
| 1533 | Ga0224712_10026058 | |||
| 1534 | Ga0224572_1013330 | |||
| 1535 | Ga0207656_10031400 | |||
| 1536 | Ga0207653_10009329 | |||
| 1537 | Ga0207692_10001168 | |||
| 1538 | Ga0207692_10019279 | |||
| 1539 | Ga0207692_10023441 | |||
| 1540 | Ga0207692_10497132 | |||
| 1541 | Ga0207642_10007684 | |||
| 1542 | Ga0207688_10009564 | |||
| 1543 | Ga0207688_10183607 | |||
| 1544 | Ga0207680_10079582 | |||
| 1545 | Ga0207647_10045470 | |||
| 1546 | Ga0207647_10076359 | |||
| 1547 | Ga0207647_10425879 | |||
| 1548 | Ga0207685_10002152 | |||
| 1549 | Ga0207685_10067406 | |||
| 1550 | Ga0207685_10180718 | |||
| 1551 | Ga0207685_10260274 | |||
| 1552 | Ga0207699_10000446 | |||
| 1553 | Ga0207699_10001789 | |||
| 1554 | Ga0207699_10003210 | |||
| 1555 | Ga0207699_10004496 | |||
| 1556 | Ga0207699_10018869 | |||
| 1557 | Ga0207699_10089591 | |||
| 1558 | Ga0207699_10182241 | |||
| 1559 | Ga0207645_10030943 | |||
| 1560 | Ga0207643_10000094 | |||
| 1561 | Ga0207643_10017566 | |||
| 1562 | Ga0207705_10004857 | |||
| 1563 | Ga0207705_10024402 | |||
| 1564 | Ga0207705_10067195 | |||
| 1565 | Ga0207705_10068283 | |||
| 1566 | Ga0207705_10474320 | |||
| 1567 | Ga0207684_10006720 | |||
| 1568 | Ga0207684_10127196 | |||
| 1569 | Ga0207684_10179774 | |||
| 1570 | Ga0207654_10073942 | |||
| 1571 | Ga0207654_10453745 | |||
| 1572 | Ga0207707_10001838 | |||
| 1573 | Ga0207707_10019126 | |||
| 1574 | Ga0207707_10025581 | |||
| 1575 | Ga0207707_10069975 | |||
| 1576 | Ga0207707_10576455 | |||
| 1577 | Ga0207707_10588095 | |||
| 1578 | Ga0207695_10066912 | |||
| 1579 | Ga0207695_10535524 | |||
| 1580 | Ga0207671_10012605 | |||
| 1581 | Ga0207671_10020055 | |||
| 1582 | Ga0207671_10073613 | |||
| 1583 | Ga0207693_10005838 | |||
| 1584 | Ga0207693_10005948 | |||
| 1585 | Ga0207693_10030474 | |||
| 1586 | Ga0207693_10043383 | |||
| 1587 | Ga0207693_10074688 | |||
| 1588 | Ga0207693_10084997 | |||
| 1589 | Ga0207693_10128361 | |||
| 1590 | Ga0207663_10034154 | |||
| 1591 | Ga0207663_10063620 | |||
| 1592 | Ga0207663_10119574 | |||
| 1593 | Ga0207663_10151914 | |||
| 1594 | Ga0207663_10286150 | |||
| 1595 | Ga0207663_10539680 | |||
| 1596 | Ga0207660_10000619 | |||
| 1597 | Ga0207660_10153879 | |||
| 1598 | Ga0207660_10189358 | |||
| 1599 | Ga0207660_10264744 | |||
| 1600 | Ga0207662_10001797 | |||
| 1601 | Ga0207662_10036196 | |||
| 1602 | Ga0207657_10010275 | |||
| 1603 | Ga0207657_10019194 | |||
| 1604 | Ga0207657_10036519 | |||
| 1605 | Ga0207657_10142202 | |||
| 1606 | Ga0207657_10256273 | |||
| 1607 | Ga0207657_10519521 | |||
| 1608 | Ga0207649_10030683 | |||
| 1609 | Ga0207649_10104830 | |||
| 1610 | Ga0207649_10266202 | |||
| 1611 | Ga0207652_10003015 | |||
| 1612 | Ga0207652_10061823 | |||
| 1613 | Ga0207652_10062453 | |||
| 1614 | Ga0207652_10114766 | |||
| 1615 | Ga0207652_10473546 | |||
| 1616 | Ga0207652_10769478 | |||
| 1617 | Ga0207646_10006537 | |||
| 1618 | Ga0207646_10019331 | |||
| 1619 | Ga0207646_10378452 | |||
| 1620 | Ga0207646_10522086 | |||
| 1621 | Ga0207646_10584878 | |||
| 1622 | Ga0207681_10140870 | |||
| 1623 | Ga0207694_10075114 | |||
| 1624 | Ga0207694_10276014 | |||
| 1625 | Ga0207694_10393757 | |||
| 1626 | Ga0207694_10571783 | |||
| 1627 | Ga0207659_10115126 | |||
| 1628 | Ga0207687_10020870 | |||
| 1629 | Ga0207687_10031614 | |||
| 1630 | Ga0207687_10112203 | |||
| 1631 | Ga0207687_10331241 | |||
| 1632 | Ga0207700_10001064 | |||
| 1633 | Ga0207700_10002230 | |||
| 1634 | Ga0207700_10011474 | |||
| 1635 | Ga0207700_10037670 | |||
| 1636 | Ga0207700_10049575 | |||
| 1637 | Ga0207700_10075305 | |||
| 1638 | Ga0207700_10121191 | |||
| 1639 | Ga0207700_10153140 | |||
| 1640 | Ga0207700_10190463 | |||
| 1641 | Ga0207700_10197504 | |||
| 1642 | Ga0207700_10210575 | |||
| 1643 | Ga0207700_10360547 | |||
| 1644 | Ga0207664_10000091 | |||
| 1645 | Ga0207664_10003245 | |||
| 1646 | Ga0207664_10004273 | |||
| 1647 | Ga0207664_10013915 | |||
| 1648 | Ga0207664_10024940 | |||
| 1649 | Ga0207664_10034866 | |||
| 1650 | Ga0207664_10038717 | |||
| 1651 | Ga0207664_10090291 | |||
| 1652 | Ga0207664_10119731 | |||
| 1653 | Ga0207664_10595297 | |||
| 1654 | Ga0207664_10909418 | |||
| 1655 | Ga0207644_10051487 | |||
| 1656 | Ga0207690_10195762 | |||
| 1657 | Ga0207690_10348048 | |||
| 1658 | Ga0207690_10451515 | |||
| 1659 | Ga0207706_10004309 | |||
| 1660 | Ga0207706_10017078 | |||
| 1661 | Ga0207706_10048116 | |||
| 1662 | Ga0207709_10118099 | |||
| 1663 | Ga0207709_10925347 | |||
| 1664 | Ga0207670_10031624 | |||
| 1665 | Ga0207670_10035070 | |||
| 1666 | Ga0207669_10280888 | |||
| 1667 | Ga0207669_10572656 | |||
| 1668 | Ga0207665_10000207 | |||
| 1669 | Ga0207665_10000352 | |||
| 1670 | Ga0207665_10001973 | |||
| 1671 | Ga0207665_10002007 | |||
| 1672 | Ga0207665_10007495 | |||
| 1673 | Ga0207665_10060528 | |||
| 1674 | Ga0207665_10061885 | |||
| 1675 | Ga0207665_10092160 | |||
| 1676 | Ga0207665_10149671 | |||
| 1677 | Ga0207691_10104557 | |||
| 1678 | Ga0207711_10000110 | |||
| 1679 | Ga0207711_10132889 | |||
| 1680 | Ga0207711_10136019 | |||
| 1681 | Ga0207711_10136533 | |||
| 1682 | Ga0207711_10206968 | |||
| 1683 | Ga0207689_10001041 | |||
| 1684 | Ga0207689_10004620 | |||
| 1685 | Ga0207689_10024307 | |||
| 1686 | Ga0207661_10062115 | |||
| 1687 | Ga0207661_10162485 | |||
| 1688 | Ga0207661_10316840 | |||
| 1689 | Ga0207679_10059918 | |||
| 1690 | Ga0207679_10511245 | |||
| 1691 | Ga0207679_10630406 | |||
| 1692 | Ga0207667_10241809 | |||
| 1693 | Ga0207712_10072455 | |||
| 1694 | Ga0207712_10176220 | |||
| 1695 | Ga0207668_10009134 | |||
| 1696 | Ga0207668_10097070 | |||
| 1697 | Ga0207640_10167982 | |||
| 1698 | Ga0207640_10396808 | |||
| 1699 | Ga0207658_10002264 | |||
| 1700 | Ga0207658_10186906 | |||
| 1701 | Ga0207658_10466750 | |||
| 1702 | Ga0207658_10709079 | |||
| 1703 | Ga0207677_10018564 | |||
| 1704 | Ga0207677_10080349 | |||
| 1705 | Ga0207703_10151025 | |||
| 1706 | Ga0207703_10904077 | |||
| 1707 | Ga0207703_11362963 | |||
| 1708 | Ga0207639_10051325 | |||
| 1709 | Ga0207639_10279224 | |||
| 1710 | Ga0207639_10804025 | |||
| 1711 | Ga0207678_10001648 | |||
| 1712 | Ga0207678_10012052 | |||
| 1713 | Ga0207678_10012661 | |||
| 1714 | Ga0207678_10035491 | |||
| 1715 | Ga0207678_10066051 | |||
| 1716 | Ga0207708_10000006 | |||
| 1717 | Ga0207708_10018835 | |||
| 1718 | Ga0207702_10002824 | |||
| 1719 | Ga0207702_10005443 | |||
| 1720 | Ga0207702_10138190 | |||
| 1721 | Ga0207702_10279070 | |||
| 1722 | Ga0207702_10546524 | |||
| 1723 | Ga0207702_11057593 | |||
| 1724 | Ga0207641_10002291 | |||
| 1725 | Ga0207641_10010850 | |||
| 1726 | Ga0207641_10010889 | |||
| 1727 | Ga0207641_10122793 | |||
| 1728 | Ga0207641_10185784 | |||
| 1729 | Ga0207641_10248583 | |||
| 1730 | Ga0207648_10220077 | |||
| 1731 | Ga0207648_10453726 | |||
| 1732 | Ga0207676_10182342 | |||
| 1733 | Ga0207676_10184767 | |||
| 1734 | Ga0207674_10005313 | |||
| 1735 | Ga0207674_10170180 | |||
| 1736 | Ga0207674_10377841 | |||
| 1737 | Ga0207674_10392901 | |||
| 1738 | Ga0207675_100009835 | |||
| 1739 | Ga0207675_100010387 | |||
| 1740 | Ga0207675_100815714 | |||
| 1741 | Ga0207675_100931209 | |||
| 1742 | Ga0207675_101130529 | |||
| 1743 | Ga0207683_10006035 | |||
| 1744 | Ga0207683_10007232 | |||
| 1745 | Ga0207683_10010376 | |||
| 1746 | Ga0207698_10006675 | |||
| 1747 | Ga0207698_10014615 | |||
| 1748 | Ga0207698_10488316 | |||
| 1749 | Ga0207698_10643341 | |||
| 1750 | Ga0207428_10270484 | |||
| 1751 | Ga0268266_10001099 | |||
| 1752 | Ga0268266_10209170 | |||
| 1753 | Ga0268266_10479718 | |||
| 1754 | Ga0268265_10085071 | |||
| 1755 | Ga0268265_10096263 | |||
| 1756 | Ga0268264_10000027 | |||
| 1757 | Ga0268264_10386541 | |||
| 1758 | Ga0265337_1000052 | |||
| 1759 | Ga0265319_1002287 | |||
| 1760 | Ga0265334_10000162 | |||
| 1761 | Ga0265336_10006354 | |||
| 1762 | Ga0265338_10000986 | |||
| 1763 | Ga0265338_10003673 | |||
| 1764 | Ga0265338_10005536 | |||
| 1765 | Ga0265324_10004189 | |||
| 1766 | Ga0265324_10045591 | |||
| 1767 | Ga0265760_10140160 | |||
| 1768 | Ga0265332_10005314 | |||
| 1769 | Ga0265320_10005127 | |||
| 1770 | Ga0265325_10011209 | |||
| 1771 | Ga0265316_10016390 | |||
| 1772 | Ga0307508_10406252 | |||
| 1773 | Ga0316575_10012981 | |||
| 1774 | Ga0316579_10034396 | |||
| 1775 | Ga0316579_10191004 | |||
| 1776 | Ga0265314_10008105 | |||
| 1777 | Ga0265342_10002806 | |||
| 1778 | Ga0316576_10000880 | |||
| 1779 | Ga0316576_10020558 | |||
| 1780 | Ga0316576_10031253 | |||
| 1781 | Ga0316577_10158033 | |||
| 1782 | Ga0307406_10093287 | |||
| 1783 | Ga0307412_10133759 | |||
| 1784 | Ga0307416_100337040 | |||
| 1785 | Ga0307411_10224681 | |||
| 1786 | Ga0316583_10014727 | |||
| 1787 | Ga0316585_10004713 | |||
| 1788 | Ga0316580_10025297 | |||
| 1789 | Ga0316580_10039072 | |||
| 1790 | Ga0316214_1009449 | |||
| 1791 | Ga0373930_0003956 | |||
| 1792 | Ga0373948_0005514 | |||
| 1793 | Ga0373948_0107981 | |||
| 1794 | Ga0373958_0064226 | |||
| 1795 | Ga0373938_0034486 | |||
| 1796 | Ga0373926_0002539 | |||
| 1797 | Ga0373926_0003223 | |||
| 1798 | Ga0373926_0070533 | |||
| 1799 | Ga0373928_0013809 | |||
| 1800 | Ga0373929_0070799 | |||
| 1801 | Ga0373934_0198101 | |||
| 1802 | Ga0373940_0041392 | |||
| 1803 | Ga0373944_0001493 | |||
| 1804 | Ga0373944_0002001 | |||
| 1805 | Ga0373944_0083248 | |||
| 1806 | Ga0373949_0007293 | |||
| 1807 | Ga0373949_0020934 | |||
| 1808 | Ga0373951_0008800 | |||
| 1809 | Ga0373952_0009453 | |||
| 1810 | Ga0373952_0157602 | |||
| 1811 | Ga0373923_0003408 | |||
| 1812 | Ga0373923_0009413 | |||
| 1813 | Ga0373923_0029851 | |||
| 1814 | Ga0373923_0132432 | |||
| 1815 | Ga0373936_0001359 | |||
| 1816 | Ga0373936_0010006 | |||
| 1817 | Ga0373936_0015931 | |||
| 1818 | Ga0373936_0080593 | |||
| 1819 | Ga0373936_0180644 | |||
| 1820 | Ga0373936_0249560 | |||
| 1821 | Ga0373939_0040470 | |||
| 1822 | Ga0373941_0062080 | |||
| 1823 | Ga0373945_0000297 | |||
| 1824 | Ga0373945_0011275 | |||
| 1825 | Ga0373945_0036865 | |||
| 1826 | Ga0373953_0029316 | |||
| 1827 | Ga0373953_0067774 | |||
| 1828 | Ga0373954_0034272 | |||
| 1829 | Ga0373954_0041217 | |||
| 1830 | Ga0373954_0058890 | |||
| 1831 | Ga0373956_0015530 | |||
| 1832 | Ga0373956_0016531 | |||
| 1833 | Ga0373956_0143791 | |||
| 1834 | Ga0373956_0151405 | |||
| 1835 | Ga0373956_0157788 | |||
| 1836 | Ga0373957_0009188 | |||
| 1837 | Ga0373957_0010297 | |||
| 1838 | Ga0373957_0075418 | |||
| 1839 | Ga0373957_0099964 | |||
| 1840 | Ga0373957_0119129 | |||
| 1841 | Ga0373957_0131598 | |||
| 1842 | Ga0373943_0000586 | |||
| 1843 | Ga0373943_0024891 | |||
| 1844 | Ga0373943_0041647 | |||
| 1845 | Ga0373943_0055482 | |||
| 1846 | Ga0373943_0330387 | |||
| 1847 | Ga0373946_0000057 | |||
| 1848 | Ga0373946_0001085 | |||
| 1849 | Ga0373946_0222630 | |||
| 1850 | Ga0373955_0033814 | |||
| 1851 | Ga0373955_0054523 | |||
| 1852 | Ga0373955_0247270 | |||
| 1853 | Ga0373942_0067104 | |||
| 1854 | Ga0373961_0006331 | |||
| 1855 | Ga0373962_0007765 | |||
| 1856 | Ga0316574_0042351 | |||
| 1857 | Ga0316574_0110048 | |||
| 1858 | Ga0373924_0008137 | |||
| 1859 | Ga0373924_0079678 | |||
| 1860 | Ga0373931_0136292 | |||
| 1861 | Ga0373935_0001547 | |||
| 1862 | Ga0373935_0007043 | |||
| 1863 | Ga0373935_0075463 | |||
| 1864 | Ga0373935_0163014 | |||
| 1865 | Ga0373935_0392627 | |||
| 1866 | Ga0373927_0000281 | |||
| 1867 | Ga0373927_0003517 | |||
| 1868 | Ga0373927_0070712 | |||
| 1869 | Ga0373927_0372474 | |||
| 1870 | Ga0373933_0005243 | |||
| 1871 | Ga0373933_0013625 | |||
| 1872 | Ga0373933_0168883 | |||
| 1873 | Ga0373947_0000793 | |||
| 1874 | Ga0373947_0107820 | |||
| 1875 | Ga0373937_0021710 | |||
| 1876 | Ga0373937_0041110 | |||
| 1877 | Ga0373937_0067476 | |||
| 1878 | Ga0373937_0090054 | |||
| 1879 | Ga0373937_0111267 | |||
| 1880 | Ga0373937_0133296 | |||
| 1881 | Ga0316582_0077263 | |||
| 1882 | Ga0316584_0028637 | |||
| 1883 | Ga0316584_0434984 | |||
| 1884 | Ga0373925_0000010 | |||
| 1885 | Ga0373925_0002499 | |||
| 1886 | Ga0373925_0004092 | |||
| 1887 | Ga0373925_0111049 | |||
| 1888 | Ga0373925_0438788 | |||
| 1889 | Ga0373925_0575413 | |||
| 1890 | Ga0395899_0012802 | |||
| 1891 | Ga0395898_0107973 | |||
| 1892 | Ga0316581_0003200 | |||
| 1893 | Ga0436364_0086889 | |||
| 1894 | Ga0436364_0126636 | |||
| 1895 | Ga0436364_0185475 | |||
| 1896 | Ga0436364_0619793 | |||
| 1897 | Ga0436364_0808550 | |||
| 1898 | Ga0436364_0856071 | |||
| 1899 | Ga0436364_1062657 | |||
| 1900 | Ga0436364_1454182 | |||
| 1901 | Ga0436364_1532341 | |||
| 1902 | Ga0436364_1551954 | |||
| 1903 | Ga0395901_0349544 | |||
| 1904 | Ga0436365_0416357 | |||
| 1905 | Ga0436365_1735070 | |||
| 1906 | Ga0436365_1876546 | |||
| 1907 | Ga0436360_0268015 | |||
| 1908 | Ga0436360_0523160 | |||
| 1909 | Ga0436361_0093002 | |||
| 1910 | Ga0436361_0243554 | |||
| 1911 | Ga0436361_0252460 | |||
| 1912 | Ga0436361_0544822 | |||
| 1913 | Ga0436361_0713206 | |||
| 1914 | Ga0436361_1214844 | |||
| 1915 | Ga0436363_0240533 | |||
| 1916 | Ga0436363_0317507 | |||
| 1917 | Ga0436363_0335771 | |||
| 1918 | Ga0436363_0346977 | |||
| 1919 | Ga0436363_0898809 | |||
| 1920 | Ga0436362_0235271 | |||
| 1921 | Ga0436362_0259253 | |||
| 1922 | Ga0436362_0763677 | |||
| 1923 | Ga0439465_0184107 | |||
| 1924 | Ga0451793_0234405 | |||
| 1925 | Ga0439448_0005040 | |||
| 1926 | Ga0439463_008572 | |||
| 1927 | Ga0439459_0005483 | |||
| 1928 | Ga0439464_0023355 | |||
| 1929 | Ga0451577_0511143 | |||
| 1930 | Ga0466969_0358801 | |||
| 1931 | Ga0466965_0084437 | |||
| 1932 | Ga0466966_0026836 | |||
| 1933 | Ga0466966_0233662 | |||
| 1934 | Ga0466966_0436822 | |||
| 1935 | Ga0466961_0198648 | |||
| 1936 | Ga0466963_0014068 | |||
| 1937 | Ga0466963_0036396 | |||
| 1938 | Ga0466963_0070588 | |||
| 1939 | Ga0466963_0218557 | |||
| 1940 | Ga0466963_0251220 | |||
| 1941 | Ga0466963_0260855 | |||
| 1942 | Ga0466963_0351984 | |||
| 1943 | Ga0466963_0384390 | |||
| 1944 | Ga0466963_0786460 | |||
| 1945 | Ga0466964_0010074 | |||
| 1946 | Ga0466971_0019885 | |||
| 1947 | Ga0466968_0098215 | |||
| 1948 | Ga0466970_0028223 | |||
| 1949 | Ga0466957_0029563 | |||
| 1950 | Ga0466957_0200466 | |||
| 1951 | Ga0466957_0238925 | |||
| 1952 | Ga0466957_0600153 | |||
| 1953 | Ga0466959_0343740 | |||
| 1954 | Ga0466959_0772027 | |||
| 1955 | Ga0451576_0032011 | |||
| 1956 | Ga0451576_0046228 | |||
| 1957 | Ga0451576_0075340 | |||
| 1958 | Ga0451576_0967594 | |||
| 1959 | Ga0466958_0009996 | |||
| 1960 | Ga0466958_0299276 | |||
| 1961 | Ga0466958_0418585 | |||
| 1962 | Ga0466967_0030521 | |||
| 1963 | Ga0466967_0032541 | |||
| 1964 | Ga0466967_0038983 | |||
| 1965 | Ga0466967_0053580 | |||
| 1966 | Ga0466967_0115842 | |||
| 1967 | Ga0466967_0129438 | |||
| 1968 | Ga0466967_0151922 | |||
| 1969 | Ga0466967_0172715 | |||
| 1970 | Ga0466967_0283298 | |||
| 1971 | Ga0466967_0362362 | |||
| 1972 | Ga0466967_0607829 | |||
| 1973 | Ga0495592_0011211 | |||
| 1974 | Ga0495592_0014634 | |||
| 1975 | Ga0495592_0026981 | |||
| 1976 | Ga0495592_0097562 | |||
| 1977 | Ga0495592_0628200 | |||
| 1978 | Ga0495603_0001542 | |||
| 1979 | Ga0495603_0319260 | |||
| 1980 | Ga0495629_0066774 | |||
| 1981 | Ga0495641_0009648 | |||
| 1982 | Ga0495641_0015388 | |||
| 1983 | Ga0495641_0028856 | |||
| 1984 | Ga0495651_0000988 | |||
| 1985 | Ga0495651_0030191 | |||
| 1986 | Ga0495651_0040334 | |||
| 1987 | Ga0495651_0058122 | |||
| 1988 | Ga0495651_0267878 | |||
| 1989 | Ga0495653_0009692 | |||
| 1990 | Ga0495653_0017917 | |||
| 1991 | Ga0495653_0018553 | |||
| 1992 | Ga0495653_0029872 | |||
| 1993 | Ga0495653_0118413 | |||
| 1994 | Ga0495653_0222626 | |||
| 1995 | Ga0495653_0334798 | |||
| 1996 | Ga0495580_0006434 | |||
| 1997 | Ga0495582_0033962 | |||
| 1998 | Ga0495582_0094148 | |||
| 1999 | Ga0495639_0001019 | |||
| 2000 | Ga0495639_0032417 | |||
| 2001 | Ga0495662_0001001 | |||
| 2002 | Ga0495662_0014145 | |||
| 2003 | Ga0495664_0001381 | |||
| 2004 | Ga0495664_0021958 | |||
| 2005 | Ga0495664_0056139 | |||
| 2006 | Ga0495664_0109830 | |||
| 2007 | Ga0495664_0149578 | |||
| 2008 | Ga0495664_0398954 | |||
| 2009 | Ga0495594_0107515 | |||
| 2010 | Ga0495608_0008266 | |||
| 2011 | Ga0495608_0016336 | |||
| 2012 | Ga0495608_0017916 | |||
| 2013 | Ga0495608_0050684 | |||
| 2014 | Ga0495608_0094606 | |||
| 2015 | Ga0495608_0110387 | |||
| 2016 | Ga0495618_0020849 | |||
| 2017 | Ga0495618_0032056 | |||
| 2018 | Ga0495618_0063487 | |||
| 2019 | Ga0495628_0043331 | |||
| 2020 | Ga0495628_0066740 | |||
| 2021 | Ga0495628_0072123 | |||
| 2022 | Ga0495628_0100645 | |||
| 2023 | Ga0495628_0172342 | |||
| 2024 | Ga0495630_0001525 | |||
| 2025 | Ga0495630_0079311 | |||
| 2026 | Ga0495630_0098520 | |||
| 2027 | Ga0495630_0736346 | |||
| 2028 | Ga0495666_0005147 | |||
| 2029 | Ga0495652_0002356 | |||
| 2030 | Ga0495652_0052444 | |||
| 2031 | Ga0495652_0161445 | |||
| 2032 | Ga0495665_0003599 | |||
| 2033 | Ga0495665_0024404 | |||
| 2034 | Ga0495665_0059679 | |||
| 2035 | Ga0495665_0145671 | |||
| 2036 | Ga0495640_0015485 | |||
| 2037 | Ga0495640_0020693 | |||
| 2038 | Ga0495640_0076610 | |||
| 2039 | Ga0495640_0086195 | |||
| 2040 | Ga0495640_0109391 | |||
| 2041 | Ga0495640_0181418 | |||
| 2042 | Ga0495586_0024803 | |||
| 2043 | Ga0495586_0120672 | |||
| 2044 | Ga0495587_0002976 | |||
| 2045 | Ga0495587_0013878 | |||
| 2046 | Ga0495587_0043414 | |||
| 2047 | Ga0495587_0059442 | |||
| 2048 | Ga0495645_0004607 | |||
| 2049 | Ga0495645_0029669 | |||
| 2050 | Ga0495645_0037957 | |||
| 2051 | Ga0495645_0049793 | |||
| 2052 | Ga0495645_0088315 | |||
| 2053 | Ga0495645_0112913 | |||
| 2054 | Ga0495622_0091930 | |||
| 2055 | Ga0495667_0000281 | |||
| 2056 | Ga0495667_0014235 | |||
| 2057 | Ga0495667_0019494 | |||
| 2058 | Ga0495667_0039509 | |||
| 2059 | Ga0495667_0070214 | |||
| 2060 | Ga0495667_0080633 | |||
| 2061 | Ga0495634_0014957 | |||
| 2062 | Ga0495634_0109734 | |||
| 2063 | Ga0495634_0117995 | |||
| 2064 | Ga0495635_0001647 | |||
| 2065 | Ga0495635_0008531 | |||
| 2066 | Ga0495635_0011143 | |||
| 2067 | Ga0495635_0047497 | |||
| 2068 | Ga0495635_0130039 | |||
| 2069 | Ga0495635_0598376 | |||
| 2070 | Ga0495588_0187629 | |||
| 2071 | Ga0495657_0000699 | |||
| 2072 | Ga0495657_0011552 | |||
| 2073 | Ga0495657_0034780 | |||
| 2074 | Ga0495657_0059801 | |||
| 2075 | Ga0495657_0122012 | |||
| 2076 | Ga0495599_0017239 | |||
| 2077 | Ga0495599_0064954 | |||
| 2078 | Ga0495599_0066985 | |||
| 2079 | Ga0495599_0465465 | |||
| 2080 | Ga0495623_0006098 | |||
| 2081 | Ga0495623_0331807 | |||
| 2082 | Ga0495646_0019122 | |||
| 2083 | Ga0495646_0081931 | |||
| 2084 | Ga0495646_0191063 | |||
| 2085 | Ga0495647_0006394 | |||
| 2086 | Ga0495658_0001135 | |||
| 2087 | Ga0495613_0039267 | |||
| 2088 | Ga0495613_0047507 | |||
| 2089 | Ga0495624_0010905 | |||
| 2090 | Ga0495624_0019973 | |||
| 2091 | Ga0495624_0120801 | |||
| 2092 | Ga0495624_0167960 | |||
| 2093 | Ga0495624_0358751 | |||
| 2094 | Ga0495600_0003393 | |||
| 2095 | Ga0495600_0004762 | |||
| 2096 | Ga0495600_0019972 | |||
| 2097 | Ga0495600_0061635 | |||
| 2098 | Ga0495600_0076617 | |||
| 2099 | Ga0495600_0102794 | |||
| 2100 | Ga0495600_0119663 | |||
| 2101 | Ga0495581_0000621 | |||
| 2102 | Ga0495581_0044797 | |||
| 2103 | Ga0495581_0180173 | |||
| 2104 | Ga0495604_0007650 | |||
| 2105 | Ga0495604_0014318 | |||
| 2106 | Ga0495604_0067564 | |||
| 2107 | Ga0495604_0235785 | |||
| 2108 | Ga0495604_0372161 | |||
| 2109 | Ga0495674_0001430 | |||
| 2110 | Ga0495674_0010716 | |||
| 2111 | Ga0495674_0029043 | |||
| 2112 | Ga0495674_0044503 | |||
| 2113 | Ga0495674_0158802 | |||
| 2114 | Ga0495676_0001791 | |||
| 2115 | Ga0495676_0047778 | |||
| 2116 | Ga0495676_0145110 | |||
| 2117 | Ga0495676_0334576 | |||
| 2118 | Ga0495680_0012668 | |||
| 2119 | Ga0495680_0043195 | |||
| 2120 | Ga0495680_0045877 | |||
| 2121 | Ga0495680_0069396 | |||
| 2122 | Ga0495680_0126836 | |||
| 2123 | Ga0495680_0415956 | |||
| 2124 | Ga0495675_0034315 | |||
| 2125 | Ga0495675_0043942 | |||
| 2126 | Ga0495675_0069792 | |||
| 2127 | Ga0495684_0004466 | |||
| 2128 | Ga0495684_0019054 | |||
| 2129 | Ga0495684_0023722 | |||
| 2130 | Ga0495684_0031990 | |||
| 2131 | Ga0495684_0036530 | |||
| 2132 | Ga0495684_0079380 | |||
| 2133 | Ga0495684_0098749 | |||
| 2134 | Ga0495593_0004888 | |||
| 2135 | Ga0495593_0070890 | |||
| 2136 | Ga0495593_0170629 | |||
| 2137 | Ga0495593_0271397 | |||
| 2138 | Ga0495602_0032207 | |||
| 2139 | Ga0495602_0040638 | |||
| 2140 | Ga0495602_0095720 | |||
| 2141 | Ga0495602_0168960 | |||
| 2142 | Ga0495602_0226456 | |||
| 2143 | Ga0495602_0242236 | |||
| 2144 | Ga0495614_0131512 | |||
| 2145 | Ga0496101_0030719 | |||
| 2146 | Ga0496101_0622115 | |||
| 2147 | Ga0496102_0001790 | |||
| 2148 | Ga0496102_0051731 | |||
| 2149 | Ga0496102_0225854 | |||
| 2150 | Ga0496102_0317064 | |||
| 2151 | Ga0496102_0425991 | |||
| 2152 | Ga0496102_0464116 | |||
| 2153 | Ga0496102_0541798 | |||
| 2154 | Ga0496102_1258848 | |||
| 2155 | Ga0496103_0011682 | |||
| 2156 | Ga0496103_0137352 | |||
| 2157 | Ga0496103_0625719 | |||
| 2158 | Ga0496104_0039664 | |||
| 2159 | Ga0496104_0201968 | |||
| 2160 | Ga0496104_0269906 | |||
| 2161 | Ga0496105_0008133 | |||
| 2162 | Ga0496105_0032462 | |||
| 2163 | Ga0496105_0128409 | |||
| 2164 | Ga0496106_0251586 | |||
| 2165 | Ga0496107_0215010 | |||
| 2166 | Ga0496107_0269747 | |||
| 2167 | Ga0496107_0276674 | |||
| 2168 | Ga0496107_0404873 | |||
| 2169 | Ga0496108_0051442 | |||
| 2170 | Ga0496108_0225042 | |||
| 2171 | Ga0496109_0005843 | |||
| 2172 | Ga0496109_0005860 | |||
| 2173 | Ga0496109_0013452 | |||
| 2174 | Ga0496109_0117097 | |||
| 2175 | Ga0496109_0284445 | |||
| 2176 | Ga0496109_0655338 | |||
| 2177 | Ga0496110_0057883 | |||
| 2178 | Ga0496110_0118043 | |||
| 2179 | Ga0496110_0226602 | |||
| 2180 | Ga0496110_0230982 | |||
| 2181 | Ga0496110_0277317 | |||
| 2182 | Ga0496110_0299314 | |||
| 2183 | Ga0496110_0404083 | |||
| 2184 | Ga0496111_0033994 | |||
| 2185 | Ga0496111_0206959 | |||
| 2186 | Ga0496111_0457945 | |||
| 2187 | Ga0496112_0055476 | |||
| 2188 | Ga0496112_0069559 | |||
| 2189 | Ga0496112_0635941 | |||
| 2190 | Ga0496113_0054854 | |||
| 2191 | Ga0496113_0062106 | |||
| 2192 | Ga0496113_0225592 | |||
| 2193 | Ga0496113_0483026 | |||
| 2194 | Ga0496114_0015245 | |||
| 2195 | Ga0496114_0158246 | |||
| 2196 | Ga0496114_0336321 | |||
| 2197 | Ga0496115_0038198 | |||
| 2198 | Ga0496117_0046447 | |||
| 2199 | Ga0496118_0002074 | |||
| 2200 | Ga0496118_0046283 | |||
| 2201 | Ga0496121_0018108 | |||
| 2202 | Ga0496126_0000006 | |||
| 2203 | Ga0496126_0032512 | |||
| 2204 | Ga0496126_0087547 | |||
| 2205 | Ga0501032_0002413 | |||
| 2206 | Ga0501034_0106793 | |||
| 2207 | Ga0501034_0814480 | |||
| 2208 | Ga0501036_0008211 | |||
| 2209 | Ga0501037_0001399 | |||
| 2210 | Ga0501038_0017389 | |||
| 2211 | Ga0501039_0084890 | |||
| 2212 | Ga0501040_0248097 | |||
| 2213 | Ga0501040_0401884 | |||
| 2214 | Ga0501042_0012475 | |||
| 2215 | Ga0501042_0039968 | |||
| 2216 | Ga0501043_0028533 | |||
| 2217 | Ga0501046_0002036 | |||
| 2218 | Ga0501047_0326284 | |||
| 2219 | Ga0501048_0027539 | |||
| 2220 | Ga0501067_0092376 | |||
| 2221 | Ga0501069_0184213 | |||
| 2222 | Ga0501069_0265471 | |||
| 2223 | Ga0501070_0014917 | |||
| 2224 | Ga0501070_0025886 | |||
| 2225 | Ga0501070_0182125 | |||
| 2226 | Ga0501070_0201323 | |||
| 2227 | Ga0501070_0244155 | |||
| 2228 | Ga0501073_0126280 | |||
| 2229 | Ga0501074_0670541 | |||
| 2230 | Ga0501076_0304547 | |||
| 2231 | Ga0501080_0016540 | |||
| 2232 | Ga0501080_0286657 | |||
| 2233 | Ga0501035_0066662 | |||
| 2234 | Ga0501044_0106860 | |||
| 2235 | Ga0501044_0224766 | |||
| 2236 | Ga0501212_039101 | |||
| 2237 | nmdc:mga05p37_8499_c1 | |||
| 2238 | nmdc:mga0n895_1059271_c1 | |||
| 2239 | nmdc:mga0n895_430831_c1 | |||
| 2240 | nmdc:mga0n895_70282_c1 | |||
| 2241 | nmdc:mga0rr50_163833_c1 | |||
| 2242 | nmdc:mga0rr50_229511_c1 | |||
| 2243 | nmdc:mga0rr50_289741_c1 | |||
| 2244 | nmdc:mga0rr50_39290_c1 | |||
| 2245 | nmdc:mga08x19_103235_c1 | |||
| 2246 | nmdc:mga08x19_272291_c1 | |||
| 2247 | nmdc:mga08x19_427776_c1 | |||
| 2248 | nmdc:mga0a205_34897_c1 | |||
| 2249 | nmdc:mga0a205_45595_c1 | |||
| 2250 | nmdc:mga0a205_8628_c1 | |||
| 2251 | Ga0495601_0028210 | |||
| 2252 | Ga0495601_0047384 | |||
| 2253 | Ga0495601_0070549 | |||
| 2254 | Ga0495612_0041563 | |||
| 2255 | Ga0495612_0387637 | |||
| 2256 | Ga0495595_0026070 | |||
| 2257 | Ga0495595_0171667 | |||
| 2258 | Ga0495595_0457617 | |||
| 2259 | Ga0495619_0022384 | |||
| 2260 | Ga0495619_0080226 | |||
| 2261 | Ga0500643_000249 | |||
| 2262 | Ga0500559_0378215 | |||
| 2263 | Ga0466962_0039503 | |||
| 2264 | Ga0466962_0076422 | |||
| 2265 | 2508677875 | |||
| 2266 | 2676203405 | |||
| 2267 | 2774847981 | |||
| 2268 | 8002780693 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4mu0-assembly1.cif.gz_A | the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution | 0.985 | 1 | 186 |
| 2f1d-assembly1.cif.gz_D | x-ray structure of imidazoleglycerol-phosphate dehydratase | 0.985 | 3 | 186 |
| 4mu3-assembly1.cif.gz_A | the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution | 0.9827 | 1 | 188 |
| 7oj5-assembly1.cif.gz_A | cryo-em structure of medicago truncatula hisn5 protein | 0.9817 | 2 | 186 |
| 4mu3-assembly1.cif.gz_A | the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution | 0.9775 | 1 | 188 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6T988_68_169_3.30.230.40 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9884 | 2 | 89 | 3.30.230.40 |
| 4qnkD01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9859 | 1 | 84 | 3.30.230.40 |
| 2f1dA02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9741 | 91 | 186 | 3.30.230.40 |
| 1rhyA02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9725 | 91 | 182 | 3.30.230.40 |
| 2f1dA02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.964 | 91 | 186 | 3.30.230.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522GSK4-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 1.004 | 4 | 78 |
GO:0000105
GO:0004424 |
| AF-A0A537XT11-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 1.003 | 3 | 78 |
GO:0000105
GO:0004424 |
| AF-A0A2W5ARQ9-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 1.002 | 1 | 74 |
GO:0000105
GO:0004424 |
| AF-A0A2E4EWP6-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 1.002 | 4 | 66 |
GO:0000105
GO:0004424 |
| AF-A0A850D107-F1-model_v4 | deleted | 1.001 | 1 | 61 |
|