F490535

General Info

Members Datasets Scaffolds Average Seq Length
1130 555 1030 158

Family's Representative Sequence

Representative Sequence 3300035119|Ga0373956_0009126|Ga0373956_0009126_1524_2093
Length 189
Sequence VTIPVTIRIQQGDFDVAREVTALSQGRTDIGAVVTFSGICRGPEGGDDIASLTLEHYPGMAEAEIRRHADEAISRWPLQGLTVIHRFGRIEPGQNIVLVVTASKHRQAAFEAAEFLMDYLKTSAPFWKQEESARGKGWVEAHAHDDAAAARWTKSLWPGASRRQKSPRQNRRKSQAANCSRCSISSAMR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
5 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
6 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
7 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
8 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
9 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
10 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
11 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
12 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
13 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
14 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
15 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
16 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
17 2922368715
18 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
19 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
20 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
21 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
22 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
23 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
24 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
25 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
26 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
27 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
28 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
29 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
30 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
31 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
32 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
33 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
34 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
35 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
36 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
37 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
38 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
39 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
40 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
41 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
42 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
43 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
44 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
45 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
46 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
47 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
48 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
49 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
50 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
51 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
52 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
53 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
54 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
55 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
56 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
57 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
58 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
59 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
60 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
61 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
62 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
63 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
64 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
65 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
66 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
67 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
68 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
69 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
70 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
71 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
72 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
73 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
74 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
75 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
76 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
78 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
80 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
81 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
82 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
83 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
84 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
85 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
86 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
87 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
88 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
89 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
90 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
91 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
92 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
93 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
94 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
95 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
96 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
97 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
98 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
99 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
100 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
101 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
102 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
103 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
104 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
105 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
106 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
107 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
108 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
109 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
110 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
111 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
112 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
113 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
114 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
115 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
116 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
117 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
118 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
119 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
120 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
121 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
122 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
123 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
124 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
125 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
126 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
127 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
128 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
129 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
130 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
131 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
132 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
133 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
134 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
135 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
136 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
137 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
138 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
139 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
140 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
141 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
142 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
143 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
144 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
145 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
146 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
147 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
148 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
149 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
150 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
151 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
152 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
153 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
154 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
155 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
156 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
157 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
158 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
159 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
160 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
161 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
162 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
163 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
164 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
165 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
166 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
167 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
168 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
169 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
170 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
171 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
172 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
173 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
174 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
175 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
176 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
177 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
178 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
179 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
180 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
181 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
182 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
183 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
184 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
185 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
186 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
187 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
188 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
189 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
190 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
191 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
192 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
193 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
194 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
195 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
196 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
197 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
198 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
199 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
200 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
201 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
202 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
203 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
204 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
205 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
206 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
207 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
208 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
209 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
211 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
213 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
279 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
283 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
284 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
285 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
286 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
287 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
288 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
289 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
290 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
291 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
292 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
293 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
294 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
295 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
296 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
297 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
298 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
299 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
300 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
301 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
302 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
303 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
304 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
305 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
306 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
307 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
308 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
309 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
310 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
311 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
312 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
313 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
314 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
315 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
316 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
317 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
318 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
319 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
320 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
321 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
322 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
323 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
324 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
325 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
326 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
327 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
328 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
329 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
330 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
331 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
332 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
333 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
334 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
335 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
336 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
337 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
338 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
339 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
340 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
341 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
342 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
343 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
344 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
345 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
346 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
347 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
348 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
349 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
350 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
351 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
352 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
353 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
354 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
355 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
356 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
357 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
358 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
359 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
360 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
361 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
362 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
363 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
364 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
365 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
366 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
367 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
368 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
369 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
370 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
371 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
372 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
373 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
374 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
375 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
376 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
377 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
378 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
379 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
380 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
381 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
382 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
383 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
384 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
385 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
386 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
387 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
388 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
389 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
390 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
391 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
392 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
393 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
394 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
395 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
396 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
397 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
398 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
399 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
400 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
401 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
402 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
403 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
404 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
405 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
406 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
407 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
408 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
409 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
410 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
411 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
412 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
413 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
414 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
415 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
416 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
417 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
418 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
419 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
420 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
421 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
422 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
423 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
424 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
425 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
426 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
427 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
428 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
429 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
430 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
431 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
432 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
433 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
434 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
435 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
436 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
437 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
438 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
439 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
440 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
441 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
442 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
443 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
444 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
445 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
446 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
447 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
448 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
449 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
450 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
451 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
452 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
453 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
454 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
455 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
456 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
457 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
458 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
459 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
461 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
463 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
471 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
472 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
473 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
474 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
475 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
476 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
477 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
478 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
479 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
480 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
481 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
482 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
483 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
484 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
485 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
486 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
487 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
488 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
489 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
490 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
491 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
492 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
493 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
494 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
495 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
496 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
497 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
498 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
499 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
500 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
501 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
502 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
503 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
504 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
505 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
506 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
507 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
508 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
509 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
510 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
511 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
512 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
513 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
514 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
515 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
516 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
517 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
518 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
519 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
520 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
521 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
522 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
523 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
524 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
525 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
526 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
527 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
528 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
529 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
530 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
531 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
532 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
533 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
534 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
535 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
536 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
537 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
538 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
539 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
540 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
541 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
542 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
543 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
544 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
545 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
546 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
547 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
548 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
549 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
550 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
551 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
552 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
553 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
554 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
555 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.88
Metatranscriptomes 0.35
Isolates 8.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.43
Nodule 8.5
Rhizoplane 7.96
Rhizosphere 70.09
Stem 0
Stem Tuber 0
Unclassified 6.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10077895 3300001989 Bacteria 1022
2 JGI24738J21930_10014806 3300002075 Bacteria 1669
3 JGI24751J29686_10004765 3300002459 Bacteria 2756
4 JGI25406J46586_10000043 3300003203 Bacteria 55866
5 JGI25406J46586_10004766 3300003203 Bacteria 6308
6 JGI25153J46596_10000584 3300003215 Bacteria 22421
7 JGI25404J52841_10013755 3300003659 Bacteria 1755
8 JGI25404J52841_10017841 3300003659 Bacteria 1539
9 JGI25404J52841_10035170 3300003659 Bacteria 1067
10 Ga0070658_10168014 3300005327 Bacteria 1842
11 Ga0070658_11314671 3300005327 Bacteria 628
12 Ga0070676_10030096 3300005328 Bacteria 3094
13 Ga0070676_10073935 3300005328 Bacteria 2051
14 Ga0070683_100009428 3300005329 Bacteria 8348
15 Ga0070683_100015413 3300005329 Bacteria 6713
16 Ga0070683_100308838 3300005329 Bacteria 1505
17 Ga0070683_100897585 3300005329 Bacteria 850
18 Ga0070690_100032631 3300005330 Bacteria 3254
19 Ga0070670_100007615 3300005331 Bacteria 9197
20 Ga0070670_100107016 3300005331 Bacteria 2410
21 Ga0070670_100123864 3300005331 Bacteria 2230
22 Ga0068869_100101232 3300005334 Bacteria 2179
23 Ga0068869_100354184 3300005334 Bacteria 1197
24 Ga0068869_100794102 3300005334 Bacteria 813
25 Ga0070666_10347337 3300005335 Bacteria 1061
26 Ga0070680_100407087 3300005336 Bacteria 1160
27 Ga0070680_100736246 3300005336 Bacteria 849
28 Ga0070682_100009389 3300005337 Bacteria 5536
29 Ga0070682_100089099 3300005337 Bacteria 2015
30 Ga0070682_100547523 3300005337 Bacteria 905
31 Ga0068868_100353863 3300005338 Bacteria 1258
32 Ga0070660_100037317 3300005339 Bacteria 3684
33 Ga0070660_100078092 3300005339 Bacteria 2595
34 Ga0070689_100048875 3300005340 Bacteria 3264
35 Ga0070691_10065733 3300005341 Bacteria 1752
36 Ga0070661_100031155 3300005344 Bacteria 3855
37 Ga0070661_100169096 3300005344 Bacteria 1659
38 Ga0070661_101210275 3300005344 Bacteria 632
39 Ga0070668_100056497 3300005347 Bacteria 3031
40 Ga0070668_100094816 3300005347 Bacteria 2356
41 Ga0070668_100185524 3300005347 Bacteria 1701
42 Ga0070668_100958030 3300005347 Bacteria 767
43 Ga0070675_100010225 3300005354 Bacteria 7318
44 Ga0070671_100003008 3300005355 Bacteria 13131
45 Ga0070671_100111626 3300005355 Bacteria 2296
46 Ga0070671_100323924 3300005355 Bacteria 1313
47 Ga0070674_100097802 3300005356 Bacteria 2132
48 Ga0070673_100004774 3300005364 Bacteria 8608
49 Ga0070688_100652260 3300005365 Bacteria 811
50 Ga0070659_100231393 3300005366 Bacteria 1527
51 Ga0070659_101009164 3300005366 Bacteria 731
52 Ga0070667_100020621 3300005367 Bacteria 5471
53 Ga0070667_100048868 3300005367 Bacteria 3562
54 Ga0070667_100121962 3300005367 Bacteria 2268
55 Ga0070703_10116811 3300005406 Bacteria 962
56 Ga0070709_10002890 3300005434 Bacteria 9260
57 Ga0070709_10006086 3300005434 Bacteria 6564
58 Ga0070709_10006951 3300005434 Bacteria 6178
59 Ga0070709_10333101 3300005434 Bacteria 1117
60 Ga0070709_10702131 3300005434 Bacteria 787
61 Ga0070714_100018377 3300005435 Bacteria 5679
62 Ga0070714_100018976 3300005435 Bacteria 5595
63 Ga0070714_100034823 3300005435 Bacteria 4217
64 Ga0070714_100070792 3300005435 Bacteria 3015
65 Ga0070714_100336444 3300005435 Bacteria 1415
66 Ga0070714_100411212 3300005435 Bacteria 1280
67 Ga0070713_100061181 3300005436 Bacteria 3150
68 Ga0070713_100062946 3300005436 Bacteria 3108
69 Ga0070713_100116289 3300005436 Bacteria 2339
70 Ga0070713_100580395 3300005436 Bacteria 1064
71 Ga0070710_10034156 3300005437 Bacteria 2765
72 Ga0070710_10116229 3300005437 Bacteria 1613
73 Ga0070710_10318664 3300005437 Bacteria 1020
74 Ga0070710_10360389 3300005437 Bacteria 965
75 Ga0070710_10389382 3300005437 Bacteria 931
76 Ga0070701_10019718 3300005438 Bacteria 3190
77 Ga0070711_100006504 3300005439 Bacteria 7046
78 Ga0070711_100063677 3300005439 Bacteria 2574
79 Ga0070711_100119677 3300005439 Bacteria 1946
80 Ga0070711_100389288 3300005439 Bacteria 1129
81 Ga0070711_100659637 3300005439 Bacteria 878
82 Ga0070711_100715855 3300005439 Bacteria 844
83 Ga0070711_100930167 3300005439 Bacteria 743
84 Ga0070711_101397920 3300005439 Bacteria 609
85 Ga0070705_100062949 3300005440 Bacteria 2211
86 Ga0070700_100021596 3300005441 Bacteria 3743
87 Ga0070694_100513365 3300005444 Bacteria 955
88 Ga0070694_100810184 3300005444 Bacteria 768
89 Ga0070663_100020381 3300005455 Bacteria 4389
90 Ga0070663_100038779 3300005455 Bacteria 3325
91 Ga0070663_100455062 3300005455 Bacteria 1056
92 Ga0070663_101786593 3300005455 Bacteria 551
93 Ga0070678_100012280 3300005456 Bacteria 5317
94 Ga0070662_100031385 3300005457 Bacteria 3728
95 Ga0070662_101025537 3300005457 Bacteria 707
96 Ga0070681_10020543 3300005458 Bacteria 6618
97 Ga0070681_10047562 3300005458 Bacteria 4288
98 Ga0070681_10308938 3300005458 Bacteria 1491
99 Ga0070681_10661284 3300005458 Bacteria 960
100 Ga0068867_100076490 3300005459 Bacteria 2513
101 Ga0070706_100774213 3300005467 Bacteria 889
102 Ga0070707_100599573 3300005468 Bacteria 1064
103 Ga0070698_100433662 3300005471 Bacteria 1249
104 Ga0070679_100007751 3300005530 Bacteria 10056
105 Ga0070679_100118675 3300005530 Bacteria 2630
106 Ga0070679_100560796 3300005530 Bacteria 1086
107 Ga0070679_101119346 3300005530 Bacteria 732
108 Ga0070679_101283283 3300005530 Bacteria 678
109 Ga0070684_100012253 3300005535 Bacteria 6865
110 Ga0070684_100030875 3300005535 Bacteria 4557
111 Ga0070684_100105471 3300005535 Bacteria 2522
112 Ga0070697_100147829 3300005536 Bacteria 1979
113 Ga0068853_100058222 3300005539 Bacteria 3335
114 Ga0068853_100092722 3300005539 Bacteria 2658
115 Ga0068853_100155163 3300005539 Bacteria 2063
116 Ga0068853_100304583 3300005539 Bacteria 1474
117 Ga0068853_100450255 3300005539 Bacteria 1211
118 Ga0070672_100844552 3300005543 Bacteria 807
119 Ga0070696_100010959 3300005546 Bacteria 6073
120 Ga0070693_100481805 3300005547 Bacteria 876
121 Ga0070665_100050501 3300005548 Bacteria 4173
122 Ga0070665_100154830 3300005548 Bacteria 2294
123 Ga0070665_100233268 3300005548 Bacteria 1840
124 Ga0070665_100348604 3300005548 Bacteria 1486
125 Ga0070665_101179948 3300005548 Bacteria 776
126 Ga0070704_100003439 3300005549 Bacteria 9081
127 Ga0070704_100035424 3300005549 Bacteria 3393
128 Ga0068855_100066662 3300005563 Bacteria 4197
129 Ga0068855_100362156 3300005563 Bacteria 1595
130 Ga0068855_100377302 3300005563 Bacteria 1557
131 Ga0068855_100521862 3300005563 Bacteria 1288
132 Ga0068855_100656803 3300005563 Bacteria 1125
133 Ga0068855_100770096 3300005563 Bacteria 1025
134 Ga0068855_101688109 3300005563 Bacteria 646
135 Ga0070664_100074972 3300005564 Bacteria 2904
136 Ga0070664_100488511 3300005564 Bacteria 1134
137 Ga0070664_101077163 3300005564 Bacteria 756
138 Ga0070664_101250738 3300005564 Bacteria 701
139 Ga0068857_100079354 3300005577 Bacteria 2930
140 Ga0068857_100178798 3300005577 Bacteria 1930
141 Ga0068857_101192792 3300005577 Bacteria 737
142 Ga0068857_101967138 3300005577 Bacteria 573
143 Ga0068854_100012801 3300005578 Bacteria 5494
144 Ga0068854_100098797 3300005578 Bacteria 2185
145 Ga0068854_100358977 3300005578 Bacteria 1195
146 Ga0068854_100799551 3300005578 Bacteria 822
147 Ga0068856_100066430 3300005614 Bacteria 3563
148 Ga0068856_100479425 3300005614 Bacteria 1265
149 Ga0068856_100525210 3300005614 Bacteria 1205
150 Ga0068856_100595365 3300005614 Bacteria 1127
151 Ga0070702_100011479 3300005615 Bacteria 4407
152 Ga0068852_100193087 3300005616 Bacteria 1922
153 Ga0068859_100064488 3300005617 Bacteria 3695
154 Ga0068859_100352355 3300005617 Bacteria 1567
155 Ga0068864_100011404 3300005618 Bacteria 7341
156 Ga0068864_101186835 3300005618 Bacteria 761
157 Ga0068864_101324513 3300005618 Bacteria 721
158 Ga0068861_100050207 3300005719 Bacteria 3162
159 Ga0068851_10045691 3300005834 Bacteria 2214
160 Ga0068851_10236656 3300005834 Bacteria 1031
161 Ga0068870_10098024 3300005840 Bacteria 1651
162 Ga0068863_100018031 3300005841 Bacteria 6757
163 Ga0068863_100600212 3300005841 Bacteria 1089
164 Ga0068858_100127486 3300005842 Bacteria 2384
165 Ga0068858_100177127 3300005842 Bacteria 2012
166 Ga0068858_100179715 3300005842 Bacteria 1997
167 Ga0068858_101109840 3300005842 Bacteria 777
168 Ga0068860_100162546 3300005843 Bacteria 2153
169 Ga0068862_100022075 3300005844 Bacteria 5324
170 Ga0068862_100401566 3300005844 Bacteria 1282
171 Ga0068862_101495038 3300005844 Bacteria 681
172 Ga0081455_10012432 3300005937 Bacteria 8495
173 Ga0081455_10100708 3300005937 Bacteria 2321
174 Ga0081455_10662096 3300005937 Bacteria 670
175 Ga0081538_10103530 3300005981 Bacteria 1424
176 Ga0081540_1025104 3300005983 Bacteria 3440
177 Ga0081540_1028909 3300005983 Bacteria 3101
178 Ga0081540_1030553 3300005983 Bacteria 2981
179 Ga0081540_1047477 3300005983 Bacteria 2159
180 Ga0081540_1118098 3300005983 Bacteria 1106
181 Ga0081539_10000324 3300005985 Bacteria 106549
182 Ga0081539_10002558 3300005985 Bacteria 25231
183 Ga0081539_10033708 3300005985 Bacteria 3113
184 Ga0070717_10000361 3300006028 Bacteria 29296
185 Ga0070717_10000817 3300006028 Bacteria 20525
186 Ga0070717_10002247 3300006028 Bacteria 13537
187 Ga0070717_10058902 3300006028 Bacteria 3176
188 Ga0070717_10263727 3300006028 Bacteria 1525
189 Ga0070717_10419032 3300006028 Bacteria 1204
190 Ga0075365_10074009 3300006038 Bacteria 2297
191 Ga0075365_10250267 3300006038 Bacteria 1245
192 Ga0075368_10033390 3300006042 Bacteria 2002
193 Ga0075368_10107349 3300006042 Bacteria 1149
194 Ga0075368_10339637 3300006042 Bacteria 652
195 Ga0075363_100151649 3300006048 Bacteria 1308
196 Ga0075363_100156015 3300006048 Bacteria 1290
197 Ga0075363_100164771 3300006048 Bacteria 1256
198 Ga0075363_100237427 3300006048 Bacteria 1047
199 Ga0075363_100406342 3300006048 Bacteria 801
200 Ga0075364_10138064 3300006051 Bacteria 1638
201 Ga0070715_10002395 3300006163 Bacteria 5744
202 Ga0070715_10049634 3300006163 Bacteria 1799
203 Ga0070716_100117656 3300006173 Bacteria 1658
204 Ga0070712_100004741 3300006175 Bacteria 8406
205 Ga0070712_100056383 3300006175 Bacteria 2756
206 Ga0070712_100056602 3300006175 Bacteria 2751
207 Ga0075362_10035073 3300006177 Bacteria 2189
208 Ga0075362_10058301 3300006177 Bacteria 1741
209 Ga0075362_10066822 3300006177 Bacteria 1635
210 Ga0075362_10138598 3300006177 Bacteria 1161
211 Ga0075362_10393079 3300006177 Bacteria 699
212 Ga0075369_10023967 3300006186 Bacteria 2526
213 Ga0075369_10064469 3300006186 Bacteria 1604
214 Ga0075369_10098445 3300006186 Bacteria 1310
215 Ga0075369_10420604 3300006186 Bacteria 631
216 Ga0075366_10024433 3300006195 Bacteria 3525
217 Ga0075366_10080872 3300006195 Bacteria 1940
218 Ga0075366_10216139 3300006195 Bacteria 1167
219 Ga0075366_10575975 3300006195 Bacteria 697
220 Ga0097621_100174234 3300006237 Bacteria 1856
221 Ga0097621_100195018 3300006237 Bacteria 1756
222 Ga0075370_10108842 3300006353 Bacteria 1608
223 Ga0075370_10198603 3300006353 Bacteria 1183
224 Ga0075370_10292155 3300006353 Bacteria 969
225 Ga0068871_100084796 3300006358 Bacteria 2629
226 Ga0075428_100162154 3300006844 Bacteria 2427
227 Ga0075434_100303038 3300006871 Bacteria 1618
228 Ga0075434_100493030 3300006871 Bacteria 1246
229 Ga0068865_100028120 3300006881 Bacteria 3721
230 Ga0068865_100055918 3300006881 Bacteria 2747
231 Ga0075436_100161011 3300006914 Bacteria 1582
232 Ga0075436_100567622 3300006914 Bacteria 834
233 Ga0097620_100064486 3300006931 Bacteria 3695
234 Ga0097620_100352307 3300006931 Bacteria 1567
235 Ga0075435_100334679 3300007076 Bacteria 1297
236 Ga0099794_10343242 3300007265 Bacteria 776
237 Ga0105250_10190319 3300009092 Bacteria 863
238 Ga0105240_10015381 3300009093 Bacteria 10403
239 Ga0105240_10080919 3300009093 Bacteria 3993
240 Ga0105240_10316975 3300009093 Bacteria 1778
241 Ga0105240_10878092 3300009093 Bacteria 966
242 Ga0105240_11126889 3300009093 Bacteria 834
243 Ga0105240_11219676 3300009093 Bacteria 796
244 Ga0111539_10269577 3300009094 Bacteria 1982
245 Ga0105245_10136563 3300009098 Bacteria 2305
246 Ga0105245_10141418 3300009098 Bacteria 2267
247 Ga0105245_10267733 3300009098 Bacteria 1665
248 Ga0105245_10414503 3300009098 Bacteria 1349
249 Ga0105247_10009307 3300009101 Bacteria 5964
250 Ga0105247_10058543 3300009101 Bacteria 2384
251 Ga0105247_10090956 3300009101 Bacteria 1937
252 Ga0105247_11015810 3300009101 Bacteria 649
253 Ga0114129_10234852 3300009147 Bacteria 2468
254 Ga0105243_10092391 3300009148 Bacteria 2495
255 Ga0105243_10191232 3300009148 Bacteria 1788
256 Ga0105243_10269958 3300009148 Bacteria 1527
257 Ga0105241_10051881 3300009174 Bacteria 3130
258 Ga0105241_10172862 3300009174 Bacteria 1786
259 Ga0105241_10237992 3300009174 Bacteria 1538
260 Ga0105241_10338577 3300009174 Bacteria 1303
261 Ga0105242_10727790 3300009176 Bacteria 974
262 Ga0105248_10159205 3300009177 Bacteria 2547
263 Ga0105248_10213030 3300009177 Bacteria 2177
264 Ga0105248_10438458 3300009177 Bacteria 1471
265 Ga0105248_10613000 3300009177 Bacteria 1228
266 Ga0105237_10081577 3300009545 Bacteria 3225
267 Ga0105237_10698814 3300009545 Bacteria 1021
268 Ga0105237_10761519 3300009545 Bacteria 975
269 Ga0105237_11033300 3300009545 Bacteria 829
270 Ga0105237_11171011 3300009545 Bacteria 775
271 Ga0105238_10392011 3300009551 Bacteria 1381
272 Ga0105238_11104047 3300009551 Bacteria 816
273 Ga0105238_11236310 3300009551 Bacteria 772
274 Ga0105238_11492689 3300009551 Bacteria 704
275 Ga0105249_10004270 3300009553 Bacteria 12350
276 Ga0105249_10028208 3300009553 Bacteria 5068
277 Ga0105249_10229182 3300009553 Bacteria 1832
278 Ga0099796_10221659 3300010159 Bacteria 775
279 Ga0105239_10090083 3300010375 Bacteria 3384
280 Ga0105239_10232065 3300010375 Bacteria 2070
281 Ga0105239_10275749 3300010375 Bacteria 1892
282 Ga0105239_10490657 3300010375 Bacteria 1396
283 Ga0105239_11671595 3300010375 Bacteria 737
284 Ga0105239_12058478 3300010375 Bacteria 663
285 Ga0105246_10014135 3300011119 Bacteria 5016
286 Ga0105246_10039960 3300011119 Bacteria 3163
287 Ga0105246_10135193 3300011119 Bacteria 1847
288 Ga0157345_1014652 3300012498 Bacteria 734
289 Ga0157313_1017102 3300012503 Bacteria 700
290 Ga0157371_10161044 3300013102 Bacteria 1603
291 Ga0157370_10099137 3300013104 Bacteria 2731
292 Ga0157369_10022887 3300013105 Bacteria 6968
293 Ga0157369_10064206 3300013105 Bacteria 3955
294 Ga0157369_10069772 3300013105 Bacteria 3775
295 Ga0157369_10230424 3300013105 Bacteria 1937
296 Ga0157374_10103930 3300013296 Bacteria 2727
297 Ga0163162_11873604 3300013306 Bacteria 686
298 Ga0157372_10235992 3300013307 Bacteria 2121
299 Ga0157372_10245298 3300013307 Bacteria 2079
300 Ga0157372_11321162 3300013307 Bacteria 832
301 Ga0157372_11621896 3300013307 Bacteria 745
302 Ga0157375_10054747 3300013308 Bacteria 3930
303 Ga0157375_10373591 3300013308 Bacteria 1592
304 Ga0157375_10547478 3300013308 Bacteria 1319
305 Ga0157375_10563447 3300013308 Bacteria 1300
306 Ga0163163_10018933 3300014325 Bacteria 6459
307 Ga0163163_10067806 3300014325 Bacteria 3549
308 Ga0163163_10426228 3300014325 Bacteria 1386
309 Ga0157380_10014851 3300014326 Bacteria 5705
310 Ga0157380_10117881 3300014326 Bacteria 2243
311 Ga0157377_10036926 3300014745 Bacteria 2690
312 Ga0157379_10107068 3300014968 Bacteria 2510
313 Ga0157379_11048051 3300014968 Bacteria 779
314 Ga0157376_10145645 3300014969 Bacteria 2130
315 Ga0157376_10202067 3300014969 Bacteria 1829
316 Ga0157376_10541882 3300014969 Bacteria 1150
317 Ga0157376_10764702 3300014969 Bacteria 976
318 Ga0182007_10105900 3300015262 Bacteria 933
319 Ga0163161_10222085 3300017792 Bacteria 1463
320 Ga0163161_10517304 3300017792 Bacteria 974
321 Ga0206356_11422122 3300020070 Bacteria 730
322 Ga0206353_10037471 3300020082 Bacteria 1478
323 Ga0213872_10072452 3300021361 Bacteria 1552
324 Ga0213874_10019910 3300021377 Bacteria 1833
325 Ga0213876_10025319 3300021384 Bacteria 3131
326 Ga0213876_10435210 3300021384 Bacteria 698
327 Ga0213875_10000142 3300021388 Bacteria 77423
328 Ga0213875_10072222 3300021388 Bacteria 1611
329 Ga0213875_10099496 3300021388 Bacteria 1357
330 Ga0213871_10025378 3300021441 Bacteria 1508
331 Ga0224712_10200821 3300022467 Bacteria 906
332 Ga0209677_100233 3300025253 Bacteria 39376
333 Ga0209233_1001314 3300025261 Bacteria 9924
334 Ga0209455_1006779 3300025272 Bacteria 3335
335 Ga0209758_1001054 3300025297 Bacteria 36110
336 Ga0209758_1002780 3300025297 Bacteria 17132
337 Ga0209758_1005792 3300025297 Bacteria 9263
338 Ga0207697_10014975 3300025315 Bacteria 3209
339 Ga0207656_10013854 3300025321 Bacteria 3093
340 Ga0207653_10065997 3300025885 Bacteria 1229
341 Ga0207692_10001234 3300025898 Bacteria 9495
342 Ga0207692_11037978 3300025898 Bacteria 542
343 Ga0207642_10027613 3300025899 Bacteria 2325
344 Ga0207710_10067924 3300025900 Bacteria 1629
345 Ga0207688_10001188 3300025901 Bacteria 13447
346 Ga0207680_10007109 3300025903 Bacteria 5441
347 Ga0207647_10000809 3300025904 Bacteria 24246
348 Ga0207647_10123044 3300025904 Bacteria 1529
349 Ga0207647_10532394 3300025904 Bacteria 653
350 Ga0207685_10177100 3300025905 Bacteria 986
351 Ga0207699_10002060 3300025906 Bacteria 9495
352 Ga0207699_10016926 3300025906 Bacteria 3824
353 Ga0207699_10048973 3300025906 Bacteria 2485
354 Ga0207699_10220046 3300025906 Bacteria 1296
355 Ga0207699_10537179 3300025906 Bacteria 847
356 Ga0207699_10620293 3300025906 Bacteria 788
357 Ga0207645_10030737 3300025907 Bacteria 3460
358 Ga0207645_10031831 3300025907 Bacteria 3391
359 Ga0207645_10175169 3300025907 Bacteria 1407
360 Ga0207643_10002016 3300025908 Bacteria 11209
361 Ga0207705_10040190 3300025909 Bacteria 3353
362 Ga0207705_10163730 3300025909 Bacteria 1672
363 Ga0207705_10840494 3300025909 Bacteria 712
364 Ga0207684_10211034 3300025910 Bacteria 1675
365 Ga0207684_10495332 3300025910 Bacteria 1048
366 Ga0207654_10050717 3300025911 Bacteria 2386
367 Ga0207654_10132691 3300025911 Bacteria 1578
368 Ga0207654_10876919 3300025911 Bacteria 650
369 Ga0207707_10000639 3300025912 Bacteria 34565
370 Ga0207707_10024022 3300025912 Bacteria 5330
371 Ga0207707_10024564 3300025912 Bacteria 5274
372 Ga0207707_10176437 3300025912 Bacteria 1867
373 Ga0207695_10445138 3300025913 Bacteria 1179
374 Ga0207695_10512086 3300025913 Bacteria 1082
375 Ga0207695_11182799 3300025913 Bacteria 645
376 Ga0207671_10079258 3300025914 Bacteria 2461
377 Ga0207671_10524173 3300025914 Bacteria 945
378 Ga0207671_10671466 3300025914 Bacteria 825
379 Ga0207693_10008491 3300025915 Bacteria 8408
380 Ga0207693_10018411 3300025915 Bacteria 5563
381 Ga0207693_10091909 3300025915 Bacteria 2379
382 Ga0207693_10184105 3300025915 Bacteria 1644
383 Ga0207693_10240618 3300025915 Bacteria 1421
384 Ga0207663_10022545 3300025916 Bacteria 3601
385 Ga0207663_10109854 3300025916 Bacteria 1869
386 Ga0207663_10206131 3300025916 Bacteria 1422
387 Ga0207663_10725516 3300025916 Bacteria 788
388 Ga0207663_10935281 3300025916 Bacteria 694
389 Ga0207660_10069657 3300025917 Bacteria 2555
390 Ga0207660_10183391 3300025917 Bacteria 1626
391 Ga0207660_10454669 3300025917 Bacteria 1036
392 Ga0207660_10458137 3300025917 Bacteria 1032
393 Ga0207660_10521969 3300025917 Bacteria 964
394 Ga0207660_10681471 3300025917 Bacteria 838
395 Ga0207662_10001080 3300025918 Bacteria 12803
396 Ga0207657_10021043 3300025919 Bacteria 6149
397 Ga0207657_10065938 3300025919 Bacteria 3084
398 Ga0207657_10570707 3300025919 Bacteria 884
399 Ga0207657_10986939 3300025919 Bacteria 646
400 Ga0207649_10015191 3300025920 Bacteria 4325
401 Ga0207649_10858982 3300025920 Bacteria 710
402 Ga0207652_10016814 3300025921 Bacteria 5978
403 Ga0207652_10100694 3300025921 Bacteria 2551
404 Ga0207652_10124141 3300025921 Bacteria 2299
405 Ga0207652_10326519 3300025921 Bacteria 1385
406 Ga0207652_10642824 3300025921 Bacteria 949
407 Ga0207646_10975034 3300025922 Bacteria 750
408 Ga0207681_10514019 3300025923 Bacteria 982
409 Ga0207694_10073031 3300025924 Bacteria 2683
410 Ga0207694_11273295 3300025924 Bacteria 622
411 Ga0207650_10018934 3300025925 Bacteria 4837
412 Ga0207687_10174581 3300025927 Bacteria 1660
413 Ga0207687_10337779 3300025927 Bacteria 1224
414 Ga0207687_10411633 3300025927 Bacteria 1114
415 Ga0207687_11153296 3300025927 Bacteria 666
416 Ga0207700_10000623 3300025928 Bacteria 20712
417 Ga0207700_10002691 3300025928 Bacteria 10243
418 Ga0207700_10032084 3300025928 Bacteria 3741
419 Ga0207700_10062218 3300025928 Bacteria 2834
420 Ga0207700_10065543 3300025928 Bacteria 2772
421 Ga0207700_10166474 3300025928 Bacteria 1835
422 Ga0207700_10178009 3300025928 Bacteria 1779
423 Ga0207700_10836562 3300025928 Bacteria 823
424 Ga0207664_10014641 3300025929 Bacteria 5672
425 Ga0207664_10056194 3300025929 Bacteria 3126
426 Ga0207664_10089570 3300025929 Bacteria 2520
427 Ga0207664_10102398 3300025929 Bacteria 2368
428 Ga0207664_10505021 3300025929 Bacteria 1083
429 Ga0207644_10010824 3300025931 Bacteria 6021
430 Ga0207644_10074843 3300025931 Bacteria 2486
431 Ga0207644_10214235 3300025931 Bacteria 1524
432 Ga0207644_10534492 3300025931 Bacteria 969
433 Ga0207690_10390622 3300025932 Bacteria 1108
434 Ga0207706_10010401 3300025933 Bacteria 8498
435 Ga0207686_10038933 3300025934 Bacteria 2881
436 Ga0207686_10911224 3300025934 Bacteria 710
437 Ga0207709_10032144 3300025935 Bacteria 3071
438 Ga0207709_10195654 3300025935 Bacteria 1440
439 Ga0207670_10025786 3300025936 Bacteria 3695
440 Ga0207669_10003777 3300025937 Bacteria 6583
441 Ga0207704_10102839 3300025938 Bacteria 1909
442 Ga0207665_10035299 3300025939 Bacteria 3319
443 Ga0207665_10184037 3300025939 Bacteria 1514
444 Ga0207665_10614057 3300025939 Bacteria 850
445 Ga0207691_10006467 3300025940 Bacteria 11318
446 Ga0207691_10046117 3300025940 Bacteria 4007
447 Ga0207689_10008692 3300025942 Bacteria 8836
448 Ga0207689_10010839 3300025942 Bacteria 7841
449 Ga0207689_10491736 3300025942 Bacteria 1027
450 Ga0207661_10000597 3300025944 Bacteria 23061
451 Ga0207661_10003825 3300025944 Bacteria 10498
452 Ga0207661_10022549 3300025944 Bacteria 4745
453 Ga0207661_10325478 3300025944 Bacteria 1383
454 Ga0207679_10097968 3300025945 Bacteria 2285
455 Ga0207679_10140050 3300025945 Bacteria 1954
456 Ga0207679_10321797 3300025945 Bacteria 1339
457 Ga0207679_10365183 3300025945 Bacteria 1262
458 Ga0207667_10225941 3300025949 Bacteria 1918
459 Ga0207667_10583989 3300025949 Bacteria 1128
460 Ga0207667_10738197 3300025949 Bacteria 985
461 Ga0207651_10046240 3300025960 Bacteria 2925
462 Ga0207651_10184467 3300025960 Bacteria 1658
463 Ga0207712_10011451 3300025961 Bacteria 5649
464 Ga0207712_10023661 3300025961 Bacteria 4058
465 Ga0207712_10041247 3300025961 Bacteria 3171
466 Ga0207712_10067877 3300025961 Bacteria 2553
467 Ga0207668_10052089 3300025972 Bacteria 2830
468 Ga0207668_10278635 3300025972 Bacteria 1370
469 Ga0207668_10360991 3300025972 Bacteria 1217
470 Ga0207640_10022181 3300025981 Bacteria 3796
471 Ga0207640_10470771 3300025981 Bacteria 1040
472 Ga0207640_10742946 3300025981 Bacteria 845
473 Ga0207658_10079632 3300025986 Bacteria 2507
474 Ga0207658_10988698 3300025986 Bacteria 767
475 Ga0207677_10034211 3300026023 Bacteria 3289
476 Ga0207677_10179835 3300026023 Bacteria 1663
477 Ga0207703_10053829 3300026035 Bacteria 3271
478 Ga0207703_10131795 3300026035 Bacteria 2159
479 Ga0207703_10172458 3300026035 Bacteria 1904
480 Ga0207703_10761331 3300026035 Bacteria 923
481 Ga0207703_11489347 3300026035 Bacteria 651
482 Ga0207639_10133372 3300026041 Bacteria 2059
483 Ga0207639_10187867 3300026041 Bacteria 1763
484 Ga0207639_10458548 3300026041 Bacteria 1158
485 Ga0207639_11258065 3300026041 Bacteria 694
486 Ga0207678_10010726 3300026067 Bacteria 8050
487 Ga0207678_10020068 3300026067 Bacteria 5871
488 Ga0207678_10070164 3300026067 Bacteria 3004
489 Ga0207708_10002263 3300026075 Bacteria 14186
490 Ga0207708_10516008 3300026075 Bacteria 1003
491 Ga0207702_10083084 3300026078 Bacteria 2786
492 Ga0207702_10191539 3300026078 Bacteria 1890
493 Ga0207702_10487189 3300026078 Bacteria 1201
494 Ga0207702_11162830 3300026078 Bacteria 766
495 Ga0207702_11334269 3300026078 Bacteria 711
496 Ga0207641_10962213 3300026088 Bacteria 849
497 Ga0207648_10002178 3300026089 Bacteria 21254
498 Ga0207676_10006683 3300026095 Bacteria 8159
499 Ga0207676_10270545 3300026095 Bacteria 1538
500 Ga0207676_11540864 3300026095 Bacteria 662
501 Ga0207674_10133883 3300026116 Bacteria 2441
502 Ga0207674_10524482 3300026116 Bacteria 1144
503 Ga0207674_10578941 3300026116 Bacteria 1084
504 Ga0207674_12039257 3300026116 Bacteria 538
505 Ga0207675_100003923 3300026118 Bacteria 14440
506 Ga0207675_100071818 3300026118 Bacteria 3236
507 Ga0207683_10004860 3300026121 Bacteria 11570
508 Ga0207698_10268494 3300026142 Bacteria 1571
509 Ga0207698_10443641 3300026142 Bacteria 1251
510 Ga0207698_10776097 3300026142 Bacteria 959
511 Ga0209813_10002805 3300027866 Bacteria 4027
512 Ga0268266_10110942 3300028379 Bacteria 2430
513 Ga0268266_10214036 3300028379 Bacteria 1768
514 Ga0268266_10260572 3300028379 Bacteria 1607
515 Ga0268266_10390138 3300028379 Bacteria 1315
516 Ga0268265_10473920 3300028380 Bacteria 1174
517 Ga0268265_10538904 3300028380 Bacteria 1106
518 Ga0268265_10816259 3300028380 Bacteria 910
519 Ga0268264_10078980 3300028381 Bacteria 2806
520 Ga0268264_11813193 3300028381 Bacteria 620
521 Ga0265338_10762236 3300028800 Bacteria 665
522 Ga0265325_10001902 3300031241 Bacteria 14413
523 Ga0265325_10266842 3300031241 Bacteria 771
524 Ga0265340_10146059 3300031247 Bacteria 1080
525 Ga0265339_10011190 3300031249 Bacteria 5537
526 Ga0265339_10283160 3300031249 Bacteria 794
527 Ga0265316_10778452 3300031344 Bacteria 672
528 Ga0307408_100103881 3300031548 Bacteria 2170
529 Ga0307408_100282708 3300031548 Bacteria 1382
530 Ga0265314_10011237 3300031711 Bacteria 7409
531 Ga0307405_11793061 3300031731 Bacteria 545
532 Ga0307406_10213010 3300031901 Bacteria 1431
533 Ga0307407_10299857 3300031903 Bacteria 1120
534 Ga0307412_10323819 3300031911 Bacteria 1227
535 Ga0307412_10405536 3300031911 Bacteria 1111
536 Ga0307416_100258607 3300032002 Bacteria 1700
537 Ga0307416_101000808 3300032002 Bacteria 939
538 Ga0307411_10480763 3300032005 Bacteria 1046
539 Ga0316215_1000679 3300033544 Bacteria 3530
540 Ga0373958_0102780 3300034819 Bacteria 672
541 Ga0373958_0108207 3300034819 Bacteria 660
542 Ga0373959_0010924 3300034820 Bacteria 1595
543 Ga0373938_0003602 3300034957 Bacteria 2552
544 Ga0373934_0030845 3300035086 Bacteria 2098
545 Ga0373952_0046289 3300035092 Bacteria 1022
546 Ga0373923_0050621 3300035111 Bacteria 1740
547 Ga0373923_0108821 3300035111 Bacteria 1229
548 Ga0373932_0248012 3300035112 Bacteria 649
549 Ga0373936_0012238 3300035113 Bacteria 3261
550 Ga0373936_0012556 3300035113 Bacteria 3225
551 Ga0373936_0217644 3300035113 Bacteria 846
552 Ga0373941_0000578 3300035115 Bacteria 7374
553 Ga0373941_0022048 3300035115 Bacteria 1804
554 Ga0373945_0263175 3300035116 Bacteria 731
555 Ga0373953_0193641 3300035117 Bacteria 878
556 Ga0373953_0208203 3300035117 Bacteria 846
557 Ga0373954_0010065 3300035118 Bacteria 4166
558 Ga0373954_0235116 3300035118 Bacteria 902
559 Ga0373954_0599989 3300035118 Bacteria 546
560 Ga0373956_0009126 3300035119 Bacteria 4022
561 Ga0373956_0035874 3300035119 Bacteria 2188
562 Ga0373960_0005392 3300035121 Bacteria 2960
563 Ga0373943_0006929 3300035170 Bacteria 5085
564 Ga0373943_0296331 3300035170 Bacteria 917
565 Ga0373946_0091900 3300035171 Bacteria 1346
566 Ga0373946_0345272 3300035171 Bacteria 743
567 Ga0373955_0004730 3300035172 Bacteria 6053
568 Ga0373955_0268436 3300035172 Bacteria 1025
569 Ga0373955_0553508 3300035172 Bacteria 704
570 Ga0373962_0003173 3300035242 Bacteria 3942
571 Ga0373924_0083274 3300035410 Bacteria 1362
572 Ga0373931_0007687 3300035691 Bacteria 5088
573 Ga0373931_0184041 3300035691 Bacteria 1239
574 Ga0373935_0190125 3300035692 Bacteria 1414
575 Ga0373927_0026537 3300035695 Bacteria 3786
576 Ga0373927_0086107 3300035695 Bacteria 2039
577 Ga0373927_0088015 3300035695 Bacteria 2016
578 Ga0373933_0000964 3300035724 Bacteria 17534
579 Ga0373933_0112940 3300035724 Bacteria 1696
580 Ga0373933_0149844 3300035724 Bacteria 1477
581 Ga0373947_0013134 3300035725 Bacteria 4748
582 Ga0373947_0019419 3300035725 Bacteria 3918
583 Ga0373937_0004681 3300036401 Bacteria 11629
584 Ga0373937_0089005 3300036401 Bacteria 2858
585 Ga0372808_001650 3300036459 Bacteria 2381
586 Ga0373925_0004333 3300037068 Bacteria 10734
587 Ga0373925_0117436 3300037068 Bacteria 2062
588 Ga0373925_0742516 3300037068 Bacteria 809
589 Ga0373925_0812531 3300037068 Bacteria 771
590 Ga0395899_0014008 3300037312 Bacteria 6122
591 Ga0395899_0022031 3300037312 Bacteria 4832
592 Ga0395899_0360095 3300037312 Bacteria 971
593 Ga0395899_0464771 3300037312 Bacteria 826
594 Ga0395900_0014973 3300037418 Bacteria 7904
595 Ga0395900_0082575 3300037418 Bacteria 3301
596 Ga0395900_0108769 3300037418 Bacteria 2848
597 Ga0395900_0148637 3300037418 Bacteria 2395
598 Ga0395900_0220560 3300037418 Bacteria 1911
599 Ga0395900_0249867 3300037418 Bacteria 1775
600 Ga0395900_0354159 3300037418 Bacteria 1441
601 Ga0395898_0007428 3300037466 Bacteria 11633
602 Ga0395898_0060527 3300037466 Bacteria 3680
603 Ga0395898_0060705 3300037466 Bacteria 3674
604 Ga0395898_0075786 3300037466 Bacteria 3248
605 Ga0395898_0095429 3300037466 Bacteria 2857
606 Ga0395898_0254403 3300037466 Bacteria 1675
607 Ga0395898_1218030 3300037466 Bacteria 684
608 Ga0395905_0240916 3300037471 Bacteria 1690
609 Ga0436364_0419251 3300037853 Bacteria 3511
610 Ga0436364_0634277 3300037853 Bacteria 5458
611 Ga0436364_1319713 3300037853 Bacteria 1689
612 Ga0436364_1465979 3300037853 Bacteria 23307
613 Ga0395901_0020070 3300038443 Bacteria 6838
614 Ga0395901_0037019 3300038443 Bacteria 5046
615 Ga0395901_0124591 3300038443 Bacteria 2708
616 Ga0395901_0168056 3300038443 Bacteria 2302
617 Ga0395901_0409511 3300038443 Bacteria 1392
618 Ga0395901_0688629 3300038443 Bacteria 1021
619 Ga0395901_1561973 3300038443 Bacteria 614
620 Ga0436365_0531841 3300039437 Bacteria 636
621 Ga0436365_0787752 3300039437 Bacteria 4585
622 Ga0436365_1437293 3300039437 Bacteria 2335
623 Ga0436365_1465346 3300039437 Bacteria 1047
624 Ga0436365_1623170 3300039437 Bacteria 1737
625 Ga0436365_1681445 3300039437 Bacteria 787
626 Ga0436365_1706766 3300039437 Bacteria 711
627 Ga0436365_1709481 3300039437 Bacteria 1760
628 Ga0436360_0172693 3300039438 Bacteria 3825
629 Ga0436360_0707092 3300039438 Bacteria 954
630 Ga0436361_0063482 3300039447 Bacteria 648
631 Ga0436361_0386711 3300039447 Bacteria 3504
632 Ga0436361_0773244 3300039447 Bacteria 2204
633 Ga0436363_0035196 3300039450 Bacteria 3554
634 Ga0436363_0411146 3300039450 Bacteria 1016
635 Ga0436363_0533424 3300039450 Bacteria 1767
636 Ga0436363_0802989 3300039450 Bacteria 633
637 Ga0436363_0819011 3300039450 Bacteria 905
638 Ga0436363_1049939 3300039450 Bacteria 2073
639 Ga0451789_0127710 3300041443 Bacteria 1369
640 Ga0451791_1805681 3300041451 Bacteria 591
641 Ga0451793_0888562 3300041452 Bacteria 934
642 Ga0451797_0233450 3300041453 Bacteria 982
643 Ga0451800_1372925 3300041459 Bacteria 1533
644 Ga0451807_0669418 3300041486 Bacteria 912
645 Ga0451807_1700963 3300041486 Bacteria 567
646 Ga0451833_1352607 3300041491 Bacteria 1108
647 Ga0451839_0986530 3300041496 Bacteria 1223
648 Ga0451841_0715077 3300041498 Bacteria 1407
649 Ga0451843_0408316 3300041509 Bacteria 852
650 Ga0451855_0428041 3300041511 Bacteria 575
651 Ga0451853_0421108 3300041512 Bacteria 1038
652 Ga0451853_1968490 3300041512 Bacteria 569
653 Ga0439449_0209599 3300042007 Bacteria 730
654 Ga0439458_0092731 3300042157 Bacteria 779
655 Ga0439458_0139370 3300042157 Bacteria 646
656 Ga0439434_0070879 3300042435 Bacteria 1097
657 Ga0466969_0168614 3300044656 Bacteria 1004
658 Ga0466969_0510267 3300044656 Bacteria 549
659 Ga0466965_0339797 3300044683 Bacteria 821
660 Ga0466966_0202043 3300044684 Bacteria 1202
661 Ga0466966_0209289 3300044684 Bacteria 1179
662 Ga0466963_0088861 3300044694 Bacteria 2102
663 Ga0466963_0137523 3300044694 Bacteria 1691
664 Ga0466964_0020730 3300044706 Bacteria 2534
665 Ga0466964_0455000 3300044706 Bacteria 679
666 Ga0466968_0174337 3300044735 Bacteria 998
667 Ga0466968_0731686 3300044735 Bacteria 507
668 Ga0466970_0165229 3300044765 Bacteria 1225
669 Ga0466970_0279239 3300044765 Bacteria 939
670 Ga0466957_0031026 3300044842 Bacteria 3193
671 Ga0466959_0294799 3300045049 Bacteria 1111
672 Ga0466959_0646560 3300045049 Bacteria 710
673 Ga0451576_0947692 3300045051 Bacteria 903
674 Ga0466958_0797522 3300045836 Bacteria 616
675 Ga0466967_0399194 3300045976 Bacteria 1337
676 Ga0466967_0842035 3300045976 Bacteria 911
677 Ga0495617_084425 3300046452 Bacteria 1039
678 Ga0495627_104886 3300046453 Bacteria 805
679 Ga0495592_0026114 3300046454 Bacteria 4431
680 Ga0495592_0129527 3300046454 Bacteria 1766
681 Ga0495592_0213048 3300046454 Bacteria 1296
682 Ga0495603_0040174 3300046455 Bacteria 2801
683 Ga0495603_0083928 3300046455 Bacteria 1865
684 Ga0495603_0168829 3300046455 Bacteria 1267
685 Ga0495590_0197288 3300046457 Bacteria 739
686 Ga0495590_0220895 3300046457 Bacteria 700
687 Ga0495629_0000026 3300046459 Bacteria 134719
688 Ga0495629_0161770 3300046459 Bacteria 1555
689 Ga0495641_0017870 3300046461 Bacteria 3677
690 Ga0495641_0394580 3300046461 Bacteria 628
691 Ga0495651_0133048 3300046462 Bacteria 1813
692 Ga0495651_0158273 3300046462 Bacteria 1625
693 Ga0495651_0757089 3300046462 Bacteria 602
694 Ga0495653_0157631 3300046463 Bacteria 1579
695 Ga0495580_0544726 3300046472 Bacteria 771
696 Ga0495582_0006073 3300046473 Bacteria 6730
697 Ga0495582_0061701 3300046473 Bacteria 2070
698 Ga0495605_0049578 3300046474 Bacteria 2051
699 Ga0495605_0050049 3300046474 Bacteria 2039
700 Ga0495605_0094492 3300046474 Bacteria 1381
701 Ga0495639_0078976 3300046475 Bacteria 1530
702 Ga0495662_0017465 3300046476 Bacteria 3472
703 Ga0495664_0012897 3300046477 Bacteria 4736
704 Ga0495664_0042373 3300046477 Bacteria 2695
705 Ga0495584_0080654 3300046491 Bacteria 1637
706 Ga0495584_0468468 3300046491 Bacteria 641
707 Ga0495585_0122722 3300046492 Bacteria 1373
708 Ga0495594_0033206 3300046499 Bacteria 2804
709 Ga0495594_0190016 3300046499 Bacteria 1170
710 Ga0495607_0177826 3300046501 Bacteria 1069
711 Ga0495583_0128608 3300046506 Bacteria 1061
712 Ga0495606_0013747 3300046507 Bacteria 6371
713 Ga0495606_0036782 3300046507 Bacteria 3331
714 Ga0495606_0202643 3300046507 Bacteria 1129
715 Ga0495608_0156305 3300046511 Bacteria 1451
716 Ga0495608_0327791 3300046511 Bacteria 945
717 Ga0495610_0072151 3300046512 Bacteria 1608
718 Ga0495616_0071592 3300046513 Bacteria 1676
719 Ga0495616_0086636 3300046513 Bacteria 1489
720 Ga0495616_0152852 3300046513 Bacteria 1043
721 Ga0495618_0285470 3300046514 Bacteria 1028
722 Ga0495620_0092004 3300046515 Bacteria 1216
723 Ga0495628_0137002 3300046516 Bacteria 1870
724 Ga0495628_0537140 3300046516 Bacteria 841
725 Ga0495630_0105716 3300046517 Bacteria 2131
726 Ga0495632_0058796 3300046519 Bacteria 1872
727 Ga0495632_0067688 3300046519 Bacteria 1722
728 Ga0495632_0438603 3300046519 Bacteria 567
729 Ga0495637_0160430 3300046520 Bacteria 844
730 Ga0495643_0004188 3300046522 Bacteria 10224
731 Ga0495643_0117339 3300046522 Bacteria 1348
732 Ga0495666_0231310 3300046526 Bacteria 845
733 Ga0495652_0041488 3300046529 Bacteria 3972
734 Ga0495665_0080877 3300046531 Bacteria 1708
735 Ga0495640_0025055 3300046533 Bacteria 4333
736 Ga0495587_0249716 3300046536 Bacteria 997
737 Ga0495587_0297520 3300046536 Bacteria 903
738 Ga0495598_0136058 3300046537 Bacteria 846
739 Ga0495609_0142037 3300046538 Bacteria 1024
740 Ga0495621_0025785 3300046539 Bacteria 1978
741 Ga0495622_0131374 3300046557 Bacteria 1140
742 Ga0495667_0171847 3300046559 Bacteria 1392
743 Ga0495656_0059991 3300046615 Bacteria 1656
744 Ga0495634_0029686 3300046642 Bacteria 3784
745 Ga0495611_0153748 3300046648 Bacteria 1074
746 Ga0495635_0042880 3300046663 Bacteria 3123
747 Ga0495659_0155873 3300046664 Bacteria 919
748 Ga0495661_0110146 3300046665 Bacteria 1536
749 Ga0495661_0125659 3300046665 Bacteria 1412
750 Ga0495588_0046148 3300046674 Bacteria 2234
751 Ga0495588_0063074 3300046674 Bacteria 1921
752 Ga0495657_0507571 3300046675 Bacteria 703
753 Ga0495599_0025746 3300046678 Bacteria 3685
754 Ga0495623_0045525 3300046679 Bacteria 2787
755 Ga0495623_0194097 3300046679 Bacteria 1171
756 Ga0495646_0038559 3300046680 Bacteria 2949
757 Ga0495647_0238377 3300046681 Bacteria 807
758 Ga0495658_0004213 3300046683 Bacteria 7076
759 Ga0495658_0004396 3300046683 Bacteria 6940
760 Ga0495669_0199262 3300046684 Bacteria 957
761 Ga0495613_0003849 3300046689 Bacteria 11230
762 Ga0495613_0250127 3300046689 Bacteria 1237
763 Ga0495624_0278865 3300046690 Bacteria 1009
764 Ga0495671_0095070 3300046692 Bacteria 1458
765 Ga0495589_0239870 3300046794 Bacteria 849
766 Ga0495589_0263572 3300046794 Bacteria 803
767 Ga0495589_0321797 3300046794 Bacteria 715
768 Ga0495600_0146398 3300046809 Bacteria 1531
769 Ga0495581_0096406 3300047315 Bacteria 1717
770 Ga0495581_0545244 3300047315 Bacteria 673
771 Ga0495604_0123964 3300047317 Bacteria 1866
772 Ga0495604_0583575 3300047317 Bacteria 718
773 Ga0495674_0010664 3300047319 Bacteria 8696
774 Ga0495674_0320052 3300047319 Bacteria 1264
775 Ga0495672_0017843 3300047320 Bacteria 4734
776 Ga0495676_0029124 3300047321 Bacteria 4704
777 Ga0495676_0124171 3300047321 Bacteria 1873
778 Ga0495676_0191915 3300047321 Bacteria 1424
779 Ga0495676_0269104 3300047321 Bacteria 1157
780 Ga0495680_0096668 3300047322 Bacteria 2205
781 Ga0495680_0955569 3300047322 Bacteria 550
782 Ga0495683_0189085 3300047323 Bacteria 935
783 Ga0495687_005489 3300047443 Bacteria 8057
784 Ga0495684_0565957 3300047471 Bacteria 772
785 Ga0495593_0127162 3300047673 Bacteria 1295
786 Ga0495602_0029536 3300048088 Bacteria 5217
787 Ga0495626_0224603 3300048091 Bacteria 762
788 Ga0496100_0073041 3300048903 Bacteria 2294
789 Ga0496100_0097342 3300048903 Bacteria 2020
790 Ga0496100_0197458 3300048903 Bacteria 1464
791 Ga0496100_0274746 3300048903 Bacteria 1254
792 Ga0496100_0347749 3300048903 Bacteria 1119
793 Ga0496100_0661330 3300048903 Bacteria 814
794 Ga0496101_0045702 3300048904 Bacteria 3138
795 Ga0496101_0080417 3300048904 Bacteria 2407
796 Ga0496101_0130721 3300048904 Bacteria 1906
797 Ga0496101_0541240 3300048904 Bacteria 921
798 Ga0496102_0009072 3300048905 Bacteria 8533
799 Ga0496102_0033286 3300048905 Bacteria 4630
800 Ga0496102_0253173 3300048905 Bacteria 1660
801 Ga0496103_0004573 3300048906 Bacteria 8381
802 Ga0496103_0030056 3300048906 Bacteria 3304
803 Ga0496103_0060685 3300048906 Bacteria 2350
804 Ga0496104_0051086 3300048907 Bacteria 3901
805 Ga0496104_0054081 3300048907 Bacteria 3794
806 Ga0496104_0126679 3300048907 Bacteria 2452
807 Ga0496104_1092601 3300048907 Bacteria 701
808 Ga0496105_0016436 3300048908 Bacteria 5910
809 Ga0496105_0037583 3300048908 Bacteria 3987
810 Ga0496105_0074130 3300048908 Bacteria 2811
811 Ga0496105_0075164 3300048908 Bacteria 2790
812 Ga0496105_0154331 3300048908 Bacteria 1886
813 Ga0496105_0445720 3300048908 Bacteria 1022
814 Ga0496105_0493511 3300048908 Bacteria 962
815 Ga0496106_0003696 3300048909 Bacteria 11413
816 Ga0496106_0009424 3300048909 Bacteria 7218
817 Ga0496106_0037654 3300048909 Bacteria 3619
818 Ga0496106_0052883 3300048909 Bacteria 3065
819 Ga0496106_0237110 3300048909 Bacteria 1457
820 Ga0496106_0541949 3300048909 Bacteria 934
821 Ga0496107_0029043 3300048910 Bacteria 3932
822 Ga0496107_0035247 3300048910 Bacteria 3587
823 Ga0496107_0107375 3300048910 Bacteria 2050
824 Ga0496107_0252868 3300048910 Bacteria 1311
825 Ga0496107_0557387 3300048910 Bacteria 848
826 Ga0496108_0003416 3300048911 Bacteria 12751
827 Ga0496108_0018377 3300048911 Bacteria 5724
828 Ga0496108_0128469 3300048911 Bacteria 2177
829 Ga0496108_0370162 3300048911 Bacteria 1251
830 Ga0496108_1335158 3300048911 Bacteria 602
831 Ga0496109_0000230 3300048912 Bacteria 54618
832 Ga0496109_0122275 3300048912 Bacteria 2425
833 Ga0496109_0296021 3300048912 Bacteria 1526
834 Ga0496109_0403397 3300048912 Bacteria 1291
835 Ga0496109_0837916 3300048912 Bacteria 857
836 Ga0496110_0037897 3300048913 Bacteria 4192
837 Ga0496110_0067729 3300048913 Bacteria 3159
838 Ga0496110_0109415 3300048913 Bacteria 2482
839 Ga0496110_0497187 3300048913 Bacteria 1110
840 Ga0496110_1293107 3300048913 Bacteria 638
841 Ga0496111_0004587 3300048914 Bacteria 8746
842 Ga0496111_0032758 3300048914 Bacteria 3705
843 Ga0496111_0095892 3300048914 Bacteria 2177
844 Ga0496111_0167656 3300048914 Bacteria 1631
845 Ga0496111_0210917 3300048914 Bacteria 1443
846 Ga0496111_0231915 3300048914 Bacteria 1371
847 Ga0496112_0000023 3300048915 Bacteria 156144
848 Ga0496112_0002087 3300048915 Bacteria 15846
849 Ga0496112_0031534 3300048915 Bacteria 5142
850 Ga0496112_0051672 3300048915 Bacteria 4032
851 Ga0496112_0135848 3300048915 Bacteria 2429
852 Ga0496112_0218843 3300048915 Bacteria 1860
853 Ga0496112_0247487 3300048915 Bacteria 1734
854 Ga0496112_0863182 3300048915 Bacteria 828
855 Ga0496113_0022759 3300048916 Bacteria 4437
856 Ga0496113_0044231 3300048916 Bacteria 3298
857 Ga0496113_0133884 3300048916 Bacteria 1946
858 Ga0496113_0221551 3300048916 Bacteria 1507
859 Ga0496113_0243906 3300048916 Bacteria 1434
860 Ga0496113_0266580 3300048916 Bacteria 1368
861 Ga0496113_0581213 3300048916 Bacteria 897
862 Ga0496113_0741359 3300048916 Bacteria 782
863 Ga0496113_0776289 3300048916 Bacteria 762
864 Ga0496114_0009309 3300048917 Bacteria 7795
865 Ga0496115_0008142 3300048918 Bacteria 7744
866 Ga0496115_0028571 3300048918 Bacteria 4372
867 Ga0496115_0040631 3300048918 Bacteria 3699
868 Ga0496115_0079177 3300048918 Bacteria 2674
869 Ga0496115_0095262 3300048918 Bacteria 2436
870 Ga0496115_0115921 3300048918 Bacteria 2203
871 Ga0496116_0018120 3300048919 Bacteria 5439
872 Ga0496116_0081305 3300048919 Bacteria 2009
873 Ga0496117_0267776 3300048920 Bacteria 922
874 Ga0496118_0021437 3300048921 Bacteria 5686
875 Ga0496118_0065475 3300048921 Bacteria 2659
876 Ga0496119_0047831 3300048922 Bacteria 2658
877 Ga0496119_0099016 3300048922 Bacteria 1641
878 Ga0496119_0375893 3300048922 Bacteria 682
879 Ga0496120_0207668 3300048923 Bacteria 944
880 Ga0496121_0001793 3300048924 Bacteria 34696
881 Ga0496121_0019921 3300048924 Bacteria 6676
882 Ga0496121_0035834 3300048924 Bacteria 4435
883 Ga0496121_0096769 3300048924 Bacteria 2289
884 Ga0496121_0163999 3300048924 Bacteria 1622
885 Ga0496121_0179081 3300048924 Bacteria 1532
886 Ga0496121_0249468 3300048924 Bacteria 1232
887 Ga0496121_0684399 3300048924 Bacteria 620
888 Ga0496122_0177917 3300048925 Bacteria 1273
889 Ga0496123_0115803 3300048926 Bacteria 1520
890 Ga0496123_0304737 3300048926 Bacteria 759
891 Ga0496124_0197901 3300048927 Bacteria 1531
892 Ga0496125_0001222 3300048928 Bacteria 38526
893 Ga0496125_0039681 3300048928 Bacteria 4049
894 Ga0496125_0204666 3300048928 Bacteria 1288
895 Ga0496125_0231190 3300048928 Bacteria 1182
896 Ga0496126_0001668 3300048929 Bacteria 33320
897 Ga0496126_0005184 3300048929 Bacteria 15063
898 Ga0496126_0067286 3300048929 Bacteria 3201
899 Ga0496126_0082223 3300048929 Bacteria 2846
900 Ga0496126_0182782 3300048929 Bacteria 1780
901 Ga0496126_0379786 3300048929 Bacteria 1150
902 Ga0501032_0211927 3300049569 Bacteria 1263
903 Ga0501033_0198516 3300049570 Bacteria 1434
904 Ga0501033_1008156 3300049570 Bacteria 556
905 Ga0501034_0029843 3300049571 Bacteria 5542
906 Ga0501034_0477166 3300049571 Bacteria 1163
907 Ga0501034_0689230 3300049571 Bacteria 921
908 Ga0501036_0062678 3300049572 Bacteria 3149
909 Ga0501036_0227627 3300049572 Bacteria 1565
910 Ga0501036_0321869 3300049572 Bacteria 1292
911 Ga0501038_0016736 3300049574 Bacteria 6642
912 Ga0501038_0118182 3300049574 Bacteria 2189
913 Ga0501038_0511913 3300049574 Bacteria 917
914 Ga0501039_0823912 3300049575 Bacteria 724
915 Ga0501042_0074658 3300049578 Bacteria 2427
916 Ga0501043_0033958 3300049579 Bacteria 4013
917 Ga0501043_0061576 3300049579 Bacteria 2947
918 Ga0501046_0046532 3300049580 Bacteria 3443
919 Ga0501046_0532555 3300049580 Bacteria 839
920 Ga0501047_0142653 3300049581 Bacteria 2273
921 Ga0501047_0349344 3300049581 Bacteria 1316
922 Ga0501047_0518470 3300049581 Bacteria 1018
923 Ga0501047_1029865 3300049581 Bacteria 636
924 Ga0501048_0178310 3300049582 Bacteria 1506
925 Ga0501067_0517976 3300049583 Bacteria 667
926 Ga0501069_0007682 3300049585 Bacteria 5658
927 Ga0501070_0007744 3300049586 Bacteria 9104
928 Ga0501070_0113582 3300049586 Bacteria 2238
929 Ga0501070_0123066 3300049586 Bacteria 2144
930 Ga0501070_0791160 3300049586 Bacteria 745
931 Ga0501073_0056399 3300049589 Bacteria 2748
932 Ga0501073_0328235 3300049589 Bacteria 1056
933 Ga0501073_0491924 3300049589 Bacteria 848
934 Ga0501074_0174932 3300049590 Bacteria 1532
935 Ga0501074_0481517 3300049590 Bacteria 880
936 Ga0501075_0329854 3300049591 Bacteria 1163
937 Ga0501076_0160981 3300049592 Bacteria 1828
938 Ga0501076_0195895 3300049592 Bacteria 1649
939 Ga0501076_0430103 3300049592 Bacteria 1086
940 Ga0501077_0041913 3300049593 Bacteria 2913
941 Ga0501077_1031021 3300049593 Bacteria 529
942 Ga0501079_0002944 3300049741 Bacteria 12446
943 Ga0501079_0111493 3300049741 Bacteria 2126
944 Ga0501080_0022026 3300049742 Bacteria 5904
945 Ga0501080_0105029 3300049742 Bacteria 2619
946 Ga0501080_1031031 3300049742 Bacteria 712
947 Ga0501081_0000925 3300049743 Bacteria 17405
948 Ga0501035_0000655 3300049822 Bacteria 38162
949 Ga0501035_0123022 3300049822 Bacteria 2266
950 Ga0501035_0180904 3300049822 Bacteria 1816
951 Ga0501035_0184970 3300049822 Bacteria 1793
952 Ga0501044_0039982 3300049823 Bacteria 4890
953 Ga0501044_0197232 3300049823 Bacteria 1972
954 Ga0501044_0256635 3300049823 Bacteria 1687
955 Ga0501044_0389985 3300049823 Bacteria 1307
956 Ga0501044_1307154 3300049823 Bacteria 592
957 nmdc:mga03683_302163_c1 3300050489 Bacteria 751
958 nmdc:mga03683_304528_c1 3300050489 Bacteria 748
959 nmdc:mga03n38_11178_c1 3300050490 Bacteria 3335
960 nmdc:mga03n38_196463_c1 3300050490 Bacteria 1042
961 nmdc:mga03n38_414661_c1 3300050490 Bacteria 744
962 nmdc:mga03n38_466597_c1 3300050490 Bacteria 704
963 nmdc:mga03n38_594230_c1 3300050490 Bacteria 630
964 nmdc:mga00v17_112485_c1 3300050491 Bacteria 1728
965 nmdc:mga00v17_22168_c1 3300050491 Bacteria 3661
966 nmdc:mga0yw44_269901_c1 3300050492 Bacteria 1135
967 nmdc:mga0yw44_39126_c1 3300050492 Bacteria 2810
968 nmdc:mga0yw44_43488_c1 3300050492 Bacteria 2682
969 nmdc:mga0yw44_46282_c1 3300050492 Bacteria 2612
970 nmdc:mga0yw44_77248_c1 3300050492 Bacteria 2080
971 nmdc:mga0k408_30886_c1 3300050493 Bacteria 3056
972 nmdc:mga0k408_60980_c1 3300050493 Bacteria 2192
973 nmdc:mga0k408_74540_c1 3300050493 Bacteria 1983
974 nmdc:mga06z11_12292_c1 3300050494 Bacteria 3720
975 nmdc:mga06z11_48797_c1 3300050494 Bacteria 2157
976 nmdc:mga06z11_692432_c1 3300050494 Bacteria 621
977 nmdc:mga04h51_26232_c1 3300050495 Bacteria 1800
978 nmdc:mga04h51_86991_c1 3300050495 Bacteria 1119
979 nmdc:mga07m45_269959_c1 3300050496 Bacteria 990
980 nmdc:mga07m45_34494_c1 3300050496 Bacteria 2813
981 nmdc:mga05p37_4482_c1 3300050507 Bacteria 16321
982 nmdc:mga05p37_49917_c1 3300050507 Bacteria 5146
983 nmdc:mga09592_2101_c1 3300050508 Bacteria 16083
984 nmdc:mga06r32_2521_c1 3300050510 Bacteria 16382
985 nmdc:mga08y16_3491_c1 3300050511 Bacteria 16323
986 nmdc:mga0n895_1560245_c1 3300050512 Bacteria 625
987 nmdc:mga0n895_209270_c1 3300050512 Bacteria 1981
988 nmdc:mga0rr50_209523_c1 3300050513 Bacteria 1605
989 nmdc:mga0rr50_33524_c1 3300050513 Bacteria 3669
990 nmdc:mga0rr50_528794_c1 3300050513 Bacteria 1004
991 nmdc:mga0rr50_92543_c1 3300050513 Bacteria 2357
992 nmdc:mga08x19_114544_c1 3300050514 Bacteria 1801
993 nmdc:mga08x19_305185_c1 3300050514 Bacteria 1106
994 nmdc:mga08x19_523923_c1 3300050514 Bacteria 838
995 nmdc:mga0sz30_19856_c1 3300050516 Bacteria 2705
996 Ga0495601_0134905 3300053077 Bacteria 1609
997 Ga0495601_0287726 3300053077 Bacteria 1071
998 Ga0495612_0005522 3300053078 Bacteria 5227
999 Ga0495612_0095023 3300053078 Bacteria 1265
1000 Ga0495619_0000360 3300053085 Bacteria 31637
1001 Ga0500578_0227945 3300053086 Bacteria 1130
1002 Ga0500646_0126378 3300053090 Bacteria 827
1003 Ga0500647_0004996 3300053091 Bacteria 5433
1004 Ga0500566_0001383 3300053094 Bacteria 14185
1005 Ga0500640_000887 3300053095 Bacteria 8330
1006 Ga0500654_189502 3300053099 Bacteria 640
1007 Ga0500557_000030 3300053105 Bacteria 76944
1008 Ga0500572_000174 3300053111 Bacteria 22807
1009 Ga0500591_041509 3300053115 Bacteria 2187
1010 Ga0500595_006730 3300053119 Bacteria 4846
1011 Ga0500614_000189 3300053123 Bacteria 15960
1012 Ga0500642_0255361 3300053130 Bacteria 804
1013 Ga0500559_0004947 3300053136 Bacteria 6196
1014 Ga0500603_001702 3300053150 Bacteria 4955
1015 Ga0500630_005291 3300053159 Bacteria 6288
1016 Ga0500638_077692 3300053162 Bacteria 1579
1017 Ga0500639_000006 3300053163 Bacteria 165068
1018 Ga0500636_0118335 3300053177 Bacteria 1489
1019 Ga0500636_0144829 3300053177 Bacteria 1311
1020 Ga0500636_0159348 3300053177 Bacteria 1232
1021 Ga0500637_0025357 3300053178 Bacteria 3257
1022 Ga0500625_083401 3300053729 Bacteria 1389
1023 Ga0500596_000164 3300053735 Bacteria 10428
1024 Ga0500601_019200 3300053737 Bacteria 786
1025 Ga0501084_0008230 3300054114 Bacteria 8603
1026 Ga0501084_0485945 3300054114 Bacteria 1044
1027 Ga0501082_0020426 3300060353 Bacteria 5710
1028 Ga0501082_2037885 3300060353 Bacteria 500
1029 Ga0466962_0387303 3300061719 Bacteria 699
1030 Ga0530510_0169435 3300061734 Bacteria 1617

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005530 Ga0070679_100007751 Ga0070679_1000077514 145
2 3300025917 Ga0207660_10183391 Ga0207660_101833913 145
3 3300028800 Ga0265338_10762236 Ga0265338_107622361 145
4 3300003203 JGI25406J46586_10004766 JGI25406J46586_100047663 147
5 3300005985 Ga0081539_10002558 Ga0081539_1000255814 147
6 3300014326 Ga0157380_10117881 Ga0157380_101178812 147
7 3300032005 Ga0307411_10480763 Ga0307411_104807632 149
8 3300005334 Ga0068869_100354184 Ga0068869_1003541842 150
9 3300025942 Ga0207689_10491736 Ga0207689_104917361 150
10 3300031241 Ga0265325_10266842 Ga0265325_102668421 150
11 3300049581 Ga0501047_0349344 Ga0501047_0349344_480_953 150
12 3300005347 Ga0070668_100185524 Ga0070668_1001855243 151
13 3300005434 Ga0070709_10006086 Ga0070709_100060868 151
14 3300005435 Ga0070714_100018976 Ga0070714_1000189763 151
15 3300005437 Ga0070710_10360389 Ga0070710_103603892 151
16 3300005444 Ga0070694_100810184 Ga0070694_1008101842 151
17 3300005546 Ga0070696_100010959 Ga0070696_1000109596 151
18 3300005549 Ga0070704_100003439 Ga0070704_10000343910 151
19 3300006038 Ga0075365_10250267 Ga0075365_102502672 151
20 3300006042 Ga0075368_10107349 Ga0075368_101073491 151
21 3300006042 Ga0075368_10339637 Ga0075368_103396372 151
22 3300006048 Ga0075363_100151649 Ga0075363_1001516491 151
23 3300006048 Ga0075363_100164771 Ga0075363_1001647712 151
24 3300006163 Ga0070715_10049634 Ga0070715_100496341 151
25 3300006177 Ga0075362_10058301 Ga0075362_100583013 151
26 3300006177 Ga0075362_10138598 Ga0075362_101385983 151
27 3300006186 Ga0075369_10023967 Ga0075369_100239672 151
28 3300006195 Ga0075366_10216139 Ga0075366_102161392 151
29 3300006195 Ga0075366_10575975 Ga0075366_105759751 151
30 3300006353 Ga0075370_10108842 Ga0075370_101088422 151
31 3300006871 Ga0075434_100493030 Ga0075434_1004930302 151
32 3300006914 Ga0075436_100567622 Ga0075436_1005676222 151
33 3300007076 Ga0075435_100334679 Ga0075435_1003346792 151
34 3300007265 Ga0099794_10343242 Ga0099794_103432422 151
35 3300009148 Ga0105243_10191232 Ga0105243_101912322 151
36 3300009176 Ga0105242_10727790 Ga0105242_107277903 151
37 3300009553 Ga0105249_10004270 Ga0105249_1000427014 151
38 3300021384 Ga0213876_10435210 Ga0213876_104352101 151
39 3300021388 Ga0213875_10000142 Ga0213875_1000014254 151
40 3300025253 Ga0209677_100233 Ga0209677_10023330 151
41 3300025261 Ga0209233_1001314 Ga0209233_10013145 151
42 3300025272 Ga0209455_1006779 Ga0209455_10067793 151
43 3300025898 Ga0207692_11037978 Ga0207692_110379781 151
44 3300025961 Ga0207712_10011451 Ga0207712_100114514 151
45 3300025972 Ga0207668_10360991 Ga0207668_103609913 151
46 3300028379 Ga0268266_10390138 Ga0268266_103901383 151
47 3300037853 Ga0436364_1465979 Ga0436364_1465979_17361_17840 151
48 3300039437 Ga0436365_1437293 Ga0436365_1437293_1102_1560 151
49 3300039437 Ga0436365_1465346 Ga0436365_1465346_432_941 151
50 3300039437 Ga0436365_1623170 Ga0436365_1623170_521_1000 151
51 3300039437 Ga0436365_1706766 Ga0436365_1706766_138_611 151
52 3300039437 Ga0436365_1709481 Ga0436365_1709481_1065_1541 151
53 3300039450 Ga0436363_0411146 Ga0436363_0411146_76_549 151
54 3300039450 Ga0436363_0819011 Ga0436363_0819011_132_605 151
55 3300045049 Ga0466959_0646560 Ga0466959_0646560_129_587 151
56 3300048903 Ga0496100_0347749 Ga0496100_0347749_165_623 151
57 3300048919 Ga0496116_0081305 Ga0496116_0081305_854_1312 151
58 3300048920 Ga0496117_0267776 Ga0496117_0267776_60_518 151
59 3300048921 Ga0496118_0021437 Ga0496118_0021437_5049_5507 151
60 3300048922 Ga0496119_0099016 Ga0496119_0099016_955_1413 151
61 3300048924 Ga0496121_0035834 Ga0496121_0035834_3322_3780 151
62 3300048924 Ga0496121_0249468 Ga0496121_0249468_694_1152 151
63 3300048928 Ga0496125_0231190 Ga0496125_0231190_153_611 151
64 3300049578 Ga0501042_0074658 Ga0501042_0074658_1888_2367 151
65 3300049591 Ga0501075_0329854 Ga0501075_0329854_340_813 151
66 3300049592 Ga0501076_0160981 Ga0501076_0160981_606_1085 151
67 3300049592 Ga0501076_0195895 Ga0501076_0195895_659_1132 151
68 3300049593 Ga0501077_0041913 Ga0501077_0041913_1219_1692 151
69 3300049741 Ga0501079_0002944 Ga0501079_0002944_792_1265 151
70 3300049742 Ga0501080_0022026 Ga0501080_0022026_4068_4544 151
71 3300049743 Ga0501081_0000925 Ga0501081_0000925_4583_5056 151
72 3300050490 nmdc:mga03n38_466597_c1 nmdc:mga03n38_466597_c1_101_562 151
73 3300050493 nmdc:mga0k408_74540_c1 nmdc:mga0k408_74540_c1_442_939 151
74 3300050494 nmdc:mga06z11_48797_c1 nmdc:mga06z11_48797_c1_685_1170 151
75 3300050495 nmdc:mga04h51_86991_c1 nmdc:mga04h51_86991_c1_142_627 151
76 3300050496 nmdc:mga07m45_269959_c1 nmdc:mga07m45_269959_c1_385_870 151
77 3300050507 nmdc:mga05p37_4482_c1 nmdc:mga05p37_4482_c1_5543_6022 151
78 3300050508 nmdc:mga09592_2101_c1 nmdc:mga09592_2101_c1_1989_2468 151
79 3300050510 nmdc:mga06r32_2521_c1 nmdc:mga06r32_2521_c1_4478_4957 151
80 3300050511 nmdc:mga08y16_3491_c1 nmdc:mga08y16_3491_c1_10210_10689 151
81 3300050512 nmdc:mga0n895_209270_c1 nmdc:mga0n895_209270_c1_817_1290 151
82 3300050513 nmdc:mga0rr50_33524_c1 nmdc:mga0rr50_33524_c1_710_1183 151
83 3300050514 nmdc:mga08x19_523923_c1 nmdc:mga08x19_523923_c1_62_526 151
84 3300050516 nmdc:mga0sz30_19856_c1 nmdc:mga0sz30_19856_c1_1727_2212 151
85 3300053119 Ga0500595_006730 Ga0500595_006730_732_1211 151
86 3300054114 Ga0501084_0008230 Ga0501084_0008230_5178_5651 151
87 3300060353 Ga0501082_0020426 Ga0501082_0020426_5100_5573 151
88 3300061734 Ga0530510_0169435 Ga0530510_0169435_424_897 151
89 iso_pu_bacteria 2919073203 2919077749 151
90 3300005331 Ga0070670_100007615 Ga0070670_1000076155 152
91 3300005344 Ga0070661_101210275 Ga0070661_1012102751 152
92 3300005347 Ga0070668_100958030 Ga0070668_1009580301 152
93 3300005355 Ga0070671_100003008 Ga0070671_1000030085 152
94 3300005364 Ga0070673_100004774 Ga0070673_1000047747 152
95 3300005367 Ga0070667_100048868 Ga0070667_1000488684 152
96 3300005434 Ga0070709_10702131 Ga0070709_107021311 152
97 3300005435 Ga0070714_100034823 Ga0070714_1000348232 152
98 3300005436 Ga0070713_100062946 Ga0070713_1000629463 152
99 3300005437 Ga0070710_10116229 Ga0070710_101162292 152
100 3300005439 Ga0070711_100063677 Ga0070711_1000636773 152
101 3300005543 Ga0070672_100844552 Ga0070672_1008445522 152
102 3300005548 Ga0070665_100154830 Ga0070665_1001548302 152
103 3300005564 Ga0070664_101250738 Ga0070664_1012507381 152
104 3300005578 Ga0068854_100098797 Ga0068854_1000987971 152
105 3300005617 Ga0068859_100352355 Ga0068859_1003523551 152
106 3300005842 Ga0068858_100177127 Ga0068858_1001771272 152
107 3300006028 Ga0070717_10419032 Ga0070717_104190322 152
108 3300006175 Ga0070712_100056383 Ga0070712_1000563834 152
109 3300006931 Ga0097620_100352307 Ga0097620_1003523071 152
110 3300009093 Ga0105240_11219676 Ga0105240_112196762 152
111 3300009098 Ga0105245_10136563 Ga0105245_101365633 152
112 3300009101 Ga0105247_11015810 Ga0105247_110158101 152
113 3300009177 Ga0105248_10613000 Ga0105248_106130002 152
114 3300009545 Ga0105237_11033300 Ga0105237_110333002 152
115 3300010375 Ga0105239_12058478 Ga0105239_120584781 152
116 3300011119 Ga0105246_10135193 Ga0105246_101351931 152
117 3300014325 Ga0163163_10067806 Ga0163163_100678062 152
118 3300014969 Ga0157376_10202067 Ga0157376_102020673 152
119 3300021388 Ga0213875_10099496 Ga0213875_100994963 152
120 3300025906 Ga0207699_10220046 Ga0207699_102200462 152
121 3300025907 Ga0207645_10175169 Ga0207645_101751692 152
122 3300025915 Ga0207693_10240618 Ga0207693_102406182 152
123 3300025916 Ga0207663_10109854 Ga0207663_101098542 152
124 3300025919 Ga0207657_10570707 Ga0207657_105707072 152
125 3300025925 Ga0207650_10018934 Ga0207650_100189342 152
126 3300025927 Ga0207687_10337779 Ga0207687_103377791 152
127 3300025929 Ga0207664_10089570 Ga0207664_100895703 152
128 3300025931 Ga0207644_10010824 Ga0207644_100108243 152
129 3300025940 Ga0207691_10046117 Ga0207691_100461174 152
130 3300025945 Ga0207679_10321797 Ga0207679_103217972 152
131 3300025960 Ga0207651_10184467 Ga0207651_101844673 152
132 3300025961 Ga0207712_10041247 Ga0207712_100412474 152
133 3300025986 Ga0207658_10988698 Ga0207658_109886982 152
134 3300026035 Ga0207703_10172458 Ga0207703_101724583 152
135 3300028379 Ga0268266_10110942 Ga0268266_101109422 152
136 3300035117 Ga0373953_0208203 Ga0373953_0208203_333_821 152
137 3300035118 Ga0373954_0235116 Ga0373954_0235116_389_877 152
138 3300035119 Ga0373956_0035874 Ga0373956_0035874_949_1437 152
139 3300035172 Ga0373955_0268436 Ga0373955_0268436_233_721 152
140 3300037853 Ga0436364_1319713 Ga0436364_1319713_1064_1528 152
141 3300041486 Ga0451807_1700963 Ga0451807_1700963_29_535 152
142 3300046454 Ga0495592_0129527 Ga0495592_0129527_388_876 152
143 3300046462 Ga0495651_0158273 Ga0495651_0158273_773_1261 152
144 3300046463 Ga0495653_0157631 Ga0495653_0157631_85_573 152
145 3300046511 Ga0495608_0156305 Ga0495608_0156305_606_1094 152
146 3300046679 Ga0495623_0194097 Ga0495623_0194097_467_955 152
147 3300048088 Ga0495602_0029536 Ga0495602_0029536_4170_4658 152
148 3300048903 Ga0496100_0197458 Ga0496100_0197458_220_708 152
149 3300048904 Ga0496101_0541240 Ga0496101_0541240_365_853 152
150 3300048909 Ga0496106_0237110 Ga0496106_0237110_129_617 152
151 3300048913 Ga0496110_0109415 Ga0496110_0109415_1519_2007 152
152 3300048918 Ga0496115_0040631 Ga0496115_0040631_2060_2548 152
153 3300002075 JGI24738J21930_10014806 JGI24738J21930_100148061 153
154 3300002459 JGI24751J29686_10004765 JGI24751J29686_100047653 153
155 3300005328 Ga0070676_10030096 Ga0070676_100300964 153
156 3300005328 Ga0070676_10073935 Ga0070676_100739351 153
157 3300005329 Ga0070683_100308838 Ga0070683_1003088381 153
158 3300005330 Ga0070690_100032631 Ga0070690_1000326311 153
159 3300005331 Ga0070670_100107016 Ga0070670_1001070164 153
160 3300005334 Ga0068869_100101232 Ga0068869_1001012322 153
161 3300005337 Ga0070682_100009389 Ga0070682_1000093893 153
162 3300005337 Ga0070682_100547523 Ga0070682_1005475232 153
163 3300005338 Ga0068868_100353863 Ga0068868_1003538632 153
164 3300005340 Ga0070689_100048875 Ga0070689_1000488754 153
165 3300005344 Ga0070661_100031155 Ga0070661_1000311555 153
166 3300005344 Ga0070661_100169096 Ga0070661_1001690961 153
167 3300005347 Ga0070668_100056497 Ga0070668_1000564972 153
168 3300005354 Ga0070675_100010225 Ga0070675_1000102254 153
169 3300005355 Ga0070671_100111626 Ga0070671_1001116262 153
170 3300005356 Ga0070674_100097802 Ga0070674_1000978023 153
171 3300005365 Ga0070688_100652260 Ga0070688_1006522602 153
172 3300005367 Ga0070667_100020621 Ga0070667_1000206215 153
173 3300005406 Ga0070703_10116811 Ga0070703_101168111 153
174 3300005434 Ga0070709_10002890 Ga0070709_100028902 153
175 3300005437 Ga0070710_10389382 Ga0070710_103893821 153
176 3300005438 Ga0070701_10019718 Ga0070701_100197184 153
177 3300005439 Ga0070711_100389288 Ga0070711_1003892883 153
178 3300005441 Ga0070700_100021596 Ga0070700_1000215964 153
179 3300005444 Ga0070694_100513365 Ga0070694_1005133652 153
180 3300005455 Ga0070663_100020381 Ga0070663_1000203814 153
181 3300005455 Ga0070663_101786593 Ga0070663_1017865931 153
182 3300005456 Ga0070678_100012280 Ga0070678_1000122802 153
183 3300005457 Ga0070662_100031385 Ga0070662_1000313852 153
184 3300005457 Ga0070662_101025537 Ga0070662_1010255371 153
185 3300005459 Ga0068867_100076490 Ga0068867_1000764903 153
186 3300005535 Ga0070684_100105471 Ga0070684_1001054712 153
187 3300005539 Ga0068853_100155163 Ga0068853_1001551633 153
188 3300005548 Ga0070665_101179948 Ga0070665_1011799482 153
189 3300005549 Ga0070704_100035424 Ga0070704_1000354243 153
190 3300005564 Ga0070664_100074972 Ga0070664_1000749724 153
191 3300005577 Ga0068857_101967138 Ga0068857_1019671381 153
192 3300005578 Ga0068854_100012801 Ga0068854_1000128013 153
193 3300005614 Ga0068856_100066430 Ga0068856_1000664301 153
194 3300005615 Ga0070702_100011479 Ga0070702_1000114793 153
195 3300005616 Ga0068852_100193087 Ga0068852_1001930872 153
196 3300005617 Ga0068859_100064488 Ga0068859_1000644884 153
197 3300005618 Ga0068864_100011404 Ga0068864_1000114047 153
198 3300005719 Ga0068861_100050207 Ga0068861_1000502074 153
199 3300005834 Ga0068851_10045691 Ga0068851_100456912 153
200 3300005840 Ga0068870_10098024 Ga0068870_100980242 153
201 3300005841 Ga0068863_100018031 Ga0068863_1000180314 153
202 3300005842 Ga0068858_100179715 Ga0068858_1001797152 153
203 3300005843 Ga0068860_100162546 Ga0068860_1001625462 153
204 3300005844 Ga0068862_100022075 Ga0068862_1000220753 153
205 3300005844 Ga0068862_100401566 Ga0068862_1004015663 153
206 3300005937 Ga0081455_10662096 Ga0081455_106620961 153
207 3300006028 Ga0070717_10263727 Ga0070717_102637272 153
208 3300006048 Ga0075363_100156015 Ga0075363_1001560152 153
209 3300006173 Ga0070716_100117656 Ga0070716_1001176563 153
210 3300006186 Ga0075369_10420604 Ga0075369_104206042 153
211 3300006237 Ga0097621_100195018 Ga0097621_1001950183 153
212 3300006358 Ga0068871_100084796 Ga0068871_1000847964 153
213 3300006881 Ga0068865_100028120 Ga0068865_1000281204 153
214 3300006914 Ga0075436_100161011 Ga0075436_1001610112 153
215 3300006931 Ga0097620_100064486 Ga0097620_1000644864 153
216 3300009092 Ga0105250_10190319 Ga0105250_101903192 153
217 3300009094 Ga0111539_10269577 Ga0111539_102695774 153
218 3300009098 Ga0105245_10141418 Ga0105245_101414184 153
219 3300009101 Ga0105247_10009307 Ga0105247_100093073 153
220 3300009148 Ga0105243_10092391 Ga0105243_100923913 153
221 3300009174 Ga0105241_10172862 Ga0105241_101728623 153
222 3300009177 Ga0105248_10159205 Ga0105248_101592053 153
223 3300009553 Ga0105249_10028208 Ga0105249_100282084 153
224 3300010375 Ga0105239_10090083 Ga0105239_100900834 153
225 3300011119 Ga0105246_10039960 Ga0105246_100399602 153
226 3300012498 Ga0157345_1014652 Ga0157345_10146522 153
227 3300013102 Ga0157371_10161044 Ga0157371_101610443 153
228 3300013105 Ga0157369_10230424 Ga0157369_102304243 153
229 3300013306 Ga0163162_11873604 Ga0163162_118736041 153
230 3300013308 Ga0157375_10054747 Ga0157375_100547474 153
231 3300013308 Ga0157375_10547478 Ga0157375_105474782 153
232 3300014325 Ga0163163_10426228 Ga0163163_104262281 153
233 3300014326 Ga0157380_10014851 Ga0157380_100148512 153
234 3300014745 Ga0157377_10036926 Ga0157377_100369263 153
235 3300014968 Ga0157379_10107068 Ga0157379_101070682 153
236 3300014969 Ga0157376_10764702 Ga0157376_107647021 153
237 3300017792 Ga0163161_10222085 Ga0163161_102220852 153
238 3300021377 Ga0213874_10019910 Ga0213874_100199102 153
239 3300021441 Ga0213871_10025378 Ga0213871_100253782 153
240 3300025315 Ga0207697_10014975 Ga0207697_100149751 153
241 3300025321 Ga0207656_10013854 Ga0207656_100138543 153
242 3300025885 Ga0207653_10065997 Ga0207653_100659972 153
243 3300025898 Ga0207692_10001234 Ga0207692_1000123411 153
244 3300025899 Ga0207642_10027613 Ga0207642_100276133 153
245 3300025901 Ga0207688_10001188 Ga0207688_1000118814 153
246 3300025903 Ga0207680_10007109 Ga0207680_100071095 153
247 3300025906 Ga0207699_10620293 Ga0207699_106202931 153
248 3300025907 Ga0207645_10030737 Ga0207645_100307372 153
249 3300025908 Ga0207643_10002016 Ga0207643_1000201610 153
250 3300025914 Ga0207671_10079258 Ga0207671_100792582 153
251 3300025915 Ga0207693_10091909 Ga0207693_100919095 153
252 3300025915 Ga0207693_10184105 Ga0207693_101841052 153
253 3300025916 Ga0207663_10206131 Ga0207663_102061313 153
254 3300025917 Ga0207660_10521969 Ga0207660_105219691 153
255 3300025918 Ga0207662_10001080 Ga0207662_1000108011 153
256 3300025920 Ga0207649_10015191 Ga0207649_100151913 153
257 3300025928 Ga0207700_10166474 Ga0207700_101664743 153
258 3300025931 Ga0207644_10534492 Ga0207644_105344922 153
259 3300025933 Ga0207706_10010401 Ga0207706_100104014 153
260 3300025934 Ga0207686_10038933 Ga0207686_100389332 153
261 3300025935 Ga0207709_10032144 Ga0207709_100321444 153
262 3300025936 Ga0207670_10025786 Ga0207670_100257863 153
263 3300025937 Ga0207669_10003777 Ga0207669_100037777 153
264 3300025938 Ga0207704_10102839 Ga0207704_101028394 153
265 3300025939 Ga0207665_10035299 Ga0207665_100352994 153
266 3300025940 Ga0207691_10006467 Ga0207691_100064675 153
267 3300025942 Ga0207689_10008692 Ga0207689_100086922 153
268 3300025942 Ga0207689_10010839 Ga0207689_100108398 153
269 3300025944 Ga0207661_10325478 Ga0207661_103254782 153
270 3300025945 Ga0207679_10140050 Ga0207679_101400501 153
271 3300025960 Ga0207651_10046240 Ga0207651_100462404 153
272 3300025961 Ga0207712_10023661 Ga0207712_100236614 153
273 3300025972 Ga0207668_10052089 Ga0207668_100520892 153
274 3300025981 Ga0207640_10022181 Ga0207640_100221814 153
275 3300026023 Ga0207677_10034211 Ga0207677_100342112 153
276 3300026035 Ga0207703_10053829 Ga0207703_100538294 153
277 3300026067 Ga0207678_10020068 Ga0207678_100200684 153
278 3300026075 Ga0207708_10002263 Ga0207708_1000226313 153
279 3300026075 Ga0207708_10516008 Ga0207708_105160082 153
280 3300026078 Ga0207702_10083084 Ga0207702_100830842 153
281 3300026089 Ga0207648_10002178 Ga0207648_1000217811 153
282 3300026095 Ga0207676_10006683 Ga0207676_100066832 153
283 3300026095 Ga0207676_10270545 Ga0207676_102705452 153
284 3300026116 Ga0207674_12039257 Ga0207674_120392571 153
285 3300026118 Ga0207675_100003923 Ga0207675_10000392311 153
286 3300026121 Ga0207683_10004860 Ga0207683_100048606 153
287 3300026142 Ga0207698_10443641 Ga0207698_104436411 153
288 3300026142 Ga0207698_10776097 Ga0207698_107760972 153
289 3300028380 Ga0268265_10473920 Ga0268265_104739202 153
290 3300028380 Ga0268265_10816259 Ga0268265_108162591 153
291 3300028381 Ga0268264_10078980 Ga0268264_100789803 153
292 3300031241 Ga0265325_10001902 Ga0265325_1000190212 153
293 3300031249 Ga0265339_10283160 Ga0265339_102831602 153
294 3300031344 Ga0265316_10778452 Ga0265316_107784521 153
295 3300031711 Ga0265314_10011237 Ga0265314_100112373 153
296 3300034819 Ga0373958_0102780 Ga0373958_0102780_92_574 153
297 3300034819 Ga0373958_0108207 Ga0373958_0108207_73_558 153
298 3300034820 Ga0373959_0010924 Ga0373959_0010924_325_810 153
299 3300034957 Ga0373938_0003602 Ga0373938_0003602_741_1226 153
300 3300035092 Ga0373952_0046289 Ga0373952_0046289_126_611 153
301 3300035111 Ga0373923_0108821 Ga0373923_0108821_671_1156 153
302 3300035112 Ga0373932_0248012 Ga0373932_0248012_116_601 153
303 3300035115 Ga0373941_0000578 Ga0373941_0000578_1026_1511 153
304 3300035115 Ga0373941_0022048 Ga0373941_0022048_951_1433 153
305 3300035121 Ga0373960_0005392 Ga0373960_0005392_903_1388 153
306 3300035170 Ga0373943_0006929 Ga0373943_0006929_729_1214 153
307 3300035171 Ga0373946_0091900 Ga0373946_0091900_652_1137 153
308 3300035172 Ga0373955_0553508 Ga0373955_0553508_46_531 153
309 3300035242 Ga0373962_0003173 Ga0373962_0003173_623_1108 153
310 3300035691 Ga0373931_0007687 Ga0373931_0007687_1158_1643 153
311 3300035695 Ga0373927_0026537 Ga0373927_0026537_3061_3546 153
312 3300035725 Ga0373947_0013134 Ga0373947_0013134_2337_2822 153
313 3300037068 Ga0373925_0004333 Ga0373925_0004333_9573_10058 153
314 3300037312 Ga0395899_0014008 Ga0395899_0014008_2897_3379 153
315 3300037312 Ga0395899_0360095 Ga0395899_0360095_245_706 153
316 3300037312 Ga0395899_0464771 Ga0395899_0464771_298_780 153
317 3300037418 Ga0395900_0082575 Ga0395900_0082575_1549_2031 153
318 3300037418 Ga0395900_0249867 Ga0395900_0249867_759_1241 153
319 3300037418 Ga0395900_0354159 Ga0395900_0354159_285_746 153
320 3300037466 Ga0395898_0007428 Ga0395898_0007428_10181_10663 153
321 3300037466 Ga0395898_0254403 Ga0395898_0254403_1117_1599 153
322 3300038443 Ga0395901_0020070 Ga0395901_0020070_1994_2476 153
323 3300038443 Ga0395901_0168056 Ga0395901_0168056_1578_2060 153
324 3300039438 Ga0436360_0172693 Ga0436360_0172693_2160_2621 153
325 3300039438 Ga0436360_0707092 Ga0436360_0707092_335_796 153
326 3300039447 Ga0436361_0063482 Ga0436361_0063482_47_508 153
327 3300039447 Ga0436361_0386711 Ga0436361_0386711_331_792 153
328 3300039447 Ga0436361_0773244 Ga0436361_0773244_482_943 153
329 3300039450 Ga0436363_0035196 Ga0436363_0035196_2062_2523 153
330 3300039450 Ga0436363_0533424 Ga0436363_0533424_304_798 153
331 3300039450 Ga0436363_0802989 Ga0436363_0802989_141_623 153
332 3300041511 Ga0451855_0428041 Ga0451855_0428041_78_563 153
333 3300042157 Ga0439458_0139370 Ga0439458_0139370_27_512 153
334 3300044656 Ga0466969_0168614 Ga0466969_0168614_92_553 153
335 3300044684 Ga0466966_0209289 Ga0466966_0209289_86_547 153
336 3300044694 Ga0466963_0088861 Ga0466963_0088861_227_688 153
337 3300044735 Ga0466968_0731686 Ga0466968_0731686_21_482 153
338 3300044765 Ga0466970_0279239 Ga0466970_0279239_54_515 153
339 3300045051 Ga0451576_0947692 Ga0451576_0947692_203_688 153
340 3300046453 Ga0495627_104886 Ga0495627_104886_151_636 153
341 3300046459 Ga0495629_0000026 Ga0495629_0000026_105200_105685 153
342 3300046461 Ga0495641_0017870 Ga0495641_0017870_414_899 153
343 3300046472 Ga0495580_0544726 Ga0495580_0544726_185_670 153
344 3300046473 Ga0495582_0006073 Ga0495582_0006073_6184_6669 153
345 3300046491 Ga0495584_0468468 Ga0495584_0468468_22_507 153
346 3300046513 Ga0495616_0071592 Ga0495616_0071592_218_703 153
347 3300046515 Ga0495620_0092004 Ga0495620_0092004_30_515 153
348 3300046516 Ga0495628_0537140 Ga0495628_0537140_331_816 153
349 3300046519 Ga0495632_0067688 Ga0495632_0067688_232_717 153
350 3300046539 Ga0495621_0025785 Ga0495621_0025785_773_1258 153
351 3300046683 Ga0495658_0004396 Ga0495658_0004396_2351_2836 153
352 3300046689 Ga0495613_0003849 Ga0495613_0003849_7381_7866 153
353 3300046794 Ga0495589_0321797 Ga0495589_0321797_124_609 153
354 3300047317 Ga0495604_0583575 Ga0495604_0583575_69_554 153
355 3300047319 Ga0495674_0320052 Ga0495674_0320052_42_527 153
356 3300047320 Ga0495672_0017843 Ga0495672_0017843_3492_3956 153
357 3300047321 Ga0495676_0029124 Ga0495676_0029124_1473_1958 153
358 3300047322 Ga0495680_0096668 Ga0495680_0096668_872_1357 153
359 3300048903 Ga0496100_0073041 Ga0496100_0073041_262_747 153
360 3300048903 Ga0496100_0097342 Ga0496100_0097342_962_1447 153
361 3300048904 Ga0496101_0080417 Ga0496101_0080417_1428_1913 153
362 3300048904 Ga0496101_0130721 Ga0496101_0130721_865_1350 153
363 3300048905 Ga0496102_0009072 Ga0496102_0009072_2607_3092 153
364 3300048905 Ga0496102_0253173 Ga0496102_0253173_1049_1534 153
365 3300048906 Ga0496103_0004573 Ga0496103_0004573_2427_2912 153
366 3300048906 Ga0496103_0060685 Ga0496103_0060685_1660_2145 153
367 3300048907 Ga0496104_0054081 Ga0496104_0054081_1245_1730 153
368 3300048908 Ga0496105_0016436 Ga0496105_0016436_2705_3190 153
369 3300048908 Ga0496105_0074130 Ga0496105_0074130_2192_2677 153
370 3300048909 Ga0496106_0003696 Ga0496106_0003696_8881_9366 153
371 3300048909 Ga0496106_0052883 Ga0496106_0052883_113_598 153
372 3300048910 Ga0496107_0107375 Ga0496107_0107375_138_623 153
373 3300048911 Ga0496108_0018377 Ga0496108_0018377_4872_5357 153
374 3300048912 Ga0496109_0122275 Ga0496109_0122275_10_495 153
375 3300048912 Ga0496109_0403397 Ga0496109_0403397_481_966 153
376 3300048912 Ga0496109_0837916 Ga0496109_0837916_326_811 153
377 3300048913 Ga0496110_1293107 Ga0496110_1293107_68_553 153
378 3300048914 Ga0496111_0004587 Ga0496111_0004587_5578_6063 153
379 3300048914 Ga0496111_0032758 Ga0496111_0032758_500_985 153
380 3300048915 Ga0496112_0002087 Ga0496112_0002087_12894_13379 153
381 3300048915 Ga0496112_0031534 Ga0496112_0031534_4290_4775 153
382 3300048915 Ga0496112_0135848 Ga0496112_0135848_958_1443 153
383 3300048916 Ga0496113_0022759 Ga0496113_0022759_368_853 153
384 3300048916 Ga0496113_0133884 Ga0496113_0133884_480_965 153
385 3300048916 Ga0496113_0221551 Ga0496113_0221551_982_1467 153
386 3300048917 Ga0496114_0009309 Ga0496114_0009309_6566_7051 153
387 3300048918 Ga0496115_0008142 Ga0496115_0008142_6703_7188 153
388 3300048918 Ga0496115_0028571 Ga0496115_0028571_2468_2953 153
389 3300048918 Ga0496115_0079177 Ga0496115_0079177_165_650 153
390 3300048924 Ga0496121_0179081 Ga0496121_0179081_524_988 153
391 3300049585 Ga0501069_0007682 Ga0501069_0007682_4942_5424 153
392 3300049586 Ga0501070_0007744 Ga0501070_0007744_6872_7354 153
393 3300049589 Ga0501073_0491924 Ga0501073_0491924_239_721 153
394 3300049590 Ga0501074_0481517 Ga0501074_0481517_182_664 153
395 3300049593 Ga0501077_1031021 Ga0501077_1031021_18_503 153
396 3300049822 Ga0501035_0000655 Ga0501035_0000655_19309_19791 153
397 3300050490 nmdc:mga03n38_196463_c1 nmdc:mga03n38_196463_c1_389_874 153
398 3300050492 nmdc:mga0yw44_43488_c1 nmdc:mga0yw44_43488_c1_52_537 153
399 3300050492 nmdc:mga0yw44_77248_c1 nmdc:mga0yw44_77248_c1_608_1093 153
400 3300050513 nmdc:mga0rr50_209523_c1 nmdc:mga0rr50_209523_c1_1090_1575 153
401 3300050513 nmdc:mga0rr50_528794_c1 nmdc:mga0rr50_528794_c1_143_628 153
402 3300050513 nmdc:mga0rr50_92543_c1 nmdc:mga0rr50_92543_c1_974_1468 153
403 3300050514 nmdc:mga08x19_114544_c1 nmdc:mga08x19_114544_c1_597_1091 153
404 3300050514 nmdc:mga08x19_305185_c1 nmdc:mga08x19_305185_c1_444_929 153
405 3300053085 Ga0495619_0000360 Ga0495619_0000360_12066_12551 153
406 3300053130 Ga0500642_0255361 Ga0500642_0255361_137_619 153
407 3300005329 Ga0070683_100897585 Ga0070683_1008975852 154
408 3300005434 Ga0070709_10333101 Ga0070709_103331012 154
409 3300005435 Ga0070714_100336444 Ga0070714_1003364442 154
410 3300005439 Ga0070711_100715855 Ga0070711_1007158551 154
411 3300005458 Ga0070681_10661284 Ga0070681_106612842 154
412 3300005530 Ga0070679_101119346 Ga0070679_1011193462 154
413 3300005539 Ga0068853_100058222 Ga0068853_1000582224 154
414 3300005563 Ga0068855_100066662 Ga0068855_1000666623 154
415 3300005577 Ga0068857_101192792 Ga0068857_1011927921 154
416 3300005842 Ga0068858_101109840 Ga0068858_1011098401 154
417 3300006028 Ga0070717_10058902 Ga0070717_100589022 154
418 3300006195 Ga0075366_10024433 Ga0075366_100244334 154
419 3300009093 Ga0105240_10015381 Ga0105240_1001538112 154
420 3300009093 Ga0105240_10316975 Ga0105240_103169752 154
421 3300009101 Ga0105247_10058543 Ga0105247_100585434 154
422 3300009545 Ga0105237_10761519 Ga0105237_107615192 154
423 3300009545 Ga0105237_11171011 Ga0105237_111710111 154
424 3300010375 Ga0105239_10275749 Ga0105239_102757492 154
425 3300013104 Ga0157370_10099137 Ga0157370_100991373 154
426 3300013105 Ga0157369_10022887 Ga0157369_100228873 154
427 3300013105 Ga0157369_10064206 Ga0157369_100642063 154
428 3300013307 Ga0157372_10245298 Ga0157372_102452983 154
429 3300020070 Ga0206356_11422122 Ga0206356_114221221 154
430 3300020082 Ga0206353_10037471 Ga0206353_100374713 154
431 3300021384 Ga0213876_10025319 Ga0213876_100253193 154
432 3300022467 Ga0224712_10200821 Ga0224712_102008212 154
433 3300025900 Ga0207710_10067924 Ga0207710_100679243 154
434 3300025904 Ga0207647_10123044 Ga0207647_101230442 154
435 3300025906 Ga0207699_10048973 Ga0207699_100489733 154
436 3300025906 Ga0207699_10537179 Ga0207699_105371791 154
437 3300025913 Ga0207695_10445138 Ga0207695_104451382 154
438 3300025914 Ga0207671_10524173 Ga0207671_105241732 154
439 3300025928 Ga0207700_10065543 Ga0207700_100655433 154
440 3300025928 Ga0207700_10178009 Ga0207700_101780093 154
441 3300025929 Ga0207664_10102398 Ga0207664_101023983 154
442 3300025949 Ga0207667_10583989 Ga0207667_105839892 154
443 3300026035 Ga0207703_11489347 Ga0207703_114893471 154
444 3300026078 Ga0207702_10191539 Ga0207702_101915394 154
445 3300026116 Ga0207674_10524482 Ga0207674_105244823 154
446 3300033544 Ga0316215_1000679 Ga0316215_10006794 154
447 3300035118 Ga0373954_0599989 Ga0373954_0599989_20_505 154
448 3300035172 Ga0373955_0004730 Ga0373955_0004730_3893_4378 154
449 3300035724 Ga0373933_0149844 Ga0373933_0149844_874_1359 154
450 3300036401 Ga0373937_0004681 Ga0373937_0004681_6714_7199 154
451 3300036459 Ga0372808_001650 Ga0372808_001650_1028_1492 154
452 3300037418 Ga0395900_0014973 Ga0395900_0014973_7410_7874 154
453 3300037418 Ga0395900_0108769 Ga0395900_0108769_982_1446 154
454 3300037466 Ga0395898_0060705 Ga0395898_0060705_2899_3363 154
455 3300037466 Ga0395898_1218030 Ga0395898_1218030_162_626 154
456 3300037853 Ga0436364_0419251 Ga0436364_0419251_1856_2320 154
457 3300038443 Ga0395901_0688629 Ga0395901_0688629_75_539 154
458 3300039437 Ga0436365_0531841 Ga0436365_0531841_135_599 154
459 3300039437 Ga0436365_0787752 Ga0436365_0787752_1097_1561 154
460 3300039450 Ga0436363_1049939 Ga0436363_1049939_1241_1708 154
461 3300041486 Ga0451807_0669418 Ga0451807_0669418_111_575 154
462 3300045976 Ga0466967_0842035 Ga0466967_0842035_189_653 154
463 3300046462 Ga0495651_0757089 Ga0495651_0757089_49_534 154
464 3300048910 Ga0496107_0035247 Ga0496107_0035247_1573_2043 154
465 3300048924 Ga0496121_0001793 Ga0496121_0001793_31243_31713 154
466 3300048924 Ga0496121_0684399 Ga0496121_0684399_30_494 154
467 3300048926 Ga0496123_0304737 Ga0496123_0304737_175_639 154
468 3300048927 Ga0496124_0197901 Ga0496124_0197901_354_818 154
469 3300048928 Ga0496125_0001222 Ga0496125_0001222_1076_1546 154
470 3300048928 Ga0496125_0039681 Ga0496125_0039681_3269_3733 154
471 3300048929 Ga0496126_0005184 Ga0496126_0005184_10284_10754 154
472 3300048929 Ga0496126_0182782 Ga0496126_0182782_650_1114 154
473 3300049569 Ga0501032_0211927 Ga0501032_0211927_541_1008 154
474 3300049570 Ga0501033_0198516 Ga0501033_0198516_318_782 154
475 3300049581 Ga0501047_0142653 Ga0501047_0142653_1237_1701 154
476 3300049586 Ga0501070_0113582 Ga0501070_0113582_1252_1716 154
477 3300049589 Ga0501073_0056399 Ga0501073_0056399_1534_1998 154
478 3300049590 Ga0501074_0174932 Ga0501074_0174932_77_541 154
479 3300049741 Ga0501079_0111493 Ga0501079_0111493_646_1110 154
480 3300049742 Ga0501080_0105029 Ga0501080_0105029_1037_1501 154
481 3300049823 Ga0501044_0039982 Ga0501044_0039982_1951_2415 154
482 3300049823 Ga0501044_0389985 Ga0501044_0389985_240_707 154
483 3300050490 nmdc:mga03n38_594230_c1 nmdc:mga03n38_594230_c1_123_590 154
484 3300050493 nmdc:mga0k408_30886_c1 nmdc:mga0k408_30886_c1_829_1314 154
485 3300050493 nmdc:mga0k408_60980_c1 nmdc:mga0k408_60980_c1_898_1383 154
486 3300050494 nmdc:mga06z11_692432_c1 nmdc:mga06z11_692432_c1_92_577 154
487 iso_pu_bacteria 2507262055 2507511947 154
488 iso_pu_bacteria 2508501009 2508545612 154
489 iso_pu_bacteria 2508501042 2508694428 154
490 iso_pu_bacteria 2515154112 2515624644 154
491 iso_pu_bacteria 2874590934 2874592164 154
492 iso_pu_bacteria 2874645413 2874646998 154
493 iso_pu_bacteria 2876771140 2876772375 154
494 iso_pu_bacteria 2876818435 2876819644 154
495 iso_pu_bacteria 2879074833 2879076219 154
496 iso_pu_bacteria 2879127579 2879132601 154
497 iso_pu_bacteria 2879142872 2879144689 154
498 iso_pu_bacteria 2935608549 2935613410 154
499 iso_pu_bacteria 2935648319 2935653710 154
500 iso_pu_bacteria 2935656913 2935662459 154
501 iso_pu_bacteria 2935819856 2935824737 154
502 iso_pu_bacteria 2935847175 2935851957 154
503 iso_pu_bacteria 2935908558 2935911305 154
504 iso_pu_bacteria 2935916978 2935920837 154
505 iso_pu_bacteria 2935926038 2935928334 154
506 iso_pu_bacteria 2935934488 2935937979 154
507 iso_pu_bacteria 2935942939 2935945261 154
508 iso_pu_bacteria 2935951376 2935954233 154
509 iso_pu_bacteria 2935967501 2935971499 154
510 iso_pu_bacteria 2935975950 2935982117 154
511 iso_pu_bacteria 2935984226 2935990542 154
512 iso_pu_bacteria 2936011229 2936016893 154
513 iso_pu_bacteria 2936019824 2936025526 154
514 iso_pu_bacteria 2936028420 2936034236 154
515 iso_pu_bacteria 2936046547 2936052293 154
516 iso_pu_bacteria 2936055302 2936060572 154
517 iso_pu_bacteria 8016630954 8016637111 154
518 iso_pu_bacteria 8019619141 8019624079 154
519 iso_pu_bacteria 8019638758 8019641678 154
520 iso_pu_bacteria 8019659431 8019665879 154
521 iso_pu_bacteria 8019668869 8019675402 154
522 iso_pu_bacteria 8019678201 8019680702 154
523 iso_pu_bacteria 8019687851 8019695068 154
524 3300003203 JGI25406J46586_10000043 JGI25406J46586_1000004329 155
525 3300003215 JGI25153J46596_10000584 JGI25153J46596_100005849 155
526 3300003659 JGI25404J52841_10013755 JGI25404J52841_100137552 155
527 3300003659 JGI25404J52841_10017841 JGI25404J52841_100178412 155
528 3300003659 JGI25404J52841_10035170 JGI25404J52841_100351702 155
529 3300005327 Ga0070658_10168014 Ga0070658_101680143 155
530 3300005329 Ga0070683_100009428 Ga0070683_1000094283 155
531 3300005329 Ga0070683_100015413 Ga0070683_1000154134 155
532 3300005335 Ga0070666_10347337 Ga0070666_103473372 155
533 3300005336 Ga0070680_100407087 Ga0070680_1004070873 155
534 3300005336 Ga0070680_100736246 Ga0070680_1007362462 155
535 3300005337 Ga0070682_100089099 Ga0070682_1000890993 155
536 3300005339 Ga0070660_100037317 Ga0070660_1000373172 155
537 3300005341 Ga0070691_10065733 Ga0070691_100657332 155
538 3300005366 Ga0070659_100231393 Ga0070659_1002313932 155
539 3300005434 Ga0070709_10006951 Ga0070709_100069517 155
540 3300005435 Ga0070714_100070792 Ga0070714_1000707922 155
541 3300005435 Ga0070714_100411212 Ga0070714_1004112122 155
542 3300005436 Ga0070713_100061181 Ga0070713_1000611814 155
543 3300005436 Ga0070713_100116289 Ga0070713_1001162892 155
544 3300005436 Ga0070713_100580395 Ga0070713_1005803951 155
545 3300005437 Ga0070710_10034156 Ga0070710_100341562 155
546 3300005437 Ga0070710_10318664 Ga0070710_103186642 155
547 3300005439 Ga0070711_100006504 Ga0070711_1000065048 155
548 3300005439 Ga0070711_100119677 Ga0070711_1001196773 155
549 3300005439 Ga0070711_100659637 Ga0070711_1006596372 155
550 3300005439 Ga0070711_100930167 Ga0070711_1009301671 155
551 3300005458 Ga0070681_10020543 Ga0070681_100205431 155
552 3300005458 Ga0070681_10047562 Ga0070681_100475623 155
553 3300005458 Ga0070681_10308938 Ga0070681_103089382 155
554 3300005467 Ga0070706_100774213 Ga0070706_1007742131 155
555 3300005468 Ga0070707_100599573 Ga0070707_1005995732 155
556 3300005471 Ga0070698_100433662 Ga0070698_1004336622 155
557 3300005530 Ga0070679_100118675 Ga0070679_1001186754 155
558 3300005530 Ga0070679_100560796 Ga0070679_1005607962 155
559 3300005530 Ga0070679_101283283 Ga0070679_1012832831 155
560 3300005535 Ga0070684_100012253 Ga0070684_1000122534 155
561 3300005535 Ga0070684_100030875 Ga0070684_1000308753 155
562 3300005536 Ga0070697_100147829 Ga0070697_1001478292 155
563 3300005539 Ga0068853_100092722 Ga0068853_1000927224 155
564 3300005539 Ga0068853_100450255 Ga0068853_1004502552 155
565 3300005548 Ga0070665_100050501 Ga0070665_1000505014 155
566 3300005548 Ga0070665_100348604 Ga0070665_1003486041 155
567 3300005563 Ga0068855_100362156 Ga0068855_1003621563 155
568 3300005563 Ga0068855_100656803 Ga0068855_1006568032 155
569 3300005563 Ga0068855_100770096 Ga0068855_1007700962 155
570 3300005563 Ga0068855_101688109 Ga0068855_1016881092 155
571 3300005577 Ga0068857_100178798 Ga0068857_1001787983 155
572 3300005578 Ga0068854_100358977 Ga0068854_1003589772 155
573 3300005578 Ga0068854_100799551 Ga0068854_1007995512 155
574 3300005614 Ga0068856_100525210 Ga0068856_1005252101 155
575 3300005614 Ga0068856_100595365 Ga0068856_1005953653 155
576 3300005618 Ga0068864_101324513 Ga0068864_1013245132 155
577 3300005937 Ga0081455_10012432 Ga0081455_100124324 155
578 3300005937 Ga0081455_10100708 Ga0081455_101007082 155
579 3300005981 Ga0081538_10103530 Ga0081538_101035302 155
580 3300005983 Ga0081540_1025104 Ga0081540_10251043 155
581 3300005983 Ga0081540_1028909 Ga0081540_10289093 155
582 3300005983 Ga0081540_1030553 Ga0081540_10305534 155
583 3300005983 Ga0081540_1047477 Ga0081540_10474771 155
584 3300005983 Ga0081540_1118098 Ga0081540_11180982 155
585 3300005985 Ga0081539_10000324 Ga0081539_1000032491 155
586 3300005985 Ga0081539_10033708 Ga0081539_100337083 155
587 3300006028 Ga0070717_10000361 Ga0070717_1000036124 155
588 3300006028 Ga0070717_10002247 Ga0070717_100022473 155
589 3300006038 Ga0075365_10074009 Ga0075365_100740093 155
590 3300006048 Ga0075363_100406342 Ga0075363_1004063422 155
591 3300006051 Ga0075364_10138064 Ga0075364_101380641 155
592 3300006175 Ga0070712_100004741 Ga0070712_1000047418 155
593 3300006177 Ga0075362_10035073 Ga0075362_100350734 155
594 3300006177 Ga0075362_10393079 Ga0075362_103930792 155
595 3300006186 Ga0075369_10098445 Ga0075369_100984452 155
596 3300006237 Ga0097621_100174234 Ga0097621_1001742343 155
597 3300006844 Ga0075428_100162154 Ga0075428_1001621542 155
598 3300009093 Ga0105240_10080919 Ga0105240_100809193 155
599 3300009093 Ga0105240_10878092 Ga0105240_108780922 155
600 3300009098 Ga0105245_10267733 Ga0105245_102677333 155
601 3300009098 Ga0105245_10414503 Ga0105245_104145033 155
602 3300009147 Ga0114129_10234852 Ga0114129_102348523 155
603 3300009174 Ga0105241_10051881 Ga0105241_100518811 155
604 3300009174 Ga0105241_10338577 Ga0105241_103385773 155
605 3300009177 Ga0105248_10213030 Ga0105248_102130304 155
606 3300009545 Ga0105237_10081577 Ga0105237_100815772 155
607 3300009551 Ga0105238_10392011 Ga0105238_103920112 155
608 3300009551 Ga0105238_11104047 Ga0105238_111040472 155
609 3300009551 Ga0105238_11492689 Ga0105238_114926891 155
610 3300009553 Ga0105249_10229182 Ga0105249_102291822 155
611 3300010159 Ga0099796_10221659 Ga0099796_102216591 155
612 3300010375 Ga0105239_10490657 Ga0105239_104906572 155
613 3300010375 Ga0105239_11671595 Ga0105239_116715952 155
614 3300012503 Ga0157313_1017102 Ga0157313_10171022 155
615 3300013105 Ga0157369_10069772 Ga0157369_100697724 155
616 3300013296 Ga0157374_10103930 Ga0157374_101039302 155
617 3300013307 Ga0157372_10235992 Ga0157372_102359923 155
618 3300013307 Ga0157372_11621896 Ga0157372_116218962 155
619 3300013308 Ga0157375_10563447 Ga0157375_105634472 155
620 3300014969 Ga0157376_10541882 Ga0157376_105418823 155
621 3300025297 Ga0209758_1001054 Ga0209758_100105410 155
622 3300025297 Ga0209758_1002780 Ga0209758_100278015 155
623 3300025904 Ga0207647_10532394 Ga0207647_105323942 155
624 3300025906 Ga0207699_10016926 Ga0207699_100169262 155
625 3300025909 Ga0207705_10163730 Ga0207705_101637302 155
626 3300025910 Ga0207684_10211034 Ga0207684_102110343 155
627 3300025910 Ga0207684_10495332 Ga0207684_104953322 155
628 3300025911 Ga0207654_10132691 Ga0207654_101326913 155
629 3300025912 Ga0207707_10000639 Ga0207707_100006394 155
630 3300025912 Ga0207707_10024022 Ga0207707_100240227 155
631 3300025912 Ga0207707_10024564 Ga0207707_100245644 155
632 3300025912 Ga0207707_10176437 Ga0207707_101764372 155
633 3300025913 Ga0207695_10512086 Ga0207695_105120863 155
634 3300025915 Ga0207693_10008491 Ga0207693_100084918 155
635 3300025916 Ga0207663_10022545 Ga0207663_100225454 155
636 3300025916 Ga0207663_10725516 Ga0207663_107255161 155
637 3300025917 Ga0207660_10454669 Ga0207660_104546692 155
638 3300025917 Ga0207660_10458137 Ga0207660_104581372 155
639 3300025917 Ga0207660_10681471 Ga0207660_106814711 155
640 3300025919 Ga0207657_10021043 Ga0207657_100210434 155
641 3300025920 Ga0207649_10858982 Ga0207649_108589822 155
642 3300025921 Ga0207652_10016814 Ga0207652_100168144 155
643 3300025921 Ga0207652_10100694 Ga0207652_101006944 155
644 3300025921 Ga0207652_10326519 Ga0207652_103265193 155
645 3300025921 Ga0207652_10642824 Ga0207652_106428242 155
646 3300025922 Ga0207646_10975034 Ga0207646_109750341 155
647 3300025924 Ga0207694_10073031 Ga0207694_100730314 155
648 3300025927 Ga0207687_10174581 Ga0207687_101745812 155
649 3300025927 Ga0207687_10411633 Ga0207687_104116332 155
650 3300025928 Ga0207700_10002691 Ga0207700_100026912 155
651 3300025928 Ga0207700_10032084 Ga0207700_100320845 155
652 3300025928 Ga0207700_10062218 Ga0207700_100622182 155
653 3300025928 Ga0207700_10836562 Ga0207700_108365622 155
654 3300025929 Ga0207664_10056194 Ga0207664_100561944 155
655 3300025929 Ga0207664_10505021 Ga0207664_105050212 155
656 3300025932 Ga0207690_10390622 Ga0207690_103906223 155
657 3300025934 Ga0207686_10911224 Ga0207686_109112242 155
658 3300025939 Ga0207665_10184037 Ga0207665_101840372 155
659 3300025944 Ga0207661_10000597 Ga0207661_1000059717 155
660 3300025944 Ga0207661_10003825 Ga0207661_100038255 155
661 3300025949 Ga0207667_10225941 Ga0207667_102259412 155
662 3300025981 Ga0207640_10470771 Ga0207640_104707712 155
663 3300026041 Ga0207639_10133372 Ga0207639_101333722 155
664 3300026041 Ga0207639_10187867 Ga0207639_101878672 155
665 3300026078 Ga0207702_10487189 Ga0207702_104871893 155
666 3300026078 Ga0207702_11162830 Ga0207702_111628301 155
667 3300026095 Ga0207676_11540864 Ga0207676_115408642 155
668 3300026116 Ga0207674_10133883 Ga0207674_101338833 155
669 3300026118 Ga0207675_100071818 Ga0207675_1000718184 155
670 3300028379 Ga0268266_10214036 Ga0268266_102140363 155
671 3300031247 Ga0265340_10146059 Ga0265340_101460592 155
672 3300031249 Ga0265339_10011190 Ga0265339_100111903 155
673 3300031548 Ga0307408_100103881 Ga0307408_1001038813 155
674 3300031548 Ga0307408_100282708 Ga0307408_1002827082 155
675 3300031731 Ga0307405_11793061 Ga0307405_117930611 155
676 3300031901 Ga0307406_10213010 Ga0307406_102130102 155
677 3300031903 Ga0307407_10299857 Ga0307407_102998573 155
678 3300031911 Ga0307412_10323819 Ga0307412_103238192 155
679 3300031911 Ga0307412_10405536 Ga0307412_104055362 155
680 3300032002 Ga0307416_100258607 Ga0307416_1002586072 155
681 3300032002 Ga0307416_101000808 Ga0307416_1010008082 155
682 3300035086 Ga0373934_0030845 Ga0373934_0030845_651_1118 155
683 3300035111 Ga0373923_0050621 Ga0373923_0050621_865_1332 155
684 3300035113 Ga0373936_0012238 Ga0373936_0012238_61_528 155
685 3300035113 Ga0373936_0012556 Ga0373936_0012556_943_1422 155
686 3300035113 Ga0373936_0217644 Ga0373936_0217644_291_761 155
687 3300035116 Ga0373945_0263175 Ga0373945_0263175_68_535 155
688 3300035117 Ga0373953_0193641 Ga0373953_0193641_346_813 155
689 3300035118 Ga0373954_0010065 Ga0373954_0010065_2459_2926 155
690 3300035119 Ga0373956_0009126 Ga0373956_0009126_1524_2093 155
691 3300035170 Ga0373943_0296331 Ga0373943_0296331_210_677 155
692 3300035171 Ga0373946_0345272 Ga0373946_0345272_75_542 155
693 3300035410 Ga0373924_0083274 Ga0373924_0083274_807_1274 155
694 3300035691 Ga0373931_0184041 Ga0373931_0184041_374_841 155
695 3300035695 Ga0373927_0086107 Ga0373927_0086107_1226_1693 155
696 3300035695 Ga0373927_0088015 Ga0373927_0088015_1232_1699 155
697 3300035724 Ga0373933_0112940 Ga0373933_0112940_465_932 155
698 3300035725 Ga0373947_0019419 Ga0373947_0019419_2454_2921 155
699 3300036401 Ga0373937_0089005 Ga0373937_0089005_244_711 155
700 3300037068 Ga0373925_0117436 Ga0373925_0117436_1416_1883 155
701 3300037068 Ga0373925_0742516 Ga0373925_0742516_48_515 155
702 3300037068 Ga0373925_0812531 Ga0373925_0812531_291_758 155
703 3300037312 Ga0395899_0022031 Ga0395899_0022031_2437_2904 155
704 3300037418 Ga0395900_0220560 Ga0395900_0220560_624_1091 155
705 3300037466 Ga0395898_0075786 Ga0395898_0075786_984_1451 155
706 3300037466 Ga0395898_0095429 Ga0395898_0095429_2259_2726 155
707 3300037471 Ga0395905_0240916 Ga0395905_0240916_1192_1659 155
708 3300038443 Ga0395901_0037019 Ga0395901_0037019_925_1398 155
709 3300038443 Ga0395901_1561973 Ga0395901_1561973_25_498 155
710 3300039437 Ga0436365_1681445 Ga0436365_1681445_200_667 155
711 3300041451 Ga0451791_1805681 Ga0451791_1805681_68_535 155
712 3300041512 Ga0451853_1968490 Ga0451853_1968490_88_555 155
713 3300042007 Ga0439449_0209599 Ga0439449_0209599_29_496 155
714 3300042157 Ga0439458_0092731 Ga0439458_0092731_74_541 155
715 3300042435 Ga0439434_0070879 Ga0439434_0070879_117_587 155
716 3300044656 Ga0466969_0510267 Ga0466969_0510267_46_513 155
717 3300044683 Ga0466965_0339797 Ga0466965_0339797_301_768 155
718 3300044684 Ga0466966_0202043 Ga0466966_0202043_109_576 155
719 3300044694 Ga0466963_0137523 Ga0466963_0137523_833_1300 155
720 3300044706 Ga0466964_0020730 Ga0466964_0020730_696_1163 155
721 3300044706 Ga0466964_0455000 Ga0466964_0455000_191_658 155
722 3300044735 Ga0466968_0174337 Ga0466968_0174337_402_869 155
723 3300044765 Ga0466970_0165229 Ga0466970_0165229_489_956 155
724 3300044842 Ga0466957_0031026 Ga0466957_0031026_982_1449 155
725 3300045049 Ga0466959_0294799 Ga0466959_0294799_375_842 155
726 3300045836 Ga0466958_0797522 Ga0466958_0797522_138_605 155
727 3300045976 Ga0466967_0399194 Ga0466967_0399194_311_778 155
728 3300046452 Ga0495617_084425 Ga0495617_084425_512_979 155
729 3300046454 Ga0495592_0213048 Ga0495592_0213048_699_1166 155
730 3300046455 Ga0495603_0040174 Ga0495603_0040174_1151_1618 155
731 3300046455 Ga0495603_0083928 Ga0495603_0083928_963_1430 155
732 3300046459 Ga0495629_0161770 Ga0495629_0161770_704_1171 155
733 3300046461 Ga0495641_0394580 Ga0495641_0394580_126_593 155
734 3300046462 Ga0495651_0133048 Ga0495651_0133048_861_1328 155
735 3300046473 Ga0495582_0061701 Ga0495582_0061701_697_1164 155
736 3300046474 Ga0495605_0094492 Ga0495605_0094492_654_1121 155
737 3300046476 Ga0495662_0017465 Ga0495662_0017465_996_1463 155
738 3300046477 Ga0495664_0012897 Ga0495664_0012897_623_1090 155
739 3300046477 Ga0495664_0042373 Ga0495664_0042373_169_636 155
740 3300046491 Ga0495584_0080654 Ga0495584_0080654_527_994 155
741 3300046492 Ga0495585_0122722 Ga0495585_0122722_689_1156 155
742 3300046499 Ga0495594_0033206 Ga0495594_0033206_1537_2004 155
743 3300046507 Ga0495606_0013747 Ga0495606_0013747_3899_4366 155
744 3300046507 Ga0495606_0036782 Ga0495606_0036782_717_1184 155
745 3300046511 Ga0495608_0327791 Ga0495608_0327791_393_860 155
746 3300046514 Ga0495618_0285470 Ga0495618_0285470_216_683 155
747 3300046516 Ga0495628_0137002 Ga0495628_0137002_1092_1559 155
748 3300046517 Ga0495630_0105716 Ga0495630_0105716_1273_1740 155
749 3300046519 Ga0495632_0438603 Ga0495632_0438603_69_536 155
750 3300046520 Ga0495637_0160430 Ga0495637_0160430_22_489 155
751 3300046526 Ga0495666_0231310 Ga0495666_0231310_261_728 155
752 3300046529 Ga0495652_0041488 Ga0495652_0041488_106_573 155
753 3300046531 Ga0495665_0080877 Ga0495665_0080877_435_902 155
754 3300046533 Ga0495640_0025055 Ga0495640_0025055_1181_1648 155
755 3300046536 Ga0495587_0297520 Ga0495587_0297520_405_872 155
756 3300046537 Ga0495598_0136058 Ga0495598_0136058_225_692 155
757 3300046557 Ga0495622_0131374 Ga0495622_0131374_252_719 155
758 3300046559 Ga0495667_0171847 Ga0495667_0171847_216_683 155
759 3300046615 Ga0495656_0059991 Ga0495656_0059991_722_1189 155
760 3300046642 Ga0495634_0029686 Ga0495634_0029686_2510_2977 155
761 3300046648 Ga0495611_0153748 Ga0495611_0153748_212_679 155
762 3300046663 Ga0495635_0042880 Ga0495635_0042880_1626_2093 155
763 3300046664 Ga0495659_0155873 Ga0495659_0155873_354_821 155
764 3300046665 Ga0495661_0125659 Ga0495661_0125659_49_516 155
765 3300046674 Ga0495588_0046148 Ga0495588_0046148_372_839 155
766 3300046678 Ga0495599_0025746 Ga0495599_0025746_645_1112 155
767 3300046679 Ga0495623_0045525 Ga0495623_0045525_1370_1837 155
768 3300046680 Ga0495646_0038559 Ga0495646_0038559_304_771 155
769 3300046681 Ga0495647_0238377 Ga0495647_0238377_316_783 155
770 3300046683 Ga0495658_0004213 Ga0495658_0004213_5315_5782 155
771 3300046689 Ga0495613_0250127 Ga0495613_0250127_106_573 155
772 3300046690 Ga0495624_0278865 Ga0495624_0278865_104_571 155
773 3300046794 Ga0495589_0263572 Ga0495589_0263572_109_576 155
774 3300046809 Ga0495600_0146398 Ga0495600_0146398_999_1466 155
775 3300047315 Ga0495581_0096406 Ga0495581_0096406_700_1167 155
776 3300047315 Ga0495581_0545244 Ga0495581_0545244_78_545 155
777 3300047317 Ga0495604_0123964 Ga0495604_0123964_1048_1515 155
778 3300047319 Ga0495674_0010664 Ga0495674_0010664_5568_6035 155
779 3300047321 Ga0495676_0124171 Ga0495676_0124171_906_1373 155
780 3300047322 Ga0495680_0955569 Ga0495680_0955569_32_499 155
781 3300047471 Ga0495684_0565957 Ga0495684_0565957_158_625 155
782 3300047673 Ga0495593_0127162 Ga0495593_0127162_639_1106 155
783 3300048904 Ga0496101_0045702 Ga0496101_0045702_176_643 155
784 3300048907 Ga0496104_0051086 Ga0496104_0051086_1009_1476 155
785 3300048908 Ga0496105_0037583 Ga0496105_0037583_3010_3477 155
786 3300048908 Ga0496105_0154331 Ga0496105_0154331_561_1028 155
787 3300048909 Ga0496106_0009424 Ga0496106_0009424_2498_2965 155
788 3300048909 Ga0496106_0541949 Ga0496106_0541949_153_620 155
789 3300048910 Ga0496107_0029043 Ga0496107_0029043_2410_2877 155
790 3300048910 Ga0496107_0252868 Ga0496107_0252868_394_861 155
791 3300048911 Ga0496108_0003416 Ga0496108_0003416_5059_5526 155
792 3300048911 Ga0496108_1335158 Ga0496108_1335158_91_558 155
793 3300048912 Ga0496109_0000230 Ga0496109_0000230_20374_20841 155
794 3300048912 Ga0496109_0296021 Ga0496109_0296021_961_1428 155
795 3300048913 Ga0496110_0037897 Ga0496110_0037897_3356_3823 155
796 3300048914 Ga0496111_0095892 Ga0496111_0095892_347_814 155
797 3300048914 Ga0496111_0167656 Ga0496111_0167656_342_809 155
798 3300048915 Ga0496112_0000023 Ga0496112_0000023_97920_98387 155
799 3300048915 Ga0496112_0051672 Ga0496112_0051672_1574_2041 155
800 3300048915 Ga0496112_0247487 Ga0496112_0247487_986_1453 155
801 3300048915 Ga0496112_0863182 Ga0496112_0863182_158_625 155
802 3300048916 Ga0496113_0044231 Ga0496113_0044231_1983_2450 155
803 3300048916 Ga0496113_0741359 Ga0496113_0741359_27_494 155
804 3300048916 Ga0496113_0776289 Ga0496113_0776289_153_620 155
805 3300048918 Ga0496115_0115921 Ga0496115_0115921_1726_2193 155
806 3300048924 Ga0496121_0096769 Ga0496121_0096769_506_973 155
807 3300048924 Ga0496121_0163999 Ga0496121_0163999_425_892 155
808 3300048925 Ga0496122_0177917 Ga0496122_0177917_429_896 155
809 3300048926 Ga0496123_0115803 Ga0496123_0115803_195_662 155
810 3300048929 Ga0496126_0001668 Ga0496126_0001668_15790_16257 155
811 3300048929 Ga0496126_0067286 Ga0496126_0067286_2677_3144 155
812 3300048929 Ga0496126_0082223 Ga0496126_0082223_1221_1688 155
813 3300049570 Ga0501033_1008156 Ga0501033_1008156_75_542 155
814 3300049571 Ga0501034_0029843 Ga0501034_0029843_4642_5115 155
815 3300049571 Ga0501034_0477166 Ga0501034_0477166_385_852 155
816 3300049571 Ga0501034_0689230 Ga0501034_0689230_218_685 155
817 3300049572 Ga0501036_0062678 Ga0501036_0062678_405_872 155
818 3300049572 Ga0501036_0227627 Ga0501036_0227627_538_1011 155
819 3300049572 Ga0501036_0321869 Ga0501036_0321869_529_999 155
820 3300049574 Ga0501038_0016736 Ga0501038_0016736_1508_1981 155
821 3300049574 Ga0501038_0118182 Ga0501038_0118182_1017_1484 155
822 3300049574 Ga0501038_0511913 Ga0501038_0511913_333_800 155
823 3300049575 Ga0501039_0823912 Ga0501039_0823912_48_515 155
824 3300049579 Ga0501043_0033958 Ga0501043_0033958_574_1044 155
825 3300049579 Ga0501043_0061576 Ga0501043_0061576_2328_2801 155
826 3300049580 Ga0501046_0046532 Ga0501046_0046532_1700_2173 155
827 3300049580 Ga0501046_0532555 Ga0501046_0532555_149_619 155
828 3300049581 Ga0501047_0518470 Ga0501047_0518470_265_735 155
829 3300049581 Ga0501047_1029865 Ga0501047_1029865_80_547 155
830 3300049582 Ga0501048_0178310 Ga0501048_0178310_495_968 155
831 3300049583 Ga0501067_0517976 Ga0501067_0517976_178_645 155
832 3300049586 Ga0501070_0123066 Ga0501070_0123066_894_1364 155
833 3300049586 Ga0501070_0791160 Ga0501070_0791160_100_567 155
834 3300049589 Ga0501073_0328235 Ga0501073_0328235_546_1013 155
835 3300049592 Ga0501076_0430103 Ga0501076_0430103_40_507 155
836 3300049742 Ga0501080_1031031 Ga0501080_1031031_179_646 155
837 3300049822 Ga0501035_0123022 Ga0501035_0123022_463_936 155
838 3300049822 Ga0501035_0180904 Ga0501035_0180904_897_1364 155
839 3300049822 Ga0501035_0184970 Ga0501035_0184970_664_1131 155
840 3300049823 Ga0501044_0197232 Ga0501044_0197232_561_1028 155
841 3300049823 Ga0501044_0256635 Ga0501044_0256635_346_816 155
842 3300049823 Ga0501044_1307154 Ga0501044_1307154_108_575 155
843 3300050489 nmdc:mga03683_302163_c1 nmdc:mga03683_302163_c1_99_566 155
844 3300050490 nmdc:mga03n38_414661_c1 nmdc:mga03n38_414661_c1_95_562 155
845 3300050491 nmdc:mga00v17_22168_c1 nmdc:mga00v17_22168_c1_923_1390 155
846 3300050492 nmdc:mga0yw44_269901_c1 nmdc:mga0yw44_269901_c1_259_729 155
847 3300050492 nmdc:mga0yw44_39126_c1 nmdc:mga0yw44_39126_c1_362_829 155
848 3300050507 nmdc:mga05p37_49917_c1 nmdc:mga05p37_49917_c1_429_896 155
849 3300050512 nmdc:mga0n895_1560245_c1 nmdc:mga0n895_1560245_c1_21_512 155
850 3300053077 Ga0495601_0134905 Ga0495601_0134905_782_1249 155
851 3300053077 Ga0495601_0287726 Ga0495601_0287726_347_814 155
852 3300053078 Ga0495612_0005522 Ga0495612_0005522_88_555 155
853 3300053078 Ga0495612_0095023 Ga0495612_0095023_543_1010 155
854 3300053086 Ga0500578_0227945 Ga0500578_0227945_626_1093 155
855 3300053090 Ga0500646_0126378 Ga0500646_0126378_192_659 155
856 3300053091 Ga0500647_0004996 Ga0500647_0004996_1782_2294 155
857 3300053094 Ga0500566_0001383 Ga0500566_0001383_2522_3001 155
858 3300053095 Ga0500640_000887 Ga0500640_000887_5813_6292 155
859 3300053099 Ga0500654_189502 Ga0500654_189502_87_554 155
860 3300053111 Ga0500572_000174 Ga0500572_000174_13777_14256 155
861 3300053115 Ga0500591_041509 Ga0500591_041509_96_575 155
862 3300053123 Ga0500614_000189 Ga0500614_000189_8471_8950 155
863 3300053136 Ga0500559_0004947 Ga0500559_0004947_2644_3123 155
864 3300053150 Ga0500603_001702 Ga0500603_001702_2798_3277 155
865 3300053159 Ga0500630_005291 Ga0500630_005291_5760_6239 155
866 3300053162 Ga0500638_077692 Ga0500638_077692_657_1136 155
867 3300053163 Ga0500639_000006 Ga0500639_000006_55627_56106 155
868 3300053177 Ga0500636_0118335 Ga0500636_0118335_572_1084 155
869 3300053177 Ga0500636_0144829 Ga0500636_0144829_138_611 155
870 3300053177 Ga0500636_0159348 Ga0500636_0159348_367_834 155
871 3300053729 Ga0500625_083401 Ga0500625_083401_84_596 155
872 3300053735 Ga0500596_000164 Ga0500596_000164_1074_1553 155
873 3300053737 Ga0500601_019200 Ga0500601_019200_259_738 155
874 3300054114 Ga0501084_0485945 Ga0501084_0485945_509_976 155
875 3300060353 Ga0501082_2037885 Ga0501082_2037885_17_484 155
876 3300061719 Ga0466962_0387303 Ga0466962_0387303_18_485 155
877 3300005327 Ga0070658_11314671 Ga0070658_113146711 156
878 3300005347 Ga0070668_100094816 Ga0070668_1000948163 156
879 3300005439 Ga0070711_101397920 Ga0070711_1013979201 156
880 3300005455 Ga0070663_100038779 Ga0070663_1000387794 156
881 3300005563 Ga0068855_100521862 Ga0068855_1005218622 156
882 3300005841 Ga0068863_100600212 Ga0068863_1006002122 156
883 3300009148 Ga0105243_10269958 Ga0105243_102699583 156
884 3300013308 Ga0157375_10373591 Ga0157375_103735912 156
885 3300014968 Ga0157379_11048051 Ga0157379_110480512 156
886 3300014969 Ga0157376_10145645 Ga0157376_101456453 156
887 3300025916 Ga0207663_10935281 Ga0207663_109352811 156
888 3300025949 Ga0207667_10738197 Ga0207667_107381972 156
889 3300026035 Ga0207703_10761331 Ga0207703_107613312 156
890 3300026041 Ga0207639_11258065 Ga0207639_112580651 156
891 3300026067 Ga0207678_10070164 Ga0207678_100701643 156
892 3300037853 Ga0436364_0634277 Ga0436364_0634277_4480_4986 156
893 3300046455 Ga0495603_0168829 Ga0495603_0168829_464_961 156
894 3300046457 Ga0495590_0197288 Ga0495590_0197288_113_610 156
895 3300046474 Ga0495605_0049578 Ga0495605_0049578_1233_1730 156
896 3300046499 Ga0495594_0190016 Ga0495594_0190016_251_748 156
897 3300046538 Ga0495609_0142037 Ga0495609_0142037_255_752 156
898 3300046665 Ga0495661_0110146 Ga0495661_0110146_67_564 156
899 3300046794 Ga0495589_0239870 Ga0495589_0239870_339_836 156
900 3300048909 Ga0496106_0037654 Ga0496106_0037654_2940_3437 156
901 3300048911 Ga0496108_0370162 Ga0496108_0370162_710_1207 156
902 3300048913 Ga0496110_0497187 Ga0496110_0497187_210_707 156
903 3300048914 Ga0496111_0210917 Ga0496111_0210917_350_847 156
904 3300048916 Ga0496113_0243906 Ga0496113_0243906_737_1234 156
905 3300048918 Ga0496115_0095262 Ga0496115_0095262_781_1278 156
906 3300048919 Ga0496116_0018120 Ga0496116_0018120_4726_5223 156
907 3300048922 Ga0496119_0047831 Ga0496119_0047831_1616_2113 156
908 3300048929 Ga0496126_0379786 Ga0496126_0379786_291_788 156
909 iso_pu_bacteria 2513237095 2513651028 156
910 iso_pu_bacteria 2816332527 2818242256 156
911 iso_pu_bacteria 2888378607 2888387455 156
912 iso_pu_bacteria 2929615660 2929620057 156
913 iso_pu_bacteria 2929624759 2929629370 156
914 iso_pu_bacteria 2932784394 2932789500 156
915 iso_pu_bacteria 2932828146 2932834123 156
916 iso_pu_bacteria 2933577622 2933581975 156
917 iso_pu_bacteria 2935616580 2935623488 156
918 iso_pu_bacteria 2935638405 2935644856 156
919 iso_pu_bacteria 2935665750 2935671924 156
920 iso_pu_bacteria 2935703347 2935710999 156
921 iso_pu_bacteria 2935801545 2935808588 156
922 iso_pu_bacteria 2935827899 2935834298 156
923 iso_pu_bacteria 2935837841 2935844881 156
924 iso_pu_bacteria 2935855204 2935861905 156
925 iso_pu_bacteria 2935864058 2935868460 156
926 iso_pu_bacteria 2935873716 2935879234 156
927 iso_pu_bacteria 2935992306 2935998599 156
928 iso_pu_bacteria 2936002035 2936008940 156
929 iso_pu_bacteria 2941538514 2941545225 156
930 iso_pu_bacteria 8016511872 8016519408 156
931 iso_pu_bacteria 8017057580 8017066112 156
932 iso_pu_bacteria 8019576017 8019578518 156
933 iso_pu_bacteria 8019586578 8019596567 156
934 iso_pu_bacteria 8019597564 8019605138 156
935 iso_pu_bacteria 8019608314 8019613402 156
936 iso_pu_bacteria 8055742211 8055750190 156
937 3300009551 Ga0105238_11236310 Ga0105238_112363102 157
938 3300021361 Ga0213872_10072452 Ga0213872_100724523 157
939 3300005339 Ga0070660_100078092 Ga0070660_1000780923 158
940 3300005366 Ga0070659_101009164 Ga0070659_1010091641 158
941 3300005435 Ga0070714_100018377 Ga0070714_1000183774 158
942 3300005440 Ga0070705_100062949 Ga0070705_1000629492 158
943 3300005455 Ga0070663_100455062 Ga0070663_1004550622 158
944 3300005547 Ga0070693_100481805 Ga0070693_1004818051 158
945 3300005564 Ga0070664_100488511 Ga0070664_1004885113 158
946 3300005564 Ga0070664_101077163 Ga0070664_1010771631 158
947 3300005577 Ga0068857_100079354 Ga0068857_1000793545 158
948 3300005618 Ga0068864_101186835 Ga0068864_1011868352 158
949 3300005834 Ga0068851_10236656 Ga0068851_102366562 158
950 3300006028 Ga0070717_10000817 Ga0070717_1000081716 158
951 3300006163 Ga0070715_10002395 Ga0070715_100023954 158
952 3300006175 Ga0070712_100056602 Ga0070712_1000566025 158
953 3300006353 Ga0075370_10292155 Ga0075370_102921552 158
954 3300006871 Ga0075434_100303038 Ga0075434_1003030382 158
955 3300006881 Ga0068865_100055918 Ga0068865_1000559183 158
956 3300009545 Ga0105237_10698814 Ga0105237_106988142 158
957 3300025905 Ga0207685_10177100 Ga0207685_101771003 158
958 3300025906 Ga0207699_10002060 Ga0207699_100020602 158
959 3300025907 Ga0207645_10031831 Ga0207645_100318315 158
960 3300025909 Ga0207705_10040190 Ga0207705_100401903 158
961 3300025911 Ga0207654_10050717 Ga0207654_100507173 158
962 3300025915 Ga0207693_10018411 Ga0207693_100184112 158
963 3300025917 Ga0207660_10069657 Ga0207660_100696572 158
964 3300025919 Ga0207657_10065938 Ga0207657_100659383 158
965 3300025921 Ga0207652_10124141 Ga0207652_101241414 158
966 3300025928 Ga0207700_10000623 Ga0207700_1000062320 158
967 3300025929 Ga0207664_10014641 Ga0207664_100146414 158
968 3300025931 Ga0207644_10074843 Ga0207644_100748432 158
969 3300025939 Ga0207665_10614057 Ga0207665_106140572 158
970 3300025944 Ga0207661_10022549 Ga0207661_100225496 158
971 3300025945 Ga0207679_10097968 Ga0207679_100979684 158
972 3300025945 Ga0207679_10365183 Ga0207679_103651832 158
973 3300025961 Ga0207712_10067877 Ga0207712_100678772 158
974 3300025981 Ga0207640_10742946 Ga0207640_107429462 158
975 3300026041 Ga0207639_10458548 Ga0207639_104585482 158
976 3300026067 Ga0207678_10010726 Ga0207678_100107264 158
977 3300026088 Ga0207641_10962213 Ga0207641_109622132 158
978 3300026116 Ga0207674_10578941 Ga0207674_105789412 158
979 3300026142 Ga0207698_10268494 Ga0207698_102684942 158
980 3300035724 Ga0373933_0000964 Ga0373933_0000964_6596_7078 158
981 3300041443 Ga0451789_0127710 Ga0451789_0127710_522_998 158
982 3300041452 Ga0451793_0888562 Ga0451793_0888562_85_561 158
983 3300041453 Ga0451797_0233450 Ga0451797_0233450_123_599 158
984 3300041459 Ga0451800_1372925 Ga0451800_1372925_443_919 158
985 3300041491 Ga0451833_1352607 Ga0451833_1352607_393_869 158
986 3300041496 Ga0451839_0986530 Ga0451839_0986530_109_585 158
987 3300041498 Ga0451841_0715077 Ga0451841_0715077_380_856 158
988 3300041509 Ga0451843_0408316 Ga0451843_0408316_295_771 158
989 3300041512 Ga0451853_0421108 Ga0451853_0421108_239_715 158
990 3300046507 Ga0495606_0202643 Ga0495606_0202643_637_1113 158
991 3300046675 Ga0495657_0507571 Ga0495657_0507571_144_620 158
992 3300048908 Ga0496105_0493511 Ga0496105_0493511_411_887 158
993 3300050492 nmdc:mga0yw44_46282_c1 nmdc:mga0yw44_46282_c1_1055_1531 158
994 3300046475 Ga0495639_0078976 Ga0495639_0078976_79_579 159
995 3300046501 Ga0495607_0177826 Ga0495607_0177826_197_697 159
996 3300046522 Ga0495643_0117339 Ga0495643_0117339_28_528 159
997 3300047321 Ga0495676_0191915 Ga0495676_0191915_696_1196 159
998 3300001989 JGI24739J22299_10077895 JGI24739J22299_100778951 160
999 3300005331 Ga0070670_100123864 Ga0070670_1001238642 160
1000 3300005334 Ga0068869_100794102 Ga0068869_1007941022 160
1001 3300005355 Ga0070671_100323924 Ga0070671_1003239243 160
1002 3300005367 Ga0070667_100121962 Ga0070667_1001219622 160
1003 3300005539 Ga0068853_100304583 Ga0068853_1003045832 160
1004 3300005548 Ga0070665_100233268 Ga0070665_1002332682 160
1005 3300005563 Ga0068855_100377302 Ga0068855_1003773023 160
1006 3300005614 Ga0068856_100479425 Ga0068856_1004794252 160
1007 3300005842 Ga0068858_100127486 Ga0068858_1001274863 160
1008 3300005844 Ga0068862_101495038 Ga0068862_1014950382 160
1009 3300006042 Ga0075368_10033390 Ga0075368_100333903 160
1010 3300006048 Ga0075363_100237427 Ga0075363_1002374273 160
1011 3300006177 Ga0075362_10066822 Ga0075362_100668222 160
1012 3300006186 Ga0075369_10064469 Ga0075369_100644692 160
1013 3300006195 Ga0075366_10080872 Ga0075366_100808723 160
1014 3300006353 Ga0075370_10198603 Ga0075370_101986033 160
1015 3300009093 Ga0105240_11126889 Ga0105240_111268892 160
1016 3300009101 Ga0105247_10090956 Ga0105247_100909563 160
1017 3300009174 Ga0105241_10237992 Ga0105241_102379922 160
1018 3300009177 Ga0105248_10438458 Ga0105248_104384582 160
1019 3300010375 Ga0105239_10232065 Ga0105239_102320651 160
1020 3300011119 Ga0105246_10014135 Ga0105246_100141354 160
1021 3300013307 Ga0157372_11321162 Ga0157372_113211621 160
1022 3300014325 Ga0163163_10018933 Ga0163163_100189336 160
1023 3300015262 Ga0182007_10105900 Ga0182007_101059002 160
1024 3300017792 Ga0163161_10517304 Ga0163161_105173042 160
1025 3300021388 Ga0213875_10072222 Ga0213875_100722222 160
1026 3300025297 Ga0209758_1005792 Ga0209758_10057929 160
1027 3300025904 Ga0207647_10000809 Ga0207647_100008093 160
1028 3300025909 Ga0207705_10840494 Ga0207705_108404941 160
1029 3300025911 Ga0207654_10876919 Ga0207654_108769191 160
1030 3300025913 Ga0207695_11182799 Ga0207695_111827992 160
1031 3300025914 Ga0207671_10671466 Ga0207671_106714662 160
1032 3300025919 Ga0207657_10986939 Ga0207657_109869392 160
1033 3300025923 Ga0207681_10514019 Ga0207681_105140192 160
1034 3300025924 Ga0207694_11273295 Ga0207694_112732952 160
1035 3300025927 Ga0207687_11153296 Ga0207687_111532961 160
1036 3300025931 Ga0207644_10214235 Ga0207644_102142353 160
1037 3300025935 Ga0207709_10195654 Ga0207709_101956542 160
1038 3300025972 Ga0207668_10278635 Ga0207668_102786352 160
1039 3300025986 Ga0207658_10079632 Ga0207658_100796323 160
1040 3300026023 Ga0207677_10179835 Ga0207677_101798352 160
1041 3300026035 Ga0207703_10131795 Ga0207703_101317952 160
1042 3300026078 Ga0207702_11334269 Ga0207702_113342691 160
1043 3300027866 Ga0209813_10002805 Ga0209813_100028054 160
1044 3300028379 Ga0268266_10260572 Ga0268266_102605722 160
1045 3300028380 Ga0268265_10538904 Ga0268265_105389042 160
1046 3300028381 Ga0268264_11813193 Ga0268264_118131931 160
1047 3300035692 Ga0373935_0190125 Ga0373935_0190125_126_608 160
1048 3300037418 Ga0395900_0148637 Ga0395900_0148637_1425_1907 160
1049 3300037466 Ga0395898_0060527 Ga0395898_0060527_271_774 160
1050 3300038443 Ga0395901_0124591 Ga0395901_0124591_685_1167 160
1051 3300038443 Ga0395901_0409511 Ga0395901_0409511_93_596 160
1052 3300046454 Ga0495592_0026114 Ga0495592_0026114_2997_3479 160
1053 3300046457 Ga0495590_0220895 Ga0495590_0220895_132_614 160
1054 3300046474 Ga0495605_0050049 Ga0495605_0050049_1312_1794 160
1055 3300046506 Ga0495583_0128608 Ga0495583_0128608_149_631 160
1056 3300046512 Ga0495610_0072151 Ga0495610_0072151_122_604 160
1057 3300046513 Ga0495616_0086636 Ga0495616_0086636_716_1198 160
1058 3300046513 Ga0495616_0152852 Ga0495616_0152852_25_522 160
1059 3300046519 Ga0495632_0058796 Ga0495632_0058796_1367_1849 160
1060 3300046522 Ga0495643_0004188 Ga0495643_0004188_3905_4387 160
1061 3300046536 Ga0495587_0249716 Ga0495587_0249716_206_688 160
1062 3300046674 Ga0495588_0063074 Ga0495588_0063074_396_878 160
1063 3300046684 Ga0495669_0199262 Ga0495669_0199262_103_585 160
1064 3300046692 Ga0495671_0095070 Ga0495671_0095070_699_1196 160
1065 3300047321 Ga0495676_0269104 Ga0495676_0269104_479_961 160
1066 3300047323 Ga0495683_0189085 Ga0495683_0189085_315_797 160
1067 3300047443 Ga0495687_005489 Ga0495687_005489_5679_6161 160
1068 3300048091 Ga0495626_0224603 Ga0495626_0224603_224_706 160
1069 3300048903 Ga0496100_0274746 Ga0496100_0274746_615_1112 160
1070 3300048903 Ga0496100_0661330 Ga0496100_0661330_127_609 160
1071 3300048905 Ga0496102_0033286 Ga0496102_0033286_2775_3257 160
1072 3300048906 Ga0496103_0030056 Ga0496103_0030056_2490_2972 160
1073 3300048907 Ga0496104_0126679 Ga0496104_0126679_888_1370 160
1074 3300048907 Ga0496104_1092601 Ga0496104_1092601_68_550 160
1075 3300048908 Ga0496105_0075164 Ga0496105_0075164_335_817 160
1076 3300048908 Ga0496105_0445720 Ga0496105_0445720_467_949 160
1077 3300048910 Ga0496107_0557387 Ga0496107_0557387_59_541 160
1078 3300048911 Ga0496108_0128469 Ga0496108_0128469_138_620 160
1079 3300048913 Ga0496110_0067729 Ga0496110_0067729_1851_2333 160
1080 3300048914 Ga0496111_0231915 Ga0496111_0231915_875_1357 160
1081 3300048915 Ga0496112_0218843 Ga0496112_0218843_1213_1695 160
1082 3300048916 Ga0496113_0266580 Ga0496113_0266580_739_1221 160
1083 3300048916 Ga0496113_0581213 Ga0496113_0581213_44_526 160
1084 3300048921 Ga0496118_0065475 Ga0496118_0065475_959_1441 160
1085 3300048922 Ga0496119_0375893 Ga0496119_0375893_33_515 160
1086 3300048923 Ga0496120_0207668 Ga0496120_0207668_438_920 160
1087 3300048924 Ga0496121_0019921 Ga0496121_0019921_1741_2223 160
1088 3300048928 Ga0496125_0204666 Ga0496125_0204666_248_730 160
1089 3300050489 nmdc:mga03683_304528_c1 nmdc:mga03683_304528_c1_69_551 160
1090 3300050490 nmdc:mga03n38_11178_c1 nmdc:mga03n38_11178_c1_548_1030 160
1091 3300050491 nmdc:mga00v17_112485_c1 nmdc:mga00v17_112485_c1_914_1396 160
1092 3300050494 nmdc:mga06z11_12292_c1 nmdc:mga06z11_12292_c1_2380_2862 160
1093 3300050495 nmdc:mga04h51_26232_c1 nmdc:mga04h51_26232_c1_594_1076 160
1094 3300050496 nmdc:mga07m45_34494_c1 nmdc:mga07m45_34494_c1_1772_2254 160
1095 3300053105 Ga0500557_000030 Ga0500557_000030_55716_56213 160
1096 3300053178 Ga0500637_0025357 Ga0500637_0025357_1755_2270 160
1097 iso_pu_bacteria 2824661429 2824668430 160
1098 iso_pu_bacteria 2922368715 2922370477 160
1099 iso_pu_bacteria 2932809354 2932814993 160
1100 iso_pu_bacteria 2932818245 2932824150 160
1101 iso_pu_bacteria 2935675223 2935683148 160
1102 iso_pu_bacteria 2935684952 2935689316 160
1103 iso_pu_bacteria 2935694250 2935697424 160
1104 iso_pu_bacteria 2935713505 2935720262 160
1105 iso_pu_bacteria 2935722832 2935728121 160
1106 iso_pu_bacteria 2935732158 2935737282 160
1107 iso_pu_bacteria 2935741537 2935746657 160
1108 iso_pu_bacteria 2935750917 2935757624 160
1109 iso_pu_bacteria 2935760218 2935764000 160
1110 iso_pu_bacteria 2935769743 2935776495 160
1111 iso_pu_bacteria 2935777560 2935784051 160
1112 iso_pu_bacteria 2935785616 2935789923 160
1113 iso_pu_bacteria 2935793552 2935798311 160
1114 iso_pu_bacteria 2935810662 2935817385 160
1115 iso_pu_bacteria 2936037263 2936044182 160
1116 iso_pu_bacteria 2940556831 2940563554 160
1117 iso_pu_bacteria 8016522445 8016524943 160
1118 iso_pu_bacteria 8016530956 8016538519 160
1119 iso_pu_bacteria 8016539877 8016542802 160
1120 iso_pu_bacteria 8016548790 8016550483 160
1121 iso_pu_bacteria 8016557553 8016558901 160
1122 iso_pu_bacteria 8016566248 8016568189 160
1123 iso_pu_bacteria 8016575299 8016580858 160
1124 iso_pu_bacteria 8016595262 8016596864 160
1125 iso_pu_bacteria 8016603502 8016607767 160
1126 iso_pu_bacteria 8016613128 8016619553 160
1127 iso_pu_bacteria 8016622563 8016630051 160
1128 iso_pu_bacteria 8019530166 8019538184 160
1129 iso_pu_bacteria 8019538911 8019541801 160
1130 iso_pu_bacteria 8019547302 8019548996 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02391

MoaE

MoaE protein

9

123

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nvj-assembly1.cif.gz_A deletion mutant (delta 141) of molybdopterin synthase 0.9673 10 133
1nvi-assembly1.cif.gz_E-2 orthorhombic crystal form of molybdopterin synthase 0.9623 10 157
1nvj-assembly3.cif.gz_E deletion mutant (delta 141) of molybdopterin synthase 0.9597 10 132
1nvj-assembly2.cif.gz_C deletion mutant (delta 141) of molybdopterin synthase 0.9457 10 133
1nvi-assembly1.cif.gz_E-2 orthorhombic crystal form of molybdopterin synthase 0.9426 10 157
ID Description Score Start End Superfamily
1fmaE00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9653 9 157 3.90.1170.40
1fmaE00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9521 9 157 3.90.1170.40
1nvjC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9457 10 133 3.90.1170.40
5mpoC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9344 7 137 3.90.1170.40
2omdA00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9224 12 137 3.90.1170.40
ID Description Score Start End GO Terms
AF-A0A520NUL0-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.98 13 159 GO:0006777
GO:0030366
AF-A0A1Q3VSL3-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.98 11 159 GO:0006777
GO:0030366
AF-A0A6I7PGD4-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.977 11 157 GO:0006777
GO:0030366
AF-A0A7V7E8K8-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9764 11 157 GO:0006777
AF-A0A847BIV7-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9763 11 157 GO:0006777
GO:0016740

Feature Viewer

pLDDT pTM Quality
86.99 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map