F490535
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1130 | 555 | 1030 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300035119|Ga0373956_0009126|Ga0373956_0009126_1524_2093 |
| Length | 189 |
| Sequence | VTIPVTIRIQQGDFDVAREVTALSQGRTDIGAVVTFSGICRGPEGGDDIASLTLEHYPGMAEAEIRRHADEAISRWPLQGLTVIHRFGRIEPGQNIVLVVTASKHRQAAFEAAEFLMDYLKTSAPFWKQEESARGKGWVEAHAHDDAAAARWTKSLWPGASRRQKSPRQNRRKSQAANCSRCSISSAMR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 5 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 6 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 7 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 8 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 9 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 10 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 11 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 12 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 13 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 14 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 15 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 16 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 17 | 2922368715 | |||
| 18 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 19 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 20 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 21 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 22 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 23 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 24 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 25 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 26 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 27 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 28 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 29 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 30 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 31 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 32 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 33 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 34 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 35 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 36 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 37 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 38 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 39 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 40 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 41 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 42 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 43 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 44 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 45 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 46 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 47 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 48 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 49 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 50 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 51 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 52 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 53 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 54 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 55 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 56 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 57 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 58 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 59 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 60 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 61 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 62 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 63 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 64 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 65 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 66 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 67 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 68 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 69 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 70 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 71 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 72 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 73 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 74 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 75 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 76 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 78 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 83 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 85 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 89 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 91 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 99 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 115 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 116 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 117 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 118 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 120 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 121 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 122 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 123 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 128 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 129 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 131 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 132 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 133 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 135 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 136 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 137 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 138 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 139 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 140 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 141 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 142 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 143 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 144 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 145 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 146 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 147 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 148 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 150 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 151 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 152 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 153 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 154 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 155 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 156 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 157 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 158 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 159 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 161 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 162 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 163 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 164 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 165 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 166 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 168 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 169 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 183 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 186 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 187 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 200 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 202 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 203 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 204 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 205 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 206 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 207 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 208 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 209 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 279 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 283 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 284 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 285 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 286 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 287 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 288 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 289 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 290 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 291 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 292 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 293 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 294 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 295 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 296 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 297 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 298 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 299 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 300 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 301 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 302 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 303 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 304 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 305 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 306 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 307 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 308 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 309 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 310 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 311 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 312 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 313 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 314 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 315 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 316 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 317 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 318 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 319 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 320 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 321 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 322 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 323 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 324 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 325 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 326 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 327 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 328 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 329 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 330 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 331 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 332 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 333 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 334 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 335 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 336 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 337 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 338 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 339 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 340 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 341 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 342 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 343 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 344 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 345 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 346 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 347 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 348 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 349 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 350 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 351 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 352 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 353 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 354 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 355 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 356 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 357 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 358 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 359 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 360 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 433 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 435 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 436 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 437 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 438 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 439 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 440 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 441 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 442 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 443 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 444 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 445 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 446 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 447 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 448 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 449 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 450 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 451 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 452 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 453 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 454 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 455 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 456 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 457 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 458 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 459 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 484 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 485 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 486 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 487 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 488 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 489 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 490 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 491 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 492 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 493 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 494 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 495 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 496 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 497 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 498 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 499 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 503 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 504 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 505 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 506 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 507 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 508 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 509 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 510 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 511 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 512 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 513 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 514 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 515 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 516 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 517 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 518 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 519 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 520 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 521 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 522 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 523 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 524 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 525 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 526 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 527 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 528 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 529 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 530 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 531 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 532 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 533 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 534 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 535 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 536 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 537 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 538 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 539 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 540 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 541 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 542 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 543 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 544 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 545 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 546 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 547 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 548 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 549 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 550 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 551 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 552 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 553 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 554 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 555 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.88 |
| Metatranscriptomes | 0.35 |
| Isolates | 8.77 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.43 |
| Nodule | 8.5 |
| Rhizoplane | 7.96 |
| Rhizosphere | 70.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10077895 | 3300001989 | Bacteria | 1022 |
| 2 | JGI24738J21930_10014806 | 3300002075 | Bacteria | 1669 |
| 3 | JGI24751J29686_10004765 | 3300002459 | Bacteria | 2756 |
| 4 | JGI25406J46586_10000043 | 3300003203 | Bacteria | 55866 |
| 5 | JGI25406J46586_10004766 | 3300003203 | Bacteria | 6308 |
| 6 | JGI25153J46596_10000584 | 3300003215 | Bacteria | 22421 |
| 7 | JGI25404J52841_10013755 | 3300003659 | Bacteria | 1755 |
| 8 | JGI25404J52841_10017841 | 3300003659 | Bacteria | 1539 |
| 9 | JGI25404J52841_10035170 | 3300003659 | Bacteria | 1067 |
| 10 | Ga0070658_10168014 | 3300005327 | Bacteria | 1842 |
| 11 | Ga0070658_11314671 | 3300005327 | Bacteria | 628 |
| 12 | Ga0070676_10030096 | 3300005328 | Bacteria | 3094 |
| 13 | Ga0070676_10073935 | 3300005328 | Bacteria | 2051 |
| 14 | Ga0070683_100009428 | 3300005329 | Bacteria | 8348 |
| 15 | Ga0070683_100015413 | 3300005329 | Bacteria | 6713 |
| 16 | Ga0070683_100308838 | 3300005329 | Bacteria | 1505 |
| 17 | Ga0070683_100897585 | 3300005329 | Bacteria | 850 |
| 18 | Ga0070690_100032631 | 3300005330 | Bacteria | 3254 |
| 19 | Ga0070670_100007615 | 3300005331 | Bacteria | 9197 |
| 20 | Ga0070670_100107016 | 3300005331 | Bacteria | 2410 |
| 21 | Ga0070670_100123864 | 3300005331 | Bacteria | 2230 |
| 22 | Ga0068869_100101232 | 3300005334 | Bacteria | 2179 |
| 23 | Ga0068869_100354184 | 3300005334 | Bacteria | 1197 |
| 24 | Ga0068869_100794102 | 3300005334 | Bacteria | 813 |
| 25 | Ga0070666_10347337 | 3300005335 | Bacteria | 1061 |
| 26 | Ga0070680_100407087 | 3300005336 | Bacteria | 1160 |
| 27 | Ga0070680_100736246 | 3300005336 | Bacteria | 849 |
| 28 | Ga0070682_100009389 | 3300005337 | Bacteria | 5536 |
| 29 | Ga0070682_100089099 | 3300005337 | Bacteria | 2015 |
| 30 | Ga0070682_100547523 | 3300005337 | Bacteria | 905 |
| 31 | Ga0068868_100353863 | 3300005338 | Bacteria | 1258 |
| 32 | Ga0070660_100037317 | 3300005339 | Bacteria | 3684 |
| 33 | Ga0070660_100078092 | 3300005339 | Bacteria | 2595 |
| 34 | Ga0070689_100048875 | 3300005340 | Bacteria | 3264 |
| 35 | Ga0070691_10065733 | 3300005341 | Bacteria | 1752 |
| 36 | Ga0070661_100031155 | 3300005344 | Bacteria | 3855 |
| 37 | Ga0070661_100169096 | 3300005344 | Bacteria | 1659 |
| 38 | Ga0070661_101210275 | 3300005344 | Bacteria | 632 |
| 39 | Ga0070668_100056497 | 3300005347 | Bacteria | 3031 |
| 40 | Ga0070668_100094816 | 3300005347 | Bacteria | 2356 |
| 41 | Ga0070668_100185524 | 3300005347 | Bacteria | 1701 |
| 42 | Ga0070668_100958030 | 3300005347 | Bacteria | 767 |
| 43 | Ga0070675_100010225 | 3300005354 | Bacteria | 7318 |
| 44 | Ga0070671_100003008 | 3300005355 | Bacteria | 13131 |
| 45 | Ga0070671_100111626 | 3300005355 | Bacteria | 2296 |
| 46 | Ga0070671_100323924 | 3300005355 | Bacteria | 1313 |
| 47 | Ga0070674_100097802 | 3300005356 | Bacteria | 2132 |
| 48 | Ga0070673_100004774 | 3300005364 | Bacteria | 8608 |
| 49 | Ga0070688_100652260 | 3300005365 | Bacteria | 811 |
| 50 | Ga0070659_100231393 | 3300005366 | Bacteria | 1527 |
| 51 | Ga0070659_101009164 | 3300005366 | Bacteria | 731 |
| 52 | Ga0070667_100020621 | 3300005367 | Bacteria | 5471 |
| 53 | Ga0070667_100048868 | 3300005367 | Bacteria | 3562 |
| 54 | Ga0070667_100121962 | 3300005367 | Bacteria | 2268 |
| 55 | Ga0070703_10116811 | 3300005406 | Bacteria | 962 |
| 56 | Ga0070709_10002890 | 3300005434 | Bacteria | 9260 |
| 57 | Ga0070709_10006086 | 3300005434 | Bacteria | 6564 |
| 58 | Ga0070709_10006951 | 3300005434 | Bacteria | 6178 |
| 59 | Ga0070709_10333101 | 3300005434 | Bacteria | 1117 |
| 60 | Ga0070709_10702131 | 3300005434 | Bacteria | 787 |
| 61 | Ga0070714_100018377 | 3300005435 | Bacteria | 5679 |
| 62 | Ga0070714_100018976 | 3300005435 | Bacteria | 5595 |
| 63 | Ga0070714_100034823 | 3300005435 | Bacteria | 4217 |
| 64 | Ga0070714_100070792 | 3300005435 | Bacteria | 3015 |
| 65 | Ga0070714_100336444 | 3300005435 | Bacteria | 1415 |
| 66 | Ga0070714_100411212 | 3300005435 | Bacteria | 1280 |
| 67 | Ga0070713_100061181 | 3300005436 | Bacteria | 3150 |
| 68 | Ga0070713_100062946 | 3300005436 | Bacteria | 3108 |
| 69 | Ga0070713_100116289 | 3300005436 | Bacteria | 2339 |
| 70 | Ga0070713_100580395 | 3300005436 | Bacteria | 1064 |
| 71 | Ga0070710_10034156 | 3300005437 | Bacteria | 2765 |
| 72 | Ga0070710_10116229 | 3300005437 | Bacteria | 1613 |
| 73 | Ga0070710_10318664 | 3300005437 | Bacteria | 1020 |
| 74 | Ga0070710_10360389 | 3300005437 | Bacteria | 965 |
| 75 | Ga0070710_10389382 | 3300005437 | Bacteria | 931 |
| 76 | Ga0070701_10019718 | 3300005438 | Bacteria | 3190 |
| 77 | Ga0070711_100006504 | 3300005439 | Bacteria | 7046 |
| 78 | Ga0070711_100063677 | 3300005439 | Bacteria | 2574 |
| 79 | Ga0070711_100119677 | 3300005439 | Bacteria | 1946 |
| 80 | Ga0070711_100389288 | 3300005439 | Bacteria | 1129 |
| 81 | Ga0070711_100659637 | 3300005439 | Bacteria | 878 |
| 82 | Ga0070711_100715855 | 3300005439 | Bacteria | 844 |
| 83 | Ga0070711_100930167 | 3300005439 | Bacteria | 743 |
| 84 | Ga0070711_101397920 | 3300005439 | Bacteria | 609 |
| 85 | Ga0070705_100062949 | 3300005440 | Bacteria | 2211 |
| 86 | Ga0070700_100021596 | 3300005441 | Bacteria | 3743 |
| 87 | Ga0070694_100513365 | 3300005444 | Bacteria | 955 |
| 88 | Ga0070694_100810184 | 3300005444 | Bacteria | 768 |
| 89 | Ga0070663_100020381 | 3300005455 | Bacteria | 4389 |
| 90 | Ga0070663_100038779 | 3300005455 | Bacteria | 3325 |
| 91 | Ga0070663_100455062 | 3300005455 | Bacteria | 1056 |
| 92 | Ga0070663_101786593 | 3300005455 | Bacteria | 551 |
| 93 | Ga0070678_100012280 | 3300005456 | Bacteria | 5317 |
| 94 | Ga0070662_100031385 | 3300005457 | Bacteria | 3728 |
| 95 | Ga0070662_101025537 | 3300005457 | Bacteria | 707 |
| 96 | Ga0070681_10020543 | 3300005458 | Bacteria | 6618 |
| 97 | Ga0070681_10047562 | 3300005458 | Bacteria | 4288 |
| 98 | Ga0070681_10308938 | 3300005458 | Bacteria | 1491 |
| 99 | Ga0070681_10661284 | 3300005458 | Bacteria | 960 |
| 100 | Ga0068867_100076490 | 3300005459 | Bacteria | 2513 |
| 101 | Ga0070706_100774213 | 3300005467 | Bacteria | 889 |
| 102 | Ga0070707_100599573 | 3300005468 | Bacteria | 1064 |
| 103 | Ga0070698_100433662 | 3300005471 | Bacteria | 1249 |
| 104 | Ga0070679_100007751 | 3300005530 | Bacteria | 10056 |
| 105 | Ga0070679_100118675 | 3300005530 | Bacteria | 2630 |
| 106 | Ga0070679_100560796 | 3300005530 | Bacteria | 1086 |
| 107 | Ga0070679_101119346 | 3300005530 | Bacteria | 732 |
| 108 | Ga0070679_101283283 | 3300005530 | Bacteria | 678 |
| 109 | Ga0070684_100012253 | 3300005535 | Bacteria | 6865 |
| 110 | Ga0070684_100030875 | 3300005535 | Bacteria | 4557 |
| 111 | Ga0070684_100105471 | 3300005535 | Bacteria | 2522 |
| 112 | Ga0070697_100147829 | 3300005536 | Bacteria | 1979 |
| 113 | Ga0068853_100058222 | 3300005539 | Bacteria | 3335 |
| 114 | Ga0068853_100092722 | 3300005539 | Bacteria | 2658 |
| 115 | Ga0068853_100155163 | 3300005539 | Bacteria | 2063 |
| 116 | Ga0068853_100304583 | 3300005539 | Bacteria | 1474 |
| 117 | Ga0068853_100450255 | 3300005539 | Bacteria | 1211 |
| 118 | Ga0070672_100844552 | 3300005543 | Bacteria | 807 |
| 119 | Ga0070696_100010959 | 3300005546 | Bacteria | 6073 |
| 120 | Ga0070693_100481805 | 3300005547 | Bacteria | 876 |
| 121 | Ga0070665_100050501 | 3300005548 | Bacteria | 4173 |
| 122 | Ga0070665_100154830 | 3300005548 | Bacteria | 2294 |
| 123 | Ga0070665_100233268 | 3300005548 | Bacteria | 1840 |
| 124 | Ga0070665_100348604 | 3300005548 | Bacteria | 1486 |
| 125 | Ga0070665_101179948 | 3300005548 | Bacteria | 776 |
| 126 | Ga0070704_100003439 | 3300005549 | Bacteria | 9081 |
| 127 | Ga0070704_100035424 | 3300005549 | Bacteria | 3393 |
| 128 | Ga0068855_100066662 | 3300005563 | Bacteria | 4197 |
| 129 | Ga0068855_100362156 | 3300005563 | Bacteria | 1595 |
| 130 | Ga0068855_100377302 | 3300005563 | Bacteria | 1557 |
| 131 | Ga0068855_100521862 | 3300005563 | Bacteria | 1288 |
| 132 | Ga0068855_100656803 | 3300005563 | Bacteria | 1125 |
| 133 | Ga0068855_100770096 | 3300005563 | Bacteria | 1025 |
| 134 | Ga0068855_101688109 | 3300005563 | Bacteria | 646 |
| 135 | Ga0070664_100074972 | 3300005564 | Bacteria | 2904 |
| 136 | Ga0070664_100488511 | 3300005564 | Bacteria | 1134 |
| 137 | Ga0070664_101077163 | 3300005564 | Bacteria | 756 |
| 138 | Ga0070664_101250738 | 3300005564 | Bacteria | 701 |
| 139 | Ga0068857_100079354 | 3300005577 | Bacteria | 2930 |
| 140 | Ga0068857_100178798 | 3300005577 | Bacteria | 1930 |
| 141 | Ga0068857_101192792 | 3300005577 | Bacteria | 737 |
| 142 | Ga0068857_101967138 | 3300005577 | Bacteria | 573 |
| 143 | Ga0068854_100012801 | 3300005578 | Bacteria | 5494 |
| 144 | Ga0068854_100098797 | 3300005578 | Bacteria | 2185 |
| 145 | Ga0068854_100358977 | 3300005578 | Bacteria | 1195 |
| 146 | Ga0068854_100799551 | 3300005578 | Bacteria | 822 |
| 147 | Ga0068856_100066430 | 3300005614 | Bacteria | 3563 |
| 148 | Ga0068856_100479425 | 3300005614 | Bacteria | 1265 |
| 149 | Ga0068856_100525210 | 3300005614 | Bacteria | 1205 |
| 150 | Ga0068856_100595365 | 3300005614 | Bacteria | 1127 |
| 151 | Ga0070702_100011479 | 3300005615 | Bacteria | 4407 |
| 152 | Ga0068852_100193087 | 3300005616 | Bacteria | 1922 |
| 153 | Ga0068859_100064488 | 3300005617 | Bacteria | 3695 |
| 154 | Ga0068859_100352355 | 3300005617 | Bacteria | 1567 |
| 155 | Ga0068864_100011404 | 3300005618 | Bacteria | 7341 |
| 156 | Ga0068864_101186835 | 3300005618 | Bacteria | 761 |
| 157 | Ga0068864_101324513 | 3300005618 | Bacteria | 721 |
| 158 | Ga0068861_100050207 | 3300005719 | Bacteria | 3162 |
| 159 | Ga0068851_10045691 | 3300005834 | Bacteria | 2214 |
| 160 | Ga0068851_10236656 | 3300005834 | Bacteria | 1031 |
| 161 | Ga0068870_10098024 | 3300005840 | Bacteria | 1651 |
| 162 | Ga0068863_100018031 | 3300005841 | Bacteria | 6757 |
| 163 | Ga0068863_100600212 | 3300005841 | Bacteria | 1089 |
| 164 | Ga0068858_100127486 | 3300005842 | Bacteria | 2384 |
| 165 | Ga0068858_100177127 | 3300005842 | Bacteria | 2012 |
| 166 | Ga0068858_100179715 | 3300005842 | Bacteria | 1997 |
| 167 | Ga0068858_101109840 | 3300005842 | Bacteria | 777 |
| 168 | Ga0068860_100162546 | 3300005843 | Bacteria | 2153 |
| 169 | Ga0068862_100022075 | 3300005844 | Bacteria | 5324 |
| 170 | Ga0068862_100401566 | 3300005844 | Bacteria | 1282 |
| 171 | Ga0068862_101495038 | 3300005844 | Bacteria | 681 |
| 172 | Ga0081455_10012432 | 3300005937 | Bacteria | 8495 |
| 173 | Ga0081455_10100708 | 3300005937 | Bacteria | 2321 |
| 174 | Ga0081455_10662096 | 3300005937 | Bacteria | 670 |
| 175 | Ga0081538_10103530 | 3300005981 | Bacteria | 1424 |
| 176 | Ga0081540_1025104 | 3300005983 | Bacteria | 3440 |
| 177 | Ga0081540_1028909 | 3300005983 | Bacteria | 3101 |
| 178 | Ga0081540_1030553 | 3300005983 | Bacteria | 2981 |
| 179 | Ga0081540_1047477 | 3300005983 | Bacteria | 2159 |
| 180 | Ga0081540_1118098 | 3300005983 | Bacteria | 1106 |
| 181 | Ga0081539_10000324 | 3300005985 | Bacteria | 106549 |
| 182 | Ga0081539_10002558 | 3300005985 | Bacteria | 25231 |
| 183 | Ga0081539_10033708 | 3300005985 | Bacteria | 3113 |
| 184 | Ga0070717_10000361 | 3300006028 | Bacteria | 29296 |
| 185 | Ga0070717_10000817 | 3300006028 | Bacteria | 20525 |
| 186 | Ga0070717_10002247 | 3300006028 | Bacteria | 13537 |
| 187 | Ga0070717_10058902 | 3300006028 | Bacteria | 3176 |
| 188 | Ga0070717_10263727 | 3300006028 | Bacteria | 1525 |
| 189 | Ga0070717_10419032 | 3300006028 | Bacteria | 1204 |
| 190 | Ga0075365_10074009 | 3300006038 | Bacteria | 2297 |
| 191 | Ga0075365_10250267 | 3300006038 | Bacteria | 1245 |
| 192 | Ga0075368_10033390 | 3300006042 | Bacteria | 2002 |
| 193 | Ga0075368_10107349 | 3300006042 | Bacteria | 1149 |
| 194 | Ga0075368_10339637 | 3300006042 | Bacteria | 652 |
| 195 | Ga0075363_100151649 | 3300006048 | Bacteria | 1308 |
| 196 | Ga0075363_100156015 | 3300006048 | Bacteria | 1290 |
| 197 | Ga0075363_100164771 | 3300006048 | Bacteria | 1256 |
| 198 | Ga0075363_100237427 | 3300006048 | Bacteria | 1047 |
| 199 | Ga0075363_100406342 | 3300006048 | Bacteria | 801 |
| 200 | Ga0075364_10138064 | 3300006051 | Bacteria | 1638 |
| 201 | Ga0070715_10002395 | 3300006163 | Bacteria | 5744 |
| 202 | Ga0070715_10049634 | 3300006163 | Bacteria | 1799 |
| 203 | Ga0070716_100117656 | 3300006173 | Bacteria | 1658 |
| 204 | Ga0070712_100004741 | 3300006175 | Bacteria | 8406 |
| 205 | Ga0070712_100056383 | 3300006175 | Bacteria | 2756 |
| 206 | Ga0070712_100056602 | 3300006175 | Bacteria | 2751 |
| 207 | Ga0075362_10035073 | 3300006177 | Bacteria | 2189 |
| 208 | Ga0075362_10058301 | 3300006177 | Bacteria | 1741 |
| 209 | Ga0075362_10066822 | 3300006177 | Bacteria | 1635 |
| 210 | Ga0075362_10138598 | 3300006177 | Bacteria | 1161 |
| 211 | Ga0075362_10393079 | 3300006177 | Bacteria | 699 |
| 212 | Ga0075369_10023967 | 3300006186 | Bacteria | 2526 |
| 213 | Ga0075369_10064469 | 3300006186 | Bacteria | 1604 |
| 214 | Ga0075369_10098445 | 3300006186 | Bacteria | 1310 |
| 215 | Ga0075369_10420604 | 3300006186 | Bacteria | 631 |
| 216 | Ga0075366_10024433 | 3300006195 | Bacteria | 3525 |
| 217 | Ga0075366_10080872 | 3300006195 | Bacteria | 1940 |
| 218 | Ga0075366_10216139 | 3300006195 | Bacteria | 1167 |
| 219 | Ga0075366_10575975 | 3300006195 | Bacteria | 697 |
| 220 | Ga0097621_100174234 | 3300006237 | Bacteria | 1856 |
| 221 | Ga0097621_100195018 | 3300006237 | Bacteria | 1756 |
| 222 | Ga0075370_10108842 | 3300006353 | Bacteria | 1608 |
| 223 | Ga0075370_10198603 | 3300006353 | Bacteria | 1183 |
| 224 | Ga0075370_10292155 | 3300006353 | Bacteria | 969 |
| 225 | Ga0068871_100084796 | 3300006358 | Bacteria | 2629 |
| 226 | Ga0075428_100162154 | 3300006844 | Bacteria | 2427 |
| 227 | Ga0075434_100303038 | 3300006871 | Bacteria | 1618 |
| 228 | Ga0075434_100493030 | 3300006871 | Bacteria | 1246 |
| 229 | Ga0068865_100028120 | 3300006881 | Bacteria | 3721 |
| 230 | Ga0068865_100055918 | 3300006881 | Bacteria | 2747 |
| 231 | Ga0075436_100161011 | 3300006914 | Bacteria | 1582 |
| 232 | Ga0075436_100567622 | 3300006914 | Bacteria | 834 |
| 233 | Ga0097620_100064486 | 3300006931 | Bacteria | 3695 |
| 234 | Ga0097620_100352307 | 3300006931 | Bacteria | 1567 |
| 235 | Ga0075435_100334679 | 3300007076 | Bacteria | 1297 |
| 236 | Ga0099794_10343242 | 3300007265 | Bacteria | 776 |
| 237 | Ga0105250_10190319 | 3300009092 | Bacteria | 863 |
| 238 | Ga0105240_10015381 | 3300009093 | Bacteria | 10403 |
| 239 | Ga0105240_10080919 | 3300009093 | Bacteria | 3993 |
| 240 | Ga0105240_10316975 | 3300009093 | Bacteria | 1778 |
| 241 | Ga0105240_10878092 | 3300009093 | Bacteria | 966 |
| 242 | Ga0105240_11126889 | 3300009093 | Bacteria | 834 |
| 243 | Ga0105240_11219676 | 3300009093 | Bacteria | 796 |
| 244 | Ga0111539_10269577 | 3300009094 | Bacteria | 1982 |
| 245 | Ga0105245_10136563 | 3300009098 | Bacteria | 2305 |
| 246 | Ga0105245_10141418 | 3300009098 | Bacteria | 2267 |
| 247 | Ga0105245_10267733 | 3300009098 | Bacteria | 1665 |
| 248 | Ga0105245_10414503 | 3300009098 | Bacteria | 1349 |
| 249 | Ga0105247_10009307 | 3300009101 | Bacteria | 5964 |
| 250 | Ga0105247_10058543 | 3300009101 | Bacteria | 2384 |
| 251 | Ga0105247_10090956 | 3300009101 | Bacteria | 1937 |
| 252 | Ga0105247_11015810 | 3300009101 | Bacteria | 649 |
| 253 | Ga0114129_10234852 | 3300009147 | Bacteria | 2468 |
| 254 | Ga0105243_10092391 | 3300009148 | Bacteria | 2495 |
| 255 | Ga0105243_10191232 | 3300009148 | Bacteria | 1788 |
| 256 | Ga0105243_10269958 | 3300009148 | Bacteria | 1527 |
| 257 | Ga0105241_10051881 | 3300009174 | Bacteria | 3130 |
| 258 | Ga0105241_10172862 | 3300009174 | Bacteria | 1786 |
| 259 | Ga0105241_10237992 | 3300009174 | Bacteria | 1538 |
| 260 | Ga0105241_10338577 | 3300009174 | Bacteria | 1303 |
| 261 | Ga0105242_10727790 | 3300009176 | Bacteria | 974 |
| 262 | Ga0105248_10159205 | 3300009177 | Bacteria | 2547 |
| 263 | Ga0105248_10213030 | 3300009177 | Bacteria | 2177 |
| 264 | Ga0105248_10438458 | 3300009177 | Bacteria | 1471 |
| 265 | Ga0105248_10613000 | 3300009177 | Bacteria | 1228 |
| 266 | Ga0105237_10081577 | 3300009545 | Bacteria | 3225 |
| 267 | Ga0105237_10698814 | 3300009545 | Bacteria | 1021 |
| 268 | Ga0105237_10761519 | 3300009545 | Bacteria | 975 |
| 269 | Ga0105237_11033300 | 3300009545 | Bacteria | 829 |
| 270 | Ga0105237_11171011 | 3300009545 | Bacteria | 775 |
| 271 | Ga0105238_10392011 | 3300009551 | Bacteria | 1381 |
| 272 | Ga0105238_11104047 | 3300009551 | Bacteria | 816 |
| 273 | Ga0105238_11236310 | 3300009551 | Bacteria | 772 |
| 274 | Ga0105238_11492689 | 3300009551 | Bacteria | 704 |
| 275 | Ga0105249_10004270 | 3300009553 | Bacteria | 12350 |
| 276 | Ga0105249_10028208 | 3300009553 | Bacteria | 5068 |
| 277 | Ga0105249_10229182 | 3300009553 | Bacteria | 1832 |
| 278 | Ga0099796_10221659 | 3300010159 | Bacteria | 775 |
| 279 | Ga0105239_10090083 | 3300010375 | Bacteria | 3384 |
| 280 | Ga0105239_10232065 | 3300010375 | Bacteria | 2070 |
| 281 | Ga0105239_10275749 | 3300010375 | Bacteria | 1892 |
| 282 | Ga0105239_10490657 | 3300010375 | Bacteria | 1396 |
| 283 | Ga0105239_11671595 | 3300010375 | Bacteria | 737 |
| 284 | Ga0105239_12058478 | 3300010375 | Bacteria | 663 |
| 285 | Ga0105246_10014135 | 3300011119 | Bacteria | 5016 |
| 286 | Ga0105246_10039960 | 3300011119 | Bacteria | 3163 |
| 287 | Ga0105246_10135193 | 3300011119 | Bacteria | 1847 |
| 288 | Ga0157345_1014652 | 3300012498 | Bacteria | 734 |
| 289 | Ga0157313_1017102 | 3300012503 | Bacteria | 700 |
| 290 | Ga0157371_10161044 | 3300013102 | Bacteria | 1603 |
| 291 | Ga0157370_10099137 | 3300013104 | Bacteria | 2731 |
| 292 | Ga0157369_10022887 | 3300013105 | Bacteria | 6968 |
| 293 | Ga0157369_10064206 | 3300013105 | Bacteria | 3955 |
| 294 | Ga0157369_10069772 | 3300013105 | Bacteria | 3775 |
| 295 | Ga0157369_10230424 | 3300013105 | Bacteria | 1937 |
| 296 | Ga0157374_10103930 | 3300013296 | Bacteria | 2727 |
| 297 | Ga0163162_11873604 | 3300013306 | Bacteria | 686 |
| 298 | Ga0157372_10235992 | 3300013307 | Bacteria | 2121 |
| 299 | Ga0157372_10245298 | 3300013307 | Bacteria | 2079 |
| 300 | Ga0157372_11321162 | 3300013307 | Bacteria | 832 |
| 301 | Ga0157372_11621896 | 3300013307 | Bacteria | 745 |
| 302 | Ga0157375_10054747 | 3300013308 | Bacteria | 3930 |
| 303 | Ga0157375_10373591 | 3300013308 | Bacteria | 1592 |
| 304 | Ga0157375_10547478 | 3300013308 | Bacteria | 1319 |
| 305 | Ga0157375_10563447 | 3300013308 | Bacteria | 1300 |
| 306 | Ga0163163_10018933 | 3300014325 | Bacteria | 6459 |
| 307 | Ga0163163_10067806 | 3300014325 | Bacteria | 3549 |
| 308 | Ga0163163_10426228 | 3300014325 | Bacteria | 1386 |
| 309 | Ga0157380_10014851 | 3300014326 | Bacteria | 5705 |
| 310 | Ga0157380_10117881 | 3300014326 | Bacteria | 2243 |
| 311 | Ga0157377_10036926 | 3300014745 | Bacteria | 2690 |
| 312 | Ga0157379_10107068 | 3300014968 | Bacteria | 2510 |
| 313 | Ga0157379_11048051 | 3300014968 | Bacteria | 779 |
| 314 | Ga0157376_10145645 | 3300014969 | Bacteria | 2130 |
| 315 | Ga0157376_10202067 | 3300014969 | Bacteria | 1829 |
| 316 | Ga0157376_10541882 | 3300014969 | Bacteria | 1150 |
| 317 | Ga0157376_10764702 | 3300014969 | Bacteria | 976 |
| 318 | Ga0182007_10105900 | 3300015262 | Bacteria | 933 |
| 319 | Ga0163161_10222085 | 3300017792 | Bacteria | 1463 |
| 320 | Ga0163161_10517304 | 3300017792 | Bacteria | 974 |
| 321 | Ga0206356_11422122 | 3300020070 | Bacteria | 730 |
| 322 | Ga0206353_10037471 | 3300020082 | Bacteria | 1478 |
| 323 | Ga0213872_10072452 | 3300021361 | Bacteria | 1552 |
| 324 | Ga0213874_10019910 | 3300021377 | Bacteria | 1833 |
| 325 | Ga0213876_10025319 | 3300021384 | Bacteria | 3131 |
| 326 | Ga0213876_10435210 | 3300021384 | Bacteria | 698 |
| 327 | Ga0213875_10000142 | 3300021388 | Bacteria | 77423 |
| 328 | Ga0213875_10072222 | 3300021388 | Bacteria | 1611 |
| 329 | Ga0213875_10099496 | 3300021388 | Bacteria | 1357 |
| 330 | Ga0213871_10025378 | 3300021441 | Bacteria | 1508 |
| 331 | Ga0224712_10200821 | 3300022467 | Bacteria | 906 |
| 332 | Ga0209677_100233 | 3300025253 | Bacteria | 39376 |
| 333 | Ga0209233_1001314 | 3300025261 | Bacteria | 9924 |
| 334 | Ga0209455_1006779 | 3300025272 | Bacteria | 3335 |
| 335 | Ga0209758_1001054 | 3300025297 | Bacteria | 36110 |
| 336 | Ga0209758_1002780 | 3300025297 | Bacteria | 17132 |
| 337 | Ga0209758_1005792 | 3300025297 | Bacteria | 9263 |
| 338 | Ga0207697_10014975 | 3300025315 | Bacteria | 3209 |
| 339 | Ga0207656_10013854 | 3300025321 | Bacteria | 3093 |
| 340 | Ga0207653_10065997 | 3300025885 | Bacteria | 1229 |
| 341 | Ga0207692_10001234 | 3300025898 | Bacteria | 9495 |
| 342 | Ga0207692_11037978 | 3300025898 | Bacteria | 542 |
| 343 | Ga0207642_10027613 | 3300025899 | Bacteria | 2325 |
| 344 | Ga0207710_10067924 | 3300025900 | Bacteria | 1629 |
| 345 | Ga0207688_10001188 | 3300025901 | Bacteria | 13447 |
| 346 | Ga0207680_10007109 | 3300025903 | Bacteria | 5441 |
| 347 | Ga0207647_10000809 | 3300025904 | Bacteria | 24246 |
| 348 | Ga0207647_10123044 | 3300025904 | Bacteria | 1529 |
| 349 | Ga0207647_10532394 | 3300025904 | Bacteria | 653 |
| 350 | Ga0207685_10177100 | 3300025905 | Bacteria | 986 |
| 351 | Ga0207699_10002060 | 3300025906 | Bacteria | 9495 |
| 352 | Ga0207699_10016926 | 3300025906 | Bacteria | 3824 |
| 353 | Ga0207699_10048973 | 3300025906 | Bacteria | 2485 |
| 354 | Ga0207699_10220046 | 3300025906 | Bacteria | 1296 |
| 355 | Ga0207699_10537179 | 3300025906 | Bacteria | 847 |
| 356 | Ga0207699_10620293 | 3300025906 | Bacteria | 788 |
| 357 | Ga0207645_10030737 | 3300025907 | Bacteria | 3460 |
| 358 | Ga0207645_10031831 | 3300025907 | Bacteria | 3391 |
| 359 | Ga0207645_10175169 | 3300025907 | Bacteria | 1407 |
| 360 | Ga0207643_10002016 | 3300025908 | Bacteria | 11209 |
| 361 | Ga0207705_10040190 | 3300025909 | Bacteria | 3353 |
| 362 | Ga0207705_10163730 | 3300025909 | Bacteria | 1672 |
| 363 | Ga0207705_10840494 | 3300025909 | Bacteria | 712 |
| 364 | Ga0207684_10211034 | 3300025910 | Bacteria | 1675 |
| 365 | Ga0207684_10495332 | 3300025910 | Bacteria | 1048 |
| 366 | Ga0207654_10050717 | 3300025911 | Bacteria | 2386 |
| 367 | Ga0207654_10132691 | 3300025911 | Bacteria | 1578 |
| 368 | Ga0207654_10876919 | 3300025911 | Bacteria | 650 |
| 369 | Ga0207707_10000639 | 3300025912 | Bacteria | 34565 |
| 370 | Ga0207707_10024022 | 3300025912 | Bacteria | 5330 |
| 371 | Ga0207707_10024564 | 3300025912 | Bacteria | 5274 |
| 372 | Ga0207707_10176437 | 3300025912 | Bacteria | 1867 |
| 373 | Ga0207695_10445138 | 3300025913 | Bacteria | 1179 |
| 374 | Ga0207695_10512086 | 3300025913 | Bacteria | 1082 |
| 375 | Ga0207695_11182799 | 3300025913 | Bacteria | 645 |
| 376 | Ga0207671_10079258 | 3300025914 | Bacteria | 2461 |
| 377 | Ga0207671_10524173 | 3300025914 | Bacteria | 945 |
| 378 | Ga0207671_10671466 | 3300025914 | Bacteria | 825 |
| 379 | Ga0207693_10008491 | 3300025915 | Bacteria | 8408 |
| 380 | Ga0207693_10018411 | 3300025915 | Bacteria | 5563 |
| 381 | Ga0207693_10091909 | 3300025915 | Bacteria | 2379 |
| 382 | Ga0207693_10184105 | 3300025915 | Bacteria | 1644 |
| 383 | Ga0207693_10240618 | 3300025915 | Bacteria | 1421 |
| 384 | Ga0207663_10022545 | 3300025916 | Bacteria | 3601 |
| 385 | Ga0207663_10109854 | 3300025916 | Bacteria | 1869 |
| 386 | Ga0207663_10206131 | 3300025916 | Bacteria | 1422 |
| 387 | Ga0207663_10725516 | 3300025916 | Bacteria | 788 |
| 388 | Ga0207663_10935281 | 3300025916 | Bacteria | 694 |
| 389 | Ga0207660_10069657 | 3300025917 | Bacteria | 2555 |
| 390 | Ga0207660_10183391 | 3300025917 | Bacteria | 1626 |
| 391 | Ga0207660_10454669 | 3300025917 | Bacteria | 1036 |
| 392 | Ga0207660_10458137 | 3300025917 | Bacteria | 1032 |
| 393 | Ga0207660_10521969 | 3300025917 | Bacteria | 964 |
| 394 | Ga0207660_10681471 | 3300025917 | Bacteria | 838 |
| 395 | Ga0207662_10001080 | 3300025918 | Bacteria | 12803 |
| 396 | Ga0207657_10021043 | 3300025919 | Bacteria | 6149 |
| 397 | Ga0207657_10065938 | 3300025919 | Bacteria | 3084 |
| 398 | Ga0207657_10570707 | 3300025919 | Bacteria | 884 |
| 399 | Ga0207657_10986939 | 3300025919 | Bacteria | 646 |
| 400 | Ga0207649_10015191 | 3300025920 | Bacteria | 4325 |
| 401 | Ga0207649_10858982 | 3300025920 | Bacteria | 710 |
| 402 | Ga0207652_10016814 | 3300025921 | Bacteria | 5978 |
| 403 | Ga0207652_10100694 | 3300025921 | Bacteria | 2551 |
| 404 | Ga0207652_10124141 | 3300025921 | Bacteria | 2299 |
| 405 | Ga0207652_10326519 | 3300025921 | Bacteria | 1385 |
| 406 | Ga0207652_10642824 | 3300025921 | Bacteria | 949 |
| 407 | Ga0207646_10975034 | 3300025922 | Bacteria | 750 |
| 408 | Ga0207681_10514019 | 3300025923 | Bacteria | 982 |
| 409 | Ga0207694_10073031 | 3300025924 | Bacteria | 2683 |
| 410 | Ga0207694_11273295 | 3300025924 | Bacteria | 622 |
| 411 | Ga0207650_10018934 | 3300025925 | Bacteria | 4837 |
| 412 | Ga0207687_10174581 | 3300025927 | Bacteria | 1660 |
| 413 | Ga0207687_10337779 | 3300025927 | Bacteria | 1224 |
| 414 | Ga0207687_10411633 | 3300025927 | Bacteria | 1114 |
| 415 | Ga0207687_11153296 | 3300025927 | Bacteria | 666 |
| 416 | Ga0207700_10000623 | 3300025928 | Bacteria | 20712 |
| 417 | Ga0207700_10002691 | 3300025928 | Bacteria | 10243 |
| 418 | Ga0207700_10032084 | 3300025928 | Bacteria | 3741 |
| 419 | Ga0207700_10062218 | 3300025928 | Bacteria | 2834 |
| 420 | Ga0207700_10065543 | 3300025928 | Bacteria | 2772 |
| 421 | Ga0207700_10166474 | 3300025928 | Bacteria | 1835 |
| 422 | Ga0207700_10178009 | 3300025928 | Bacteria | 1779 |
| 423 | Ga0207700_10836562 | 3300025928 | Bacteria | 823 |
| 424 | Ga0207664_10014641 | 3300025929 | Bacteria | 5672 |
| 425 | Ga0207664_10056194 | 3300025929 | Bacteria | 3126 |
| 426 | Ga0207664_10089570 | 3300025929 | Bacteria | 2520 |
| 427 | Ga0207664_10102398 | 3300025929 | Bacteria | 2368 |
| 428 | Ga0207664_10505021 | 3300025929 | Bacteria | 1083 |
| 429 | Ga0207644_10010824 | 3300025931 | Bacteria | 6021 |
| 430 | Ga0207644_10074843 | 3300025931 | Bacteria | 2486 |
| 431 | Ga0207644_10214235 | 3300025931 | Bacteria | 1524 |
| 432 | Ga0207644_10534492 | 3300025931 | Bacteria | 969 |
| 433 | Ga0207690_10390622 | 3300025932 | Bacteria | 1108 |
| 434 | Ga0207706_10010401 | 3300025933 | Bacteria | 8498 |
| 435 | Ga0207686_10038933 | 3300025934 | Bacteria | 2881 |
| 436 | Ga0207686_10911224 | 3300025934 | Bacteria | 710 |
| 437 | Ga0207709_10032144 | 3300025935 | Bacteria | 3071 |
| 438 | Ga0207709_10195654 | 3300025935 | Bacteria | 1440 |
| 439 | Ga0207670_10025786 | 3300025936 | Bacteria | 3695 |
| 440 | Ga0207669_10003777 | 3300025937 | Bacteria | 6583 |
| 441 | Ga0207704_10102839 | 3300025938 | Bacteria | 1909 |
| 442 | Ga0207665_10035299 | 3300025939 | Bacteria | 3319 |
| 443 | Ga0207665_10184037 | 3300025939 | Bacteria | 1514 |
| 444 | Ga0207665_10614057 | 3300025939 | Bacteria | 850 |
| 445 | Ga0207691_10006467 | 3300025940 | Bacteria | 11318 |
| 446 | Ga0207691_10046117 | 3300025940 | Bacteria | 4007 |
| 447 | Ga0207689_10008692 | 3300025942 | Bacteria | 8836 |
| 448 | Ga0207689_10010839 | 3300025942 | Bacteria | 7841 |
| 449 | Ga0207689_10491736 | 3300025942 | Bacteria | 1027 |
| 450 | Ga0207661_10000597 | 3300025944 | Bacteria | 23061 |
| 451 | Ga0207661_10003825 | 3300025944 | Bacteria | 10498 |
| 452 | Ga0207661_10022549 | 3300025944 | Bacteria | 4745 |
| 453 | Ga0207661_10325478 | 3300025944 | Bacteria | 1383 |
| 454 | Ga0207679_10097968 | 3300025945 | Bacteria | 2285 |
| 455 | Ga0207679_10140050 | 3300025945 | Bacteria | 1954 |
| 456 | Ga0207679_10321797 | 3300025945 | Bacteria | 1339 |
| 457 | Ga0207679_10365183 | 3300025945 | Bacteria | 1262 |
| 458 | Ga0207667_10225941 | 3300025949 | Bacteria | 1918 |
| 459 | Ga0207667_10583989 | 3300025949 | Bacteria | 1128 |
| 460 | Ga0207667_10738197 | 3300025949 | Bacteria | 985 |
| 461 | Ga0207651_10046240 | 3300025960 | Bacteria | 2925 |
| 462 | Ga0207651_10184467 | 3300025960 | Bacteria | 1658 |
| 463 | Ga0207712_10011451 | 3300025961 | Bacteria | 5649 |
| 464 | Ga0207712_10023661 | 3300025961 | Bacteria | 4058 |
| 465 | Ga0207712_10041247 | 3300025961 | Bacteria | 3171 |
| 466 | Ga0207712_10067877 | 3300025961 | Bacteria | 2553 |
| 467 | Ga0207668_10052089 | 3300025972 | Bacteria | 2830 |
| 468 | Ga0207668_10278635 | 3300025972 | Bacteria | 1370 |
| 469 | Ga0207668_10360991 | 3300025972 | Bacteria | 1217 |
| 470 | Ga0207640_10022181 | 3300025981 | Bacteria | 3796 |
| 471 | Ga0207640_10470771 | 3300025981 | Bacteria | 1040 |
| 472 | Ga0207640_10742946 | 3300025981 | Bacteria | 845 |
| 473 | Ga0207658_10079632 | 3300025986 | Bacteria | 2507 |
| 474 | Ga0207658_10988698 | 3300025986 | Bacteria | 767 |
| 475 | Ga0207677_10034211 | 3300026023 | Bacteria | 3289 |
| 476 | Ga0207677_10179835 | 3300026023 | Bacteria | 1663 |
| 477 | Ga0207703_10053829 | 3300026035 | Bacteria | 3271 |
| 478 | Ga0207703_10131795 | 3300026035 | Bacteria | 2159 |
| 479 | Ga0207703_10172458 | 3300026035 | Bacteria | 1904 |
| 480 | Ga0207703_10761331 | 3300026035 | Bacteria | 923 |
| 481 | Ga0207703_11489347 | 3300026035 | Bacteria | 651 |
| 482 | Ga0207639_10133372 | 3300026041 | Bacteria | 2059 |
| 483 | Ga0207639_10187867 | 3300026041 | Bacteria | 1763 |
| 484 | Ga0207639_10458548 | 3300026041 | Bacteria | 1158 |
| 485 | Ga0207639_11258065 | 3300026041 | Bacteria | 694 |
| 486 | Ga0207678_10010726 | 3300026067 | Bacteria | 8050 |
| 487 | Ga0207678_10020068 | 3300026067 | Bacteria | 5871 |
| 488 | Ga0207678_10070164 | 3300026067 | Bacteria | 3004 |
| 489 | Ga0207708_10002263 | 3300026075 | Bacteria | 14186 |
| 490 | Ga0207708_10516008 | 3300026075 | Bacteria | 1003 |
| 491 | Ga0207702_10083084 | 3300026078 | Bacteria | 2786 |
| 492 | Ga0207702_10191539 | 3300026078 | Bacteria | 1890 |
| 493 | Ga0207702_10487189 | 3300026078 | Bacteria | 1201 |
| 494 | Ga0207702_11162830 | 3300026078 | Bacteria | 766 |
| 495 | Ga0207702_11334269 | 3300026078 | Bacteria | 711 |
| 496 | Ga0207641_10962213 | 3300026088 | Bacteria | 849 |
| 497 | Ga0207648_10002178 | 3300026089 | Bacteria | 21254 |
| 498 | Ga0207676_10006683 | 3300026095 | Bacteria | 8159 |
| 499 | Ga0207676_10270545 | 3300026095 | Bacteria | 1538 |
| 500 | Ga0207676_11540864 | 3300026095 | Bacteria | 662 |
| 501 | Ga0207674_10133883 | 3300026116 | Bacteria | 2441 |
| 502 | Ga0207674_10524482 | 3300026116 | Bacteria | 1144 |
| 503 | Ga0207674_10578941 | 3300026116 | Bacteria | 1084 |
| 504 | Ga0207674_12039257 | 3300026116 | Bacteria | 538 |
| 505 | Ga0207675_100003923 | 3300026118 | Bacteria | 14440 |
| 506 | Ga0207675_100071818 | 3300026118 | Bacteria | 3236 |
| 507 | Ga0207683_10004860 | 3300026121 | Bacteria | 11570 |
| 508 | Ga0207698_10268494 | 3300026142 | Bacteria | 1571 |
| 509 | Ga0207698_10443641 | 3300026142 | Bacteria | 1251 |
| 510 | Ga0207698_10776097 | 3300026142 | Bacteria | 959 |
| 511 | Ga0209813_10002805 | 3300027866 | Bacteria | 4027 |
| 512 | Ga0268266_10110942 | 3300028379 | Bacteria | 2430 |
| 513 | Ga0268266_10214036 | 3300028379 | Bacteria | 1768 |
| 514 | Ga0268266_10260572 | 3300028379 | Bacteria | 1607 |
| 515 | Ga0268266_10390138 | 3300028379 | Bacteria | 1315 |
| 516 | Ga0268265_10473920 | 3300028380 | Bacteria | 1174 |
| 517 | Ga0268265_10538904 | 3300028380 | Bacteria | 1106 |
| 518 | Ga0268265_10816259 | 3300028380 | Bacteria | 910 |
| 519 | Ga0268264_10078980 | 3300028381 | Bacteria | 2806 |
| 520 | Ga0268264_11813193 | 3300028381 | Bacteria | 620 |
| 521 | Ga0265338_10762236 | 3300028800 | Bacteria | 665 |
| 522 | Ga0265325_10001902 | 3300031241 | Bacteria | 14413 |
| 523 | Ga0265325_10266842 | 3300031241 | Bacteria | 771 |
| 524 | Ga0265340_10146059 | 3300031247 | Bacteria | 1080 |
| 525 | Ga0265339_10011190 | 3300031249 | Bacteria | 5537 |
| 526 | Ga0265339_10283160 | 3300031249 | Bacteria | 794 |
| 527 | Ga0265316_10778452 | 3300031344 | Bacteria | 672 |
| 528 | Ga0307408_100103881 | 3300031548 | Bacteria | 2170 |
| 529 | Ga0307408_100282708 | 3300031548 | Bacteria | 1382 |
| 530 | Ga0265314_10011237 | 3300031711 | Bacteria | 7409 |
| 531 | Ga0307405_11793061 | 3300031731 | Bacteria | 545 |
| 532 | Ga0307406_10213010 | 3300031901 | Bacteria | 1431 |
| 533 | Ga0307407_10299857 | 3300031903 | Bacteria | 1120 |
| 534 | Ga0307412_10323819 | 3300031911 | Bacteria | 1227 |
| 535 | Ga0307412_10405536 | 3300031911 | Bacteria | 1111 |
| 536 | Ga0307416_100258607 | 3300032002 | Bacteria | 1700 |
| 537 | Ga0307416_101000808 | 3300032002 | Bacteria | 939 |
| 538 | Ga0307411_10480763 | 3300032005 | Bacteria | 1046 |
| 539 | Ga0316215_1000679 | 3300033544 | Bacteria | 3530 |
| 540 | Ga0373958_0102780 | 3300034819 | Bacteria | 672 |
| 541 | Ga0373958_0108207 | 3300034819 | Bacteria | 660 |
| 542 | Ga0373959_0010924 | 3300034820 | Bacteria | 1595 |
| 543 | Ga0373938_0003602 | 3300034957 | Bacteria | 2552 |
| 544 | Ga0373934_0030845 | 3300035086 | Bacteria | 2098 |
| 545 | Ga0373952_0046289 | 3300035092 | Bacteria | 1022 |
| 546 | Ga0373923_0050621 | 3300035111 | Bacteria | 1740 |
| 547 | Ga0373923_0108821 | 3300035111 | Bacteria | 1229 |
| 548 | Ga0373932_0248012 | 3300035112 | Bacteria | 649 |
| 549 | Ga0373936_0012238 | 3300035113 | Bacteria | 3261 |
| 550 | Ga0373936_0012556 | 3300035113 | Bacteria | 3225 |
| 551 | Ga0373936_0217644 | 3300035113 | Bacteria | 846 |
| 552 | Ga0373941_0000578 | 3300035115 | Bacteria | 7374 |
| 553 | Ga0373941_0022048 | 3300035115 | Bacteria | 1804 |
| 554 | Ga0373945_0263175 | 3300035116 | Bacteria | 731 |
| 555 | Ga0373953_0193641 | 3300035117 | Bacteria | 878 |
| 556 | Ga0373953_0208203 | 3300035117 | Bacteria | 846 |
| 557 | Ga0373954_0010065 | 3300035118 | Bacteria | 4166 |
| 558 | Ga0373954_0235116 | 3300035118 | Bacteria | 902 |
| 559 | Ga0373954_0599989 | 3300035118 | Bacteria | 546 |
| 560 | Ga0373956_0009126 | 3300035119 | Bacteria | 4022 |
| 561 | Ga0373956_0035874 | 3300035119 | Bacteria | 2188 |
| 562 | Ga0373960_0005392 | 3300035121 | Bacteria | 2960 |
| 563 | Ga0373943_0006929 | 3300035170 | Bacteria | 5085 |
| 564 | Ga0373943_0296331 | 3300035170 | Bacteria | 917 |
| 565 | Ga0373946_0091900 | 3300035171 | Bacteria | 1346 |
| 566 | Ga0373946_0345272 | 3300035171 | Bacteria | 743 |
| 567 | Ga0373955_0004730 | 3300035172 | Bacteria | 6053 |
| 568 | Ga0373955_0268436 | 3300035172 | Bacteria | 1025 |
| 569 | Ga0373955_0553508 | 3300035172 | Bacteria | 704 |
| 570 | Ga0373962_0003173 | 3300035242 | Bacteria | 3942 |
| 571 | Ga0373924_0083274 | 3300035410 | Bacteria | 1362 |
| 572 | Ga0373931_0007687 | 3300035691 | Bacteria | 5088 |
| 573 | Ga0373931_0184041 | 3300035691 | Bacteria | 1239 |
| 574 | Ga0373935_0190125 | 3300035692 | Bacteria | 1414 |
| 575 | Ga0373927_0026537 | 3300035695 | Bacteria | 3786 |
| 576 | Ga0373927_0086107 | 3300035695 | Bacteria | 2039 |
| 577 | Ga0373927_0088015 | 3300035695 | Bacteria | 2016 |
| 578 | Ga0373933_0000964 | 3300035724 | Bacteria | 17534 |
| 579 | Ga0373933_0112940 | 3300035724 | Bacteria | 1696 |
| 580 | Ga0373933_0149844 | 3300035724 | Bacteria | 1477 |
| 581 | Ga0373947_0013134 | 3300035725 | Bacteria | 4748 |
| 582 | Ga0373947_0019419 | 3300035725 | Bacteria | 3918 |
| 583 | Ga0373937_0004681 | 3300036401 | Bacteria | 11629 |
| 584 | Ga0373937_0089005 | 3300036401 | Bacteria | 2858 |
| 585 | Ga0372808_001650 | 3300036459 | Bacteria | 2381 |
| 586 | Ga0373925_0004333 | 3300037068 | Bacteria | 10734 |
| 587 | Ga0373925_0117436 | 3300037068 | Bacteria | 2062 |
| 588 | Ga0373925_0742516 | 3300037068 | Bacteria | 809 |
| 589 | Ga0373925_0812531 | 3300037068 | Bacteria | 771 |
| 590 | Ga0395899_0014008 | 3300037312 | Bacteria | 6122 |
| 591 | Ga0395899_0022031 | 3300037312 | Bacteria | 4832 |
| 592 | Ga0395899_0360095 | 3300037312 | Bacteria | 971 |
| 593 | Ga0395899_0464771 | 3300037312 | Bacteria | 826 |
| 594 | Ga0395900_0014973 | 3300037418 | Bacteria | 7904 |
| 595 | Ga0395900_0082575 | 3300037418 | Bacteria | 3301 |
| 596 | Ga0395900_0108769 | 3300037418 | Bacteria | 2848 |
| 597 | Ga0395900_0148637 | 3300037418 | Bacteria | 2395 |
| 598 | Ga0395900_0220560 | 3300037418 | Bacteria | 1911 |
| 599 | Ga0395900_0249867 | 3300037418 | Bacteria | 1775 |
| 600 | Ga0395900_0354159 | 3300037418 | Bacteria | 1441 |
| 601 | Ga0395898_0007428 | 3300037466 | Bacteria | 11633 |
| 602 | Ga0395898_0060527 | 3300037466 | Bacteria | 3680 |
| 603 | Ga0395898_0060705 | 3300037466 | Bacteria | 3674 |
| 604 | Ga0395898_0075786 | 3300037466 | Bacteria | 3248 |
| 605 | Ga0395898_0095429 | 3300037466 | Bacteria | 2857 |
| 606 | Ga0395898_0254403 | 3300037466 | Bacteria | 1675 |
| 607 | Ga0395898_1218030 | 3300037466 | Bacteria | 684 |
| 608 | Ga0395905_0240916 | 3300037471 | Bacteria | 1690 |
| 609 | Ga0436364_0419251 | 3300037853 | Bacteria | 3511 |
| 610 | Ga0436364_0634277 | 3300037853 | Bacteria | 5458 |
| 611 | Ga0436364_1319713 | 3300037853 | Bacteria | 1689 |
| 612 | Ga0436364_1465979 | 3300037853 | Bacteria | 23307 |
| 613 | Ga0395901_0020070 | 3300038443 | Bacteria | 6838 |
| 614 | Ga0395901_0037019 | 3300038443 | Bacteria | 5046 |
| 615 | Ga0395901_0124591 | 3300038443 | Bacteria | 2708 |
| 616 | Ga0395901_0168056 | 3300038443 | Bacteria | 2302 |
| 617 | Ga0395901_0409511 | 3300038443 | Bacteria | 1392 |
| 618 | Ga0395901_0688629 | 3300038443 | Bacteria | 1021 |
| 619 | Ga0395901_1561973 | 3300038443 | Bacteria | 614 |
| 620 | Ga0436365_0531841 | 3300039437 | Bacteria | 636 |
| 621 | Ga0436365_0787752 | 3300039437 | Bacteria | 4585 |
| 622 | Ga0436365_1437293 | 3300039437 | Bacteria | 2335 |
| 623 | Ga0436365_1465346 | 3300039437 | Bacteria | 1047 |
| 624 | Ga0436365_1623170 | 3300039437 | Bacteria | 1737 |
| 625 | Ga0436365_1681445 | 3300039437 | Bacteria | 787 |
| 626 | Ga0436365_1706766 | 3300039437 | Bacteria | 711 |
| 627 | Ga0436365_1709481 | 3300039437 | Bacteria | 1760 |
| 628 | Ga0436360_0172693 | 3300039438 | Bacteria | 3825 |
| 629 | Ga0436360_0707092 | 3300039438 | Bacteria | 954 |
| 630 | Ga0436361_0063482 | 3300039447 | Bacteria | 648 |
| 631 | Ga0436361_0386711 | 3300039447 | Bacteria | 3504 |
| 632 | Ga0436361_0773244 | 3300039447 | Bacteria | 2204 |
| 633 | Ga0436363_0035196 | 3300039450 | Bacteria | 3554 |
| 634 | Ga0436363_0411146 | 3300039450 | Bacteria | 1016 |
| 635 | Ga0436363_0533424 | 3300039450 | Bacteria | 1767 |
| 636 | Ga0436363_0802989 | 3300039450 | Bacteria | 633 |
| 637 | Ga0436363_0819011 | 3300039450 | Bacteria | 905 |
| 638 | Ga0436363_1049939 | 3300039450 | Bacteria | 2073 |
| 639 | Ga0451789_0127710 | 3300041443 | Bacteria | 1369 |
| 640 | Ga0451791_1805681 | 3300041451 | Bacteria | 591 |
| 641 | Ga0451793_0888562 | 3300041452 | Bacteria | 934 |
| 642 | Ga0451797_0233450 | 3300041453 | Bacteria | 982 |
| 643 | Ga0451800_1372925 | 3300041459 | Bacteria | 1533 |
| 644 | Ga0451807_0669418 | 3300041486 | Bacteria | 912 |
| 645 | Ga0451807_1700963 | 3300041486 | Bacteria | 567 |
| 646 | Ga0451833_1352607 | 3300041491 | Bacteria | 1108 |
| 647 | Ga0451839_0986530 | 3300041496 | Bacteria | 1223 |
| 648 | Ga0451841_0715077 | 3300041498 | Bacteria | 1407 |
| 649 | Ga0451843_0408316 | 3300041509 | Bacteria | 852 |
| 650 | Ga0451855_0428041 | 3300041511 | Bacteria | 575 |
| 651 | Ga0451853_0421108 | 3300041512 | Bacteria | 1038 |
| 652 | Ga0451853_1968490 | 3300041512 | Bacteria | 569 |
| 653 | Ga0439449_0209599 | 3300042007 | Bacteria | 730 |
| 654 | Ga0439458_0092731 | 3300042157 | Bacteria | 779 |
| 655 | Ga0439458_0139370 | 3300042157 | Bacteria | 646 |
| 656 | Ga0439434_0070879 | 3300042435 | Bacteria | 1097 |
| 657 | Ga0466969_0168614 | 3300044656 | Bacteria | 1004 |
| 658 | Ga0466969_0510267 | 3300044656 | Bacteria | 549 |
| 659 | Ga0466965_0339797 | 3300044683 | Bacteria | 821 |
| 660 | Ga0466966_0202043 | 3300044684 | Bacteria | 1202 |
| 661 | Ga0466966_0209289 | 3300044684 | Bacteria | 1179 |
| 662 | Ga0466963_0088861 | 3300044694 | Bacteria | 2102 |
| 663 | Ga0466963_0137523 | 3300044694 | Bacteria | 1691 |
| 664 | Ga0466964_0020730 | 3300044706 | Bacteria | 2534 |
| 665 | Ga0466964_0455000 | 3300044706 | Bacteria | 679 |
| 666 | Ga0466968_0174337 | 3300044735 | Bacteria | 998 |
| 667 | Ga0466968_0731686 | 3300044735 | Bacteria | 507 |
| 668 | Ga0466970_0165229 | 3300044765 | Bacteria | 1225 |
| 669 | Ga0466970_0279239 | 3300044765 | Bacteria | 939 |
| 670 | Ga0466957_0031026 | 3300044842 | Bacteria | 3193 |
| 671 | Ga0466959_0294799 | 3300045049 | Bacteria | 1111 |
| 672 | Ga0466959_0646560 | 3300045049 | Bacteria | 710 |
| 673 | Ga0451576_0947692 | 3300045051 | Bacteria | 903 |
| 674 | Ga0466958_0797522 | 3300045836 | Bacteria | 616 |
| 675 | Ga0466967_0399194 | 3300045976 | Bacteria | 1337 |
| 676 | Ga0466967_0842035 | 3300045976 | Bacteria | 911 |
| 677 | Ga0495617_084425 | 3300046452 | Bacteria | 1039 |
| 678 | Ga0495627_104886 | 3300046453 | Bacteria | 805 |
| 679 | Ga0495592_0026114 | 3300046454 | Bacteria | 4431 |
| 680 | Ga0495592_0129527 | 3300046454 | Bacteria | 1766 |
| 681 | Ga0495592_0213048 | 3300046454 | Bacteria | 1296 |
| 682 | Ga0495603_0040174 | 3300046455 | Bacteria | 2801 |
| 683 | Ga0495603_0083928 | 3300046455 | Bacteria | 1865 |
| 684 | Ga0495603_0168829 | 3300046455 | Bacteria | 1267 |
| 685 | Ga0495590_0197288 | 3300046457 | Bacteria | 739 |
| 686 | Ga0495590_0220895 | 3300046457 | Bacteria | 700 |
| 687 | Ga0495629_0000026 | 3300046459 | Bacteria | 134719 |
| 688 | Ga0495629_0161770 | 3300046459 | Bacteria | 1555 |
| 689 | Ga0495641_0017870 | 3300046461 | Bacteria | 3677 |
| 690 | Ga0495641_0394580 | 3300046461 | Bacteria | 628 |
| 691 | Ga0495651_0133048 | 3300046462 | Bacteria | 1813 |
| 692 | Ga0495651_0158273 | 3300046462 | Bacteria | 1625 |
| 693 | Ga0495651_0757089 | 3300046462 | Bacteria | 602 |
| 694 | Ga0495653_0157631 | 3300046463 | Bacteria | 1579 |
| 695 | Ga0495580_0544726 | 3300046472 | Bacteria | 771 |
| 696 | Ga0495582_0006073 | 3300046473 | Bacteria | 6730 |
| 697 | Ga0495582_0061701 | 3300046473 | Bacteria | 2070 |
| 698 | Ga0495605_0049578 | 3300046474 | Bacteria | 2051 |
| 699 | Ga0495605_0050049 | 3300046474 | Bacteria | 2039 |
| 700 | Ga0495605_0094492 | 3300046474 | Bacteria | 1381 |
| 701 | Ga0495639_0078976 | 3300046475 | Bacteria | 1530 |
| 702 | Ga0495662_0017465 | 3300046476 | Bacteria | 3472 |
| 703 | Ga0495664_0012897 | 3300046477 | Bacteria | 4736 |
| 704 | Ga0495664_0042373 | 3300046477 | Bacteria | 2695 |
| 705 | Ga0495584_0080654 | 3300046491 | Bacteria | 1637 |
| 706 | Ga0495584_0468468 | 3300046491 | Bacteria | 641 |
| 707 | Ga0495585_0122722 | 3300046492 | Bacteria | 1373 |
| 708 | Ga0495594_0033206 | 3300046499 | Bacteria | 2804 |
| 709 | Ga0495594_0190016 | 3300046499 | Bacteria | 1170 |
| 710 | Ga0495607_0177826 | 3300046501 | Bacteria | 1069 |
| 711 | Ga0495583_0128608 | 3300046506 | Bacteria | 1061 |
| 712 | Ga0495606_0013747 | 3300046507 | Bacteria | 6371 |
| 713 | Ga0495606_0036782 | 3300046507 | Bacteria | 3331 |
| 714 | Ga0495606_0202643 | 3300046507 | Bacteria | 1129 |
| 715 | Ga0495608_0156305 | 3300046511 | Bacteria | 1451 |
| 716 | Ga0495608_0327791 | 3300046511 | Bacteria | 945 |
| 717 | Ga0495610_0072151 | 3300046512 | Bacteria | 1608 |
| 718 | Ga0495616_0071592 | 3300046513 | Bacteria | 1676 |
| 719 | Ga0495616_0086636 | 3300046513 | Bacteria | 1489 |
| 720 | Ga0495616_0152852 | 3300046513 | Bacteria | 1043 |
| 721 | Ga0495618_0285470 | 3300046514 | Bacteria | 1028 |
| 722 | Ga0495620_0092004 | 3300046515 | Bacteria | 1216 |
| 723 | Ga0495628_0137002 | 3300046516 | Bacteria | 1870 |
| 724 | Ga0495628_0537140 | 3300046516 | Bacteria | 841 |
| 725 | Ga0495630_0105716 | 3300046517 | Bacteria | 2131 |
| 726 | Ga0495632_0058796 | 3300046519 | Bacteria | 1872 |
| 727 | Ga0495632_0067688 | 3300046519 | Bacteria | 1722 |
| 728 | Ga0495632_0438603 | 3300046519 | Bacteria | 567 |
| 729 | Ga0495637_0160430 | 3300046520 | Bacteria | 844 |
| 730 | Ga0495643_0004188 | 3300046522 | Bacteria | 10224 |
| 731 | Ga0495643_0117339 | 3300046522 | Bacteria | 1348 |
| 732 | Ga0495666_0231310 | 3300046526 | Bacteria | 845 |
| 733 | Ga0495652_0041488 | 3300046529 | Bacteria | 3972 |
| 734 | Ga0495665_0080877 | 3300046531 | Bacteria | 1708 |
| 735 | Ga0495640_0025055 | 3300046533 | Bacteria | 4333 |
| 736 | Ga0495587_0249716 | 3300046536 | Bacteria | 997 |
| 737 | Ga0495587_0297520 | 3300046536 | Bacteria | 903 |
| 738 | Ga0495598_0136058 | 3300046537 | Bacteria | 846 |
| 739 | Ga0495609_0142037 | 3300046538 | Bacteria | 1024 |
| 740 | Ga0495621_0025785 | 3300046539 | Bacteria | 1978 |
| 741 | Ga0495622_0131374 | 3300046557 | Bacteria | 1140 |
| 742 | Ga0495667_0171847 | 3300046559 | Bacteria | 1392 |
| 743 | Ga0495656_0059991 | 3300046615 | Bacteria | 1656 |
| 744 | Ga0495634_0029686 | 3300046642 | Bacteria | 3784 |
| 745 | Ga0495611_0153748 | 3300046648 | Bacteria | 1074 |
| 746 | Ga0495635_0042880 | 3300046663 | Bacteria | 3123 |
| 747 | Ga0495659_0155873 | 3300046664 | Bacteria | 919 |
| 748 | Ga0495661_0110146 | 3300046665 | Bacteria | 1536 |
| 749 | Ga0495661_0125659 | 3300046665 | Bacteria | 1412 |
| 750 | Ga0495588_0046148 | 3300046674 | Bacteria | 2234 |
| 751 | Ga0495588_0063074 | 3300046674 | Bacteria | 1921 |
| 752 | Ga0495657_0507571 | 3300046675 | Bacteria | 703 |
| 753 | Ga0495599_0025746 | 3300046678 | Bacteria | 3685 |
| 754 | Ga0495623_0045525 | 3300046679 | Bacteria | 2787 |
| 755 | Ga0495623_0194097 | 3300046679 | Bacteria | 1171 |
| 756 | Ga0495646_0038559 | 3300046680 | Bacteria | 2949 |
| 757 | Ga0495647_0238377 | 3300046681 | Bacteria | 807 |
| 758 | Ga0495658_0004213 | 3300046683 | Bacteria | 7076 |
| 759 | Ga0495658_0004396 | 3300046683 | Bacteria | 6940 |
| 760 | Ga0495669_0199262 | 3300046684 | Bacteria | 957 |
| 761 | Ga0495613_0003849 | 3300046689 | Bacteria | 11230 |
| 762 | Ga0495613_0250127 | 3300046689 | Bacteria | 1237 |
| 763 | Ga0495624_0278865 | 3300046690 | Bacteria | 1009 |
| 764 | Ga0495671_0095070 | 3300046692 | Bacteria | 1458 |
| 765 | Ga0495589_0239870 | 3300046794 | Bacteria | 849 |
| 766 | Ga0495589_0263572 | 3300046794 | Bacteria | 803 |
| 767 | Ga0495589_0321797 | 3300046794 | Bacteria | 715 |
| 768 | Ga0495600_0146398 | 3300046809 | Bacteria | 1531 |
| 769 | Ga0495581_0096406 | 3300047315 | Bacteria | 1717 |
| 770 | Ga0495581_0545244 | 3300047315 | Bacteria | 673 |
| 771 | Ga0495604_0123964 | 3300047317 | Bacteria | 1866 |
| 772 | Ga0495604_0583575 | 3300047317 | Bacteria | 718 |
| 773 | Ga0495674_0010664 | 3300047319 | Bacteria | 8696 |
| 774 | Ga0495674_0320052 | 3300047319 | Bacteria | 1264 |
| 775 | Ga0495672_0017843 | 3300047320 | Bacteria | 4734 |
| 776 | Ga0495676_0029124 | 3300047321 | Bacteria | 4704 |
| 777 | Ga0495676_0124171 | 3300047321 | Bacteria | 1873 |
| 778 | Ga0495676_0191915 | 3300047321 | Bacteria | 1424 |
| 779 | Ga0495676_0269104 | 3300047321 | Bacteria | 1157 |
| 780 | Ga0495680_0096668 | 3300047322 | Bacteria | 2205 |
| 781 | Ga0495680_0955569 | 3300047322 | Bacteria | 550 |
| 782 | Ga0495683_0189085 | 3300047323 | Bacteria | 935 |
| 783 | Ga0495687_005489 | 3300047443 | Bacteria | 8057 |
| 784 | Ga0495684_0565957 | 3300047471 | Bacteria | 772 |
| 785 | Ga0495593_0127162 | 3300047673 | Bacteria | 1295 |
| 786 | Ga0495602_0029536 | 3300048088 | Bacteria | 5217 |
| 787 | Ga0495626_0224603 | 3300048091 | Bacteria | 762 |
| 788 | Ga0496100_0073041 | 3300048903 | Bacteria | 2294 |
| 789 | Ga0496100_0097342 | 3300048903 | Bacteria | 2020 |
| 790 | Ga0496100_0197458 | 3300048903 | Bacteria | 1464 |
| 791 | Ga0496100_0274746 | 3300048903 | Bacteria | 1254 |
| 792 | Ga0496100_0347749 | 3300048903 | Bacteria | 1119 |
| 793 | Ga0496100_0661330 | 3300048903 | Bacteria | 814 |
| 794 | Ga0496101_0045702 | 3300048904 | Bacteria | 3138 |
| 795 | Ga0496101_0080417 | 3300048904 | Bacteria | 2407 |
| 796 | Ga0496101_0130721 | 3300048904 | Bacteria | 1906 |
| 797 | Ga0496101_0541240 | 3300048904 | Bacteria | 921 |
| 798 | Ga0496102_0009072 | 3300048905 | Bacteria | 8533 |
| 799 | Ga0496102_0033286 | 3300048905 | Bacteria | 4630 |
| 800 | Ga0496102_0253173 | 3300048905 | Bacteria | 1660 |
| 801 | Ga0496103_0004573 | 3300048906 | Bacteria | 8381 |
| 802 | Ga0496103_0030056 | 3300048906 | Bacteria | 3304 |
| 803 | Ga0496103_0060685 | 3300048906 | Bacteria | 2350 |
| 804 | Ga0496104_0051086 | 3300048907 | Bacteria | 3901 |
| 805 | Ga0496104_0054081 | 3300048907 | Bacteria | 3794 |
| 806 | Ga0496104_0126679 | 3300048907 | Bacteria | 2452 |
| 807 | Ga0496104_1092601 | 3300048907 | Bacteria | 701 |
| 808 | Ga0496105_0016436 | 3300048908 | Bacteria | 5910 |
| 809 | Ga0496105_0037583 | 3300048908 | Bacteria | 3987 |
| 810 | Ga0496105_0074130 | 3300048908 | Bacteria | 2811 |
| 811 | Ga0496105_0075164 | 3300048908 | Bacteria | 2790 |
| 812 | Ga0496105_0154331 | 3300048908 | Bacteria | 1886 |
| 813 | Ga0496105_0445720 | 3300048908 | Bacteria | 1022 |
| 814 | Ga0496105_0493511 | 3300048908 | Bacteria | 962 |
| 815 | Ga0496106_0003696 | 3300048909 | Bacteria | 11413 |
| 816 | Ga0496106_0009424 | 3300048909 | Bacteria | 7218 |
| 817 | Ga0496106_0037654 | 3300048909 | Bacteria | 3619 |
| 818 | Ga0496106_0052883 | 3300048909 | Bacteria | 3065 |
| 819 | Ga0496106_0237110 | 3300048909 | Bacteria | 1457 |
| 820 | Ga0496106_0541949 | 3300048909 | Bacteria | 934 |
| 821 | Ga0496107_0029043 | 3300048910 | Bacteria | 3932 |
| 822 | Ga0496107_0035247 | 3300048910 | Bacteria | 3587 |
| 823 | Ga0496107_0107375 | 3300048910 | Bacteria | 2050 |
| 824 | Ga0496107_0252868 | 3300048910 | Bacteria | 1311 |
| 825 | Ga0496107_0557387 | 3300048910 | Bacteria | 848 |
| 826 | Ga0496108_0003416 | 3300048911 | Bacteria | 12751 |
| 827 | Ga0496108_0018377 | 3300048911 | Bacteria | 5724 |
| 828 | Ga0496108_0128469 | 3300048911 | Bacteria | 2177 |
| 829 | Ga0496108_0370162 | 3300048911 | Bacteria | 1251 |
| 830 | Ga0496108_1335158 | 3300048911 | Bacteria | 602 |
| 831 | Ga0496109_0000230 | 3300048912 | Bacteria | 54618 |
| 832 | Ga0496109_0122275 | 3300048912 | Bacteria | 2425 |
| 833 | Ga0496109_0296021 | 3300048912 | Bacteria | 1526 |
| 834 | Ga0496109_0403397 | 3300048912 | Bacteria | 1291 |
| 835 | Ga0496109_0837916 | 3300048912 | Bacteria | 857 |
| 836 | Ga0496110_0037897 | 3300048913 | Bacteria | 4192 |
| 837 | Ga0496110_0067729 | 3300048913 | Bacteria | 3159 |
| 838 | Ga0496110_0109415 | 3300048913 | Bacteria | 2482 |
| 839 | Ga0496110_0497187 | 3300048913 | Bacteria | 1110 |
| 840 | Ga0496110_1293107 | 3300048913 | Bacteria | 638 |
| 841 | Ga0496111_0004587 | 3300048914 | Bacteria | 8746 |
| 842 | Ga0496111_0032758 | 3300048914 | Bacteria | 3705 |
| 843 | Ga0496111_0095892 | 3300048914 | Bacteria | 2177 |
| 844 | Ga0496111_0167656 | 3300048914 | Bacteria | 1631 |
| 845 | Ga0496111_0210917 | 3300048914 | Bacteria | 1443 |
| 846 | Ga0496111_0231915 | 3300048914 | Bacteria | 1371 |
| 847 | Ga0496112_0000023 | 3300048915 | Bacteria | 156144 |
| 848 | Ga0496112_0002087 | 3300048915 | Bacteria | 15846 |
| 849 | Ga0496112_0031534 | 3300048915 | Bacteria | 5142 |
| 850 | Ga0496112_0051672 | 3300048915 | Bacteria | 4032 |
| 851 | Ga0496112_0135848 | 3300048915 | Bacteria | 2429 |
| 852 | Ga0496112_0218843 | 3300048915 | Bacteria | 1860 |
| 853 | Ga0496112_0247487 | 3300048915 | Bacteria | 1734 |
| 854 | Ga0496112_0863182 | 3300048915 | Bacteria | 828 |
| 855 | Ga0496113_0022759 | 3300048916 | Bacteria | 4437 |
| 856 | Ga0496113_0044231 | 3300048916 | Bacteria | 3298 |
| 857 | Ga0496113_0133884 | 3300048916 | Bacteria | 1946 |
| 858 | Ga0496113_0221551 | 3300048916 | Bacteria | 1507 |
| 859 | Ga0496113_0243906 | 3300048916 | Bacteria | 1434 |
| 860 | Ga0496113_0266580 | 3300048916 | Bacteria | 1368 |
| 861 | Ga0496113_0581213 | 3300048916 | Bacteria | 897 |
| 862 | Ga0496113_0741359 | 3300048916 | Bacteria | 782 |
| 863 | Ga0496113_0776289 | 3300048916 | Bacteria | 762 |
| 864 | Ga0496114_0009309 | 3300048917 | Bacteria | 7795 |
| 865 | Ga0496115_0008142 | 3300048918 | Bacteria | 7744 |
| 866 | Ga0496115_0028571 | 3300048918 | Bacteria | 4372 |
| 867 | Ga0496115_0040631 | 3300048918 | Bacteria | 3699 |
| 868 | Ga0496115_0079177 | 3300048918 | Bacteria | 2674 |
| 869 | Ga0496115_0095262 | 3300048918 | Bacteria | 2436 |
| 870 | Ga0496115_0115921 | 3300048918 | Bacteria | 2203 |
| 871 | Ga0496116_0018120 | 3300048919 | Bacteria | 5439 |
| 872 | Ga0496116_0081305 | 3300048919 | Bacteria | 2009 |
| 873 | Ga0496117_0267776 | 3300048920 | Bacteria | 922 |
| 874 | Ga0496118_0021437 | 3300048921 | Bacteria | 5686 |
| 875 | Ga0496118_0065475 | 3300048921 | Bacteria | 2659 |
| 876 | Ga0496119_0047831 | 3300048922 | Bacteria | 2658 |
| 877 | Ga0496119_0099016 | 3300048922 | Bacteria | 1641 |
| 878 | Ga0496119_0375893 | 3300048922 | Bacteria | 682 |
| 879 | Ga0496120_0207668 | 3300048923 | Bacteria | 944 |
| 880 | Ga0496121_0001793 | 3300048924 | Bacteria | 34696 |
| 881 | Ga0496121_0019921 | 3300048924 | Bacteria | 6676 |
| 882 | Ga0496121_0035834 | 3300048924 | Bacteria | 4435 |
| 883 | Ga0496121_0096769 | 3300048924 | Bacteria | 2289 |
| 884 | Ga0496121_0163999 | 3300048924 | Bacteria | 1622 |
| 885 | Ga0496121_0179081 | 3300048924 | Bacteria | 1532 |
| 886 | Ga0496121_0249468 | 3300048924 | Bacteria | 1232 |
| 887 | Ga0496121_0684399 | 3300048924 | Bacteria | 620 |
| 888 | Ga0496122_0177917 | 3300048925 | Bacteria | 1273 |
| 889 | Ga0496123_0115803 | 3300048926 | Bacteria | 1520 |
| 890 | Ga0496123_0304737 | 3300048926 | Bacteria | 759 |
| 891 | Ga0496124_0197901 | 3300048927 | Bacteria | 1531 |
| 892 | Ga0496125_0001222 | 3300048928 | Bacteria | 38526 |
| 893 | Ga0496125_0039681 | 3300048928 | Bacteria | 4049 |
| 894 | Ga0496125_0204666 | 3300048928 | Bacteria | 1288 |
| 895 | Ga0496125_0231190 | 3300048928 | Bacteria | 1182 |
| 896 | Ga0496126_0001668 | 3300048929 | Bacteria | 33320 |
| 897 | Ga0496126_0005184 | 3300048929 | Bacteria | 15063 |
| 898 | Ga0496126_0067286 | 3300048929 | Bacteria | 3201 |
| 899 | Ga0496126_0082223 | 3300048929 | Bacteria | 2846 |
| 900 | Ga0496126_0182782 | 3300048929 | Bacteria | 1780 |
| 901 | Ga0496126_0379786 | 3300048929 | Bacteria | 1150 |
| 902 | Ga0501032_0211927 | 3300049569 | Bacteria | 1263 |
| 903 | Ga0501033_0198516 | 3300049570 | Bacteria | 1434 |
| 904 | Ga0501033_1008156 | 3300049570 | Bacteria | 556 |
| 905 | Ga0501034_0029843 | 3300049571 | Bacteria | 5542 |
| 906 | Ga0501034_0477166 | 3300049571 | Bacteria | 1163 |
| 907 | Ga0501034_0689230 | 3300049571 | Bacteria | 921 |
| 908 | Ga0501036_0062678 | 3300049572 | Bacteria | 3149 |
| 909 | Ga0501036_0227627 | 3300049572 | Bacteria | 1565 |
| 910 | Ga0501036_0321869 | 3300049572 | Bacteria | 1292 |
| 911 | Ga0501038_0016736 | 3300049574 | Bacteria | 6642 |
| 912 | Ga0501038_0118182 | 3300049574 | Bacteria | 2189 |
| 913 | Ga0501038_0511913 | 3300049574 | Bacteria | 917 |
| 914 | Ga0501039_0823912 | 3300049575 | Bacteria | 724 |
| 915 | Ga0501042_0074658 | 3300049578 | Bacteria | 2427 |
| 916 | Ga0501043_0033958 | 3300049579 | Bacteria | 4013 |
| 917 | Ga0501043_0061576 | 3300049579 | Bacteria | 2947 |
| 918 | Ga0501046_0046532 | 3300049580 | Bacteria | 3443 |
| 919 | Ga0501046_0532555 | 3300049580 | Bacteria | 839 |
| 920 | Ga0501047_0142653 | 3300049581 | Bacteria | 2273 |
| 921 | Ga0501047_0349344 | 3300049581 | Bacteria | 1316 |
| 922 | Ga0501047_0518470 | 3300049581 | Bacteria | 1018 |
| 923 | Ga0501047_1029865 | 3300049581 | Bacteria | 636 |
| 924 | Ga0501048_0178310 | 3300049582 | Bacteria | 1506 |
| 925 | Ga0501067_0517976 | 3300049583 | Bacteria | 667 |
| 926 | Ga0501069_0007682 | 3300049585 | Bacteria | 5658 |
| 927 | Ga0501070_0007744 | 3300049586 | Bacteria | 9104 |
| 928 | Ga0501070_0113582 | 3300049586 | Bacteria | 2238 |
| 929 | Ga0501070_0123066 | 3300049586 | Bacteria | 2144 |
| 930 | Ga0501070_0791160 | 3300049586 | Bacteria | 745 |
| 931 | Ga0501073_0056399 | 3300049589 | Bacteria | 2748 |
| 932 | Ga0501073_0328235 | 3300049589 | Bacteria | 1056 |
| 933 | Ga0501073_0491924 | 3300049589 | Bacteria | 848 |
| 934 | Ga0501074_0174932 | 3300049590 | Bacteria | 1532 |
| 935 | Ga0501074_0481517 | 3300049590 | Bacteria | 880 |
| 936 | Ga0501075_0329854 | 3300049591 | Bacteria | 1163 |
| 937 | Ga0501076_0160981 | 3300049592 | Bacteria | 1828 |
| 938 | Ga0501076_0195895 | 3300049592 | Bacteria | 1649 |
| 939 | Ga0501076_0430103 | 3300049592 | Bacteria | 1086 |
| 940 | Ga0501077_0041913 | 3300049593 | Bacteria | 2913 |
| 941 | Ga0501077_1031021 | 3300049593 | Bacteria | 529 |
| 942 | Ga0501079_0002944 | 3300049741 | Bacteria | 12446 |
| 943 | Ga0501079_0111493 | 3300049741 | Bacteria | 2126 |
| 944 | Ga0501080_0022026 | 3300049742 | Bacteria | 5904 |
| 945 | Ga0501080_0105029 | 3300049742 | Bacteria | 2619 |
| 946 | Ga0501080_1031031 | 3300049742 | Bacteria | 712 |
| 947 | Ga0501081_0000925 | 3300049743 | Bacteria | 17405 |
| 948 | Ga0501035_0000655 | 3300049822 | Bacteria | 38162 |
| 949 | Ga0501035_0123022 | 3300049822 | Bacteria | 2266 |
| 950 | Ga0501035_0180904 | 3300049822 | Bacteria | 1816 |
| 951 | Ga0501035_0184970 | 3300049822 | Bacteria | 1793 |
| 952 | Ga0501044_0039982 | 3300049823 | Bacteria | 4890 |
| 953 | Ga0501044_0197232 | 3300049823 | Bacteria | 1972 |
| 954 | Ga0501044_0256635 | 3300049823 | Bacteria | 1687 |
| 955 | Ga0501044_0389985 | 3300049823 | Bacteria | 1307 |
| 956 | Ga0501044_1307154 | 3300049823 | Bacteria | 592 |
| 957 | nmdc:mga03683_302163_c1 | 3300050489 | Bacteria | 751 |
| 958 | nmdc:mga03683_304528_c1 | 3300050489 | Bacteria | 748 |
| 959 | nmdc:mga03n38_11178_c1 | 3300050490 | Bacteria | 3335 |
| 960 | nmdc:mga03n38_196463_c1 | 3300050490 | Bacteria | 1042 |
| 961 | nmdc:mga03n38_414661_c1 | 3300050490 | Bacteria | 744 |
| 962 | nmdc:mga03n38_466597_c1 | 3300050490 | Bacteria | 704 |
| 963 | nmdc:mga03n38_594230_c1 | 3300050490 | Bacteria | 630 |
| 964 | nmdc:mga00v17_112485_c1 | 3300050491 | Bacteria | 1728 |
| 965 | nmdc:mga00v17_22168_c1 | 3300050491 | Bacteria | 3661 |
| 966 | nmdc:mga0yw44_269901_c1 | 3300050492 | Bacteria | 1135 |
| 967 | nmdc:mga0yw44_39126_c1 | 3300050492 | Bacteria | 2810 |
| 968 | nmdc:mga0yw44_43488_c1 | 3300050492 | Bacteria | 2682 |
| 969 | nmdc:mga0yw44_46282_c1 | 3300050492 | Bacteria | 2612 |
| 970 | nmdc:mga0yw44_77248_c1 | 3300050492 | Bacteria | 2080 |
| 971 | nmdc:mga0k408_30886_c1 | 3300050493 | Bacteria | 3056 |
| 972 | nmdc:mga0k408_60980_c1 | 3300050493 | Bacteria | 2192 |
| 973 | nmdc:mga0k408_74540_c1 | 3300050493 | Bacteria | 1983 |
| 974 | nmdc:mga06z11_12292_c1 | 3300050494 | Bacteria | 3720 |
| 975 | nmdc:mga06z11_48797_c1 | 3300050494 | Bacteria | 2157 |
| 976 | nmdc:mga06z11_692432_c1 | 3300050494 | Bacteria | 621 |
| 977 | nmdc:mga04h51_26232_c1 | 3300050495 | Bacteria | 1800 |
| 978 | nmdc:mga04h51_86991_c1 | 3300050495 | Bacteria | 1119 |
| 979 | nmdc:mga07m45_269959_c1 | 3300050496 | Bacteria | 990 |
| 980 | nmdc:mga07m45_34494_c1 | 3300050496 | Bacteria | 2813 |
| 981 | nmdc:mga05p37_4482_c1 | 3300050507 | Bacteria | 16321 |
| 982 | nmdc:mga05p37_49917_c1 | 3300050507 | Bacteria | 5146 |
| 983 | nmdc:mga09592_2101_c1 | 3300050508 | Bacteria | 16083 |
| 984 | nmdc:mga06r32_2521_c1 | 3300050510 | Bacteria | 16382 |
| 985 | nmdc:mga08y16_3491_c1 | 3300050511 | Bacteria | 16323 |
| 986 | nmdc:mga0n895_1560245_c1 | 3300050512 | Bacteria | 625 |
| 987 | nmdc:mga0n895_209270_c1 | 3300050512 | Bacteria | 1981 |
| 988 | nmdc:mga0rr50_209523_c1 | 3300050513 | Bacteria | 1605 |
| 989 | nmdc:mga0rr50_33524_c1 | 3300050513 | Bacteria | 3669 |
| 990 | nmdc:mga0rr50_528794_c1 | 3300050513 | Bacteria | 1004 |
| 991 | nmdc:mga0rr50_92543_c1 | 3300050513 | Bacteria | 2357 |
| 992 | nmdc:mga08x19_114544_c1 | 3300050514 | Bacteria | 1801 |
| 993 | nmdc:mga08x19_305185_c1 | 3300050514 | Bacteria | 1106 |
| 994 | nmdc:mga08x19_523923_c1 | 3300050514 | Bacteria | 838 |
| 995 | nmdc:mga0sz30_19856_c1 | 3300050516 | Bacteria | 2705 |
| 996 | Ga0495601_0134905 | 3300053077 | Bacteria | 1609 |
| 997 | Ga0495601_0287726 | 3300053077 | Bacteria | 1071 |
| 998 | Ga0495612_0005522 | 3300053078 | Bacteria | 5227 |
| 999 | Ga0495612_0095023 | 3300053078 | Bacteria | 1265 |
| 1000 | Ga0495619_0000360 | 3300053085 | Bacteria | 31637 |
| 1001 | Ga0500578_0227945 | 3300053086 | Bacteria | 1130 |
| 1002 | Ga0500646_0126378 | 3300053090 | Bacteria | 827 |
| 1003 | Ga0500647_0004996 | 3300053091 | Bacteria | 5433 |
| 1004 | Ga0500566_0001383 | 3300053094 | Bacteria | 14185 |
| 1005 | Ga0500640_000887 | 3300053095 | Bacteria | 8330 |
| 1006 | Ga0500654_189502 | 3300053099 | Bacteria | 640 |
| 1007 | Ga0500557_000030 | 3300053105 | Bacteria | 76944 |
| 1008 | Ga0500572_000174 | 3300053111 | Bacteria | 22807 |
| 1009 | Ga0500591_041509 | 3300053115 | Bacteria | 2187 |
| 1010 | Ga0500595_006730 | 3300053119 | Bacteria | 4846 |
| 1011 | Ga0500614_000189 | 3300053123 | Bacteria | 15960 |
| 1012 | Ga0500642_0255361 | 3300053130 | Bacteria | 804 |
| 1013 | Ga0500559_0004947 | 3300053136 | Bacteria | 6196 |
| 1014 | Ga0500603_001702 | 3300053150 | Bacteria | 4955 |
| 1015 | Ga0500630_005291 | 3300053159 | Bacteria | 6288 |
| 1016 | Ga0500638_077692 | 3300053162 | Bacteria | 1579 |
| 1017 | Ga0500639_000006 | 3300053163 | Bacteria | 165068 |
| 1018 | Ga0500636_0118335 | 3300053177 | Bacteria | 1489 |
| 1019 | Ga0500636_0144829 | 3300053177 | Bacteria | 1311 |
| 1020 | Ga0500636_0159348 | 3300053177 | Bacteria | 1232 |
| 1021 | Ga0500637_0025357 | 3300053178 | Bacteria | 3257 |
| 1022 | Ga0500625_083401 | 3300053729 | Bacteria | 1389 |
| 1023 | Ga0500596_000164 | 3300053735 | Bacteria | 10428 |
| 1024 | Ga0500601_019200 | 3300053737 | Bacteria | 786 |
| 1025 | Ga0501084_0008230 | 3300054114 | Bacteria | 8603 |
| 1026 | Ga0501084_0485945 | 3300054114 | Bacteria | 1044 |
| 1027 | Ga0501082_0020426 | 3300060353 | Bacteria | 5710 |
| 1028 | Ga0501082_2037885 | 3300060353 | Bacteria | 500 |
| 1029 | Ga0466962_0387303 | 3300061719 | Bacteria | 699 |
| 1030 | Ga0530510_0169435 | 3300061734 | Bacteria | 1617 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005530 | Ga0070679_100007751 | Ga0070679_1000077514 | 145 |
| 2 | 3300025917 | Ga0207660_10183391 | Ga0207660_101833913 | 145 |
| 3 | 3300028800 | Ga0265338_10762236 | Ga0265338_107622361 | 145 |
| 4 | 3300003203 | JGI25406J46586_10004766 | JGI25406J46586_100047663 | 147 |
| 5 | 3300005985 | Ga0081539_10002558 | Ga0081539_1000255814 | 147 |
| 6 | 3300014326 | Ga0157380_10117881 | Ga0157380_101178812 | 147 |
| 7 | 3300032005 | Ga0307411_10480763 | Ga0307411_104807632 | 149 |
| 8 | 3300005334 | Ga0068869_100354184 | Ga0068869_1003541842 | 150 |
| 9 | 3300025942 | Ga0207689_10491736 | Ga0207689_104917361 | 150 |
| 10 | 3300031241 | Ga0265325_10266842 | Ga0265325_102668421 | 150 |
| 11 | 3300049581 | Ga0501047_0349344 | Ga0501047_0349344_480_953 | 150 |
| 12 | 3300005347 | Ga0070668_100185524 | Ga0070668_1001855243 | 151 |
| 13 | 3300005434 | Ga0070709_10006086 | Ga0070709_100060868 | 151 |
| 14 | 3300005435 | Ga0070714_100018976 | Ga0070714_1000189763 | 151 |
| 15 | 3300005437 | Ga0070710_10360389 | Ga0070710_103603892 | 151 |
| 16 | 3300005444 | Ga0070694_100810184 | Ga0070694_1008101842 | 151 |
| 17 | 3300005546 | Ga0070696_100010959 | Ga0070696_1000109596 | 151 |
| 18 | 3300005549 | Ga0070704_100003439 | Ga0070704_10000343910 | 151 |
| 19 | 3300006038 | Ga0075365_10250267 | Ga0075365_102502672 | 151 |
| 20 | 3300006042 | Ga0075368_10107349 | Ga0075368_101073491 | 151 |
| 21 | 3300006042 | Ga0075368_10339637 | Ga0075368_103396372 | 151 |
| 22 | 3300006048 | Ga0075363_100151649 | Ga0075363_1001516491 | 151 |
| 23 | 3300006048 | Ga0075363_100164771 | Ga0075363_1001647712 | 151 |
| 24 | 3300006163 | Ga0070715_10049634 | Ga0070715_100496341 | 151 |
| 25 | 3300006177 | Ga0075362_10058301 | Ga0075362_100583013 | 151 |
| 26 | 3300006177 | Ga0075362_10138598 | Ga0075362_101385983 | 151 |
| 27 | 3300006186 | Ga0075369_10023967 | Ga0075369_100239672 | 151 |
| 28 | 3300006195 | Ga0075366_10216139 | Ga0075366_102161392 | 151 |
| 29 | 3300006195 | Ga0075366_10575975 | Ga0075366_105759751 | 151 |
| 30 | 3300006353 | Ga0075370_10108842 | Ga0075370_101088422 | 151 |
| 31 | 3300006871 | Ga0075434_100493030 | Ga0075434_1004930302 | 151 |
| 32 | 3300006914 | Ga0075436_100567622 | Ga0075436_1005676222 | 151 |
| 33 | 3300007076 | Ga0075435_100334679 | Ga0075435_1003346792 | 151 |
| 34 | 3300007265 | Ga0099794_10343242 | Ga0099794_103432422 | 151 |
| 35 | 3300009148 | Ga0105243_10191232 | Ga0105243_101912322 | 151 |
| 36 | 3300009176 | Ga0105242_10727790 | Ga0105242_107277903 | 151 |
| 37 | 3300009553 | Ga0105249_10004270 | Ga0105249_1000427014 | 151 |
| 38 | 3300021384 | Ga0213876_10435210 | Ga0213876_104352101 | 151 |
| 39 | 3300021388 | Ga0213875_10000142 | Ga0213875_1000014254 | 151 |
| 40 | 3300025253 | Ga0209677_100233 | Ga0209677_10023330 | 151 |
| 41 | 3300025261 | Ga0209233_1001314 | Ga0209233_10013145 | 151 |
| 42 | 3300025272 | Ga0209455_1006779 | Ga0209455_10067793 | 151 |
| 43 | 3300025898 | Ga0207692_11037978 | Ga0207692_110379781 | 151 |
| 44 | 3300025961 | Ga0207712_10011451 | Ga0207712_100114514 | 151 |
| 45 | 3300025972 | Ga0207668_10360991 | Ga0207668_103609913 | 151 |
| 46 | 3300028379 | Ga0268266_10390138 | Ga0268266_103901383 | 151 |
| 47 | 3300037853 | Ga0436364_1465979 | Ga0436364_1465979_17361_17840 | 151 |
| 48 | 3300039437 | Ga0436365_1437293 | Ga0436365_1437293_1102_1560 | 151 |
| 49 | 3300039437 | Ga0436365_1465346 | Ga0436365_1465346_432_941 | 151 |
| 50 | 3300039437 | Ga0436365_1623170 | Ga0436365_1623170_521_1000 | 151 |
| 51 | 3300039437 | Ga0436365_1706766 | Ga0436365_1706766_138_611 | 151 |
| 52 | 3300039437 | Ga0436365_1709481 | Ga0436365_1709481_1065_1541 | 151 |
| 53 | 3300039450 | Ga0436363_0411146 | Ga0436363_0411146_76_549 | 151 |
| 54 | 3300039450 | Ga0436363_0819011 | Ga0436363_0819011_132_605 | 151 |
| 55 | 3300045049 | Ga0466959_0646560 | Ga0466959_0646560_129_587 | 151 |
| 56 | 3300048903 | Ga0496100_0347749 | Ga0496100_0347749_165_623 | 151 |
| 57 | 3300048919 | Ga0496116_0081305 | Ga0496116_0081305_854_1312 | 151 |
| 58 | 3300048920 | Ga0496117_0267776 | Ga0496117_0267776_60_518 | 151 |
| 59 | 3300048921 | Ga0496118_0021437 | Ga0496118_0021437_5049_5507 | 151 |
| 60 | 3300048922 | Ga0496119_0099016 | Ga0496119_0099016_955_1413 | 151 |
| 61 | 3300048924 | Ga0496121_0035834 | Ga0496121_0035834_3322_3780 | 151 |
| 62 | 3300048924 | Ga0496121_0249468 | Ga0496121_0249468_694_1152 | 151 |
| 63 | 3300048928 | Ga0496125_0231190 | Ga0496125_0231190_153_611 | 151 |
| 64 | 3300049578 | Ga0501042_0074658 | Ga0501042_0074658_1888_2367 | 151 |
| 65 | 3300049591 | Ga0501075_0329854 | Ga0501075_0329854_340_813 | 151 |
| 66 | 3300049592 | Ga0501076_0160981 | Ga0501076_0160981_606_1085 | 151 |
| 67 | 3300049592 | Ga0501076_0195895 | Ga0501076_0195895_659_1132 | 151 |
| 68 | 3300049593 | Ga0501077_0041913 | Ga0501077_0041913_1219_1692 | 151 |
| 69 | 3300049741 | Ga0501079_0002944 | Ga0501079_0002944_792_1265 | 151 |
| 70 | 3300049742 | Ga0501080_0022026 | Ga0501080_0022026_4068_4544 | 151 |
| 71 | 3300049743 | Ga0501081_0000925 | Ga0501081_0000925_4583_5056 | 151 |
| 72 | 3300050490 | nmdc:mga03n38_466597_c1 | nmdc:mga03n38_466597_c1_101_562 | 151 |
| 73 | 3300050493 | nmdc:mga0k408_74540_c1 | nmdc:mga0k408_74540_c1_442_939 | 151 |
| 74 | 3300050494 | nmdc:mga06z11_48797_c1 | nmdc:mga06z11_48797_c1_685_1170 | 151 |
| 75 | 3300050495 | nmdc:mga04h51_86991_c1 | nmdc:mga04h51_86991_c1_142_627 | 151 |
| 76 | 3300050496 | nmdc:mga07m45_269959_c1 | nmdc:mga07m45_269959_c1_385_870 | 151 |
| 77 | 3300050507 | nmdc:mga05p37_4482_c1 | nmdc:mga05p37_4482_c1_5543_6022 | 151 |
| 78 | 3300050508 | nmdc:mga09592_2101_c1 | nmdc:mga09592_2101_c1_1989_2468 | 151 |
| 79 | 3300050510 | nmdc:mga06r32_2521_c1 | nmdc:mga06r32_2521_c1_4478_4957 | 151 |
| 80 | 3300050511 | nmdc:mga08y16_3491_c1 | nmdc:mga08y16_3491_c1_10210_10689 | 151 |
| 81 | 3300050512 | nmdc:mga0n895_209270_c1 | nmdc:mga0n895_209270_c1_817_1290 | 151 |
| 82 | 3300050513 | nmdc:mga0rr50_33524_c1 | nmdc:mga0rr50_33524_c1_710_1183 | 151 |
| 83 | 3300050514 | nmdc:mga08x19_523923_c1 | nmdc:mga08x19_523923_c1_62_526 | 151 |
| 84 | 3300050516 | nmdc:mga0sz30_19856_c1 | nmdc:mga0sz30_19856_c1_1727_2212 | 151 |
| 85 | 3300053119 | Ga0500595_006730 | Ga0500595_006730_732_1211 | 151 |
| 86 | 3300054114 | Ga0501084_0008230 | Ga0501084_0008230_5178_5651 | 151 |
| 87 | 3300060353 | Ga0501082_0020426 | Ga0501082_0020426_5100_5573 | 151 |
| 88 | 3300061734 | Ga0530510_0169435 | Ga0530510_0169435_424_897 | 151 |
| 89 | iso_pu_bacteria | 2919073203 | 2919077749 | 151 |
| 90 | 3300005331 | Ga0070670_100007615 | Ga0070670_1000076155 | 152 |
| 91 | 3300005344 | Ga0070661_101210275 | Ga0070661_1012102751 | 152 |
| 92 | 3300005347 | Ga0070668_100958030 | Ga0070668_1009580301 | 152 |
| 93 | 3300005355 | Ga0070671_100003008 | Ga0070671_1000030085 | 152 |
| 94 | 3300005364 | Ga0070673_100004774 | Ga0070673_1000047747 | 152 |
| 95 | 3300005367 | Ga0070667_100048868 | Ga0070667_1000488684 | 152 |
| 96 | 3300005434 | Ga0070709_10702131 | Ga0070709_107021311 | 152 |
| 97 | 3300005435 | Ga0070714_100034823 | Ga0070714_1000348232 | 152 |
| 98 | 3300005436 | Ga0070713_100062946 | Ga0070713_1000629463 | 152 |
| 99 | 3300005437 | Ga0070710_10116229 | Ga0070710_101162292 | 152 |
| 100 | 3300005439 | Ga0070711_100063677 | Ga0070711_1000636773 | 152 |
| 101 | 3300005543 | Ga0070672_100844552 | Ga0070672_1008445522 | 152 |
| 102 | 3300005548 | Ga0070665_100154830 | Ga0070665_1001548302 | 152 |
| 103 | 3300005564 | Ga0070664_101250738 | Ga0070664_1012507381 | 152 |
| 104 | 3300005578 | Ga0068854_100098797 | Ga0068854_1000987971 | 152 |
| 105 | 3300005617 | Ga0068859_100352355 | Ga0068859_1003523551 | 152 |
| 106 | 3300005842 | Ga0068858_100177127 | Ga0068858_1001771272 | 152 |
| 107 | 3300006028 | Ga0070717_10419032 | Ga0070717_104190322 | 152 |
| 108 | 3300006175 | Ga0070712_100056383 | Ga0070712_1000563834 | 152 |
| 109 | 3300006931 | Ga0097620_100352307 | Ga0097620_1003523071 | 152 |
| 110 | 3300009093 | Ga0105240_11219676 | Ga0105240_112196762 | 152 |
| 111 | 3300009098 | Ga0105245_10136563 | Ga0105245_101365633 | 152 |
| 112 | 3300009101 | Ga0105247_11015810 | Ga0105247_110158101 | 152 |
| 113 | 3300009177 | Ga0105248_10613000 | Ga0105248_106130002 | 152 |
| 114 | 3300009545 | Ga0105237_11033300 | Ga0105237_110333002 | 152 |
| 115 | 3300010375 | Ga0105239_12058478 | Ga0105239_120584781 | 152 |
| 116 | 3300011119 | Ga0105246_10135193 | Ga0105246_101351931 | 152 |
| 117 | 3300014325 | Ga0163163_10067806 | Ga0163163_100678062 | 152 |
| 118 | 3300014969 | Ga0157376_10202067 | Ga0157376_102020673 | 152 |
| 119 | 3300021388 | Ga0213875_10099496 | Ga0213875_100994963 | 152 |
| 120 | 3300025906 | Ga0207699_10220046 | Ga0207699_102200462 | 152 |
| 121 | 3300025907 | Ga0207645_10175169 | Ga0207645_101751692 | 152 |
| 122 | 3300025915 | Ga0207693_10240618 | Ga0207693_102406182 | 152 |
| 123 | 3300025916 | Ga0207663_10109854 | Ga0207663_101098542 | 152 |
| 124 | 3300025919 | Ga0207657_10570707 | Ga0207657_105707072 | 152 |
| 125 | 3300025925 | Ga0207650_10018934 | Ga0207650_100189342 | 152 |
| 126 | 3300025927 | Ga0207687_10337779 | Ga0207687_103377791 | 152 |
| 127 | 3300025929 | Ga0207664_10089570 | Ga0207664_100895703 | 152 |
| 128 | 3300025931 | Ga0207644_10010824 | Ga0207644_100108243 | 152 |
| 129 | 3300025940 | Ga0207691_10046117 | Ga0207691_100461174 | 152 |
| 130 | 3300025945 | Ga0207679_10321797 | Ga0207679_103217972 | 152 |
| 131 | 3300025960 | Ga0207651_10184467 | Ga0207651_101844673 | 152 |
| 132 | 3300025961 | Ga0207712_10041247 | Ga0207712_100412474 | 152 |
| 133 | 3300025986 | Ga0207658_10988698 | Ga0207658_109886982 | 152 |
| 134 | 3300026035 | Ga0207703_10172458 | Ga0207703_101724583 | 152 |
| 135 | 3300028379 | Ga0268266_10110942 | Ga0268266_101109422 | 152 |
| 136 | 3300035117 | Ga0373953_0208203 | Ga0373953_0208203_333_821 | 152 |
| 137 | 3300035118 | Ga0373954_0235116 | Ga0373954_0235116_389_877 | 152 |
| 138 | 3300035119 | Ga0373956_0035874 | Ga0373956_0035874_949_1437 | 152 |
| 139 | 3300035172 | Ga0373955_0268436 | Ga0373955_0268436_233_721 | 152 |
| 140 | 3300037853 | Ga0436364_1319713 | Ga0436364_1319713_1064_1528 | 152 |
| 141 | 3300041486 | Ga0451807_1700963 | Ga0451807_1700963_29_535 | 152 |
| 142 | 3300046454 | Ga0495592_0129527 | Ga0495592_0129527_388_876 | 152 |
| 143 | 3300046462 | Ga0495651_0158273 | Ga0495651_0158273_773_1261 | 152 |
| 144 | 3300046463 | Ga0495653_0157631 | Ga0495653_0157631_85_573 | 152 |
| 145 | 3300046511 | Ga0495608_0156305 | Ga0495608_0156305_606_1094 | 152 |
| 146 | 3300046679 | Ga0495623_0194097 | Ga0495623_0194097_467_955 | 152 |
| 147 | 3300048088 | Ga0495602_0029536 | Ga0495602_0029536_4170_4658 | 152 |
| 148 | 3300048903 | Ga0496100_0197458 | Ga0496100_0197458_220_708 | 152 |
| 149 | 3300048904 | Ga0496101_0541240 | Ga0496101_0541240_365_853 | 152 |
| 150 | 3300048909 | Ga0496106_0237110 | Ga0496106_0237110_129_617 | 152 |
| 151 | 3300048913 | Ga0496110_0109415 | Ga0496110_0109415_1519_2007 | 152 |
| 152 | 3300048918 | Ga0496115_0040631 | Ga0496115_0040631_2060_2548 | 152 |
| 153 | 3300002075 | JGI24738J21930_10014806 | JGI24738J21930_100148061 | 153 |
| 154 | 3300002459 | JGI24751J29686_10004765 | JGI24751J29686_100047653 | 153 |
| 155 | 3300005328 | Ga0070676_10030096 | Ga0070676_100300964 | 153 |
| 156 | 3300005328 | Ga0070676_10073935 | Ga0070676_100739351 | 153 |
| 157 | 3300005329 | Ga0070683_100308838 | Ga0070683_1003088381 | 153 |
| 158 | 3300005330 | Ga0070690_100032631 | Ga0070690_1000326311 | 153 |
| 159 | 3300005331 | Ga0070670_100107016 | Ga0070670_1001070164 | 153 |
| 160 | 3300005334 | Ga0068869_100101232 | Ga0068869_1001012322 | 153 |
| 161 | 3300005337 | Ga0070682_100009389 | Ga0070682_1000093893 | 153 |
| 162 | 3300005337 | Ga0070682_100547523 | Ga0070682_1005475232 | 153 |
| 163 | 3300005338 | Ga0068868_100353863 | Ga0068868_1003538632 | 153 |
| 164 | 3300005340 | Ga0070689_100048875 | Ga0070689_1000488754 | 153 |
| 165 | 3300005344 | Ga0070661_100031155 | Ga0070661_1000311555 | 153 |
| 166 | 3300005344 | Ga0070661_100169096 | Ga0070661_1001690961 | 153 |
| 167 | 3300005347 | Ga0070668_100056497 | Ga0070668_1000564972 | 153 |
| 168 | 3300005354 | Ga0070675_100010225 | Ga0070675_1000102254 | 153 |
| 169 | 3300005355 | Ga0070671_100111626 | Ga0070671_1001116262 | 153 |
| 170 | 3300005356 | Ga0070674_100097802 | Ga0070674_1000978023 | 153 |
| 171 | 3300005365 | Ga0070688_100652260 | Ga0070688_1006522602 | 153 |
| 172 | 3300005367 | Ga0070667_100020621 | Ga0070667_1000206215 | 153 |
| 173 | 3300005406 | Ga0070703_10116811 | Ga0070703_101168111 | 153 |
| 174 | 3300005434 | Ga0070709_10002890 | Ga0070709_100028902 | 153 |
| 175 | 3300005437 | Ga0070710_10389382 | Ga0070710_103893821 | 153 |
| 176 | 3300005438 | Ga0070701_10019718 | Ga0070701_100197184 | 153 |
| 177 | 3300005439 | Ga0070711_100389288 | Ga0070711_1003892883 | 153 |
| 178 | 3300005441 | Ga0070700_100021596 | Ga0070700_1000215964 | 153 |
| 179 | 3300005444 | Ga0070694_100513365 | Ga0070694_1005133652 | 153 |
| 180 | 3300005455 | Ga0070663_100020381 | Ga0070663_1000203814 | 153 |
| 181 | 3300005455 | Ga0070663_101786593 | Ga0070663_1017865931 | 153 |
| 182 | 3300005456 | Ga0070678_100012280 | Ga0070678_1000122802 | 153 |
| 183 | 3300005457 | Ga0070662_100031385 | Ga0070662_1000313852 | 153 |
| 184 | 3300005457 | Ga0070662_101025537 | Ga0070662_1010255371 | 153 |
| 185 | 3300005459 | Ga0068867_100076490 | Ga0068867_1000764903 | 153 |
| 186 | 3300005535 | Ga0070684_100105471 | Ga0070684_1001054712 | 153 |
| 187 | 3300005539 | Ga0068853_100155163 | Ga0068853_1001551633 | 153 |
| 188 | 3300005548 | Ga0070665_101179948 | Ga0070665_1011799482 | 153 |
| 189 | 3300005549 | Ga0070704_100035424 | Ga0070704_1000354243 | 153 |
| 190 | 3300005564 | Ga0070664_100074972 | Ga0070664_1000749724 | 153 |
| 191 | 3300005577 | Ga0068857_101967138 | Ga0068857_1019671381 | 153 |
| 192 | 3300005578 | Ga0068854_100012801 | Ga0068854_1000128013 | 153 |
| 193 | 3300005614 | Ga0068856_100066430 | Ga0068856_1000664301 | 153 |
| 194 | 3300005615 | Ga0070702_100011479 | Ga0070702_1000114793 | 153 |
| 195 | 3300005616 | Ga0068852_100193087 | Ga0068852_1001930872 | 153 |
| 196 | 3300005617 | Ga0068859_100064488 | Ga0068859_1000644884 | 153 |
| 197 | 3300005618 | Ga0068864_100011404 | Ga0068864_1000114047 | 153 |
| 198 | 3300005719 | Ga0068861_100050207 | Ga0068861_1000502074 | 153 |
| 199 | 3300005834 | Ga0068851_10045691 | Ga0068851_100456912 | 153 |
| 200 | 3300005840 | Ga0068870_10098024 | Ga0068870_100980242 | 153 |
| 201 | 3300005841 | Ga0068863_100018031 | Ga0068863_1000180314 | 153 |
| 202 | 3300005842 | Ga0068858_100179715 | Ga0068858_1001797152 | 153 |
| 203 | 3300005843 | Ga0068860_100162546 | Ga0068860_1001625462 | 153 |
| 204 | 3300005844 | Ga0068862_100022075 | Ga0068862_1000220753 | 153 |
| 205 | 3300005844 | Ga0068862_100401566 | Ga0068862_1004015663 | 153 |
| 206 | 3300005937 | Ga0081455_10662096 | Ga0081455_106620961 | 153 |
| 207 | 3300006028 | Ga0070717_10263727 | Ga0070717_102637272 | 153 |
| 208 | 3300006048 | Ga0075363_100156015 | Ga0075363_1001560152 | 153 |
| 209 | 3300006173 | Ga0070716_100117656 | Ga0070716_1001176563 | 153 |
| 210 | 3300006186 | Ga0075369_10420604 | Ga0075369_104206042 | 153 |
| 211 | 3300006237 | Ga0097621_100195018 | Ga0097621_1001950183 | 153 |
| 212 | 3300006358 | Ga0068871_100084796 | Ga0068871_1000847964 | 153 |
| 213 | 3300006881 | Ga0068865_100028120 | Ga0068865_1000281204 | 153 |
| 214 | 3300006914 | Ga0075436_100161011 | Ga0075436_1001610112 | 153 |
| 215 | 3300006931 | Ga0097620_100064486 | Ga0097620_1000644864 | 153 |
| 216 | 3300009092 | Ga0105250_10190319 | Ga0105250_101903192 | 153 |
| 217 | 3300009094 | Ga0111539_10269577 | Ga0111539_102695774 | 153 |
| 218 | 3300009098 | Ga0105245_10141418 | Ga0105245_101414184 | 153 |
| 219 | 3300009101 | Ga0105247_10009307 | Ga0105247_100093073 | 153 |
| 220 | 3300009148 | Ga0105243_10092391 | Ga0105243_100923913 | 153 |
| 221 | 3300009174 | Ga0105241_10172862 | Ga0105241_101728623 | 153 |
| 222 | 3300009177 | Ga0105248_10159205 | Ga0105248_101592053 | 153 |
| 223 | 3300009553 | Ga0105249_10028208 | Ga0105249_100282084 | 153 |
| 224 | 3300010375 | Ga0105239_10090083 | Ga0105239_100900834 | 153 |
| 225 | 3300011119 | Ga0105246_10039960 | Ga0105246_100399602 | 153 |
| 226 | 3300012498 | Ga0157345_1014652 | Ga0157345_10146522 | 153 |
| 227 | 3300013102 | Ga0157371_10161044 | Ga0157371_101610443 | 153 |
| 228 | 3300013105 | Ga0157369_10230424 | Ga0157369_102304243 | 153 |
| 229 | 3300013306 | Ga0163162_11873604 | Ga0163162_118736041 | 153 |
| 230 | 3300013308 | Ga0157375_10054747 | Ga0157375_100547474 | 153 |
| 231 | 3300013308 | Ga0157375_10547478 | Ga0157375_105474782 | 153 |
| 232 | 3300014325 | Ga0163163_10426228 | Ga0163163_104262281 | 153 |
| 233 | 3300014326 | Ga0157380_10014851 | Ga0157380_100148512 | 153 |
| 234 | 3300014745 | Ga0157377_10036926 | Ga0157377_100369263 | 153 |
| 235 | 3300014968 | Ga0157379_10107068 | Ga0157379_101070682 | 153 |
| 236 | 3300014969 | Ga0157376_10764702 | Ga0157376_107647021 | 153 |
| 237 | 3300017792 | Ga0163161_10222085 | Ga0163161_102220852 | 153 |
| 238 | 3300021377 | Ga0213874_10019910 | Ga0213874_100199102 | 153 |
| 239 | 3300021441 | Ga0213871_10025378 | Ga0213871_100253782 | 153 |
| 240 | 3300025315 | Ga0207697_10014975 | Ga0207697_100149751 | 153 |
| 241 | 3300025321 | Ga0207656_10013854 | Ga0207656_100138543 | 153 |
| 242 | 3300025885 | Ga0207653_10065997 | Ga0207653_100659972 | 153 |
| 243 | 3300025898 | Ga0207692_10001234 | Ga0207692_1000123411 | 153 |
| 244 | 3300025899 | Ga0207642_10027613 | Ga0207642_100276133 | 153 |
| 245 | 3300025901 | Ga0207688_10001188 | Ga0207688_1000118814 | 153 |
| 246 | 3300025903 | Ga0207680_10007109 | Ga0207680_100071095 | 153 |
| 247 | 3300025906 | Ga0207699_10620293 | Ga0207699_106202931 | 153 |
| 248 | 3300025907 | Ga0207645_10030737 | Ga0207645_100307372 | 153 |
| 249 | 3300025908 | Ga0207643_10002016 | Ga0207643_1000201610 | 153 |
| 250 | 3300025914 | Ga0207671_10079258 | Ga0207671_100792582 | 153 |
| 251 | 3300025915 | Ga0207693_10091909 | Ga0207693_100919095 | 153 |
| 252 | 3300025915 | Ga0207693_10184105 | Ga0207693_101841052 | 153 |
| 253 | 3300025916 | Ga0207663_10206131 | Ga0207663_102061313 | 153 |
| 254 | 3300025917 | Ga0207660_10521969 | Ga0207660_105219691 | 153 |
| 255 | 3300025918 | Ga0207662_10001080 | Ga0207662_1000108011 | 153 |
| 256 | 3300025920 | Ga0207649_10015191 | Ga0207649_100151913 | 153 |
| 257 | 3300025928 | Ga0207700_10166474 | Ga0207700_101664743 | 153 |
| 258 | 3300025931 | Ga0207644_10534492 | Ga0207644_105344922 | 153 |
| 259 | 3300025933 | Ga0207706_10010401 | Ga0207706_100104014 | 153 |
| 260 | 3300025934 | Ga0207686_10038933 | Ga0207686_100389332 | 153 |
| 261 | 3300025935 | Ga0207709_10032144 | Ga0207709_100321444 | 153 |
| 262 | 3300025936 | Ga0207670_10025786 | Ga0207670_100257863 | 153 |
| 263 | 3300025937 | Ga0207669_10003777 | Ga0207669_100037777 | 153 |
| 264 | 3300025938 | Ga0207704_10102839 | Ga0207704_101028394 | 153 |
| 265 | 3300025939 | Ga0207665_10035299 | Ga0207665_100352994 | 153 |
| 266 | 3300025940 | Ga0207691_10006467 | Ga0207691_100064675 | 153 |
| 267 | 3300025942 | Ga0207689_10008692 | Ga0207689_100086922 | 153 |
| 268 | 3300025942 | Ga0207689_10010839 | Ga0207689_100108398 | 153 |
| 269 | 3300025944 | Ga0207661_10325478 | Ga0207661_103254782 | 153 |
| 270 | 3300025945 | Ga0207679_10140050 | Ga0207679_101400501 | 153 |
| 271 | 3300025960 | Ga0207651_10046240 | Ga0207651_100462404 | 153 |
| 272 | 3300025961 | Ga0207712_10023661 | Ga0207712_100236614 | 153 |
| 273 | 3300025972 | Ga0207668_10052089 | Ga0207668_100520892 | 153 |
| 274 | 3300025981 | Ga0207640_10022181 | Ga0207640_100221814 | 153 |
| 275 | 3300026023 | Ga0207677_10034211 | Ga0207677_100342112 | 153 |
| 276 | 3300026035 | Ga0207703_10053829 | Ga0207703_100538294 | 153 |
| 277 | 3300026067 | Ga0207678_10020068 | Ga0207678_100200684 | 153 |
| 278 | 3300026075 | Ga0207708_10002263 | Ga0207708_1000226313 | 153 |
| 279 | 3300026075 | Ga0207708_10516008 | Ga0207708_105160082 | 153 |
| 280 | 3300026078 | Ga0207702_10083084 | Ga0207702_100830842 | 153 |
| 281 | 3300026089 | Ga0207648_10002178 | Ga0207648_1000217811 | 153 |
| 282 | 3300026095 | Ga0207676_10006683 | Ga0207676_100066832 | 153 |
| 283 | 3300026095 | Ga0207676_10270545 | Ga0207676_102705452 | 153 |
| 284 | 3300026116 | Ga0207674_12039257 | Ga0207674_120392571 | 153 |
| 285 | 3300026118 | Ga0207675_100003923 | Ga0207675_10000392311 | 153 |
| 286 | 3300026121 | Ga0207683_10004860 | Ga0207683_100048606 | 153 |
| 287 | 3300026142 | Ga0207698_10443641 | Ga0207698_104436411 | 153 |
| 288 | 3300026142 | Ga0207698_10776097 | Ga0207698_107760972 | 153 |
| 289 | 3300028380 | Ga0268265_10473920 | Ga0268265_104739202 | 153 |
| 290 | 3300028380 | Ga0268265_10816259 | Ga0268265_108162591 | 153 |
| 291 | 3300028381 | Ga0268264_10078980 | Ga0268264_100789803 | 153 |
| 292 | 3300031241 | Ga0265325_10001902 | Ga0265325_1000190212 | 153 |
| 293 | 3300031249 | Ga0265339_10283160 | Ga0265339_102831602 | 153 |
| 294 | 3300031344 | Ga0265316_10778452 | Ga0265316_107784521 | 153 |
| 295 | 3300031711 | Ga0265314_10011237 | Ga0265314_100112373 | 153 |
| 296 | 3300034819 | Ga0373958_0102780 | Ga0373958_0102780_92_574 | 153 |
| 297 | 3300034819 | Ga0373958_0108207 | Ga0373958_0108207_73_558 | 153 |
| 298 | 3300034820 | Ga0373959_0010924 | Ga0373959_0010924_325_810 | 153 |
| 299 | 3300034957 | Ga0373938_0003602 | Ga0373938_0003602_741_1226 | 153 |
| 300 | 3300035092 | Ga0373952_0046289 | Ga0373952_0046289_126_611 | 153 |
| 301 | 3300035111 | Ga0373923_0108821 | Ga0373923_0108821_671_1156 | 153 |
| 302 | 3300035112 | Ga0373932_0248012 | Ga0373932_0248012_116_601 | 153 |
| 303 | 3300035115 | Ga0373941_0000578 | Ga0373941_0000578_1026_1511 | 153 |
| 304 | 3300035115 | Ga0373941_0022048 | Ga0373941_0022048_951_1433 | 153 |
| 305 | 3300035121 | Ga0373960_0005392 | Ga0373960_0005392_903_1388 | 153 |
| 306 | 3300035170 | Ga0373943_0006929 | Ga0373943_0006929_729_1214 | 153 |
| 307 | 3300035171 | Ga0373946_0091900 | Ga0373946_0091900_652_1137 | 153 |
| 308 | 3300035172 | Ga0373955_0553508 | Ga0373955_0553508_46_531 | 153 |
| 309 | 3300035242 | Ga0373962_0003173 | Ga0373962_0003173_623_1108 | 153 |
| 310 | 3300035691 | Ga0373931_0007687 | Ga0373931_0007687_1158_1643 | 153 |
| 311 | 3300035695 | Ga0373927_0026537 | Ga0373927_0026537_3061_3546 | 153 |
| 312 | 3300035725 | Ga0373947_0013134 | Ga0373947_0013134_2337_2822 | 153 |
| 313 | 3300037068 | Ga0373925_0004333 | Ga0373925_0004333_9573_10058 | 153 |
| 314 | 3300037312 | Ga0395899_0014008 | Ga0395899_0014008_2897_3379 | 153 |
| 315 | 3300037312 | Ga0395899_0360095 | Ga0395899_0360095_245_706 | 153 |
| 316 | 3300037312 | Ga0395899_0464771 | Ga0395899_0464771_298_780 | 153 |
| 317 | 3300037418 | Ga0395900_0082575 | Ga0395900_0082575_1549_2031 | 153 |
| 318 | 3300037418 | Ga0395900_0249867 | Ga0395900_0249867_759_1241 | 153 |
| 319 | 3300037418 | Ga0395900_0354159 | Ga0395900_0354159_285_746 | 153 |
| 320 | 3300037466 | Ga0395898_0007428 | Ga0395898_0007428_10181_10663 | 153 |
| 321 | 3300037466 | Ga0395898_0254403 | Ga0395898_0254403_1117_1599 | 153 |
| 322 | 3300038443 | Ga0395901_0020070 | Ga0395901_0020070_1994_2476 | 153 |
| 323 | 3300038443 | Ga0395901_0168056 | Ga0395901_0168056_1578_2060 | 153 |
| 324 | 3300039438 | Ga0436360_0172693 | Ga0436360_0172693_2160_2621 | 153 |
| 325 | 3300039438 | Ga0436360_0707092 | Ga0436360_0707092_335_796 | 153 |
| 326 | 3300039447 | Ga0436361_0063482 | Ga0436361_0063482_47_508 | 153 |
| 327 | 3300039447 | Ga0436361_0386711 | Ga0436361_0386711_331_792 | 153 |
| 328 | 3300039447 | Ga0436361_0773244 | Ga0436361_0773244_482_943 | 153 |
| 329 | 3300039450 | Ga0436363_0035196 | Ga0436363_0035196_2062_2523 | 153 |
| 330 | 3300039450 | Ga0436363_0533424 | Ga0436363_0533424_304_798 | 153 |
| 331 | 3300039450 | Ga0436363_0802989 | Ga0436363_0802989_141_623 | 153 |
| 332 | 3300041511 | Ga0451855_0428041 | Ga0451855_0428041_78_563 | 153 |
| 333 | 3300042157 | Ga0439458_0139370 | Ga0439458_0139370_27_512 | 153 |
| 334 | 3300044656 | Ga0466969_0168614 | Ga0466969_0168614_92_553 | 153 |
| 335 | 3300044684 | Ga0466966_0209289 | Ga0466966_0209289_86_547 | 153 |
| 336 | 3300044694 | Ga0466963_0088861 | Ga0466963_0088861_227_688 | 153 |
| 337 | 3300044735 | Ga0466968_0731686 | Ga0466968_0731686_21_482 | 153 |
| 338 | 3300044765 | Ga0466970_0279239 | Ga0466970_0279239_54_515 | 153 |
| 339 | 3300045051 | Ga0451576_0947692 | Ga0451576_0947692_203_688 | 153 |
| 340 | 3300046453 | Ga0495627_104886 | Ga0495627_104886_151_636 | 153 |
| 341 | 3300046459 | Ga0495629_0000026 | Ga0495629_0000026_105200_105685 | 153 |
| 342 | 3300046461 | Ga0495641_0017870 | Ga0495641_0017870_414_899 | 153 |
| 343 | 3300046472 | Ga0495580_0544726 | Ga0495580_0544726_185_670 | 153 |
| 344 | 3300046473 | Ga0495582_0006073 | Ga0495582_0006073_6184_6669 | 153 |
| 345 | 3300046491 | Ga0495584_0468468 | Ga0495584_0468468_22_507 | 153 |
| 346 | 3300046513 | Ga0495616_0071592 | Ga0495616_0071592_218_703 | 153 |
| 347 | 3300046515 | Ga0495620_0092004 | Ga0495620_0092004_30_515 | 153 |
| 348 | 3300046516 | Ga0495628_0537140 | Ga0495628_0537140_331_816 | 153 |
| 349 | 3300046519 | Ga0495632_0067688 | Ga0495632_0067688_232_717 | 153 |
| 350 | 3300046539 | Ga0495621_0025785 | Ga0495621_0025785_773_1258 | 153 |
| 351 | 3300046683 | Ga0495658_0004396 | Ga0495658_0004396_2351_2836 | 153 |
| 352 | 3300046689 | Ga0495613_0003849 | Ga0495613_0003849_7381_7866 | 153 |
| 353 | 3300046794 | Ga0495589_0321797 | Ga0495589_0321797_124_609 | 153 |
| 354 | 3300047317 | Ga0495604_0583575 | Ga0495604_0583575_69_554 | 153 |
| 355 | 3300047319 | Ga0495674_0320052 | Ga0495674_0320052_42_527 | 153 |
| 356 | 3300047320 | Ga0495672_0017843 | Ga0495672_0017843_3492_3956 | 153 |
| 357 | 3300047321 | Ga0495676_0029124 | Ga0495676_0029124_1473_1958 | 153 |
| 358 | 3300047322 | Ga0495680_0096668 | Ga0495680_0096668_872_1357 | 153 |
| 359 | 3300048903 | Ga0496100_0073041 | Ga0496100_0073041_262_747 | 153 |
| 360 | 3300048903 | Ga0496100_0097342 | Ga0496100_0097342_962_1447 | 153 |
| 361 | 3300048904 | Ga0496101_0080417 | Ga0496101_0080417_1428_1913 | 153 |
| 362 | 3300048904 | Ga0496101_0130721 | Ga0496101_0130721_865_1350 | 153 |
| 363 | 3300048905 | Ga0496102_0009072 | Ga0496102_0009072_2607_3092 | 153 |
| 364 | 3300048905 | Ga0496102_0253173 | Ga0496102_0253173_1049_1534 | 153 |
| 365 | 3300048906 | Ga0496103_0004573 | Ga0496103_0004573_2427_2912 | 153 |
| 366 | 3300048906 | Ga0496103_0060685 | Ga0496103_0060685_1660_2145 | 153 |
| 367 | 3300048907 | Ga0496104_0054081 | Ga0496104_0054081_1245_1730 | 153 |
| 368 | 3300048908 | Ga0496105_0016436 | Ga0496105_0016436_2705_3190 | 153 |
| 369 | 3300048908 | Ga0496105_0074130 | Ga0496105_0074130_2192_2677 | 153 |
| 370 | 3300048909 | Ga0496106_0003696 | Ga0496106_0003696_8881_9366 | 153 |
| 371 | 3300048909 | Ga0496106_0052883 | Ga0496106_0052883_113_598 | 153 |
| 372 | 3300048910 | Ga0496107_0107375 | Ga0496107_0107375_138_623 | 153 |
| 373 | 3300048911 | Ga0496108_0018377 | Ga0496108_0018377_4872_5357 | 153 |
| 374 | 3300048912 | Ga0496109_0122275 | Ga0496109_0122275_10_495 | 153 |
| 375 | 3300048912 | Ga0496109_0403397 | Ga0496109_0403397_481_966 | 153 |
| 376 | 3300048912 | Ga0496109_0837916 | Ga0496109_0837916_326_811 | 153 |
| 377 | 3300048913 | Ga0496110_1293107 | Ga0496110_1293107_68_553 | 153 |
| 378 | 3300048914 | Ga0496111_0004587 | Ga0496111_0004587_5578_6063 | 153 |
| 379 | 3300048914 | Ga0496111_0032758 | Ga0496111_0032758_500_985 | 153 |
| 380 | 3300048915 | Ga0496112_0002087 | Ga0496112_0002087_12894_13379 | 153 |
| 381 | 3300048915 | Ga0496112_0031534 | Ga0496112_0031534_4290_4775 | 153 |
| 382 | 3300048915 | Ga0496112_0135848 | Ga0496112_0135848_958_1443 | 153 |
| 383 | 3300048916 | Ga0496113_0022759 | Ga0496113_0022759_368_853 | 153 |
| 384 | 3300048916 | Ga0496113_0133884 | Ga0496113_0133884_480_965 | 153 |
| 385 | 3300048916 | Ga0496113_0221551 | Ga0496113_0221551_982_1467 | 153 |
| 386 | 3300048917 | Ga0496114_0009309 | Ga0496114_0009309_6566_7051 | 153 |
| 387 | 3300048918 | Ga0496115_0008142 | Ga0496115_0008142_6703_7188 | 153 |
| 388 | 3300048918 | Ga0496115_0028571 | Ga0496115_0028571_2468_2953 | 153 |
| 389 | 3300048918 | Ga0496115_0079177 | Ga0496115_0079177_165_650 | 153 |
| 390 | 3300048924 | Ga0496121_0179081 | Ga0496121_0179081_524_988 | 153 |
| 391 | 3300049585 | Ga0501069_0007682 | Ga0501069_0007682_4942_5424 | 153 |
| 392 | 3300049586 | Ga0501070_0007744 | Ga0501070_0007744_6872_7354 | 153 |
| 393 | 3300049589 | Ga0501073_0491924 | Ga0501073_0491924_239_721 | 153 |
| 394 | 3300049590 | Ga0501074_0481517 | Ga0501074_0481517_182_664 | 153 |
| 395 | 3300049593 | Ga0501077_1031021 | Ga0501077_1031021_18_503 | 153 |
| 396 | 3300049822 | Ga0501035_0000655 | Ga0501035_0000655_19309_19791 | 153 |
| 397 | 3300050490 | nmdc:mga03n38_196463_c1 | nmdc:mga03n38_196463_c1_389_874 | 153 |
| 398 | 3300050492 | nmdc:mga0yw44_43488_c1 | nmdc:mga0yw44_43488_c1_52_537 | 153 |
| 399 | 3300050492 | nmdc:mga0yw44_77248_c1 | nmdc:mga0yw44_77248_c1_608_1093 | 153 |
| 400 | 3300050513 | nmdc:mga0rr50_209523_c1 | nmdc:mga0rr50_209523_c1_1090_1575 | 153 |
| 401 | 3300050513 | nmdc:mga0rr50_528794_c1 | nmdc:mga0rr50_528794_c1_143_628 | 153 |
| 402 | 3300050513 | nmdc:mga0rr50_92543_c1 | nmdc:mga0rr50_92543_c1_974_1468 | 153 |
| 403 | 3300050514 | nmdc:mga08x19_114544_c1 | nmdc:mga08x19_114544_c1_597_1091 | 153 |
| 404 | 3300050514 | nmdc:mga08x19_305185_c1 | nmdc:mga08x19_305185_c1_444_929 | 153 |
| 405 | 3300053085 | Ga0495619_0000360 | Ga0495619_0000360_12066_12551 | 153 |
| 406 | 3300053130 | Ga0500642_0255361 | Ga0500642_0255361_137_619 | 153 |
| 407 | 3300005329 | Ga0070683_100897585 | Ga0070683_1008975852 | 154 |
| 408 | 3300005434 | Ga0070709_10333101 | Ga0070709_103331012 | 154 |
| 409 | 3300005435 | Ga0070714_100336444 | Ga0070714_1003364442 | 154 |
| 410 | 3300005439 | Ga0070711_100715855 | Ga0070711_1007158551 | 154 |
| 411 | 3300005458 | Ga0070681_10661284 | Ga0070681_106612842 | 154 |
| 412 | 3300005530 | Ga0070679_101119346 | Ga0070679_1011193462 | 154 |
| 413 | 3300005539 | Ga0068853_100058222 | Ga0068853_1000582224 | 154 |
| 414 | 3300005563 | Ga0068855_100066662 | Ga0068855_1000666623 | 154 |
| 415 | 3300005577 | Ga0068857_101192792 | Ga0068857_1011927921 | 154 |
| 416 | 3300005842 | Ga0068858_101109840 | Ga0068858_1011098401 | 154 |
| 417 | 3300006028 | Ga0070717_10058902 | Ga0070717_100589022 | 154 |
| 418 | 3300006195 | Ga0075366_10024433 | Ga0075366_100244334 | 154 |
| 419 | 3300009093 | Ga0105240_10015381 | Ga0105240_1001538112 | 154 |
| 420 | 3300009093 | Ga0105240_10316975 | Ga0105240_103169752 | 154 |
| 421 | 3300009101 | Ga0105247_10058543 | Ga0105247_100585434 | 154 |
| 422 | 3300009545 | Ga0105237_10761519 | Ga0105237_107615192 | 154 |
| 423 | 3300009545 | Ga0105237_11171011 | Ga0105237_111710111 | 154 |
| 424 | 3300010375 | Ga0105239_10275749 | Ga0105239_102757492 | 154 |
| 425 | 3300013104 | Ga0157370_10099137 | Ga0157370_100991373 | 154 |
| 426 | 3300013105 | Ga0157369_10022887 | Ga0157369_100228873 | 154 |
| 427 | 3300013105 | Ga0157369_10064206 | Ga0157369_100642063 | 154 |
| 428 | 3300013307 | Ga0157372_10245298 | Ga0157372_102452983 | 154 |
| 429 | 3300020070 | Ga0206356_11422122 | Ga0206356_114221221 | 154 |
| 430 | 3300020082 | Ga0206353_10037471 | Ga0206353_100374713 | 154 |
| 431 | 3300021384 | Ga0213876_10025319 | Ga0213876_100253193 | 154 |
| 432 | 3300022467 | Ga0224712_10200821 | Ga0224712_102008212 | 154 |
| 433 | 3300025900 | Ga0207710_10067924 | Ga0207710_100679243 | 154 |
| 434 | 3300025904 | Ga0207647_10123044 | Ga0207647_101230442 | 154 |
| 435 | 3300025906 | Ga0207699_10048973 | Ga0207699_100489733 | 154 |
| 436 | 3300025906 | Ga0207699_10537179 | Ga0207699_105371791 | 154 |
| 437 | 3300025913 | Ga0207695_10445138 | Ga0207695_104451382 | 154 |
| 438 | 3300025914 | Ga0207671_10524173 | Ga0207671_105241732 | 154 |
| 439 | 3300025928 | Ga0207700_10065543 | Ga0207700_100655433 | 154 |
| 440 | 3300025928 | Ga0207700_10178009 | Ga0207700_101780093 | 154 |
| 441 | 3300025929 | Ga0207664_10102398 | Ga0207664_101023983 | 154 |
| 442 | 3300025949 | Ga0207667_10583989 | Ga0207667_105839892 | 154 |
| 443 | 3300026035 | Ga0207703_11489347 | Ga0207703_114893471 | 154 |
| 444 | 3300026078 | Ga0207702_10191539 | Ga0207702_101915394 | 154 |
| 445 | 3300026116 | Ga0207674_10524482 | Ga0207674_105244823 | 154 |
| 446 | 3300033544 | Ga0316215_1000679 | Ga0316215_10006794 | 154 |
| 447 | 3300035118 | Ga0373954_0599989 | Ga0373954_0599989_20_505 | 154 |
| 448 | 3300035172 | Ga0373955_0004730 | Ga0373955_0004730_3893_4378 | 154 |
| 449 | 3300035724 | Ga0373933_0149844 | Ga0373933_0149844_874_1359 | 154 |
| 450 | 3300036401 | Ga0373937_0004681 | Ga0373937_0004681_6714_7199 | 154 |
| 451 | 3300036459 | Ga0372808_001650 | Ga0372808_001650_1028_1492 | 154 |
| 452 | 3300037418 | Ga0395900_0014973 | Ga0395900_0014973_7410_7874 | 154 |
| 453 | 3300037418 | Ga0395900_0108769 | Ga0395900_0108769_982_1446 | 154 |
| 454 | 3300037466 | Ga0395898_0060705 | Ga0395898_0060705_2899_3363 | 154 |
| 455 | 3300037466 | Ga0395898_1218030 | Ga0395898_1218030_162_626 | 154 |
| 456 | 3300037853 | Ga0436364_0419251 | Ga0436364_0419251_1856_2320 | 154 |
| 457 | 3300038443 | Ga0395901_0688629 | Ga0395901_0688629_75_539 | 154 |
| 458 | 3300039437 | Ga0436365_0531841 | Ga0436365_0531841_135_599 | 154 |
| 459 | 3300039437 | Ga0436365_0787752 | Ga0436365_0787752_1097_1561 | 154 |
| 460 | 3300039450 | Ga0436363_1049939 | Ga0436363_1049939_1241_1708 | 154 |
| 461 | 3300041486 | Ga0451807_0669418 | Ga0451807_0669418_111_575 | 154 |
| 462 | 3300045976 | Ga0466967_0842035 | Ga0466967_0842035_189_653 | 154 |
| 463 | 3300046462 | Ga0495651_0757089 | Ga0495651_0757089_49_534 | 154 |
| 464 | 3300048910 | Ga0496107_0035247 | Ga0496107_0035247_1573_2043 | 154 |
| 465 | 3300048924 | Ga0496121_0001793 | Ga0496121_0001793_31243_31713 | 154 |
| 466 | 3300048924 | Ga0496121_0684399 | Ga0496121_0684399_30_494 | 154 |
| 467 | 3300048926 | Ga0496123_0304737 | Ga0496123_0304737_175_639 | 154 |
| 468 | 3300048927 | Ga0496124_0197901 | Ga0496124_0197901_354_818 | 154 |
| 469 | 3300048928 | Ga0496125_0001222 | Ga0496125_0001222_1076_1546 | 154 |
| 470 | 3300048928 | Ga0496125_0039681 | Ga0496125_0039681_3269_3733 | 154 |
| 471 | 3300048929 | Ga0496126_0005184 | Ga0496126_0005184_10284_10754 | 154 |
| 472 | 3300048929 | Ga0496126_0182782 | Ga0496126_0182782_650_1114 | 154 |
| 473 | 3300049569 | Ga0501032_0211927 | Ga0501032_0211927_541_1008 | 154 |
| 474 | 3300049570 | Ga0501033_0198516 | Ga0501033_0198516_318_782 | 154 |
| 475 | 3300049581 | Ga0501047_0142653 | Ga0501047_0142653_1237_1701 | 154 |
| 476 | 3300049586 | Ga0501070_0113582 | Ga0501070_0113582_1252_1716 | 154 |
| 477 | 3300049589 | Ga0501073_0056399 | Ga0501073_0056399_1534_1998 | 154 |
| 478 | 3300049590 | Ga0501074_0174932 | Ga0501074_0174932_77_541 | 154 |
| 479 | 3300049741 | Ga0501079_0111493 | Ga0501079_0111493_646_1110 | 154 |
| 480 | 3300049742 | Ga0501080_0105029 | Ga0501080_0105029_1037_1501 | 154 |
| 481 | 3300049823 | Ga0501044_0039982 | Ga0501044_0039982_1951_2415 | 154 |
| 482 | 3300049823 | Ga0501044_0389985 | Ga0501044_0389985_240_707 | 154 |
| 483 | 3300050490 | nmdc:mga03n38_594230_c1 | nmdc:mga03n38_594230_c1_123_590 | 154 |
| 484 | 3300050493 | nmdc:mga0k408_30886_c1 | nmdc:mga0k408_30886_c1_829_1314 | 154 |
| 485 | 3300050493 | nmdc:mga0k408_60980_c1 | nmdc:mga0k408_60980_c1_898_1383 | 154 |
| 486 | 3300050494 | nmdc:mga06z11_692432_c1 | nmdc:mga06z11_692432_c1_92_577 | 154 |
| 487 | iso_pu_bacteria | 2507262055 | 2507511947 | 154 |
| 488 | iso_pu_bacteria | 2508501009 | 2508545612 | 154 |
| 489 | iso_pu_bacteria | 2508501042 | 2508694428 | 154 |
| 490 | iso_pu_bacteria | 2515154112 | 2515624644 | 154 |
| 491 | iso_pu_bacteria | 2874590934 | 2874592164 | 154 |
| 492 | iso_pu_bacteria | 2874645413 | 2874646998 | 154 |
| 493 | iso_pu_bacteria | 2876771140 | 2876772375 | 154 |
| 494 | iso_pu_bacteria | 2876818435 | 2876819644 | 154 |
| 495 | iso_pu_bacteria | 2879074833 | 2879076219 | 154 |
| 496 | iso_pu_bacteria | 2879127579 | 2879132601 | 154 |
| 497 | iso_pu_bacteria | 2879142872 | 2879144689 | 154 |
| 498 | iso_pu_bacteria | 2935608549 | 2935613410 | 154 |
| 499 | iso_pu_bacteria | 2935648319 | 2935653710 | 154 |
| 500 | iso_pu_bacteria | 2935656913 | 2935662459 | 154 |
| 501 | iso_pu_bacteria | 2935819856 | 2935824737 | 154 |
| 502 | iso_pu_bacteria | 2935847175 | 2935851957 | 154 |
| 503 | iso_pu_bacteria | 2935908558 | 2935911305 | 154 |
| 504 | iso_pu_bacteria | 2935916978 | 2935920837 | 154 |
| 505 | iso_pu_bacteria | 2935926038 | 2935928334 | 154 |
| 506 | iso_pu_bacteria | 2935934488 | 2935937979 | 154 |
| 507 | iso_pu_bacteria | 2935942939 | 2935945261 | 154 |
| 508 | iso_pu_bacteria | 2935951376 | 2935954233 | 154 |
| 509 | iso_pu_bacteria | 2935967501 | 2935971499 | 154 |
| 510 | iso_pu_bacteria | 2935975950 | 2935982117 | 154 |
| 511 | iso_pu_bacteria | 2935984226 | 2935990542 | 154 |
| 512 | iso_pu_bacteria | 2936011229 | 2936016893 | 154 |
| 513 | iso_pu_bacteria | 2936019824 | 2936025526 | 154 |
| 514 | iso_pu_bacteria | 2936028420 | 2936034236 | 154 |
| 515 | iso_pu_bacteria | 2936046547 | 2936052293 | 154 |
| 516 | iso_pu_bacteria | 2936055302 | 2936060572 | 154 |
| 517 | iso_pu_bacteria | 8016630954 | 8016637111 | 154 |
| 518 | iso_pu_bacteria | 8019619141 | 8019624079 | 154 |
| 519 | iso_pu_bacteria | 8019638758 | 8019641678 | 154 |
| 520 | iso_pu_bacteria | 8019659431 | 8019665879 | 154 |
| 521 | iso_pu_bacteria | 8019668869 | 8019675402 | 154 |
| 522 | iso_pu_bacteria | 8019678201 | 8019680702 | 154 |
| 523 | iso_pu_bacteria | 8019687851 | 8019695068 | 154 |
| 524 | 3300003203 | JGI25406J46586_10000043 | JGI25406J46586_1000004329 | 155 |
| 525 | 3300003215 | JGI25153J46596_10000584 | JGI25153J46596_100005849 | 155 |
| 526 | 3300003659 | JGI25404J52841_10013755 | JGI25404J52841_100137552 | 155 |
| 527 | 3300003659 | JGI25404J52841_10017841 | JGI25404J52841_100178412 | 155 |
| 528 | 3300003659 | JGI25404J52841_10035170 | JGI25404J52841_100351702 | 155 |
| 529 | 3300005327 | Ga0070658_10168014 | Ga0070658_101680143 | 155 |
| 530 | 3300005329 | Ga0070683_100009428 | Ga0070683_1000094283 | 155 |
| 531 | 3300005329 | Ga0070683_100015413 | Ga0070683_1000154134 | 155 |
| 532 | 3300005335 | Ga0070666_10347337 | Ga0070666_103473372 | 155 |
| 533 | 3300005336 | Ga0070680_100407087 | Ga0070680_1004070873 | 155 |
| 534 | 3300005336 | Ga0070680_100736246 | Ga0070680_1007362462 | 155 |
| 535 | 3300005337 | Ga0070682_100089099 | Ga0070682_1000890993 | 155 |
| 536 | 3300005339 | Ga0070660_100037317 | Ga0070660_1000373172 | 155 |
| 537 | 3300005341 | Ga0070691_10065733 | Ga0070691_100657332 | 155 |
| 538 | 3300005366 | Ga0070659_100231393 | Ga0070659_1002313932 | 155 |
| 539 | 3300005434 | Ga0070709_10006951 | Ga0070709_100069517 | 155 |
| 540 | 3300005435 | Ga0070714_100070792 | Ga0070714_1000707922 | 155 |
| 541 | 3300005435 | Ga0070714_100411212 | Ga0070714_1004112122 | 155 |
| 542 | 3300005436 | Ga0070713_100061181 | Ga0070713_1000611814 | 155 |
| 543 | 3300005436 | Ga0070713_100116289 | Ga0070713_1001162892 | 155 |
| 544 | 3300005436 | Ga0070713_100580395 | Ga0070713_1005803951 | 155 |
| 545 | 3300005437 | Ga0070710_10034156 | Ga0070710_100341562 | 155 |
| 546 | 3300005437 | Ga0070710_10318664 | Ga0070710_103186642 | 155 |
| 547 | 3300005439 | Ga0070711_100006504 | Ga0070711_1000065048 | 155 |
| 548 | 3300005439 | Ga0070711_100119677 | Ga0070711_1001196773 | 155 |
| 549 | 3300005439 | Ga0070711_100659637 | Ga0070711_1006596372 | 155 |
| 550 | 3300005439 | Ga0070711_100930167 | Ga0070711_1009301671 | 155 |
| 551 | 3300005458 | Ga0070681_10020543 | Ga0070681_100205431 | 155 |
| 552 | 3300005458 | Ga0070681_10047562 | Ga0070681_100475623 | 155 |
| 553 | 3300005458 | Ga0070681_10308938 | Ga0070681_103089382 | 155 |
| 554 | 3300005467 | Ga0070706_100774213 | Ga0070706_1007742131 | 155 |
| 555 | 3300005468 | Ga0070707_100599573 | Ga0070707_1005995732 | 155 |
| 556 | 3300005471 | Ga0070698_100433662 | Ga0070698_1004336622 | 155 |
| 557 | 3300005530 | Ga0070679_100118675 | Ga0070679_1001186754 | 155 |
| 558 | 3300005530 | Ga0070679_100560796 | Ga0070679_1005607962 | 155 |
| 559 | 3300005530 | Ga0070679_101283283 | Ga0070679_1012832831 | 155 |
| 560 | 3300005535 | Ga0070684_100012253 | Ga0070684_1000122534 | 155 |
| 561 | 3300005535 | Ga0070684_100030875 | Ga0070684_1000308753 | 155 |
| 562 | 3300005536 | Ga0070697_100147829 | Ga0070697_1001478292 | 155 |
| 563 | 3300005539 | Ga0068853_100092722 | Ga0068853_1000927224 | 155 |
| 564 | 3300005539 | Ga0068853_100450255 | Ga0068853_1004502552 | 155 |
| 565 | 3300005548 | Ga0070665_100050501 | Ga0070665_1000505014 | 155 |
| 566 | 3300005548 | Ga0070665_100348604 | Ga0070665_1003486041 | 155 |
| 567 | 3300005563 | Ga0068855_100362156 | Ga0068855_1003621563 | 155 |
| 568 | 3300005563 | Ga0068855_100656803 | Ga0068855_1006568032 | 155 |
| 569 | 3300005563 | Ga0068855_100770096 | Ga0068855_1007700962 | 155 |
| 570 | 3300005563 | Ga0068855_101688109 | Ga0068855_1016881092 | 155 |
| 571 | 3300005577 | Ga0068857_100178798 | Ga0068857_1001787983 | 155 |
| 572 | 3300005578 | Ga0068854_100358977 | Ga0068854_1003589772 | 155 |
| 573 | 3300005578 | Ga0068854_100799551 | Ga0068854_1007995512 | 155 |
| 574 | 3300005614 | Ga0068856_100525210 | Ga0068856_1005252101 | 155 |
| 575 | 3300005614 | Ga0068856_100595365 | Ga0068856_1005953653 | 155 |
| 576 | 3300005618 | Ga0068864_101324513 | Ga0068864_1013245132 | 155 |
| 577 | 3300005937 | Ga0081455_10012432 | Ga0081455_100124324 | 155 |
| 578 | 3300005937 | Ga0081455_10100708 | Ga0081455_101007082 | 155 |
| 579 | 3300005981 | Ga0081538_10103530 | Ga0081538_101035302 | 155 |
| 580 | 3300005983 | Ga0081540_1025104 | Ga0081540_10251043 | 155 |
| 581 | 3300005983 | Ga0081540_1028909 | Ga0081540_10289093 | 155 |
| 582 | 3300005983 | Ga0081540_1030553 | Ga0081540_10305534 | 155 |
| 583 | 3300005983 | Ga0081540_1047477 | Ga0081540_10474771 | 155 |
| 584 | 3300005983 | Ga0081540_1118098 | Ga0081540_11180982 | 155 |
| 585 | 3300005985 | Ga0081539_10000324 | Ga0081539_1000032491 | 155 |
| 586 | 3300005985 | Ga0081539_10033708 | Ga0081539_100337083 | 155 |
| 587 | 3300006028 | Ga0070717_10000361 | Ga0070717_1000036124 | 155 |
| 588 | 3300006028 | Ga0070717_10002247 | Ga0070717_100022473 | 155 |
| 589 | 3300006038 | Ga0075365_10074009 | Ga0075365_100740093 | 155 |
| 590 | 3300006048 | Ga0075363_100406342 | Ga0075363_1004063422 | 155 |
| 591 | 3300006051 | Ga0075364_10138064 | Ga0075364_101380641 | 155 |
| 592 | 3300006175 | Ga0070712_100004741 | Ga0070712_1000047418 | 155 |
| 593 | 3300006177 | Ga0075362_10035073 | Ga0075362_100350734 | 155 |
| 594 | 3300006177 | Ga0075362_10393079 | Ga0075362_103930792 | 155 |
| 595 | 3300006186 | Ga0075369_10098445 | Ga0075369_100984452 | 155 |
| 596 | 3300006237 | Ga0097621_100174234 | Ga0097621_1001742343 | 155 |
| 597 | 3300006844 | Ga0075428_100162154 | Ga0075428_1001621542 | 155 |
| 598 | 3300009093 | Ga0105240_10080919 | Ga0105240_100809193 | 155 |
| 599 | 3300009093 | Ga0105240_10878092 | Ga0105240_108780922 | 155 |
| 600 | 3300009098 | Ga0105245_10267733 | Ga0105245_102677333 | 155 |
| 601 | 3300009098 | Ga0105245_10414503 | Ga0105245_104145033 | 155 |
| 602 | 3300009147 | Ga0114129_10234852 | Ga0114129_102348523 | 155 |
| 603 | 3300009174 | Ga0105241_10051881 | Ga0105241_100518811 | 155 |
| 604 | 3300009174 | Ga0105241_10338577 | Ga0105241_103385773 | 155 |
| 605 | 3300009177 | Ga0105248_10213030 | Ga0105248_102130304 | 155 |
| 606 | 3300009545 | Ga0105237_10081577 | Ga0105237_100815772 | 155 |
| 607 | 3300009551 | Ga0105238_10392011 | Ga0105238_103920112 | 155 |
| 608 | 3300009551 | Ga0105238_11104047 | Ga0105238_111040472 | 155 |
| 609 | 3300009551 | Ga0105238_11492689 | Ga0105238_114926891 | 155 |
| 610 | 3300009553 | Ga0105249_10229182 | Ga0105249_102291822 | 155 |
| 611 | 3300010159 | Ga0099796_10221659 | Ga0099796_102216591 | 155 |
| 612 | 3300010375 | Ga0105239_10490657 | Ga0105239_104906572 | 155 |
| 613 | 3300010375 | Ga0105239_11671595 | Ga0105239_116715952 | 155 |
| 614 | 3300012503 | Ga0157313_1017102 | Ga0157313_10171022 | 155 |
| 615 | 3300013105 | Ga0157369_10069772 | Ga0157369_100697724 | 155 |
| 616 | 3300013296 | Ga0157374_10103930 | Ga0157374_101039302 | 155 |
| 617 | 3300013307 | Ga0157372_10235992 | Ga0157372_102359923 | 155 |
| 618 | 3300013307 | Ga0157372_11621896 | Ga0157372_116218962 | 155 |
| 619 | 3300013308 | Ga0157375_10563447 | Ga0157375_105634472 | 155 |
| 620 | 3300014969 | Ga0157376_10541882 | Ga0157376_105418823 | 155 |
| 621 | 3300025297 | Ga0209758_1001054 | Ga0209758_100105410 | 155 |
| 622 | 3300025297 | Ga0209758_1002780 | Ga0209758_100278015 | 155 |
| 623 | 3300025904 | Ga0207647_10532394 | Ga0207647_105323942 | 155 |
| 624 | 3300025906 | Ga0207699_10016926 | Ga0207699_100169262 | 155 |
| 625 | 3300025909 | Ga0207705_10163730 | Ga0207705_101637302 | 155 |
| 626 | 3300025910 | Ga0207684_10211034 | Ga0207684_102110343 | 155 |
| 627 | 3300025910 | Ga0207684_10495332 | Ga0207684_104953322 | 155 |
| 628 | 3300025911 | Ga0207654_10132691 | Ga0207654_101326913 | 155 |
| 629 | 3300025912 | Ga0207707_10000639 | Ga0207707_100006394 | 155 |
| 630 | 3300025912 | Ga0207707_10024022 | Ga0207707_100240227 | 155 |
| 631 | 3300025912 | Ga0207707_10024564 | Ga0207707_100245644 | 155 |
| 632 | 3300025912 | Ga0207707_10176437 | Ga0207707_101764372 | 155 |
| 633 | 3300025913 | Ga0207695_10512086 | Ga0207695_105120863 | 155 |
| 634 | 3300025915 | Ga0207693_10008491 | Ga0207693_100084918 | 155 |
| 635 | 3300025916 | Ga0207663_10022545 | Ga0207663_100225454 | 155 |
| 636 | 3300025916 | Ga0207663_10725516 | Ga0207663_107255161 | 155 |
| 637 | 3300025917 | Ga0207660_10454669 | Ga0207660_104546692 | 155 |
| 638 | 3300025917 | Ga0207660_10458137 | Ga0207660_104581372 | 155 |
| 639 | 3300025917 | Ga0207660_10681471 | Ga0207660_106814711 | 155 |
| 640 | 3300025919 | Ga0207657_10021043 | Ga0207657_100210434 | 155 |
| 641 | 3300025920 | Ga0207649_10858982 | Ga0207649_108589822 | 155 |
| 642 | 3300025921 | Ga0207652_10016814 | Ga0207652_100168144 | 155 |
| 643 | 3300025921 | Ga0207652_10100694 | Ga0207652_101006944 | 155 |
| 644 | 3300025921 | Ga0207652_10326519 | Ga0207652_103265193 | 155 |
| 645 | 3300025921 | Ga0207652_10642824 | Ga0207652_106428242 | 155 |
| 646 | 3300025922 | Ga0207646_10975034 | Ga0207646_109750341 | 155 |
| 647 | 3300025924 | Ga0207694_10073031 | Ga0207694_100730314 | 155 |
| 648 | 3300025927 | Ga0207687_10174581 | Ga0207687_101745812 | 155 |
| 649 | 3300025927 | Ga0207687_10411633 | Ga0207687_104116332 | 155 |
| 650 | 3300025928 | Ga0207700_10002691 | Ga0207700_100026912 | 155 |
| 651 | 3300025928 | Ga0207700_10032084 | Ga0207700_100320845 | 155 |
| 652 | 3300025928 | Ga0207700_10062218 | Ga0207700_100622182 | 155 |
| 653 | 3300025928 | Ga0207700_10836562 | Ga0207700_108365622 | 155 |
| 654 | 3300025929 | Ga0207664_10056194 | Ga0207664_100561944 | 155 |
| 655 | 3300025929 | Ga0207664_10505021 | Ga0207664_105050212 | 155 |
| 656 | 3300025932 | Ga0207690_10390622 | Ga0207690_103906223 | 155 |
| 657 | 3300025934 | Ga0207686_10911224 | Ga0207686_109112242 | 155 |
| 658 | 3300025939 | Ga0207665_10184037 | Ga0207665_101840372 | 155 |
| 659 | 3300025944 | Ga0207661_10000597 | Ga0207661_1000059717 | 155 |
| 660 | 3300025944 | Ga0207661_10003825 | Ga0207661_100038255 | 155 |
| 661 | 3300025949 | Ga0207667_10225941 | Ga0207667_102259412 | 155 |
| 662 | 3300025981 | Ga0207640_10470771 | Ga0207640_104707712 | 155 |
| 663 | 3300026041 | Ga0207639_10133372 | Ga0207639_101333722 | 155 |
| 664 | 3300026041 | Ga0207639_10187867 | Ga0207639_101878672 | 155 |
| 665 | 3300026078 | Ga0207702_10487189 | Ga0207702_104871893 | 155 |
| 666 | 3300026078 | Ga0207702_11162830 | Ga0207702_111628301 | 155 |
| 667 | 3300026095 | Ga0207676_11540864 | Ga0207676_115408642 | 155 |
| 668 | 3300026116 | Ga0207674_10133883 | Ga0207674_101338833 | 155 |
| 669 | 3300026118 | Ga0207675_100071818 | Ga0207675_1000718184 | 155 |
| 670 | 3300028379 | Ga0268266_10214036 | Ga0268266_102140363 | 155 |
| 671 | 3300031247 | Ga0265340_10146059 | Ga0265340_101460592 | 155 |
| 672 | 3300031249 | Ga0265339_10011190 | Ga0265339_100111903 | 155 |
| 673 | 3300031548 | Ga0307408_100103881 | Ga0307408_1001038813 | 155 |
| 674 | 3300031548 | Ga0307408_100282708 | Ga0307408_1002827082 | 155 |
| 675 | 3300031731 | Ga0307405_11793061 | Ga0307405_117930611 | 155 |
| 676 | 3300031901 | Ga0307406_10213010 | Ga0307406_102130102 | 155 |
| 677 | 3300031903 | Ga0307407_10299857 | Ga0307407_102998573 | 155 |
| 678 | 3300031911 | Ga0307412_10323819 | Ga0307412_103238192 | 155 |
| 679 | 3300031911 | Ga0307412_10405536 | Ga0307412_104055362 | 155 |
| 680 | 3300032002 | Ga0307416_100258607 | Ga0307416_1002586072 | 155 |
| 681 | 3300032002 | Ga0307416_101000808 | Ga0307416_1010008082 | 155 |
| 682 | 3300035086 | Ga0373934_0030845 | Ga0373934_0030845_651_1118 | 155 |
| 683 | 3300035111 | Ga0373923_0050621 | Ga0373923_0050621_865_1332 | 155 |
| 684 | 3300035113 | Ga0373936_0012238 | Ga0373936_0012238_61_528 | 155 |
| 685 | 3300035113 | Ga0373936_0012556 | Ga0373936_0012556_943_1422 | 155 |
| 686 | 3300035113 | Ga0373936_0217644 | Ga0373936_0217644_291_761 | 155 |
| 687 | 3300035116 | Ga0373945_0263175 | Ga0373945_0263175_68_535 | 155 |
| 688 | 3300035117 | Ga0373953_0193641 | Ga0373953_0193641_346_813 | 155 |
| 689 | 3300035118 | Ga0373954_0010065 | Ga0373954_0010065_2459_2926 | 155 |
| 690 | 3300035119 | Ga0373956_0009126 | Ga0373956_0009126_1524_2093 | 155 |
| 691 | 3300035170 | Ga0373943_0296331 | Ga0373943_0296331_210_677 | 155 |
| 692 | 3300035171 | Ga0373946_0345272 | Ga0373946_0345272_75_542 | 155 |
| 693 | 3300035410 | Ga0373924_0083274 | Ga0373924_0083274_807_1274 | 155 |
| 694 | 3300035691 | Ga0373931_0184041 | Ga0373931_0184041_374_841 | 155 |
| 695 | 3300035695 | Ga0373927_0086107 | Ga0373927_0086107_1226_1693 | 155 |
| 696 | 3300035695 | Ga0373927_0088015 | Ga0373927_0088015_1232_1699 | 155 |
| 697 | 3300035724 | Ga0373933_0112940 | Ga0373933_0112940_465_932 | 155 |
| 698 | 3300035725 | Ga0373947_0019419 | Ga0373947_0019419_2454_2921 | 155 |
| 699 | 3300036401 | Ga0373937_0089005 | Ga0373937_0089005_244_711 | 155 |
| 700 | 3300037068 | Ga0373925_0117436 | Ga0373925_0117436_1416_1883 | 155 |
| 701 | 3300037068 | Ga0373925_0742516 | Ga0373925_0742516_48_515 | 155 |
| 702 | 3300037068 | Ga0373925_0812531 | Ga0373925_0812531_291_758 | 155 |
| 703 | 3300037312 | Ga0395899_0022031 | Ga0395899_0022031_2437_2904 | 155 |
| 704 | 3300037418 | Ga0395900_0220560 | Ga0395900_0220560_624_1091 | 155 |
| 705 | 3300037466 | Ga0395898_0075786 | Ga0395898_0075786_984_1451 | 155 |
| 706 | 3300037466 | Ga0395898_0095429 | Ga0395898_0095429_2259_2726 | 155 |
| 707 | 3300037471 | Ga0395905_0240916 | Ga0395905_0240916_1192_1659 | 155 |
| 708 | 3300038443 | Ga0395901_0037019 | Ga0395901_0037019_925_1398 | 155 |
| 709 | 3300038443 | Ga0395901_1561973 | Ga0395901_1561973_25_498 | 155 |
| 710 | 3300039437 | Ga0436365_1681445 | Ga0436365_1681445_200_667 | 155 |
| 711 | 3300041451 | Ga0451791_1805681 | Ga0451791_1805681_68_535 | 155 |
| 712 | 3300041512 | Ga0451853_1968490 | Ga0451853_1968490_88_555 | 155 |
| 713 | 3300042007 | Ga0439449_0209599 | Ga0439449_0209599_29_496 | 155 |
| 714 | 3300042157 | Ga0439458_0092731 | Ga0439458_0092731_74_541 | 155 |
| 715 | 3300042435 | Ga0439434_0070879 | Ga0439434_0070879_117_587 | 155 |
| 716 | 3300044656 | Ga0466969_0510267 | Ga0466969_0510267_46_513 | 155 |
| 717 | 3300044683 | Ga0466965_0339797 | Ga0466965_0339797_301_768 | 155 |
| 718 | 3300044684 | Ga0466966_0202043 | Ga0466966_0202043_109_576 | 155 |
| 719 | 3300044694 | Ga0466963_0137523 | Ga0466963_0137523_833_1300 | 155 |
| 720 | 3300044706 | Ga0466964_0020730 | Ga0466964_0020730_696_1163 | 155 |
| 721 | 3300044706 | Ga0466964_0455000 | Ga0466964_0455000_191_658 | 155 |
| 722 | 3300044735 | Ga0466968_0174337 | Ga0466968_0174337_402_869 | 155 |
| 723 | 3300044765 | Ga0466970_0165229 | Ga0466970_0165229_489_956 | 155 |
| 724 | 3300044842 | Ga0466957_0031026 | Ga0466957_0031026_982_1449 | 155 |
| 725 | 3300045049 | Ga0466959_0294799 | Ga0466959_0294799_375_842 | 155 |
| 726 | 3300045836 | Ga0466958_0797522 | Ga0466958_0797522_138_605 | 155 |
| 727 | 3300045976 | Ga0466967_0399194 | Ga0466967_0399194_311_778 | 155 |
| 728 | 3300046452 | Ga0495617_084425 | Ga0495617_084425_512_979 | 155 |
| 729 | 3300046454 | Ga0495592_0213048 | Ga0495592_0213048_699_1166 | 155 |
| 730 | 3300046455 | Ga0495603_0040174 | Ga0495603_0040174_1151_1618 | 155 |
| 731 | 3300046455 | Ga0495603_0083928 | Ga0495603_0083928_963_1430 | 155 |
| 732 | 3300046459 | Ga0495629_0161770 | Ga0495629_0161770_704_1171 | 155 |
| 733 | 3300046461 | Ga0495641_0394580 | Ga0495641_0394580_126_593 | 155 |
| 734 | 3300046462 | Ga0495651_0133048 | Ga0495651_0133048_861_1328 | 155 |
| 735 | 3300046473 | Ga0495582_0061701 | Ga0495582_0061701_697_1164 | 155 |
| 736 | 3300046474 | Ga0495605_0094492 | Ga0495605_0094492_654_1121 | 155 |
| 737 | 3300046476 | Ga0495662_0017465 | Ga0495662_0017465_996_1463 | 155 |
| 738 | 3300046477 | Ga0495664_0012897 | Ga0495664_0012897_623_1090 | 155 |
| 739 | 3300046477 | Ga0495664_0042373 | Ga0495664_0042373_169_636 | 155 |
| 740 | 3300046491 | Ga0495584_0080654 | Ga0495584_0080654_527_994 | 155 |
| 741 | 3300046492 | Ga0495585_0122722 | Ga0495585_0122722_689_1156 | 155 |
| 742 | 3300046499 | Ga0495594_0033206 | Ga0495594_0033206_1537_2004 | 155 |
| 743 | 3300046507 | Ga0495606_0013747 | Ga0495606_0013747_3899_4366 | 155 |
| 744 | 3300046507 | Ga0495606_0036782 | Ga0495606_0036782_717_1184 | 155 |
| 745 | 3300046511 | Ga0495608_0327791 | Ga0495608_0327791_393_860 | 155 |
| 746 | 3300046514 | Ga0495618_0285470 | Ga0495618_0285470_216_683 | 155 |
| 747 | 3300046516 | Ga0495628_0137002 | Ga0495628_0137002_1092_1559 | 155 |
| 748 | 3300046517 | Ga0495630_0105716 | Ga0495630_0105716_1273_1740 | 155 |
| 749 | 3300046519 | Ga0495632_0438603 | Ga0495632_0438603_69_536 | 155 |
| 750 | 3300046520 | Ga0495637_0160430 | Ga0495637_0160430_22_489 | 155 |
| 751 | 3300046526 | Ga0495666_0231310 | Ga0495666_0231310_261_728 | 155 |
| 752 | 3300046529 | Ga0495652_0041488 | Ga0495652_0041488_106_573 | 155 |
| 753 | 3300046531 | Ga0495665_0080877 | Ga0495665_0080877_435_902 | 155 |
| 754 | 3300046533 | Ga0495640_0025055 | Ga0495640_0025055_1181_1648 | 155 |
| 755 | 3300046536 | Ga0495587_0297520 | Ga0495587_0297520_405_872 | 155 |
| 756 | 3300046537 | Ga0495598_0136058 | Ga0495598_0136058_225_692 | 155 |
| 757 | 3300046557 | Ga0495622_0131374 | Ga0495622_0131374_252_719 | 155 |
| 758 | 3300046559 | Ga0495667_0171847 | Ga0495667_0171847_216_683 | 155 |
| 759 | 3300046615 | Ga0495656_0059991 | Ga0495656_0059991_722_1189 | 155 |
| 760 | 3300046642 | Ga0495634_0029686 | Ga0495634_0029686_2510_2977 | 155 |
| 761 | 3300046648 | Ga0495611_0153748 | Ga0495611_0153748_212_679 | 155 |
| 762 | 3300046663 | Ga0495635_0042880 | Ga0495635_0042880_1626_2093 | 155 |
| 763 | 3300046664 | Ga0495659_0155873 | Ga0495659_0155873_354_821 | 155 |
| 764 | 3300046665 | Ga0495661_0125659 | Ga0495661_0125659_49_516 | 155 |
| 765 | 3300046674 | Ga0495588_0046148 | Ga0495588_0046148_372_839 | 155 |
| 766 | 3300046678 | Ga0495599_0025746 | Ga0495599_0025746_645_1112 | 155 |
| 767 | 3300046679 | Ga0495623_0045525 | Ga0495623_0045525_1370_1837 | 155 |
| 768 | 3300046680 | Ga0495646_0038559 | Ga0495646_0038559_304_771 | 155 |
| 769 | 3300046681 | Ga0495647_0238377 | Ga0495647_0238377_316_783 | 155 |
| 770 | 3300046683 | Ga0495658_0004213 | Ga0495658_0004213_5315_5782 | 155 |
| 771 | 3300046689 | Ga0495613_0250127 | Ga0495613_0250127_106_573 | 155 |
| 772 | 3300046690 | Ga0495624_0278865 | Ga0495624_0278865_104_571 | 155 |
| 773 | 3300046794 | Ga0495589_0263572 | Ga0495589_0263572_109_576 | 155 |
| 774 | 3300046809 | Ga0495600_0146398 | Ga0495600_0146398_999_1466 | 155 |
| 775 | 3300047315 | Ga0495581_0096406 | Ga0495581_0096406_700_1167 | 155 |
| 776 | 3300047315 | Ga0495581_0545244 | Ga0495581_0545244_78_545 | 155 |
| 777 | 3300047317 | Ga0495604_0123964 | Ga0495604_0123964_1048_1515 | 155 |
| 778 | 3300047319 | Ga0495674_0010664 | Ga0495674_0010664_5568_6035 | 155 |
| 779 | 3300047321 | Ga0495676_0124171 | Ga0495676_0124171_906_1373 | 155 |
| 780 | 3300047322 | Ga0495680_0955569 | Ga0495680_0955569_32_499 | 155 |
| 781 | 3300047471 | Ga0495684_0565957 | Ga0495684_0565957_158_625 | 155 |
| 782 | 3300047673 | Ga0495593_0127162 | Ga0495593_0127162_639_1106 | 155 |
| 783 | 3300048904 | Ga0496101_0045702 | Ga0496101_0045702_176_643 | 155 |
| 784 | 3300048907 | Ga0496104_0051086 | Ga0496104_0051086_1009_1476 | 155 |
| 785 | 3300048908 | Ga0496105_0037583 | Ga0496105_0037583_3010_3477 | 155 |
| 786 | 3300048908 | Ga0496105_0154331 | Ga0496105_0154331_561_1028 | 155 |
| 787 | 3300048909 | Ga0496106_0009424 | Ga0496106_0009424_2498_2965 | 155 |
| 788 | 3300048909 | Ga0496106_0541949 | Ga0496106_0541949_153_620 | 155 |
| 789 | 3300048910 | Ga0496107_0029043 | Ga0496107_0029043_2410_2877 | 155 |
| 790 | 3300048910 | Ga0496107_0252868 | Ga0496107_0252868_394_861 | 155 |
| 791 | 3300048911 | Ga0496108_0003416 | Ga0496108_0003416_5059_5526 | 155 |
| 792 | 3300048911 | Ga0496108_1335158 | Ga0496108_1335158_91_558 | 155 |
| 793 | 3300048912 | Ga0496109_0000230 | Ga0496109_0000230_20374_20841 | 155 |
| 794 | 3300048912 | Ga0496109_0296021 | Ga0496109_0296021_961_1428 | 155 |
| 795 | 3300048913 | Ga0496110_0037897 | Ga0496110_0037897_3356_3823 | 155 |
| 796 | 3300048914 | Ga0496111_0095892 | Ga0496111_0095892_347_814 | 155 |
| 797 | 3300048914 | Ga0496111_0167656 | Ga0496111_0167656_342_809 | 155 |
| 798 | 3300048915 | Ga0496112_0000023 | Ga0496112_0000023_97920_98387 | 155 |
| 799 | 3300048915 | Ga0496112_0051672 | Ga0496112_0051672_1574_2041 | 155 |
| 800 | 3300048915 | Ga0496112_0247487 | Ga0496112_0247487_986_1453 | 155 |
| 801 | 3300048915 | Ga0496112_0863182 | Ga0496112_0863182_158_625 | 155 |
| 802 | 3300048916 | Ga0496113_0044231 | Ga0496113_0044231_1983_2450 | 155 |
| 803 | 3300048916 | Ga0496113_0741359 | Ga0496113_0741359_27_494 | 155 |
| 804 | 3300048916 | Ga0496113_0776289 | Ga0496113_0776289_153_620 | 155 |
| 805 | 3300048918 | Ga0496115_0115921 | Ga0496115_0115921_1726_2193 | 155 |
| 806 | 3300048924 | Ga0496121_0096769 | Ga0496121_0096769_506_973 | 155 |
| 807 | 3300048924 | Ga0496121_0163999 | Ga0496121_0163999_425_892 | 155 |
| 808 | 3300048925 | Ga0496122_0177917 | Ga0496122_0177917_429_896 | 155 |
| 809 | 3300048926 | Ga0496123_0115803 | Ga0496123_0115803_195_662 | 155 |
| 810 | 3300048929 | Ga0496126_0001668 | Ga0496126_0001668_15790_16257 | 155 |
| 811 | 3300048929 | Ga0496126_0067286 | Ga0496126_0067286_2677_3144 | 155 |
| 812 | 3300048929 | Ga0496126_0082223 | Ga0496126_0082223_1221_1688 | 155 |
| 813 | 3300049570 | Ga0501033_1008156 | Ga0501033_1008156_75_542 | 155 |
| 814 | 3300049571 | Ga0501034_0029843 | Ga0501034_0029843_4642_5115 | 155 |
| 815 | 3300049571 | Ga0501034_0477166 | Ga0501034_0477166_385_852 | 155 |
| 816 | 3300049571 | Ga0501034_0689230 | Ga0501034_0689230_218_685 | 155 |
| 817 | 3300049572 | Ga0501036_0062678 | Ga0501036_0062678_405_872 | 155 |
| 818 | 3300049572 | Ga0501036_0227627 | Ga0501036_0227627_538_1011 | 155 |
| 819 | 3300049572 | Ga0501036_0321869 | Ga0501036_0321869_529_999 | 155 |
| 820 | 3300049574 | Ga0501038_0016736 | Ga0501038_0016736_1508_1981 | 155 |
| 821 | 3300049574 | Ga0501038_0118182 | Ga0501038_0118182_1017_1484 | 155 |
| 822 | 3300049574 | Ga0501038_0511913 | Ga0501038_0511913_333_800 | 155 |
| 823 | 3300049575 | Ga0501039_0823912 | Ga0501039_0823912_48_515 | 155 |
| 824 | 3300049579 | Ga0501043_0033958 | Ga0501043_0033958_574_1044 | 155 |
| 825 | 3300049579 | Ga0501043_0061576 | Ga0501043_0061576_2328_2801 | 155 |
| 826 | 3300049580 | Ga0501046_0046532 | Ga0501046_0046532_1700_2173 | 155 |
| 827 | 3300049580 | Ga0501046_0532555 | Ga0501046_0532555_149_619 | 155 |
| 828 | 3300049581 | Ga0501047_0518470 | Ga0501047_0518470_265_735 | 155 |
| 829 | 3300049581 | Ga0501047_1029865 | Ga0501047_1029865_80_547 | 155 |
| 830 | 3300049582 | Ga0501048_0178310 | Ga0501048_0178310_495_968 | 155 |
| 831 | 3300049583 | Ga0501067_0517976 | Ga0501067_0517976_178_645 | 155 |
| 832 | 3300049586 | Ga0501070_0123066 | Ga0501070_0123066_894_1364 | 155 |
| 833 | 3300049586 | Ga0501070_0791160 | Ga0501070_0791160_100_567 | 155 |
| 834 | 3300049589 | Ga0501073_0328235 | Ga0501073_0328235_546_1013 | 155 |
| 835 | 3300049592 | Ga0501076_0430103 | Ga0501076_0430103_40_507 | 155 |
| 836 | 3300049742 | Ga0501080_1031031 | Ga0501080_1031031_179_646 | 155 |
| 837 | 3300049822 | Ga0501035_0123022 | Ga0501035_0123022_463_936 | 155 |
| 838 | 3300049822 | Ga0501035_0180904 | Ga0501035_0180904_897_1364 | 155 |
| 839 | 3300049822 | Ga0501035_0184970 | Ga0501035_0184970_664_1131 | 155 |
| 840 | 3300049823 | Ga0501044_0197232 | Ga0501044_0197232_561_1028 | 155 |
| 841 | 3300049823 | Ga0501044_0256635 | Ga0501044_0256635_346_816 | 155 |
| 842 | 3300049823 | Ga0501044_1307154 | Ga0501044_1307154_108_575 | 155 |
| 843 | 3300050489 | nmdc:mga03683_302163_c1 | nmdc:mga03683_302163_c1_99_566 | 155 |
| 844 | 3300050490 | nmdc:mga03n38_414661_c1 | nmdc:mga03n38_414661_c1_95_562 | 155 |
| 845 | 3300050491 | nmdc:mga00v17_22168_c1 | nmdc:mga00v17_22168_c1_923_1390 | 155 |
| 846 | 3300050492 | nmdc:mga0yw44_269901_c1 | nmdc:mga0yw44_269901_c1_259_729 | 155 |
| 847 | 3300050492 | nmdc:mga0yw44_39126_c1 | nmdc:mga0yw44_39126_c1_362_829 | 155 |
| 848 | 3300050507 | nmdc:mga05p37_49917_c1 | nmdc:mga05p37_49917_c1_429_896 | 155 |
| 849 | 3300050512 | nmdc:mga0n895_1560245_c1 | nmdc:mga0n895_1560245_c1_21_512 | 155 |
| 850 | 3300053077 | Ga0495601_0134905 | Ga0495601_0134905_782_1249 | 155 |
| 851 | 3300053077 | Ga0495601_0287726 | Ga0495601_0287726_347_814 | 155 |
| 852 | 3300053078 | Ga0495612_0005522 | Ga0495612_0005522_88_555 | 155 |
| 853 | 3300053078 | Ga0495612_0095023 | Ga0495612_0095023_543_1010 | 155 |
| 854 | 3300053086 | Ga0500578_0227945 | Ga0500578_0227945_626_1093 | 155 |
| 855 | 3300053090 | Ga0500646_0126378 | Ga0500646_0126378_192_659 | 155 |
| 856 | 3300053091 | Ga0500647_0004996 | Ga0500647_0004996_1782_2294 | 155 |
| 857 | 3300053094 | Ga0500566_0001383 | Ga0500566_0001383_2522_3001 | 155 |
| 858 | 3300053095 | Ga0500640_000887 | Ga0500640_000887_5813_6292 | 155 |
| 859 | 3300053099 | Ga0500654_189502 | Ga0500654_189502_87_554 | 155 |
| 860 | 3300053111 | Ga0500572_000174 | Ga0500572_000174_13777_14256 | 155 |
| 861 | 3300053115 | Ga0500591_041509 | Ga0500591_041509_96_575 | 155 |
| 862 | 3300053123 | Ga0500614_000189 | Ga0500614_000189_8471_8950 | 155 |
| 863 | 3300053136 | Ga0500559_0004947 | Ga0500559_0004947_2644_3123 | 155 |
| 864 | 3300053150 | Ga0500603_001702 | Ga0500603_001702_2798_3277 | 155 |
| 865 | 3300053159 | Ga0500630_005291 | Ga0500630_005291_5760_6239 | 155 |
| 866 | 3300053162 | Ga0500638_077692 | Ga0500638_077692_657_1136 | 155 |
| 867 | 3300053163 | Ga0500639_000006 | Ga0500639_000006_55627_56106 | 155 |
| 868 | 3300053177 | Ga0500636_0118335 | Ga0500636_0118335_572_1084 | 155 |
| 869 | 3300053177 | Ga0500636_0144829 | Ga0500636_0144829_138_611 | 155 |
| 870 | 3300053177 | Ga0500636_0159348 | Ga0500636_0159348_367_834 | 155 |
| 871 | 3300053729 | Ga0500625_083401 | Ga0500625_083401_84_596 | 155 |
| 872 | 3300053735 | Ga0500596_000164 | Ga0500596_000164_1074_1553 | 155 |
| 873 | 3300053737 | Ga0500601_019200 | Ga0500601_019200_259_738 | 155 |
| 874 | 3300054114 | Ga0501084_0485945 | Ga0501084_0485945_509_976 | 155 |
| 875 | 3300060353 | Ga0501082_2037885 | Ga0501082_2037885_17_484 | 155 |
| 876 | 3300061719 | Ga0466962_0387303 | Ga0466962_0387303_18_485 | 155 |
| 877 | 3300005327 | Ga0070658_11314671 | Ga0070658_113146711 | 156 |
| 878 | 3300005347 | Ga0070668_100094816 | Ga0070668_1000948163 | 156 |
| 879 | 3300005439 | Ga0070711_101397920 | Ga0070711_1013979201 | 156 |
| 880 | 3300005455 | Ga0070663_100038779 | Ga0070663_1000387794 | 156 |
| 881 | 3300005563 | Ga0068855_100521862 | Ga0068855_1005218622 | 156 |
| 882 | 3300005841 | Ga0068863_100600212 | Ga0068863_1006002122 | 156 |
| 883 | 3300009148 | Ga0105243_10269958 | Ga0105243_102699583 | 156 |
| 884 | 3300013308 | Ga0157375_10373591 | Ga0157375_103735912 | 156 |
| 885 | 3300014968 | Ga0157379_11048051 | Ga0157379_110480512 | 156 |
| 886 | 3300014969 | Ga0157376_10145645 | Ga0157376_101456453 | 156 |
| 887 | 3300025916 | Ga0207663_10935281 | Ga0207663_109352811 | 156 |
| 888 | 3300025949 | Ga0207667_10738197 | Ga0207667_107381972 | 156 |
| 889 | 3300026035 | Ga0207703_10761331 | Ga0207703_107613312 | 156 |
| 890 | 3300026041 | Ga0207639_11258065 | Ga0207639_112580651 | 156 |
| 891 | 3300026067 | Ga0207678_10070164 | Ga0207678_100701643 | 156 |
| 892 | 3300037853 | Ga0436364_0634277 | Ga0436364_0634277_4480_4986 | 156 |
| 893 | 3300046455 | Ga0495603_0168829 | Ga0495603_0168829_464_961 | 156 |
| 894 | 3300046457 | Ga0495590_0197288 | Ga0495590_0197288_113_610 | 156 |
| 895 | 3300046474 | Ga0495605_0049578 | Ga0495605_0049578_1233_1730 | 156 |
| 896 | 3300046499 | Ga0495594_0190016 | Ga0495594_0190016_251_748 | 156 |
| 897 | 3300046538 | Ga0495609_0142037 | Ga0495609_0142037_255_752 | 156 |
| 898 | 3300046665 | Ga0495661_0110146 | Ga0495661_0110146_67_564 | 156 |
| 899 | 3300046794 | Ga0495589_0239870 | Ga0495589_0239870_339_836 | 156 |
| 900 | 3300048909 | Ga0496106_0037654 | Ga0496106_0037654_2940_3437 | 156 |
| 901 | 3300048911 | Ga0496108_0370162 | Ga0496108_0370162_710_1207 | 156 |
| 902 | 3300048913 | Ga0496110_0497187 | Ga0496110_0497187_210_707 | 156 |
| 903 | 3300048914 | Ga0496111_0210917 | Ga0496111_0210917_350_847 | 156 |
| 904 | 3300048916 | Ga0496113_0243906 | Ga0496113_0243906_737_1234 | 156 |
| 905 | 3300048918 | Ga0496115_0095262 | Ga0496115_0095262_781_1278 | 156 |
| 906 | 3300048919 | Ga0496116_0018120 | Ga0496116_0018120_4726_5223 | 156 |
| 907 | 3300048922 | Ga0496119_0047831 | Ga0496119_0047831_1616_2113 | 156 |
| 908 | 3300048929 | Ga0496126_0379786 | Ga0496126_0379786_291_788 | 156 |
| 909 | iso_pu_bacteria | 2513237095 | 2513651028 | 156 |
| 910 | iso_pu_bacteria | 2816332527 | 2818242256 | 156 |
| 911 | iso_pu_bacteria | 2888378607 | 2888387455 | 156 |
| 912 | iso_pu_bacteria | 2929615660 | 2929620057 | 156 |
| 913 | iso_pu_bacteria | 2929624759 | 2929629370 | 156 |
| 914 | iso_pu_bacteria | 2932784394 | 2932789500 | 156 |
| 915 | iso_pu_bacteria | 2932828146 | 2932834123 | 156 |
| 916 | iso_pu_bacteria | 2933577622 | 2933581975 | 156 |
| 917 | iso_pu_bacteria | 2935616580 | 2935623488 | 156 |
| 918 | iso_pu_bacteria | 2935638405 | 2935644856 | 156 |
| 919 | iso_pu_bacteria | 2935665750 | 2935671924 | 156 |
| 920 | iso_pu_bacteria | 2935703347 | 2935710999 | 156 |
| 921 | iso_pu_bacteria | 2935801545 | 2935808588 | 156 |
| 922 | iso_pu_bacteria | 2935827899 | 2935834298 | 156 |
| 923 | iso_pu_bacteria | 2935837841 | 2935844881 | 156 |
| 924 | iso_pu_bacteria | 2935855204 | 2935861905 | 156 |
| 925 | iso_pu_bacteria | 2935864058 | 2935868460 | 156 |
| 926 | iso_pu_bacteria | 2935873716 | 2935879234 | 156 |
| 927 | iso_pu_bacteria | 2935992306 | 2935998599 | 156 |
| 928 | iso_pu_bacteria | 2936002035 | 2936008940 | 156 |
| 929 | iso_pu_bacteria | 2941538514 | 2941545225 | 156 |
| 930 | iso_pu_bacteria | 8016511872 | 8016519408 | 156 |
| 931 | iso_pu_bacteria | 8017057580 | 8017066112 | 156 |
| 932 | iso_pu_bacteria | 8019576017 | 8019578518 | 156 |
| 933 | iso_pu_bacteria | 8019586578 | 8019596567 | 156 |
| 934 | iso_pu_bacteria | 8019597564 | 8019605138 | 156 |
| 935 | iso_pu_bacteria | 8019608314 | 8019613402 | 156 |
| 936 | iso_pu_bacteria | 8055742211 | 8055750190 | 156 |
| 937 | 3300009551 | Ga0105238_11236310 | Ga0105238_112363102 | 157 |
| 938 | 3300021361 | Ga0213872_10072452 | Ga0213872_100724523 | 157 |
| 939 | 3300005339 | Ga0070660_100078092 | Ga0070660_1000780923 | 158 |
| 940 | 3300005366 | Ga0070659_101009164 | Ga0070659_1010091641 | 158 |
| 941 | 3300005435 | Ga0070714_100018377 | Ga0070714_1000183774 | 158 |
| 942 | 3300005440 | Ga0070705_100062949 | Ga0070705_1000629492 | 158 |
| 943 | 3300005455 | Ga0070663_100455062 | Ga0070663_1004550622 | 158 |
| 944 | 3300005547 | Ga0070693_100481805 | Ga0070693_1004818051 | 158 |
| 945 | 3300005564 | Ga0070664_100488511 | Ga0070664_1004885113 | 158 |
| 946 | 3300005564 | Ga0070664_101077163 | Ga0070664_1010771631 | 158 |
| 947 | 3300005577 | Ga0068857_100079354 | Ga0068857_1000793545 | 158 |
| 948 | 3300005618 | Ga0068864_101186835 | Ga0068864_1011868352 | 158 |
| 949 | 3300005834 | Ga0068851_10236656 | Ga0068851_102366562 | 158 |
| 950 | 3300006028 | Ga0070717_10000817 | Ga0070717_1000081716 | 158 |
| 951 | 3300006163 | Ga0070715_10002395 | Ga0070715_100023954 | 158 |
| 952 | 3300006175 | Ga0070712_100056602 | Ga0070712_1000566025 | 158 |
| 953 | 3300006353 | Ga0075370_10292155 | Ga0075370_102921552 | 158 |
| 954 | 3300006871 | Ga0075434_100303038 | Ga0075434_1003030382 | 158 |
| 955 | 3300006881 | Ga0068865_100055918 | Ga0068865_1000559183 | 158 |
| 956 | 3300009545 | Ga0105237_10698814 | Ga0105237_106988142 | 158 |
| 957 | 3300025905 | Ga0207685_10177100 | Ga0207685_101771003 | 158 |
| 958 | 3300025906 | Ga0207699_10002060 | Ga0207699_100020602 | 158 |
| 959 | 3300025907 | Ga0207645_10031831 | Ga0207645_100318315 | 158 |
| 960 | 3300025909 | Ga0207705_10040190 | Ga0207705_100401903 | 158 |
| 961 | 3300025911 | Ga0207654_10050717 | Ga0207654_100507173 | 158 |
| 962 | 3300025915 | Ga0207693_10018411 | Ga0207693_100184112 | 158 |
| 963 | 3300025917 | Ga0207660_10069657 | Ga0207660_100696572 | 158 |
| 964 | 3300025919 | Ga0207657_10065938 | Ga0207657_100659383 | 158 |
| 965 | 3300025921 | Ga0207652_10124141 | Ga0207652_101241414 | 158 |
| 966 | 3300025928 | Ga0207700_10000623 | Ga0207700_1000062320 | 158 |
| 967 | 3300025929 | Ga0207664_10014641 | Ga0207664_100146414 | 158 |
| 968 | 3300025931 | Ga0207644_10074843 | Ga0207644_100748432 | 158 |
| 969 | 3300025939 | Ga0207665_10614057 | Ga0207665_106140572 | 158 |
| 970 | 3300025944 | Ga0207661_10022549 | Ga0207661_100225496 | 158 |
| 971 | 3300025945 | Ga0207679_10097968 | Ga0207679_100979684 | 158 |
| 972 | 3300025945 | Ga0207679_10365183 | Ga0207679_103651832 | 158 |
| 973 | 3300025961 | Ga0207712_10067877 | Ga0207712_100678772 | 158 |
| 974 | 3300025981 | Ga0207640_10742946 | Ga0207640_107429462 | 158 |
| 975 | 3300026041 | Ga0207639_10458548 | Ga0207639_104585482 | 158 |
| 976 | 3300026067 | Ga0207678_10010726 | Ga0207678_100107264 | 158 |
| 977 | 3300026088 | Ga0207641_10962213 | Ga0207641_109622132 | 158 |
| 978 | 3300026116 | Ga0207674_10578941 | Ga0207674_105789412 | 158 |
| 979 | 3300026142 | Ga0207698_10268494 | Ga0207698_102684942 | 158 |
| 980 | 3300035724 | Ga0373933_0000964 | Ga0373933_0000964_6596_7078 | 158 |
| 981 | 3300041443 | Ga0451789_0127710 | Ga0451789_0127710_522_998 | 158 |
| 982 | 3300041452 | Ga0451793_0888562 | Ga0451793_0888562_85_561 | 158 |
| 983 | 3300041453 | Ga0451797_0233450 | Ga0451797_0233450_123_599 | 158 |
| 984 | 3300041459 | Ga0451800_1372925 | Ga0451800_1372925_443_919 | 158 |
| 985 | 3300041491 | Ga0451833_1352607 | Ga0451833_1352607_393_869 | 158 |
| 986 | 3300041496 | Ga0451839_0986530 | Ga0451839_0986530_109_585 | 158 |
| 987 | 3300041498 | Ga0451841_0715077 | Ga0451841_0715077_380_856 | 158 |
| 988 | 3300041509 | Ga0451843_0408316 | Ga0451843_0408316_295_771 | 158 |
| 989 | 3300041512 | Ga0451853_0421108 | Ga0451853_0421108_239_715 | 158 |
| 990 | 3300046507 | Ga0495606_0202643 | Ga0495606_0202643_637_1113 | 158 |
| 991 | 3300046675 | Ga0495657_0507571 | Ga0495657_0507571_144_620 | 158 |
| 992 | 3300048908 | Ga0496105_0493511 | Ga0496105_0493511_411_887 | 158 |
| 993 | 3300050492 | nmdc:mga0yw44_46282_c1 | nmdc:mga0yw44_46282_c1_1055_1531 | 158 |
| 994 | 3300046475 | Ga0495639_0078976 | Ga0495639_0078976_79_579 | 159 |
| 995 | 3300046501 | Ga0495607_0177826 | Ga0495607_0177826_197_697 | 159 |
| 996 | 3300046522 | Ga0495643_0117339 | Ga0495643_0117339_28_528 | 159 |
| 997 | 3300047321 | Ga0495676_0191915 | Ga0495676_0191915_696_1196 | 159 |
| 998 | 3300001989 | JGI24739J22299_10077895 | JGI24739J22299_100778951 | 160 |
| 999 | 3300005331 | Ga0070670_100123864 | Ga0070670_1001238642 | 160 |
| 1000 | 3300005334 | Ga0068869_100794102 | Ga0068869_1007941022 | 160 |
| 1001 | 3300005355 | Ga0070671_100323924 | Ga0070671_1003239243 | 160 |
| 1002 | 3300005367 | Ga0070667_100121962 | Ga0070667_1001219622 | 160 |
| 1003 | 3300005539 | Ga0068853_100304583 | Ga0068853_1003045832 | 160 |
| 1004 | 3300005548 | Ga0070665_100233268 | Ga0070665_1002332682 | 160 |
| 1005 | 3300005563 | Ga0068855_100377302 | Ga0068855_1003773023 | 160 |
| 1006 | 3300005614 | Ga0068856_100479425 | Ga0068856_1004794252 | 160 |
| 1007 | 3300005842 | Ga0068858_100127486 | Ga0068858_1001274863 | 160 |
| 1008 | 3300005844 | Ga0068862_101495038 | Ga0068862_1014950382 | 160 |
| 1009 | 3300006042 | Ga0075368_10033390 | Ga0075368_100333903 | 160 |
| 1010 | 3300006048 | Ga0075363_100237427 | Ga0075363_1002374273 | 160 |
| 1011 | 3300006177 | Ga0075362_10066822 | Ga0075362_100668222 | 160 |
| 1012 | 3300006186 | Ga0075369_10064469 | Ga0075369_100644692 | 160 |
| 1013 | 3300006195 | Ga0075366_10080872 | Ga0075366_100808723 | 160 |
| 1014 | 3300006353 | Ga0075370_10198603 | Ga0075370_101986033 | 160 |
| 1015 | 3300009093 | Ga0105240_11126889 | Ga0105240_111268892 | 160 |
| 1016 | 3300009101 | Ga0105247_10090956 | Ga0105247_100909563 | 160 |
| 1017 | 3300009174 | Ga0105241_10237992 | Ga0105241_102379922 | 160 |
| 1018 | 3300009177 | Ga0105248_10438458 | Ga0105248_104384582 | 160 |
| 1019 | 3300010375 | Ga0105239_10232065 | Ga0105239_102320651 | 160 |
| 1020 | 3300011119 | Ga0105246_10014135 | Ga0105246_100141354 | 160 |
| 1021 | 3300013307 | Ga0157372_11321162 | Ga0157372_113211621 | 160 |
| 1022 | 3300014325 | Ga0163163_10018933 | Ga0163163_100189336 | 160 |
| 1023 | 3300015262 | Ga0182007_10105900 | Ga0182007_101059002 | 160 |
| 1024 | 3300017792 | Ga0163161_10517304 | Ga0163161_105173042 | 160 |
| 1025 | 3300021388 | Ga0213875_10072222 | Ga0213875_100722222 | 160 |
| 1026 | 3300025297 | Ga0209758_1005792 | Ga0209758_10057929 | 160 |
| 1027 | 3300025904 | Ga0207647_10000809 | Ga0207647_100008093 | 160 |
| 1028 | 3300025909 | Ga0207705_10840494 | Ga0207705_108404941 | 160 |
| 1029 | 3300025911 | Ga0207654_10876919 | Ga0207654_108769191 | 160 |
| 1030 | 3300025913 | Ga0207695_11182799 | Ga0207695_111827992 | 160 |
| 1031 | 3300025914 | Ga0207671_10671466 | Ga0207671_106714662 | 160 |
| 1032 | 3300025919 | Ga0207657_10986939 | Ga0207657_109869392 | 160 |
| 1033 | 3300025923 | Ga0207681_10514019 | Ga0207681_105140192 | 160 |
| 1034 | 3300025924 | Ga0207694_11273295 | Ga0207694_112732952 | 160 |
| 1035 | 3300025927 | Ga0207687_11153296 | Ga0207687_111532961 | 160 |
| 1036 | 3300025931 | Ga0207644_10214235 | Ga0207644_102142353 | 160 |
| 1037 | 3300025935 | Ga0207709_10195654 | Ga0207709_101956542 | 160 |
| 1038 | 3300025972 | Ga0207668_10278635 | Ga0207668_102786352 | 160 |
| 1039 | 3300025986 | Ga0207658_10079632 | Ga0207658_100796323 | 160 |
| 1040 | 3300026023 | Ga0207677_10179835 | Ga0207677_101798352 | 160 |
| 1041 | 3300026035 | Ga0207703_10131795 | Ga0207703_101317952 | 160 |
| 1042 | 3300026078 | Ga0207702_11334269 | Ga0207702_113342691 | 160 |
| 1043 | 3300027866 | Ga0209813_10002805 | Ga0209813_100028054 | 160 |
| 1044 | 3300028379 | Ga0268266_10260572 | Ga0268266_102605722 | 160 |
| 1045 | 3300028380 | Ga0268265_10538904 | Ga0268265_105389042 | 160 |
| 1046 | 3300028381 | Ga0268264_11813193 | Ga0268264_118131931 | 160 |
| 1047 | 3300035692 | Ga0373935_0190125 | Ga0373935_0190125_126_608 | 160 |
| 1048 | 3300037418 | Ga0395900_0148637 | Ga0395900_0148637_1425_1907 | 160 |
| 1049 | 3300037466 | Ga0395898_0060527 | Ga0395898_0060527_271_774 | 160 |
| 1050 | 3300038443 | Ga0395901_0124591 | Ga0395901_0124591_685_1167 | 160 |
| 1051 | 3300038443 | Ga0395901_0409511 | Ga0395901_0409511_93_596 | 160 |
| 1052 | 3300046454 | Ga0495592_0026114 | Ga0495592_0026114_2997_3479 | 160 |
| 1053 | 3300046457 | Ga0495590_0220895 | Ga0495590_0220895_132_614 | 160 |
| 1054 | 3300046474 | Ga0495605_0050049 | Ga0495605_0050049_1312_1794 | 160 |
| 1055 | 3300046506 | Ga0495583_0128608 | Ga0495583_0128608_149_631 | 160 |
| 1056 | 3300046512 | Ga0495610_0072151 | Ga0495610_0072151_122_604 | 160 |
| 1057 | 3300046513 | Ga0495616_0086636 | Ga0495616_0086636_716_1198 | 160 |
| 1058 | 3300046513 | Ga0495616_0152852 | Ga0495616_0152852_25_522 | 160 |
| 1059 | 3300046519 | Ga0495632_0058796 | Ga0495632_0058796_1367_1849 | 160 |
| 1060 | 3300046522 | Ga0495643_0004188 | Ga0495643_0004188_3905_4387 | 160 |
| 1061 | 3300046536 | Ga0495587_0249716 | Ga0495587_0249716_206_688 | 160 |
| 1062 | 3300046674 | Ga0495588_0063074 | Ga0495588_0063074_396_878 | 160 |
| 1063 | 3300046684 | Ga0495669_0199262 | Ga0495669_0199262_103_585 | 160 |
| 1064 | 3300046692 | Ga0495671_0095070 | Ga0495671_0095070_699_1196 | 160 |
| 1065 | 3300047321 | Ga0495676_0269104 | Ga0495676_0269104_479_961 | 160 |
| 1066 | 3300047323 | Ga0495683_0189085 | Ga0495683_0189085_315_797 | 160 |
| 1067 | 3300047443 | Ga0495687_005489 | Ga0495687_005489_5679_6161 | 160 |
| 1068 | 3300048091 | Ga0495626_0224603 | Ga0495626_0224603_224_706 | 160 |
| 1069 | 3300048903 | Ga0496100_0274746 | Ga0496100_0274746_615_1112 | 160 |
| 1070 | 3300048903 | Ga0496100_0661330 | Ga0496100_0661330_127_609 | 160 |
| 1071 | 3300048905 | Ga0496102_0033286 | Ga0496102_0033286_2775_3257 | 160 |
| 1072 | 3300048906 | Ga0496103_0030056 | Ga0496103_0030056_2490_2972 | 160 |
| 1073 | 3300048907 | Ga0496104_0126679 | Ga0496104_0126679_888_1370 | 160 |
| 1074 | 3300048907 | Ga0496104_1092601 | Ga0496104_1092601_68_550 | 160 |
| 1075 | 3300048908 | Ga0496105_0075164 | Ga0496105_0075164_335_817 | 160 |
| 1076 | 3300048908 | Ga0496105_0445720 | Ga0496105_0445720_467_949 | 160 |
| 1077 | 3300048910 | Ga0496107_0557387 | Ga0496107_0557387_59_541 | 160 |
| 1078 | 3300048911 | Ga0496108_0128469 | Ga0496108_0128469_138_620 | 160 |
| 1079 | 3300048913 | Ga0496110_0067729 | Ga0496110_0067729_1851_2333 | 160 |
| 1080 | 3300048914 | Ga0496111_0231915 | Ga0496111_0231915_875_1357 | 160 |
| 1081 | 3300048915 | Ga0496112_0218843 | Ga0496112_0218843_1213_1695 | 160 |
| 1082 | 3300048916 | Ga0496113_0266580 | Ga0496113_0266580_739_1221 | 160 |
| 1083 | 3300048916 | Ga0496113_0581213 | Ga0496113_0581213_44_526 | 160 |
| 1084 | 3300048921 | Ga0496118_0065475 | Ga0496118_0065475_959_1441 | 160 |
| 1085 | 3300048922 | Ga0496119_0375893 | Ga0496119_0375893_33_515 | 160 |
| 1086 | 3300048923 | Ga0496120_0207668 | Ga0496120_0207668_438_920 | 160 |
| 1087 | 3300048924 | Ga0496121_0019921 | Ga0496121_0019921_1741_2223 | 160 |
| 1088 | 3300048928 | Ga0496125_0204666 | Ga0496125_0204666_248_730 | 160 |
| 1089 | 3300050489 | nmdc:mga03683_304528_c1 | nmdc:mga03683_304528_c1_69_551 | 160 |
| 1090 | 3300050490 | nmdc:mga03n38_11178_c1 | nmdc:mga03n38_11178_c1_548_1030 | 160 |
| 1091 | 3300050491 | nmdc:mga00v17_112485_c1 | nmdc:mga00v17_112485_c1_914_1396 | 160 |
| 1092 | 3300050494 | nmdc:mga06z11_12292_c1 | nmdc:mga06z11_12292_c1_2380_2862 | 160 |
| 1093 | 3300050495 | nmdc:mga04h51_26232_c1 | nmdc:mga04h51_26232_c1_594_1076 | 160 |
| 1094 | 3300050496 | nmdc:mga07m45_34494_c1 | nmdc:mga07m45_34494_c1_1772_2254 | 160 |
| 1095 | 3300053105 | Ga0500557_000030 | Ga0500557_000030_55716_56213 | 160 |
| 1096 | 3300053178 | Ga0500637_0025357 | Ga0500637_0025357_1755_2270 | 160 |
| 1097 | iso_pu_bacteria | 2824661429 | 2824668430 | 160 |
| 1098 | iso_pu_bacteria | 2922368715 | 2922370477 | 160 |
| 1099 | iso_pu_bacteria | 2932809354 | 2932814993 | 160 |
| 1100 | iso_pu_bacteria | 2932818245 | 2932824150 | 160 |
| 1101 | iso_pu_bacteria | 2935675223 | 2935683148 | 160 |
| 1102 | iso_pu_bacteria | 2935684952 | 2935689316 | 160 |
| 1103 | iso_pu_bacteria | 2935694250 | 2935697424 | 160 |
| 1104 | iso_pu_bacteria | 2935713505 | 2935720262 | 160 |
| 1105 | iso_pu_bacteria | 2935722832 | 2935728121 | 160 |
| 1106 | iso_pu_bacteria | 2935732158 | 2935737282 | 160 |
| 1107 | iso_pu_bacteria | 2935741537 | 2935746657 | 160 |
| 1108 | iso_pu_bacteria | 2935750917 | 2935757624 | 160 |
| 1109 | iso_pu_bacteria | 2935760218 | 2935764000 | 160 |
| 1110 | iso_pu_bacteria | 2935769743 | 2935776495 | 160 |
| 1111 | iso_pu_bacteria | 2935777560 | 2935784051 | 160 |
| 1112 | iso_pu_bacteria | 2935785616 | 2935789923 | 160 |
| 1113 | iso_pu_bacteria | 2935793552 | 2935798311 | 160 |
| 1114 | iso_pu_bacteria | 2935810662 | 2935817385 | 160 |
| 1115 | iso_pu_bacteria | 2936037263 | 2936044182 | 160 |
| 1116 | iso_pu_bacteria | 2940556831 | 2940563554 | 160 |
| 1117 | iso_pu_bacteria | 8016522445 | 8016524943 | 160 |
| 1118 | iso_pu_bacteria | 8016530956 | 8016538519 | 160 |
| 1119 | iso_pu_bacteria | 8016539877 | 8016542802 | 160 |
| 1120 | iso_pu_bacteria | 8016548790 | 8016550483 | 160 |
| 1121 | iso_pu_bacteria | 8016557553 | 8016558901 | 160 |
| 1122 | iso_pu_bacteria | 8016566248 | 8016568189 | 160 |
| 1123 | iso_pu_bacteria | 8016575299 | 8016580858 | 160 |
| 1124 | iso_pu_bacteria | 8016595262 | 8016596864 | 160 |
| 1125 | iso_pu_bacteria | 8016603502 | 8016607767 | 160 |
| 1126 | iso_pu_bacteria | 8016613128 | 8016619553 | 160 |
| 1127 | iso_pu_bacteria | 8016622563 | 8016630051 | 160 |
| 1128 | iso_pu_bacteria | 8019530166 | 8019538184 | 160 |
| 1129 | iso_pu_bacteria | 8019538911 | 8019541801 | 160 |
| 1130 | iso_pu_bacteria | 8019547302 | 8019548996 | 160 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nvj-assembly1.cif.gz_A | deletion mutant (delta 141) of molybdopterin synthase | 0.9673 | 10 | 133 |
| 1nvi-assembly1.cif.gz_E-2 | orthorhombic crystal form of molybdopterin synthase | 0.9623 | 10 | 157 |
| 1nvj-assembly3.cif.gz_E | deletion mutant (delta 141) of molybdopterin synthase | 0.9597 | 10 | 132 |
| 1nvj-assembly2.cif.gz_C | deletion mutant (delta 141) of molybdopterin synthase | 0.9457 | 10 | 133 |
| 1nvi-assembly1.cif.gz_E-2 | orthorhombic crystal form of molybdopterin synthase | 0.9426 | 10 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1fmaE00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9653 | 9 | 157 | 3.90.1170.40 |
| 1fmaE00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9521 | 9 | 157 | 3.90.1170.40 |
| 1nvjC00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9457 | 10 | 133 | 3.90.1170.40 |
| 5mpoC00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9344 | 7 | 137 | 3.90.1170.40 |
| 2omdA00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9224 | 12 | 137 | 3.90.1170.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520NUL0-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.98 | 13 | 159 |
GO:0006777
GO:0030366 |
| AF-A0A1Q3VSL3-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.98 | 11 | 159 |
GO:0006777
GO:0030366 |
| AF-A0A6I7PGD4-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.977 | 11 | 157 |
GO:0006777
GO:0030366 |
| AF-A0A7V7E8K8-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.9764 | 11 | 157 |
GO:0006777
|
| AF-A0A847BIV7-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.9763 | 11 | 157 |
GO:0006777
GO:0016740 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar